1JHHA

Lexa s119a mutant
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
197
structure length
197
Chain Sequence
KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAAGEPLLAQQHIEGHYQVDPSLFKPNADFLLRVSGMAMKDIGIMDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGNKVELLPENSEFKPIVVDLRQQSFTIEGLAVGVIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of LexA: a conformational switch for regulation of self-cleavage.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords LEXA REPRESSOR
total genus 45
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature ec 3.4.21.88: Repressor LexA.
pdb deposition date 2001-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF01726 LexA_DNA_bind LexA DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1jhhA02
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1jhhA01
2DFIA 5JHUA 3V7RA 4IF4A 5ILUA 3F6VA 3SZTA 1HKSA 2DBBA 2JPBA 3E3VA 1PP7U 3I5UA 1O3SA 4YFNF 5ILSA 5K5QA 3DPLC 2RKHA 2FE3A 3RYRA 3WE3A 3KETA 2ZCWA 4LK0F 1D8KA 2KIMA 4HV6A 1QZYA 2PLYA 3TGNA 4L18B 3KP5A 4IJAA 2P4WA 2PFBA 1YG2A 1BI2A 1UB9A 3DPTA 2XKOA 4LLNA 2VBXA 1B9MA 4LG0B 4UHTA 5BPDA 3ZN0A 1U78A 3FX3A 2FBKA 3L09A 3FF5A 4WWCA 3LA3A 1BBYA 4Y15A 4LJZF 1STZA 4HBLA 3FXQA 2COMA 2QZ8A 4CICA 4A0XA 3RI4A 3FXRA 1XGSA 2HGCA 2V1UA 2JRTA 4UVCA 4ESBA 1L0OC 2R3SA 5AIPA 2DK5A 1KQ8A 3WGGA 2OQRA 1YW9A 2CSOA 3HOSA 2ZMEA 2PG4A 2BBYA 2K4BA 2DQRA 5ICCA 1GXQA 1SFUA 5ICGA 1C0WA 3E6BA 2W85A 3JTGA 4A0YA 4Q4ZF 2P5KA 4YIFA 4KIFA 3I0TA 1FNNA 1IW7F 2O0YA 4S05A 2PJPA 4DQ2A 3MWMA 2RVCA 4U88A 2HNFA 1T38A 1YS6A 4EV0A 5E18F 3HSEA 5E1ZB 2EFPA 5JVTA 5HS8A 1G3YA 2FMLA 1HKTA 3KEQA 4RGXA 4NV4A 1KU3A 2VONA 2HQRA 1YW7A 1XB4A 4KN7X 4I0BA 4M6YA 2ACJA 5L3FA 5KVRA 1CF7A 2X0LA 1WQ2A 2LF8A 1P6RA 5TJJA 2V9VA 4HX8A 1TLHB 2ESHA 3KZYA 5LRSA 1DPRA 2QQ9A 2K7LA 2A69F 3PQJA 3M8EA 4PGHA 3WTVC 2QYOA 4A2UA 5A2QZ 2M87A 3DQVC 4FT8A 3CUOA 4OIOF 5L3CA 4GXOA 3WTWC 1DDNA 2XAHA 3C1DA 4NQWA 3WG9A 1WKMA 2QLZA 4KN4X 3LAJA 5FFZA 3V7CA 1R1TA 2IVMA 5D5UB 3F8FA 1FZPB 1P4XA 4AWXB 4K2EA 2IT0A 4RGSA 1B59A 4Y17A 2OZUA 1DP7P 1G3TA 3E5XA 1MDMA 2FJRA 3N4MA 2OAZA 1R00A 4G7OF 1Z05A 3ISPA 5AONA 1FP2A 3EYIA 2G9WA 2BE5F 2ZO4A 1BN5A 1D8JA 3I58A 4MGRA 1HSTA 2FOKA 4M9SA 3GEZA 3ZMSA 4P9UA 2JZYA 2MLKA 1O57A 4MEXF 1LB2A 4WXCA 1USTA 2XUBA 4GGGA 2VE9A 4HX4A 1LDDA 2FEZA 5CVVA 3KEOA 2VT3A 3RTRA 3HRMA 4LMYA 2HTSA 2M45A 2GAUA 2X4HA 2EWNA 3EYYA 3VODA 5EEHA 3IRQA 2HFHA 4HF0A 2NNNA 1BOAA 5E1WA 4XLPF 1I1GA 2EB7A 4WX9A 1EH7A 5ED4A 2DTRA 2LDUA 4L0YB 2FF4A 4N9IA 3TKYA 1W5TA 3QRFF 2EFWA 2WWYA 5HDNA 2XAGA 3LAPA 2HS5A 3EETA 2YSRA 5E17F 3K0LA 1QZZA 2ADUA 1LEAA 1J75A 1P4WA 4LGWA 3WU0A 4ENJA 5LHGA 4MQVA 5L3BA 3JSPA 1ZREA 2H6BA 4I02A 1T6SA 4UUVA 4K8WA 4EJUA 2EV0A 3R4KA 1J5YA 4GYGA 3HRSA 2PEXA 1KCAA 2PQ8A 3G3ZA 2L3DA 1HW1A 1L3LA 4L9VA 1TW3A 4CYDA 1IXCA 1RUOA 4XSZF 4AVPA 1TQIA 2K27A 2CGPA 3J7AO 2F2EA 3S2WA 2O8XA 4GCVA 5CVUA 2UXNA 3ULQB 3E6CC 1ZLKA 5FD6A 3FM5A 4Q47A 2EK5A 3LFKA 4ASNA 3R0JA 3T8TA 3LWFA 3D0SA 4G9YA 4G6DA 3ZMUA 4IVNA 1FWZA 2WV0A 4F7ZA 1KU2A 3M9AA 1OPCA 1LQ1A 2CFXA 2PMHA 1T98A 3KZZA 1J0RA 3Q9VA 4WXHA 3ZMVA 3CLOA 1OMIA 3IWZA 5E20A 2FRHA 3GFLA 2YR2A 4OINF 1HSJA 2QBYB 3I4PA 4G94A 2STTA 1GVJA 1ZN2A 3RKXA 1OR7A 2ZBKA 4EJVA 1U3EM 3K1MA 2M5WA 3AAFA 1FBSA 1OYWA 4WCGA 1YFHA 2FNAA 1TQPA 3CDHA 2XKPA 1U5TC 4RB3C 4LB5A 2CO5A 5DEQA 3HRTA 5LHIA 3HIFA 3IIQA 1V3FA 2Z5UA 3E5UA 2GA2A 1UCRA 1K78A 2HQNA 5HOOA 1FY7A 1KGSA 3HSFA 2RV8A 1ZG1A 1ON1A 2RN7A 3KCCA 1F4KA 1LDKB 1WI9A 4EM1A 3FXUA 2TDXA 1IAWA 2YX7A 4ENNA 3WTZA 3ZP5A 2H6CA 2RQPA 2GXGA 1OYIA 3ZPLA 2K4JA 1XMAA 2R7FA 3HYIA 1VTNC 1TNSA 1BI1A 3KP6A 1SMTA 2RDPA 3U2RA 3V8JA 2RGVA 3WU1B 4L0ZB 3FMSA 4PGGA 3HOTA 4XRFA 2LKPA 3I71A 1GHCA 3WTTC 2P6SA 1U5TB 1KU9A 4Q5SF 3TQNA 3QPHA 1JHEA 5F6FA 1RUNA 4OIQF 1U2WA 1BI0A 4KNYA 3VEPA 2FQ3A 4Y13A 5H20A 1IZ1A 5DCFA 5D6EA 1AWCA 5D5XB 2M30A 1TTYA 1KYZA 3RPUA 1U6GA 4HAMA 4RB2C 4L5IA 3E6DA 1ZYRF 2FNPA 4OU0A 4ZYHA 2DQLA 3OOPA 1SD6A 2KRFA 2A61A 1I1SA 3BP8A 2FU4A 1JHHA 2IJLA 3JTHA 4H0EA 2Q8KA 4IHSA 1AOYA 3I59A 3GYHX 3R0AA 3GFJA 3F72A 1LJ9A 1XGOA 5FO5A 5D4RA 5LBQA 5DV5A 3BJ6A 4P9FA 1JHFA 2V6CA 3MZYA 4EM0B 4BHCA 4HDUA 1OKRA 4DNCA 3RKYA 1O7FA 2K02A 1ZG5A 3F21A 1RIOH 2W24A 5D4SA 2FBIA 3TOBA 2IA1A 1QPMA 1A04A 3EQLF 1IRGA 3TO7A 3ABTA 1ZHFA 1YYVA 2J5PA 1PDNC 4L9TA 4P96A 2PBIA 3WE2A 1QQIA 2P8TA 1W5SA 4QLCU 1LEBA 1D3YA 2Q2EA 1G4DA 4BNCA 4HZFA 4PDKA 2NAZA 4YFXF 1IRFA 2QQAA 2LF7A 5ICFA 4U7BA 4I0AA 4BHPA 3RKWA 3F23A 3J80K 2EFNA 4IXAA 1XN7A 2A6HF 4I7HA 5LHHA 3V4GA 1B9NA 1EV7A 2BV6A 2P7VB 2MLGA 2ELHA 4FX0A 2O6GE 1FYKA 1Z9CA 1IUYA 1GXPA 2IPQX 1T2KA 2GA1A 2KIUA 2KIFA 1B12A 2BYVE 4GO1A 3BROA 2DW4A 4OOIA 3QU6A 4YG2F 3GFMA 3QOPA 2MBFA 2XHKA 4IPAA 1ZG3A 2XROA 5ILVA 4PZJA 3I54A 2QWWA 2ZXJA 5LLQA 3K9TA 3E5QA 4U0WA 5DCMA 4O3MA 1R1UA 3FM3A 3FHZA 3L2CA 2H09A 3G73A 3E6MA 4FX4A 3BPXA 3ELKA 4KYWA 1LNWA 3DFGA 3HTSB 2RC4A 5FLXZ 1Z7UA 1MZBA 4WK8F 1IXRC 2UXXA 2MA3A 3I59B 2HO0A 5ERIA 2EFOA 1XDUA 2W84A 2FMYA 1FYMA 1ZRCA 4A12A 4EM2A 5HS7A 2DK8A 1USSA 2VN2A 2V79A 1QBJA 3KLNA 2VBWA 2O3FA 3VFZA 3M8FA 4M6XA 3BWGA 3RIRA 3BZ6A 4CDGA 1IN7A 3COAC 4EMSA 4MHGA 2L01A 2CW0F 3GZ5A 2A6EF 2YX4A 1Y0UA 4KMFA 4R79A 3KLOA 4KFCA 2ZKZA 2VC0A 4HLYA 5H6RA 4A6EA 3BPVA 2JPCA 2HYFA 1TW2A 5IT9Z 1SD7A 5J8FA 2F5CA 3RDIA 1ZARA 2JT1A 5L3EA 3P9KA 2DI3A 2GQQA 1O3QA 2EFQA 1WWXA 1PP8F 2W25A 5CVRA 3CUQB 4ESFA 4KIGA 4RB1A 1IN6A 3BDDA 4ZH4F 4ZYDA 1S3JA 3KP7A 1FT9A 3IL2A 4MQ9F 3TO6A 4ENMA 1QGPA 3HHHA 3QAHA 3VB2A 3KP4A 2HKXA 1R22A 4EVIA 5FB2A 1ZRDA 1JE8A 1FC3A 5CLSA 1DPUA 2F5FA 2GIVA 1XSXA 1IXSB 3ZQ7A 4AIKA 1FOKA 2LNBA 3IWFA 4CO8A 5DDGA 3EDPA 4M72A 4UV8A 4HX7A 3P9IA 5FD5A 4JBAA 4G8XA 3H3ZA 3I64A 2Z99A 4HQEA 1ON2A 4XSXF 4EJTA 1ZGAA 3GZ6A 5FFXA 3BOQA 1DUXC 2F5EA 2GXBA 3WGHA 4E70A 2ZJ2A 3S04A 2RNJA 3ECHA 3ROUA 2O61A 3P9CA 4AIHA 2AS5F 1XGMA 1XD7A 2QENA 3O3KA 4L9JA 4XLNF 2D2WA 3PQKA 4BHBA 1ONVA 1CGPA 2XVCA 2E1NA 3RYPA 1O7LA 1W4MA 2O03A 4LFUA 2XASA 4M71A 4EGYA 3R60A 2GWRA 4I01A 2BGCA 4PCQA 3L7WA 4UNOA 2P5VA 1R36A 3LA7A 1FLIA 4A0ZA 2XIGA 5J8CA 1R7JA 1J9IA 3MFKA 3ZMZA 1MDMB 4KIBA 4ON0A 1QNTA 2OD5A 4ZYEA 2B0LA 2M1BA 3D5LA 3GVAA 3MQ0A 3H92A 3CTAA 1O3TA 1TBXA 2YPRA 4M9ZA 2KJCA 4A5NA 5JI6A 2LSOA 2A07F 1E17A 3ZMDA 3K69A 2FBHA 2YU3A 3Q5FA 2M8EA 3JAMK 5L3DA 2D45A 2D1VA 3ABUA 4CXFA 3WTXC 2OQGA 1ZRFA 3BDNA 2H94A 3KP2A 2FSWA 3QP5A 5CYVA 5DUIA 3IKTA 2VOOA 3QU3A 2OA4A 4U0YA 4OIPF 2NYXA 2QVOA 2IRFG 2P5LC 4BXUA 5LGUA 1E2XA 3R6SA 5LGTA 4AD9A 5A2QK 5TRDA 3CJNA 3C3WA 3F6OA 3B73A 3L00A 1HW2A 2ESNA 1IN8A 1UHMA 3V8KA 4M73A 4ENKA 2JSCA 2VXZA 1IN5A 1BM9A 1KU7A 3NEUA 1G3WA 1P2FA 5L3GA 4KICA 3DEUA 5HLHA 5DD4A 1I27A 5DCMB 5F1RA 4KUMA 3F22A 3GXOA 4HLXA 4LLLA 2QUFA 1SFXA 4UVBA 1BC8C 1ULYA 1LVAA 1B1BA 3WGIA 4EJOA 5JR3A 1YLFA 1ZGJA 2C6YA 4ESJA 1Z1DA 2EV5A 3PFIA 3FMQA 1R23A 1SD4A 2UWMA 5H6QA 3QP6A 4LK1F 1YTYA 3L9FA 4A5MA 5K5OA 1FYLA 3REOA 4AIJA 1G3SA 1I5ZA 2EA2A 1I4VA 3V7SA 1B6AA 1T0FA 4S04A 2FKDA 3FMRA 4BQAA 4CGZA 3LQQA 6PAXA 3BJOA 4RS8A 2ZFWA 1H9TA 2ZNYA 1S29A 3TDUC 1RNLA 2A3SA 1MD0A 2PN6A 3GWZA 5FLXK 3SQNA 5DUKA 3U9GA 4BAYA 4G7ZF 2A5YB 4LD5A 1K6OA 1YQAA 3OV8A 1UMUA 4JQFA 4KMUX 3F8NA 1TQMA 2AXLA 4M9XA 3K1NA 4A6DA 5FGMA 3SHFA 2Z9OA 5D8KB 4NHJA 3DP7A 2HKOA 3B02A 4R1HA 3HSRA 2DPUA 5AIQA 4N9HA 2HTJA 1V4RA 5HLIA 3U1DA 3M7GA 2DAOA 3DXJF 5E1XA 3HUGA 2HYGD 2UZKA 3JSOA 1HKQA 2ISZA 1MJAA 1KN9A 1R5GA 1P4AA 2EJRA 1FSHA 1S8NA 5D8LB 2HDCA 1F39A 3M1EA 4LLGF 2R7DA 5ICEA 2WTEA 4OIRF 3SFZA 5IT3A 4IHTA 5LRRA 1AY9A 1PUEE 2OZ6A 1I6XA 1BIBA 1KQ0A 1KQ9A 1HQCA 2VT2A 2J5OA 1J2XA 2ETHA 1HXDA 1MGTA 3GF2A 2XAFA 1S6LA 4Q48A 2VODA 3F3XA 5HDGA 2L54A 1K7AA 2IA2A 1X3UA 4YFKF 2JTVA 2VBZA 2DT5A 2L4MA 4L5JA 3TDZC 3TO9A 1R1VA 1G6NA 4IRGA 2Z33A 2Q0OA 5BS6A 5E8GA 1MJ9A 3R61A 5IT9K 2D1HA 3GUDA 5K5RA 2Y75A 1S7AA 4WF2A 1FX7A 2DLLA 4MTDA 3W6KB 2W57A 1FP1D 3KP3A 3KFWX 1U8RA 2G7UA 3GW2A 1K79A 3N97A 3LSTA 2QBYA 1J7KA 2QM3A 1BC7C 1FBQA 4Z2YA 1Z91A 3IKVA 4RGUA 2F5DA 4ZZDA 2Z3YA 2HZTA 4R8HA 5DD8A 4HF1A 4MNUA 4UVAA 1T7DA 2V1XA 3QPTA 3HRUA 2NNYA 1ODDA 4MTEA 1FBUA 5DYMA 1K78B 3SZPA 1W7PD 2BEOA 4P5OA 4HYEA 4I98B 1RZ4A 5D6FA 1Z6RA 2P6TA 2HR3A 2DPDA 2PI0A 3F8MA 3WODF 1H9GA 4HDVA 1XSVA 2CYYA 1BI3A 1XMKA 3K2ZA 5E8IA 4RGRA 3LA2A 1W7PA 3TOAA 5EEGA 1REPC 4KDPA 4LG0A 3E97A 2G7HA 2CG4A 5CVIA 1KA8A 3IHUA 3DKWA 1BJAA 1BIAA 4EGZA 3IC7A 1EH8A 3JAMZ 1NHAA 2IP2A 4KT5C 3WTYC 1F9NA 4HV5A 3C18A 3DV8A 2QQBA 5CVJA 3HHGA 3NQOA 4ZYGA 4WXDA 1XGNA 5LEKA 5J6XA 5BMZA 4G6QA 3CUQA 4NB5A 4N0BA 3MEXA 2Y48A 5HVQC 1SMYF 5KK1A 4UXNA 4EJWA 2KJBA 4HQMA 4QWQA 4G7HF 4I09A 1SFEA 3MAJA 4EQQA 3WTUC 3T5XA 2XAQA 3FZVA 3O6BB 4U0VA 2L4AA 1LDJA 2VC1A 3K1PA 2HWVA 3IRRA 2WC2A 2XV4S 2V1DA 2MH2A 3BY6A 1SAXA 3BJAA 5HDKA 2XAJA 1UFMA 3MZHA 2E7XA 2XGXA 3W6JB 4GYIA 4B09A 1Z6TA 4ME8A 4MEYF 1JHCA 4HOBA 4UV9A 2NS0A 1ZAOA 4RAYA 1R5HA 3RJPA 5D5VB 5JFRA 1HW5A 4HA8A 3RPQA 3T0YA 3JW4A 2ISYA 4U7DA 3GX4X 3CO7C 2NRAC 1CF7B 3P7NA 3F8BA 2HOEA 3F8CA 1F5TA 1HBXG 3ZMTA 3T1BA 3J81Z 4BH9A 3CO6C 4OMYA 2DU9A 2L02A 3ML6A 1YIOA 4JK1X 4CZZA 1WSUA 2FXAA 2OBPA 2E1CA 1IF1A 4M74A 4IRHA 5BQTA 1MKMA 1OYYA 1O3RA 4O6JA 4P55A 3T8RA 1XDSA 2EV6A 5LEJA 1YO5C 5HS9A 4HF2A 3DF8A 2MD5A 2H27A 3FWEA 3C7JA 1W7PB 2PMUA 4L9NA 1UHWA 1JXSA 2STWA 3KE2A 4HW0A 1T39A 1XSDA 3H3UA 5D5WB 1IN4A 1JGSA 3NRVA 4D0PA 4LB6B 2CWEA 4I2OA 2VE8A 2HEOA 4TV7A 3WTSC 2KKOA 4BYYA 4B8XA 4O5VA 1R58A 2FA5A 4YIIA 2E7WA 3MCZA 4XBFA 3J81K 2MC3A 1MJBA 5HLGA 3V8LA 3GFIA 5BOXA 3SXYA 4FHTA 2EA4A 1YS7A 3Q9SA 1P92A 1RI7A 4OMZA 2P7CB 3VOEA 1XCBA 4ZZLA 2MH9A 3J80Z 3CUQC 4N31A 1XCVA 1QO0D 5F64A 1ZLJA 1TNTA 5LGNA 3EUHA 3HTUA 2VBYA 1U5TA 2IW5A 3LQRA 4CHUA 3GO5A 1B4AA 1WRJA 4RB0A 4RAZA 3ECOA 1ZH5A 2ZNZA 2K86A 4IRIA 5CJ9A 3GLXA 1D5VA 3ZN1A 2IA0A 3O2PE 1SD5A 4KA4A 2A68F 1FSEA 1YW8A 2XRNA 2VOPA 2GZWA 1KYWA 3I53A 1EH6A 3ERED 5BPIA 2ZMEB 2DO7A 2OU2A 2Y0MA 5K1YA 1H0MA 2CQKA 1FPQA 4ETSA 1Q1HA 1J59A 1F1ZA 1S7OA
chains in the Genus database with same CATH superfamily
2EZIA 2IEKA 5IPAA 1GDTA 1IDZA 3CQZJ 2DFIA 2RAEA 2VI6A 3SDGA 5JHUA 5B1BH 3W2VA 3V7RA 4IF4A 5ILUA 2KQRA 3F6VA 3SZTA 1HKSA 2DBBA 2JPBA 1H88C 2IBDA 3E3VA 1HDDC 1PP7U 3I5UA 1O3SA 1YJ9I 3WHCA 3OYEA 4YFNF 1WCMJ 2GBYA 3DPLC 5ILSA 2RKHA 5K5QA 2FE3A 3RYRA 4D7MA 3WE3A 3KETA 2ZCWA 4LK0F 1D8KA 3LL7A 3CP2A 2KIMA 4HV6A 1QZYA 2WA0A 2PLYA 2W00A 3TGNA 5F0HA 4KT6A 4L18B 3JRBA 2RNGA 3KP5A 4IJAA 2P4WA 2PFBA 4P1WA 1NK3P 4DJAA 2NVUB 4A3KJ 1YG2A 2M9HA 4XMYA 1BI2A 1UB9A 1V5EA 3DPTA 2XKOA 1ZR4A 4LLNA 3VYRB 1M1EB 2VBXA 1NH3A 1GV2A 1MBHA 2BY2A 1B9MA 4LG0B 3CDIA 3CCYA 1ZK8A 5HNFA 1SEUA 4UHTA 5BPDA 1K4TA 5M3MJ 3L2VA 3S2DJ 1MMAA 3ZN0A 2EQRA 1U78A 3FX3A 1IO2A 2FBKA 3H5RA 4X0GA 4PFPA 3L09A 3FF5A 4WWCA 4PJLA 1KONA 3LA3A 3LSHA 1BBYA 4I6ZA 4Y15A 4LJZF 3FXMA 1STZA 4HBLA 3W6VA 2CV2A 3FXQA 2COMA 2R7QA 1RETA 2QZ8A 5LD2C 1Z3YA 4CICA 4QIWN 3M4OJ 2JJ7A 3AG2H 4IL6C 2K3FA 3DBLB 2LC2A 2L9RA 4A0XA 3RI4A 3FXRA 1XGSA 2HGCA 3A03A 2Y2ZA 2E2HJ 2JRTA 4HSRA 1MW7A 2BY1A 4EEFG 2V1UA 2L9VA 4UVCA 2CQNA 1WFXA 3OYBA 4FE7A 4ESBA 1L0OC 2R3SA 5AIPA 2DK5A 1KQ8A 5J1UA 3WGGA 2OQRA 1B72A 4HEA2 1O4XA 1YW9A 3P5JA 2CSOA 2K9QA 3HOSA 2ZMEA 3GTKJ 2PG4A 2DODA 2BBYA 1N75A 2HU9A 2K4BA 1QA6A 4IQJA 2DQRA 1TZLA 5ICCA 1GXQA 3E1SA 1HLVA 3J7YJ 3JRDA 1SFUA 2AHQA 5FLVA 4DYRA 5ICGA 1C0WA 1WJBA 3E6BA 2W85A 4GFBA 2ZJQF 3PJRA 3JTGA 4C2TA 4A0YA 4Q4ZF 2P5KA 4YIFA 1K6YA 3I0TA 4KIFA 4OWRB 3K70D 3AG4H 3OY9A 1FNNA 1IW7F 2O0YA 3TL4X 3LSJA 4S05A 4RMNA 2PJPA 3BTIA 4YELA 4DQ2A 2WAEA 5GAGJ 3MWMA 1QPIA 2OF7A 2RVCA 4U88A 3G4SI 1AKHB 2HNFA 3DU5A 3PL8A 1T38A 1YS6A 2LP0A 4EV0A 3HSEA 5E18F 5E1ZB 1YX3A 2EFPA 4HG2A 3QYFA 5JVTA 2M4GA 1MNDA 5HS8A 3DKYA 1G3YA 3BG9A 2FMLA 1HKTA 3KEQA 4RGXA 4NV4A 2R7RA 3Q0UA 1KU3A 2VONA 2HQRA 1VQ4I 1DP3A 1YW7A 1XB4A 4A3LJ 2CMPA 4KN7X 4I0BA 4M6YA 2ACJA 5L3FA 3UKGA 5KVRA 1CF7A 2M7AA 2X0LA 3G2BA 2X6WA 1WQ2A 3U21A 2I5UA 2LF8A 1P6RA 5TJJA 2V9VA 4DBRA 4HX8A 1TWHJ 1TLHB 2OCCH 3ZRGA 3RZOJ 2ESHA 3KZYA 5LRSA 3W2WA 1DPRA 2QQ9A 4E7ZA 1X1AA 1EA3A 2K7LA 2A69F 3PQJA 3AFHA 3M8EA 4PGHA 4QTRA 3WTVC 2QYOA 4MO7A 4A2UA 5A2QZ 2M87A 3DQVC 2XSJC 2H1KA 3VYTB 5FRMA 1OR7C 4FT8A 2IGOA 3OWTA 3CUOA 4OIOF 5L3CA 1OCOH 2IS6A 3BR0A 2NVYJ 3DCFA 3H5AA 2XDVA 1I6HJ 1X3ZB 4GXOA 3WTWC 1DDNA 2XAHA 3C1DA 5E3LA 3I4MJ 2HPIA 3M8JA 4F55A 3S1MJ 4NQWA 3WG9A 2TCTA 1WKMA 3FXOA 2QLZA 5CQEA 3GTGJ 2DA2A 4KN4X 1FOXA 3LAJA 5FFZA 3V7CA 3OYIA 2R7VA 2XB5A 5B5EC 1X1DA 3TP3A 2Y30A 1R1TA 4QPQA 1LE8B 2IAIA 2IVMA 3RQ4A 1Z7LA 3F8FA 5D5UB 1P4XA 4FTHA 1FZPB 3HG9A 4AWXB 4K2EA 2IT0A 4RGSA 1B59A 2XGEA 2ZB9A 4Y17A 2W7NA 2OZUA 4D5FA 4IKFA 1DP7P 2X9DA 1G3TA 2HZDA 3E5XA 3TBIA 1MDMA 2FJRA 3N4MA 2OAZA 1R00A 2BHZA 3L2RA 3ZOBA 4XIDA 4G7OF 1Y8RB 1Z05A 4BL0B 3ISPA 1JT6A 2V9KA 2ME6A 2DOAA 1S72I 5AONA 1FP2A 5EDNA 1QRYA 3M1CA 3EYIA 1A6QA 2G9WA 2BE5F 2ID3A 4Y3OA 2ZO4A 1BN5A 3FHNA 1D8JA 3ERMA 3I58A 4ZDLA 4MGRA 4M3EA 3S16J 1HSTA 2FOKA 4M9SA 3GEZA 4CUGA 3OS1A 2E19A 1T56A 2Y0SN 3ZMSA 3LSIA 3MMYB 4P9UA 1VQNI 2JZYA 2MLKA 1O57A 4MEXF 1LB2A 4WXCA 1ZGWA 1R6RA 1USTA 2XUBA 3PUBA 4GGGA 2BY0A 2WY7Q 2VE9A 4HX4A 1LDDA 2FEZA 2K9NA 5CVVA 5HODA 1TC3C 2EBIA 3KEOA 2VT3A 3RTRA 1JKOC 1BR2A 2FOWA 3HRMA 4LMYA 2HTSA 2A5WA 2M45A 2GAUA 4D5CA 3ZCOA 2X4HA 2EWNA 3AG3H 3EYYA 5EEHA 3VODA 3IRQA 2HFHA 2VXDA 4HF0A 4BJ5C 2NNNA 1BOAA 2M7BA 5E1WA 4XLPF 1I1GA 3LOCA 4BACA 3BG7A 2EB7A 3HL2A 4WX9A 1EH7A 2PJRA 5ED4A 2MABA 1A31A 3JR9A 2DTRA 2LDUA 4L0YB 2FF4A 3A0HC 4N9IA 3TKYA 1W5TA 3QRFF 4AIDA 3IAM2 2EFWA 1A5JA 3CDLA 3S93A 4XORA 2F4IA 2WWYA 3DBRB 2R7OA 4HRIA 3BR5A 1PUFA 5HDNA 4DYCA 2XAGA 3LAPA 3CCRI 1SFKA 2HS5A 3EETA 2DT6A 3VDXA 2YSRA 5E17F 3NWTA 3K0LA 1QZZA 2ADUA 1LEAA 2IGMA 5E3NA 4NC8A 5FKKA 1J75A 1P4WA 4LGWA 3WU0A 4ENJA 5LHGA 4MQVA 2QSHX 5L3BA 4UUSA 5C44J 3OYFA 3JSPA 1ETXA 1ZREA 2H6BA 4I02A 4ZTJA 5FROA 1T6SA 4XL9A 4UUVA 4K8WA 4EJUA 4BE0A 2EV0A 3R4KA 5KNLA 1PVEA 4HNTA 3C2GA 1J5YA 4GYGA 4D9JA 4BDZA 2R7ZJ 3HRSA 2PEXA 5DM6F 1KCAA 2M8GX 1N78A 2PQ8A 3FXLA 3G3ZA 2L3DA 1HW1A 4BE2A 1L3LA 4L9VA 1TW3A 4CYDA 2DTZA 1IXCA 3GZNB 1FJLA 1RUOA 4XSZF 4AVPA 1TQIA 2K27A 2R7UA 2CGPA 1JUMA 3J7AO 2DMQA 2F2EA 4KISA 1YHQI 4UB8C 2HQ5A 3S2WA 2O8XA 1RRJA 2LRDA 4GCVA 4CZCA 5CVUA 2UXNA 3ULQB 3E6CC 3S2HJ 2CUJA 1ZLKA 5FD6A 2VKDA 3FM5A 4Q47A 2EK5A 3DEEA 3LFKA 4ASNA 3R0JA 3T8TA 2BW3B 4CCKA 3LWFA 3D0SA 4G9YA 4XRSA 3JREA 3CCSI 4G6DA 3ZMUA 4IVNA 5GADJ 4A3JJ 1FWZA 2WV0A 4II3A 4F7ZA 1KU2A 1SVLA 3M9AA 4Y4RA 1OPCA 1LQ1A 2YS9A 4DZPA 2H8WA 2CFXA 2PMHA 2V1NA 1T98A 3DWLE 1J0RA 3KZZA 5GTHC 3KYLA 4V19K 3Q9VA 4WXHA 5JLXA 2K9LA 3DTKA 3ZMVA 1E3HA 2JA2A 3CLOA 3DBHB 1B72B 1OMIA 3IWZA 5E20A 2FRHA 3FKJA 3GFLA 2L9NA 4JYKA 2DFEA 1VZ0A 2YR2A 1LFBA 3FK7A 5TISC 1ETQA 4XLCA 4OINF 3PM1A 1HSJA 4HNVA 5B3SH 4W1UA 4AC0A 2QBYB 1I3AA 3I4PA 4G94A 1WHUA 2STTA 1GVJA 1ZN2A 3SEZA 1QVUA 3RKXA 1A6IA 4BEHA 1W36C 3ABMH 1OR7A 1B8IB 2ZBKA 4EJVA 2Q1ZB 2ZXWH 4OAYA 1U3EM 3K1MA 2E1MB 2M2EA 2M5WA 1J09A 4J19A 2MG4A 4PK4A 1Y39A 2JA8J 3AAFA 5GP9A 1FBSA 1OYWA 3A01A 4XNFA 1NTCA 4WCGA 5EG0B 3NWSA 2GLOA 3SZGA 1X2MA 4PSWA 3OYLA 2GXAA 2VL8A 1YFHA 2FNAA 1TQPA 1ETKA 3CDHA 2XKPA 2IS1A 1U5TC 4RB3C 4B3XA 4LB5A 1SC7A 2CO5A 3FKIJ 2KMUA 2CS3A 2VQLA 3HRTA 5DEQA 5LHIA 3K4LA 5M3FJ 3HIFA 3IIQA 1V3FA 2Z5UA 1WH7A 2DXIA 3E5UA 3B6AA 2A05A 2GA2A 3HKZA 4JX6A 1UCRA 4M3FA 3VPRA 2HQNA 5HOOA 1K78A 1FY7A 3H9JA 1KGSA 2YUSA 3HSFA 5IYBJ 5K7ZA 3JRAA 4XK4A 2RV8A 4XKVA 1ZG1A 1Z0XA 1QZEA 1ON1A 3BZKA 3S1RJ 4M3GA 2RN7A 3KCCA 3OYJA 1F4KA 1LDKB 1HCRA 1WI9A 3CJQB 4EM1A 2E35A 3FXUA 4LIUA 1Y56A 5TGTA 2TDXA 1IAWA 2YX7A 4ENNA 3WTZA 3ZP5A 1XX5A 2H6CA 3OYHA 2RQPA 2XF6A 2K5CA 1DGWY 4CSWA 1D0XA 2JUCA 2GXGA 3W2AA 1OYIA 1W0TA 2K4JA 1VTNC 1XMAA 2R7FA 3HYIA 3ZPLA 1TNSA 1BI1A 3KP6A 3RQIA 1SMTA 2RDPA 3U2RA 3V8JA 2RGVA 5K7HA 3WU1B 5FKLA 4L0ZB 1HA8A 3FMSA 4PGGA 2LMDA 3NAUA 3UNGC 4IHWA 1S5LC 1YX5A 3ZR8X 3HBLA 3HOTA 4XRFA 4BJTA 1U0JA 2LKPA 1MH3A 2ZSHB 2VB6A 1K83J 3I71A 3MKYB 1GHCA 4XN3A 3WTTC 2P6SA 3MN2A 1JGGA 1U5TB 5M5WJ 1KU9A 4UB6C 3CESA 4Q5SF 3K4CA 4XN0A 2ICWG 2R7TA 1IDYA 3TQNA 4F3QA 1WJAA 1DGRM 3QPHA 4XLFA 1JHEA 4XRSG 3PNYA 5F6FA 1RUNA 1MMGA 4OIQF 1I3QJ 4RM2A 1U2WA 1BI0A 4KNYA 3VEPA 5LFAA 3VYSB 1OCCH 2FQ3A 4Y13A 5H20A 1IZ1A 4J01A 1PJRA 5D6EA 5DCFA 1AWCA 5D5XB 2M30A 1TTYA 1KYZA 3QPSA 1JT0A 3RPUA 1U6GA 4HAMA 5DTDA 4RB2C 3G1MA 4L5IA 1U9OA 3E6DA 1ZYRF 2CQXA 2AQEA 2FNPA 5C4JJ 4UY8I 4OU0A 4ZYHA 1RR8C 2EIJH 2DQLA 3OOPA 1SD6A 2FJ1A 2KRFA 3QQAA 2A61A 3BR1A 5CKTA 1I1SA 3BP8A 2FU4A 5EGOA 1JHHA 3IV5A 3BG3A 2NOGA 2W82A 2IJLA 3JTHA 1QHHD 2DA1A 2Q8KA 4DBQA 4H0EA 4PFOA 2HQAA 2OC6A 4IHSA 3H0GJ 3OIOA 4A3BJ 2OV7A 3HOZJ 3CMMA 1AOYA 1RKTA 3O8HA 5EEAA 3I59A 3CF5F 5IY5H 3GYHX 3R0AA 3TW7A 3GFJA 3F72A 3GTJJ 1LJ9A 1XGOA 1VNDA 2XRLA 2FUG2 5FO5A 4C2MJ 5D4RA 5LBQA 2X51A 5DV5A 2OJED 3BJ6A 4P9FA 1JHFA 1P9QC 2AO9A 1D0ZA 1X2NA 2V6CA 3MZYA 1Y6IA 3CC7I 4EM0B 4BHCA 3HB9A 5GPCA 1OKRA 4BBRJ 4HDUA 1Y1WJ 4DNCA 3RKYA 1FMWA 3BLYA 1O7FA 2K02A 4DIQA 1U9NA 1ZG5A 3F21A 2P0WA 2VJJA 3LSPA 3MKZA 2W24A 1RIOH 1X4PA 5D4SA 3FXJA 3KIOA 3QODA 5FKNA 5J3LA 2DA5A 3OS0A 1OFCX 2FBIA 3PSIA 1APLC 5F0FA 3TOBA 2R5YA 2DJIA 2Y69H 2IA1A 1CQTA 4PJNA 2R5YB 1GT0C 1JKPC 1QPMA 2BXZA 1A04A 2BXYA 2HOAA 4ZDOA 3OSGA 3EQLF 4BGDA 1IRGA 3DLLF 3TO7A 3OIQA 3ABTA 5IP9J 1RC9A 1ZHFA 1YYVA 2J5PA 1PDNC 4L9TA 3A02A 1MMSA 3FBNB 2M0MA 2KFDA 4P96A 2HDDA 4W97A 4DGWB 2PBIA 3WE2A 1QQIA 3GBGA 2P8TA 1W5SA 1E3OC 4QLCU 1LEBA 1D3YA 5J4YA 2Q2EA 1G4DA 4LG3A 4BNCA 3DTIA 2WAQN 4HZFA 4PDKA 2NAZA 4YFXF 5J4VA 1IRFA 2QQAA 2LKXA 2LF7A 4E7SA 5ICFA 3A4CA 3KPHA 5H2FC 4U7BA 4I0AA 3CCQI 1A35A 4BHPA 1E0EA 1YITI 1EKEA 1MNMC 1MBEA 3RKWA 3F23A 3ESWB 3HKZN 1TL8A 3J80K 2EFNA 4IXAA 1XN7A 2A6HF 1X1PA 4I7HA 2QGUA 1Q1VA 3V4GA 5LHHA 1B9NA 1EV7A 2BV6A 2P7VB 2MLGA 4ABZA 2ELHA 4FX0A 4PJJA 2O6GE 5GTIC 1FYKA 1Z9CA 1SANA 4A3DJ 1IUYA 1GXPA 4E4HA 2IPQX 4D7NA 4XKCA 2JVGA 1T2KA 2GA1A 2KIUA 2KIFA 1B12A 2BYVE 3Q3SA 4GO1A 4AVZA 1IUFA 3BROA 4LIVA 4ZYAA 2DW4A 4OOIA 1ETVA 3QU6A 3ZQGA 4QPOA 1X1BA 4MFEA 4YG2F 3GFMA 3QOPA 2MBFA 2XHKA 2E2JJ 2ME0A 2Q2EB 4IPAA 5FRNA 3HEFA 2LD5A 1ZG3A 3J7ZI 3GTQJ 2OPTA 3L2UA 3BCAA 5HLTA 2XROA 2GOXB 2TRTA 5ILVA 4PZJA 1VQ8I 3I54A 2QWWA 2ZXJA 5LLQA 4CCJA 2W48A 3JRFA 3K9TA 3E5QA 2H8RA 4U0WA 2HI3A 2HVQA 3H35A 5DCMA 4O3MA 1R1UA 3FM3A 3FXKA 3FHZA 3L2CA 2KIQA 2H09A 3C2HA 2L7KA 3N05A 3E6MA 5IOYA 2KDZA 3G73A 2VJIA 4FX4A 2LREA 3BPXA 3ELKA 4KYWA 2X1DA 1LNWA 2R93J 1ETYA 3ZQQA 1YI2I 2XGDA 2QEXI 1IGNA 3DFGA 5IP6A 2HXIA 2RC4A 3H1CA 3HTSB 1WJ5A 5FLXZ 1Z7UA 2L5QA 1WPKA 1ZR2A 1MZBA 4WK8F 3S17J 1IXRC 2UXXA 2MA3A 3I59B 5FKOA 1R49A 3DPUA 2R5ZA 2HO0A 4IO9F 5ERIA 2EFOA 5E3MA 1XDUA 2W84A 2QSFX 2CQ7A 4Y33A 2FMYA 1FYMA 1X3WB 1BR1A 1ZRCA 1OJLA 2LG4A 2VQHA 4A12A 4EM2A 3LSRA 2R0QC 3H5NA 5HS7A 2DK8A 1USSA 2VN2A 2HVSA 2K85A 3PSFA 2V79A 2OCEA 4Z6YA 1MBJA 1QBJA 3KLNA 5E79C 4M3BA 1ZELA 2VBWA 2O3FA 1HOMA 2QA4I 4IEJA 3VFZA 3M8FA 3RPUD 3ONQA 4M6XA 4B44A 4A69C 3HOYJ 3CJRB 2JA7J 3BWGA 2UV1A 3RIRA 4OAZA 3BZ6A 4CDGA 3OYGA 1IN7A 3LFUA 1JTYA 3GTPJ 3COAC 3I3LA 4EMSA 3OS2A 4MHGA 2LH9A 2L01A 2CW0F 3GZ5A 1I50J 2A6EF 2YX4A 1Y0UA 4KMFA 2AXTC 4R79A 3KLOA 2HPMA 4KFCA 2ZKZA 2VC0A 1WJFA 2DOFA 2ZFUA 2LY2A 3GLLA 5H6RA 4HLYA 4A6EA 3BPVA 2JPCA 2HYFA 2Y31A 3E7LA 2DYSH 1TW2A 2QCOA 5IT9Z 1SD7A 5J8FA 2F5CA 3RDIA 1ZARA 2JT1A 5L3EA 4F91B 3P9KA 2DI3A 2M0CA 1SAUA 2GQQA 2IS4A 4PJ0C 1O3QA 5F0CA 3D5RC 3DTEA 2EFQA 1QU3A 1WWXA 1PP8F 2JUGA 1UAAA 2W25A 5CVRA 3CUQB 4ESFA 5J1YA 4KIGA 3VYUB 3BZCA 1IN6A 1D1CA 3BDDA 4ZH4F 1RR7A 3BC8A 4RB1A 1GUUA 4BXFA 1ITYA 4BQQA 4ZYDA 5KAIC 1S3JA 3K4BA 1FT9A 3KP7A 3IL2A 4MQ9F 3TO6A 4ENMA 1QGPA 3HHHA 2L7ZA 3QAHA 1YRNB 5M5XJ 3VB2A 2KRCA 3KP4A 2HKXA 1R22A 4EVIA 1OCTC 1SVMA 5FB2A 1ZRDA 4C3IJ 2CRGA 1JE8A 1MSEC 1FC3A 4FETA 4A3FJ 5CLSA 3GMEA 1DPUA 2F5FA 1HDPA 1S9HA 2GIVA 5KHDA 3E0JB 1LE8A 1XSXA 1IXSB 3ZQ7A 2X6OA 5J47A 4AIKA 1FOKA 2LNBA 2MFZA 3IWFA 1DQUA 1IV8A 5EGOB 4FASD 4CO8A 2CW8A 1OQYA 2ZMEC 5DDGA 3HZJA 3EDPA 3U1KA 4ZJZA 4M72A 4UV8A 4HX7A 4JX5A 1IG7A 3P9IA 3IUOA 3CF2A 5FD5A 2N8GA 1B8IA 1FMVA 4JBAA 4GDFA 2KHMA 3KZIC 4G8XA 3H3ZA 3I64A 2BVLA 2Z99A 4IOCF 2V6EA 4HQEA 5F04A 5DM7F 1LKXA 3IH3A 4XKBA 2QSGX 2Y0SA 1ON2A 4XSXF 4EJTA 1ZGAA 3LSMA 2VPRA 4I76A 3GZ6A 1N77A 5FFXA 1Z77A 3BOQA 2VLAA 2F5EA 1DUXC 2GXBA 3HOUJ 1JI8A 5M5YJ 3HOXJ 4X1EA 3WGHA 1ZQ3P 1XMXA 4E70A 3GCMA 2ZJ2A 3OR1C 2EZKA 2RNJA 3S04A 3ECHA 3ROUA 2O61A 2V7FA 3P9CA 4AIHA 3WU2C 3OYCA 2AS5F 1XGMA 1XD7A 2QENA 3O3KA 4L9JA 1VQLI 4XLNF 3I4NJ 1T0FC 2D2WA 1H89C 3GTLJ 2K9SA 4BU2A 4ZTFA 4MFDA 1YE9A 3PQKA 9ANTA 1EJ9A 3AG1H 3EUAA 3KYDB 4II2A 3VSKA 1BOBA 3HC7A 1PYVA 3OL3A 1ONVA 4XLHA 4BHBA 1JJ8C 2GIZA 1CGPA 2QQ8A 2XVCA 2E1NA 4A3MJ 4BJ6C 3ASOH 3RYPA 1O7LA 1W4MA 2DMPA 2O03A 4LFUA 2F6CA 2XASA 1UG0A 4M71A 5CQGA 5GAHJ 2HNHA 3PFYA 1W0UA 1AU7A 2DDAA 2L2OA 2V4JC 1JJ6C 4EGYA 3CCLI 3R60A 4XRMA 2GWRA 4RLFA 3A0BC 2X6YA 4I01A 1HC8A 2VUMJ 2BGCA 3BR2A 3O8GA 4PCQA 3L7WA 4UNOA 1JTXA 2P5VA 4BUPA 4XLAA 2EINH 1R36A 3LA7A 4XR6A 1FLIA 4A0ZA 2RQQA 2XIGA 5J8CA 2JN6A 1IRZA 2F48A 1EF4A 1R7JA 1J9IA 5JVGF 3MFKA 3ZMZA 2QKLB 1MDMB 1NK2P 4KIBA 3L2QA 3WG7H 2R92J 2XPWA 2WADA 3JRCA 4ON0A 5J40A 5FKMA 3MVPA 5F27A 1QNTA 2OD5A 4ZYEA 2F4MB 3J7AY 1OCZH 4NC7A 3PO3J 2B0LA 2VJ5A 2M1BA 2PX9A 2X85A 4E7JA 3D5LA 3GVAA 4E7HA 2QKMB 3MQ0A 3H92A 4AUXA 2FQ4A 4Y52J 1ERDA 3DKXA 2B63J 3CTAA 1O3TA 1Z3XA 1TBXA 1P7IA 2YPRA 4RBOA 4M9ZA 1TWAJ 1TWFJ 2X1CA 3K6GA 2KJCA 1R4MB 4A5NA 3HDDA 5JI6A 2Z2SB 2UUZA 3QYBA 2LSOA 2R7XA 3BT9A 2A07F 1E17A 2CFOA 3VWBA 3L2WA 5EZHA 3ZMDA 3K69A 2FBHA 3KYCB 2YU3A 1OLTA 1LUJB 1JUSA 4A3CJ 2VQGA 1UHSA 3F0CA 3BG6A 4XKWA 3OIPA 1LPQA 5KCMA 3Q5FA 2A6TA 2M8EA 3JAMK 1WI3A 5L3DA 2D45A 2D1VA 3TP0A 3ABUA 4CXFA 1TT0A 3WTXC 2OQGA 1ZRFA 4A3GJ 3BDNA 2KT0A 1WJCA 2H94A 3KP2A 2FSWA 2WB1A 2XF5A 3QP5A 5CYVA 5IYDJ 3OMYA 5DUIA 3IKTA 1D0YA 1NG7A 5DS9A 2Y9ZA 2VOOA 3QU3A 2OA4A 2CJJA 4U0YA 3OYNA 4LOCA 4OIPF 3OOUA 2NYXA 2QVOA 3H0DA 2OUMA 3K4NA 2IRFG 3ZQCA 2P5LC 2XC7A 4BXUA 5LGUA 1E2XA 3R6SA 2HOSA 2VJ4A 5LGTA 4AD9A 2BY3A 5A2QK 5TRDA 1WZ2A 1XC5A 2CV1A 2HVRA 3CJNA 3C3WA 2RREA 3F6OA 3HPGA 3B73A 4ITVA 3L00A 1HW2A 1T33A 2ESNA 1IN8A 1UHMA 2VIXA 3QYEA 4B48A 3V8KA 4M73A 1VQ6I 4ENKA 2JSCA 2VXZA 1IN5A 1ZTRA 3K10A 1BM9A 2NOJB 3MD2A 3NEUA 1KU7A 4GRIA 1G3WA 1MBFA 1P2FA 3ASNH 5IOZA 3PNVA 5L3GA 1R9TJ 3JRHA 2ZXIA 3B6CA 2WBMA 4FE4A 4KICA 3HGYA 3DEUA 3M3YJ 3FISA 3ABKH 2JK3A 2NVXJ 1XG1A 4C3HJ 4C9YA 5HLHA 2XF7A 5DD4A 4NQWB 1I27A 5DCMB 5F1RA 1X4OA 4KUMA 3F22A 3GXOA 2E5NA 1VQ5I 4HLXA 4LLLA 2QUFA 1FIPA 1ENHA 1NG6A 1SFXA 4C3JJ 4X6AJ 1W36D 3HJEA 4UVBA 1BC8C 2BW3A 1ULYA 1LVAA 2X1EA 4DW6A 4BBSJ 1FTZA 1B1BA 2BHYA 4FQGA 3WGIA 4EJOA 5JR3A 1YLFA 1ZGJA 2C6YA 2ZJRF 4ESJA 1X1CA 1Z1DA 2E5ZA 2EV5A 3FMQA 3PFIA 1UG2A 1Y0NA 1R23A 1SD4A 3I55I 1ETOA 2OTJI 2KPMA 2CH0A 4FCYA 2UWMA 5H6QA 4CA0A 3QP6A 4LK1F 1YTYA 3L9FA 4A5MA 5K5OA 1W5CC 1FYLA 3REOA 4AIJA 2XAUA 1G3SA 3PIPF 1I5ZA 1V5GA 2IS2A 2HYJA 2EA2A 2L0KA 3OYMA 4HNUA 1I4VA 3MZ8A 3V7SA 1B6AA 1T0FA 4S04A 4JP0A 3LSKA 2FKDA 3FMRA 3S8PA 4S0HB 4BQAA 3LQQA 4A3IJ 4CGZA 6PAXA 3BJOA 3OYAA 4RS8A 4C30A 3LNQA 1F36A 2ZFWA 1XTAA 4CCLA 1H9TA 1D1AA 2ZNYA 3S3NA 1S29A 3TDUC 4KITB 5JHFA 1VI0A 1RNLA 2A3SA 1MD0A 2PN6A 2NS8A 1IJWC 4PSXA 2JWTA 3GWZA 2M3AA 3FK6A 5FLXK 2ZSIB 3SQNA 4ANJA 5DUKA 3U9GA 4BAYA 3L1PA 4MLOA 2L9SA 2A5YB 4G7ZF 5EZGA 4XLEA 4LD5A 1K6OA 1Z67A 1YQAA 3OV8A 4BKXA 1W1WE 1UMUA 2XPUA 2DMTA 4JQFA 2GM4A 3CC4I 1OISA 2D5VA 2YU9J 2DDBA 2GOMA 4KMUX 3IH2A 3F8NA 3CCVI 2KRHA 1TQMA 2HDWA 4G6TB 1R5ID 3LSGA 2E2IJ 1MH4A 3K4KA 2MW8A 2AXLA 3S14J 4M9XA 3K1NA 4A6DA 1MNEA 2W4SA 4BY1J 1VQOI 2Z16A 5FGMA 3SHFA 1HF0A 3VSLA 2Z9OA 5D8KB 4NHJA 2EZHA 3LMMA 1WJDA 2L7MP 2Y9YA 3PO2J 2NVQJ 3DP7A 2HKOA 1LFUP 1WH5A 1N25A 3B02A 4R1HA 3HSRA 3S3MA 5AIQA 5HNHA 2DPUA 4E7IA 4N9HA 3CCUI 4NNJA 4PJMA 4N4OB 2LBFA 2HTJA 4AYBA 1V4RA 5HLIA 3C2BA 3U1DA 3K2AA 3M7GA 1IV6A 3H36A 2DAOA 3DXJF 2M34A 5E1XA 3QOEA 3I9V2 3HUGA 3CCMI 2VPLA 2HYGD 4RAFA 1FIAA 3JSOA 3MKWB 2UZKA 1HKQA 3S15J 1G8XA 2V9PA 2ZXHA 1MJAA 2ISZA 1KN9A 1MIJA 1BW6A 1R5GA 1P4AA 2EJRA 3EPZA 4ZC3A 1FSHA 1S8NA 4IHXA 5D8LB 1S7EA 2DFFA 1Y8QB 2HDCA 1F39A 3M1EA 4LLGF 1RKWA 2R7DA 4F93B 5B1AH 5ICEA 2WTEA 4OIRF 3SFZA 5IT3A 4IHTA 5LRRA 1AY9A 3BCBA 1PUEE 2OZ6A 1I6XA 2G0EA 1BJZA 4M6VA 1BIBA 1KQ0A 3TEDA 1KQ9A 1BA5A 4HSTA 1HQCA 3DEWA 2VT2A 2J5OA 1J2XA 2ETHA 1HXDA 3S1QJ 1MGTA 3GF2A 1VQKI 2XAFA 1VQ9I 4AU7A 1S6LA 4Q48A 2VODA 2MSYA 4RDUA 3F3XA 5HDGA 3SDBA 2L54A 5C4XJ 1G2HA 2VKVA 1K7AA 2IA2A 1X3UA 2BZTA 4YFKF 1VFCA 3DLAA 3S32A 3HUGB 2JTVA 4NUBA 2VBZA 4MIMA 3ZQLA 2DT5A 4AM3A 2L4MA 4L5JA 4H4KC 3BG5A 3TDZC 2WY8Q 1VQMI 3TO9A 1R1VA 3M07A 2H1LA 5FLMJ 1G6NA 3CMAI 4CCMA 1G59A 4IRGA 2Z33A 1IRXA 2Q0OA 1F43A 5BS6A 3FBIB 5E8GA 1MJ9A 3R61A 1UJ8A 5IT9K 2D1HA 3GUDA 2Y75A 5K5RA 4IZZA 1S7AA 2L7FP 1MBGA 4WF2A 4UUSB 1FX7A 2EPFA 3W3CA 2XSDC 2Z1DA 2DLLA 4MTDA 3W6KB 2W57A 1FP1D 3D5SC 3KP3A 3KFWX 3I56I 5J1RA 4G12A 3IAS2 1U8RA 2KZVA 3BTJA 2JVHA 1TT5B 1IC8A 2G7UA 4XOPA 3GW2A 1MBKA 1K79A 3N97A 2EZLA 3LSTA 4IQ4A 4CCOA 2QBYA 3BR3A 1J7KA 2QM3A 1R71A 1BC7C 1DU0A 1FBQA 3D1NI 4L5EA 4Z2YA 2OTLI 1Z91A 3IKVA 4PUSA 1T08B 3A2KA 2E34A 2VKHA 4RGUA 4IOAF 5EF6A 2F5DA 3G6EI 4ZZDA 2COBA 2Z3YA 2HZTA 4R8HA 5DD8A 1FEXA 1I39A 3MKLA 4HF1A 1WVRA 3IH4A 3HPHA 2B7EA 3ZQHA 4MNUA 4UVAA 1T7DA 1BR4A 2V1XA 3QPTA 2E71A 4B43A 3HRUA 3S1NJ 2EILH 2NNYA 1ODDA 1QVTA 4MTEA 3CD6I 1FBUA 5DYMA 2JRMA 1K78B 3SZPA 2LKSA 4I99C 1W7PD 2BEOA 4P5OA 4FISA 4HYEA 2KL4A 4I98B 2VKEA 2BOLA 1X19A 1RZ4A 5D6FA 1E3PA 1Z6RA 3TMOA 2CW7A 2V26A 2P6TA 1YJWI 1FOWA 2HR3A 2DPDA 2DA3A 2E60A 3JRIA 2PI0A 3F8MA 4B4CA 3WODF 1H9GA 4HDVA 4NC6A 2VQCA 4IHYA 1XSVA 2CYYA 1BI3A 2DMNA 1K61A 2K40A 1XMKA 4KJZA 2DA6A 3EUKL 3K2ZA 2XB0X 5E8IA 4RGRA 3LA2A 1W7PA 2KDOA 3TOAA 2K3PA 5EEGA 1REPC 3V42A 4EATA 1OCPA 2PJRB 1SFOJ 4KDPA 1X58A 2DA7A 4LG0A 1BL0A 3E97A 1SVOA 2G7HA 2DN0A 2CG4A 1DU6A 5CVIA 2O8KA 5C3EJ 3ZXSA 3SEQA 5BNGA 5F08A 2PMZN 1KA8A 3IHUA 4YRVA 3DKWA 1BJAA 1BIAA 2DMUA 4EGZA 3IC7A 1EH8A 3JAMZ 1NHAA 2IP2A 3KEYA 2BVMA 4KT5C 1ACIA 3WTYC 1F9NA 2ELJA 2NS7A 3C18A 4HV5A 1MMDA 1ZKGA 1D1BA 2QQBA 3DV8A 3NARA 5CVJA 3HHGA 5GPAA 3NQOA 4ZYGA 1JUPA 4WXDA 1XGNA 5LEKA 1Y1VJ 5J6XA 4YIRX 2P81A 5BMZA 4BS9A 4YEJA 3G1LA 4G6QA 3CUQA 4NB5A 2E1MC 3RZDJ 4N0BA 3MEXA 2Y48A 4DYQA 3BR6A 3EUHC 2ZJPF 5HVQC 3K7AJ 1SMYF 5KK1A 4UXNA 3X2QH 2ID6A 2IXSA 2KJBA 4EJWA 3AL0C 3OSFA 4B3AA 2F5VA 3H9GA 2DFHA 4HQMA 4XICA 3FDYA 4QWQA 4G7HF 3DU6A 4I09A 2I8DA 1SFEA 3MAJA 4EQQA 4XONA 3WTUC 3T5XA 2WB1N 5IP7J 2XAQA 3FZVA 2ECBA 3O6BB 5CPRB 4UUTA 1XS9A 1VF9A 4U0VA 2L4AA 2VASA 1LDJA 3BQYA 2VC1A 3PNTA 2LOOA 2IGKA 2X48A 5KAFC 1T8IA 2IGNA 3K1PA 2HWVA 3IRRA 2WC2A 5F1JA 2XV4S 2ECCA 2MH2A 2V1DA 3BY6A 1SAXA 3BJAA 1RESA 5HDKA 2DJNA 1YJNI 4Y7NJ 2E36A 2XAJA 1UFMA 4F52A 3MZHA 2E7XA 2XGXA 3CZ6A 2F4OB 1UMQA 3W6JB 2O5RA 2NXNB 4GYIA 4B09A 2LFBA 1Z6TA 4ME8A 4MEYF 3H3VK 1JHCA 4HOBA 3TW6A 2MD0A 3BTLA 4UV9A 4N4NB 4CCNA 2NS0A 4BQNA 1ZAOA 1ORKA 4V2GA 1FTTA 4RAYA 3AL0B 3RSNA 2WV1A 1R5HA 1PUFB 3RJPA 2WAFA 3JCUC 5D5VB 4HPQA 3SFIA 5JFRA 1JKRC 1HW5A 4HA8A 3AKZA 3RPQA 3T0YA 3JW4A 1Z21A 2LBFB 2ISYA 1UZCA 2X6XA 2XGCA 1YRNA 3SYTA 4U7DA 2DT7B 4B1RA 3GX4X 4D1QA 3CO7C 2NRAC 2HXOA 1CF7B 3P7NA 4CYCB 3F8BA 2HOEA 3F8CA 2CUEA 3CP8A 1HBXG 1F5TA 3ZMTA 3T1BA 2R7WA 1V54H 3HXLA 3ZQIA 3J81Z 4M3DA 3G71I 2JA6J 4BH9A 1V5FA 4IHVA 3CO6C 4OMYA 2DU9A 3OYDA 3A1YA 3HGGA 2L02A 3ML6A 4E6KG 1YIOA 4JK1X 4CZZA 3PIOF 1POGA 2WAQA 1WSUA 2FXAA 3OR2C 3GTMJ 2OBPA 4XQFA 2E1CA 1IF1A 2LR8A 4M74A 3K4JA 1VQPI 1U8BA 4IRHA 5BQTA 1MMNA 1MKMA 3G1OA 2R5ZB 2EIKH 3BQZA 1OYYA 5JLWA 1O3RA 4O6JA 4P55A 4BY7J 3T8RA 5FJ8J 1XDSA 4JOMA 3CCJI 2EV6A 5LEJA 1YO5C 2I10A 4NBQA 5HS9A 4BEHB 4HF2A 2W1OA 4A3EJ 3RKQA 3DF8A 4E7LA 2MD5A 2H27A 2K9MA 3RCOA 3FWEA 5B66C 3Q0VA 3C7JA 4RA2A 3S3OA 2DOEA 4C2UA 3K4MA 3IP4B 3CMYA 2KZGA 1W7PB 2PMUA 4L9NA 2LVSA 1H8AC 2JQ7A 3OL4A 2CU7A 2LTPA 1UHWA 1AKHA 3H9QA 1JKQC 1JXSA 2STWA 3KE2A 2KISA 1WJEA 4HW0A 3A01B 2FX0A 2DCEA 2HOTA 4IX7A 3HOVJ 1T39A 1XSDA 2NVTJ 1YOVB 2ZC2A 3H3UA 5D5WB 1K4SA 1IN4A 3ZQFA 1JGSA 2JMWA 2XPVA 3NRVA 1LVKA 4NDLA 4D0PA 4LB6B 2CWEA 3PUFA 4I2OA 2LK2A 2VE8A 1AHDP 1TWCJ 4BXXJ 2CQQA 3K70C 2M4KA 1AA7A 2HEOA 4TV7A 3QPLA 3WTSC 2EH3A 3GTOJ 3BTCA 2KKOA 4BYYA 4E7KA 4B8XA 4O5VA 1R58A 2DA4A 2FA5A 1A36A 2CUFA 2DYRH 4JX4A 4XM3A 4YIIA 2E7WA 1BW5A 3MCZA 4RAGA 4XBFA 3J81K 2MC3A 4LITA 2JA5J 1MJBA 5HLGA 1TWGJ 3F9KA 3V8LA 2LY9A 5IYCJ 3GFIA 4V2FA 3JRGA 5BOXA 3SXYA 1RPWA 2KP6A 4BE1A 4FHTA 4CYCA 2EA4A 2PMZA 1YS7A 1MSFC 3QWLA 3Q9SA 1ETWA 2LYCA 3UR3C 4RM3A 2MC4A 2LLKA 1P92A 1RI7A 4OMZA 1YIJI 2P7CB 3VOEA 4DOZA 3SJMA 2CUZA 2MGQA 1XPXA 3CMEI 2R4GA 2ELKA 3ABLH 1XCBA 3HM5A 3OYKA 1P7JA 1GVDA 2FD5A 4ZZLA 2MH9A 2R7SA 3J80Z 3CUQC 5EYRA 4N31A 4A93J 1XCVA 2JSPA 1QO0D 1VQ7I 4F92B 5F64A 5GAEJ 1QHGA 1ZLJA 1TNTA 3CC2I 3EUHA 3HTUA 5LGNA 2VBYA 1FOYA 1U5TA 2IW5A 3LQRA 4CHUA 5K7FA 2QF7A 3GO5A 1B4AA 2E1OA 1WRJA 4RB0A 4RAZA 1KZHA 3Q0WA 5EG0A 3ECOA 4CH7A 1ZH5A 4AYBN 4U87A 3CCEI 2O9LA 5E3OA 3KX2A 1LFPA 2ZNZA 1GV5A 2AQFA 2K86A 4IRIA 5CJ9A 3GLXA 1D5VA 3ZN1A 2IA0A 1D5YA 3HOWJ 4J00A 3O2PE 2EIMH 4B47A 1SD5A 1TP4A 4KA4A 2A68F 1FSEA 2XRNA 1YW8A 4RLQA 2VOPA 1WGXA 4QSHA 3WHBA 2GZWA 1KYWA 4ZDPA 3I53A 1T95A 2B9SA 4BDYA 3CJTB 1EH6A 3ERED 5BPIA 2CV0A 2O7OA 2ZMEB 4XOTA 1OCRH 4DZJA 5EJCA 2DO7A 4BQOA 3CLQA 2OU2A 3ZGKA 2Y0MA 1GLNA 2KLOA 1UELB 2MYSA 5K1YA 1H0MA 2CQKA 1FPQA 3FIWA 1Q1HA 4ETSA 2LY1A 1R4NB 1J59A 1F1ZA 1V55H 1S7OA
chains in the Genus database with same CATH topology
2DFIA 5JHUA 3V7RA 4IF4A 5ILUA 3F6VA 3SZTA 1HKSA 2DBBA 2JPBA 3E3VA 1PP7U 3I5UA 1O3SA 4YFNF 5ILSA 5K5QA 3DPLC 2RKHA 2FE3A 3RYRA 3WE3A 3KETA 2ZCWA 4LK0F 1D8KA 2KIMA 4HV6A 1QZYA 2PLYA 3TGNA 4L18B 3KP5A 4IJAA 2P4WA 2PFBA 1YG2A 1BI2A 1UB9A 3DPTA 2XKOA 4LLNA 2VBXA 1B9MA 4LG0B 4UHTA 5BPDA 3ZN0A 1U78A 3FX3A 2FBKA 3L09A 3FF5A 4WWCA 3LA3A 1BBYA 4Y15A 4LJZF 1STZA 4HBLA 3FXQA 2COMA 2QZ8A 4CICA 4A0XA 3RI4A 3FXRA 1XGSA 2HGCA 2V1UA 2JRTA 4UVCA 4ESBA 1L0OC 2R3SA 5AIPA 2DK5A 1KQ8A 3WGGA 2OQRA 1YW9A 2CSOA 3HOSA 2ZMEA 2PG4A 2BBYA 2K4BA 2DQRA 5ICCA 1GXQA 1SFUA 5ICGA 1C0WA 3E6BA 2W85A 3JTGA 4A0YA 4Q4ZF 2P5KA 4YIFA 4KIFA 3I0TA 1FNNA 1IW7F 2O0YA 4S05A 2PJPA 4DQ2A 3MWMA 2RVCA 4U88A 2HNFA 1T38A 1YS6A 4EV0A 5E18F 3HSEA 5E1ZB 2EFPA 5JVTA 5HS8A 1G3YA 2FMLA 1HKTA 3KEQA 4RGXA 4NV4A 1KU3A 2VONA 2HQRA 1YW7A 1XB4A 4KN7X 4I0BA 4M6YA 2ACJA 5L3FA 5KVRA 1CF7A 2X0LA 1WQ2A 2LF8A 1P6RA 5TJJA 2V9VA 4HX8A 1TLHB 2ESHA 3KZYA 5LRSA 1DPRA 2QQ9A 2K7LA 2A69F 3PQJA 3M8EA 4PGHA 3WTVC 2QYOA 4A2UA 5A2QZ 2M87A 3DQVC 4FT8A 3CUOA 4OIOF 5L3CA 4GXOA 3WTWC 1DDNA 2XAHA 3C1DA 4NQWA 3WG9A 1WKMA 2QLZA 4KN4X 3LAJA 5FFZA 3V7CA 1R1TA 2IVMA 5D5UB 3F8FA 1FZPB 1P4XA 4AWXB 4K2EA 2IT0A 4RGSA 1B59A 4Y17A 2OZUA 1DP7P 1G3TA 3E5XA 1MDMA 2FJRA 3N4MA 2OAZA 1R00A 4G7OF 1Z05A 3ISPA 5AONA 1FP2A 3EYIA 2G9WA 2BE5F 2ZO4A 1BN5A 1D8JA 3I58A 4MGRA 1HSTA 2FOKA 4M9SA 3GEZA 3ZMSA 4P9UA 2JZYA 2MLKA 1O57A 4MEXF 1LB2A 4WXCA 1USTA 2XUBA 4GGGA 2VE9A 4HX4A 1LDDA 2FEZA 5CVVA 3KEOA 2VT3A 3RTRA 3HRMA 4LMYA 2HTSA 2M45A 2GAUA 2X4HA 2EWNA 3EYYA 3VODA 5EEHA 3IRQA 2HFHA 4HF0A 2NNNA 1BOAA 5E1WA 4XLPF 1I1GA 2EB7A 4WX9A 1EH7A 5ED4A 2DTRA 2LDUA 4L0YB 2FF4A 4N9IA 3TKYA 1W5TA 3QRFF 2EFWA 2WWYA 5HDNA 2XAGA 3LAPA 2HS5A 3EETA 2YSRA 5E17F 3K0LA 1QZZA 2ADUA 1LEAA 1J75A 1P4WA 4LGWA 3WU0A 4ENJA 5LHGA 4MQVA 5L3BA 3JSPA 1ZREA 2H6BA 4I02A 1T6SA 4UUVA 4K8WA 4EJUA 2EV0A 3R4KA 1J5YA 4GYGA 3HRSA 2PEXA 1KCAA 2PQ8A 3G3ZA 2L3DA 1HW1A 1L3LA 4L9VA 1TW3A 4CYDA 1IXCA 1RUOA 4XSZF 4AVPA 1TQIA 2K27A 2CGPA 3J7AO 2F2EA 3S2WA 2O8XA 4GCVA 5CVUA 2UXNA 3ULQB 3E6CC 1ZLKA 5FD6A 3FM5A 4Q47A 2EK5A 3LFKA 4ASNA 3R0JA 3T8TA 3LWFA 3D0SA 4G9YA 4G6DA 3ZMUA 4IVNA 1FWZA 2WV0A 4F7ZA 1KU2A 3M9AA 1OPCA 1LQ1A 2CFXA 2PMHA 1T98A 3KZZA 1J0RA 3Q9VA 4WXHA 3ZMVA 3CLOA 1OMIA 3IWZA 5E20A 2FRHA 3GFLA 2YR2A 4OINF 1HSJA 2QBYB 3I4PA 4G94A 2STTA 1GVJA 1ZN2A 3RKXA 1OR7A 2ZBKA 4EJVA 1U3EM 3K1MA 2M5WA 3AAFA 1FBSA 1OYWA 4WCGA 1YFHA 2FNAA 1TQPA 3CDHA 2XKPA 1U5TC 4RB3C 4LB5A 2CO5A 5DEQA 3HRTA 5LHIA 3HIFA 3IIQA 1V3FA 2Z5UA 3E5UA 2GA2A 1UCRA 1K78A 2HQNA 5HOOA 1FY7A 1KGSA 3HSFA 2RV8A 1ZG1A 1ON1A 2RN7A 3KCCA 1F4KA 1LDKB 1WI9A 4EM1A 3FXUA 2TDXA 1IAWA 2YX7A 4ENNA 3WTZA 3ZP5A 2H6CA 2RQPA 2GXGA 1OYIA 3ZPLA 2K4JA 1XMAA 2R7FA 3HYIA 1VTNC 1TNSA 1BI1A 3KP6A 1SMTA 2RDPA 3U2RA 3V8JA 2RGVA 3WU1B 4L0ZB 3FMSA 4PGGA 3HOTA 4XRFA 2LKPA 3I71A 1GHCA 3WTTC 2P6SA 1U5TB 1KU9A 4Q5SF 3TQNA 3QPHA 1JHEA 5F6FA 1RUNA 4OIQF 1U2WA 1BI0A 4KNYA 3VEPA 2FQ3A 4Y13A 5H20A 1IZ1A 5DCFA 5D6EA 1AWCA 5D5XB 2M30A 1TTYA 1KYZA 3RPUA 1U6GA 4HAMA 4RB2C 4L5IA 3E6DA 1ZYRF 2FNPA 4OU0A 4ZYHA 2DQLA 3OOPA 1SD6A 2KRFA 2A61A 1I1SA 3BP8A 2FU4A 1JHHA 2IJLA 3JTHA 4H0EA 2Q8KA 4IHSA 1AOYA 3I59A 3GYHX 3R0AA 3GFJA 3F72A 1LJ9A 1XGOA 5FO5A 5D4RA 5LBQA 5DV5A 3BJ6A 4P9FA 1JHFA 2V6CA 3MZYA 4EM0B 4BHCA 4HDUA 1OKRA 4DNCA 3RKYA 1O7FA 2K02A 1ZG5A 3F21A 1RIOH 2W24A 5D4SA 2FBIA 3TOBA 2IA1A 1QPMA 1A04A 3EQLF 1IRGA 3TO7A 3ABTA 1ZHFA 1YYVA 2J5PA 1PDNC 4L9TA 4P96A 2PBIA 3WE2A 1QQIA 2P8TA 1W5SA 4QLCU 1LEBA 1D3YA 2Q2EA 1G4DA 4BNCA 4HZFA 4PDKA 2NAZA 4YFXF 1IRFA 2QQAA 2LF7A 5ICFA 4U7BA 4I0AA 4BHPA 3RKWA 3F23A 3J80K 2EFNA 4IXAA 1XN7A 2A6HF 4I7HA 5LHHA 3V4GA 1B9NA 1EV7A 2BV6A 2P7VB 2MLGA 2ELHA 4FX0A 2O6GE 1FYKA 1Z9CA 1IUYA 1GXPA 2IPQX 1T2KA 2GA1A 2KIUA 2KIFA 1B12A 2BYVE 4GO1A 3BROA 2DW4A 4OOIA 3QU6A 4YG2F 3GFMA 3QOPA 2MBFA 2XHKA 4IPAA 1ZG3A 2XROA 5ILVA 4PZJA 3I54A 2QWWA 2ZXJA 5LLQA 3K9TA 3E5QA 4U0WA 5DCMA 4O3MA 1R1UA 3FM3A 3FHZA 3L2CA 2H09A 3G73A 3E6MA 4FX4A 3BPXA 3ELKA 4KYWA 1LNWA 3DFGA 3HTSB 2RC4A 5FLXZ 1Z7UA 1MZBA 4WK8F 1IXRC 2UXXA 2MA3A 3I59B 2HO0A 5ERIA 2EFOA 1XDUA 2W84A 2FMYA 1FYMA 1ZRCA 4A12A 4EM2A 5HS7A 2DK8A 1USSA 2VN2A 2V79A 1QBJA 3KLNA 2VBWA 2O3FA 3VFZA 3M8FA 4M6XA 3BWGA 3RIRA 3BZ6A 4CDGA 1IN7A 3COAC 4EMSA 4MHGA 2L01A 2CW0F 3GZ5A 2A6EF 2YX4A 1Y0UA 4KMFA 4R79A 3KLOA 4KFCA 2ZKZA 2VC0A 4HLYA 5H6RA 4A6EA 3BPVA 2JPCA 2HYFA 1TW2A 5IT9Z 1SD7A 5J8FA 2F5CA 3RDIA 1ZARA 2JT1A 5L3EA 3P9KA 2DI3A 2GQQA 1O3QA 2EFQA 1WWXA 1PP8F 2W25A 5CVRA 3CUQB 4ESFA 4KIGA 4RB1A 1IN6A 3BDDA 4ZH4F 4ZYDA 1S3JA 3KP7A 1FT9A 3IL2A 4MQ9F 3TO6A 4ENMA 1QGPA 3HHHA 3QAHA 3VB2A 3KP4A 2HKXA 1R22A 4EVIA 5FB2A 1ZRDA 1JE8A 1FC3A 5CLSA 1DPUA 2F5FA 2GIVA 1XSXA 1IXSB 3ZQ7A 4AIKA 1FOKA 2LNBA 3IWFA 4CO8A 5DDGA 3EDPA 4M72A 4UV8A 4HX7A 3P9IA 5FD5A 4JBAA 4G8XA 3H3ZA 3I64A 2Z99A 4HQEA 1ON2A 4XSXF 4EJTA 1ZGAA 3GZ6A 5FFXA 3BOQA 1DUXC 2F5EA 2GXBA 3WGHA 4E70A 2ZJ2A 3S04A 2RNJA 3ECHA 3ROUA 2O61A 3P9CA 4AIHA 2AS5F 1XGMA 1XD7A 2QENA 3O3KA 4L9JA 4XLNF 2D2WA 3PQKA 4BHBA 1ONVA 1CGPA 2XVCA 2E1NA 3RYPA 1O7LA 1W4MA 2O03A 4LFUA 2XASA 4M71A 4EGYA 3R60A 2GWRA 4I01A 2BGCA 4PCQA 3L7WA 4UNOA 2P5VA 1R36A 3LA7A 1FLIA 4A0ZA 2XIGA 5J8CA 1R7JA 1J9IA 3MFKA 3ZMZA 1MDMB 4KIBA 4ON0A 1QNTA 2OD5A 4ZYEA 2B0LA 2M1BA 3D5LA 3GVAA 3MQ0A 3H92A 3CTAA 1O3TA 1TBXA 2YPRA 4M9ZA 2KJCA 4A5NA 5JI6A 2LSOA 2A07F 1E17A 3ZMDA 3K69A 2FBHA 2YU3A 3Q5FA 2M8EA 3JAMK 5L3DA 2D45A 2D1VA 3ABUA 4CXFA 3WTXC 2OQGA 1ZRFA 3BDNA 2H94A 3KP2A 2FSWA 3QP5A 5CYVA 5DUIA 3IKTA 2VOOA 3QU3A 2OA4A 4U0YA 4OIPF 2NYXA 2QVOA 2IRFG 2P5LC 4BXUA 5LGUA 1E2XA 3R6SA 5LGTA 4AD9A 5A2QK 5TRDA 3CJNA 3C3WA 3F6OA 3B73A 3L00A 1HW2A 2ESNA 1IN8A 1UHMA 3V8KA 4M73A 4ENKA 2JSCA 2VXZA 1IN5A 1BM9A 1KU7A 3NEUA 1G3WA 1P2FA 5L3GA 4KICA 3DEUA 5HLHA 5DD4A 1I27A 5DCMB 5F1RA 4KUMA 3F22A 3GXOA 4HLXA 4LLLA 2QUFA 1SFXA 4UVBA 1BC8C 1ULYA 1LVAA 1B1BA 3WGIA 4EJOA 5JR3A 1YLFA 1ZGJA 2C6YA 4ESJA 1Z1DA 2EV5A 3PFIA 3FMQA 1R23A 1SD4A 2UWMA 5H6QA 3QP6A 4LK1F 1YTYA 3L9FA 4A5MA 5K5OA 1FYLA 3REOA 4AIJA 1G3SA 1I5ZA 2EA2A 1I4VA 3V7SA 1B6AA 1T0FA 4S04A 2FKDA 3FMRA 4BQAA 4CGZA 3LQQA 6PAXA 3BJOA 4RS8A 2ZFWA 1H9TA 2ZNYA 1S29A 3TDUC 1RNLA 2A3SA 1MD0A 2PN6A 3GWZA 5FLXK 3SQNA 5DUKA 3U9GA 4BAYA 4G7ZF 2A5YB 4LD5A 1K6OA 1YQAA 3OV8A 1UMUA 4JQFA 4KMUX 3F8NA 1TQMA 2AXLA 4M9XA 3K1NA 4A6DA 5FGMA 3SHFA 2Z9OA 5D8KB 4NHJA 3DP7A 2HKOA 3B02A 4R1HA 3HSRA 2DPUA 5AIQA 4N9HA 2HTJA 1V4RA 5HLIA 3U1DA 3M7GA 2DAOA 3DXJF 5E1XA 3HUGA 2HYGD 2UZKA 3JSOA 1HKQA 2ISZA 1MJAA 1KN9A 1R5GA 1P4AA 2EJRA 1FSHA 1S8NA 5D8LB 2HDCA 1F39A 3M1EA 4LLGF 2R7DA 5ICEA 2WTEA 4OIRF 3SFZA 5IT3A 4IHTA 5LRRA 1AY9A 1PUEE 2OZ6A 1I6XA 1BIBA 1KQ0A 1KQ9A 1HQCA 2VT2A 2J5OA 1J2XA 2ETHA 1HXDA 1MGTA 3GF2A 2XAFA 1S6LA 4Q48A 2VODA 3F3XA 5HDGA 2L54A 1K7AA 2IA2A 1X3UA 4YFKF 2JTVA 2VBZA 2DT5A 2L4MA 4L5JA 3TDZC 3TO9A 1R1VA 1G6NA 4IRGA 2Z33A 2Q0OA 5BS6A 5E8GA 1MJ9A 3R61A 5IT9K 2D1HA 3GUDA 5K5RA 2Y75A 1S7AA 4WF2A 1FX7A 2DLLA 4MTDA 3W6KB 2W57A 1FP1D 3KP3A 3KFWX 1U8RA 2G7UA 3GW2A 1K79A 3N97A 3LSTA 2QBYA 1J7KA 2QM3A 1BC7C 1FBQA 4Z2YA 1Z91A 3IKVA 4RGUA 2F5DA 4ZZDA 2Z3YA 2HZTA 4R8HA 5DD8A 4HF1A 4MNUA 4UVAA 1T7DA 2V1XA 3QPTA 3HRUA 2NNYA 1ODDA 4MTEA 1FBUA 5DYMA 1K78B 3SZPA 1W7PD 2BEOA 4P5OA 4HYEA 4I98B 1RZ4A 5D6FA 1Z6RA 2P6TA 2HR3A 2DPDA 2PI0A 3F8MA 3WODF 1H9GA 4HDVA 1XSVA 2CYYA 1BI3A 1XMKA 3K2ZA 5E8IA 4RGRA 3LA2A 1W7PA 3TOAA 5EEGA 1REPC 4KDPA 4LG0A 3E97A 2G7HA 2CG4A 5CVIA 1KA8A 3IHUA 3DKWA 1BJAA 1BIAA 4EGZA 3IC7A 1EH8A 3JAMZ 1NHAA 2IP2A 4KT5C 3WTYC 1F9NA 4HV5A 3C18A 3DV8A 2QQBA 5CVJA 3HHGA 3NQOA 4ZYGA 4WXDA 1XGNA 5LEKA 5J6XA 5BMZA 4G6QA 3CUQA 4NB5A 4N0BA 3MEXA 2Y48A 5HVQC 1SMYF 5KK1A 4UXNA 4EJWA 2KJBA 4HQMA 4QWQA 4G7HF 4I09A 1SFEA 3MAJA 4EQQA 3WTUC 3T5XA 2XAQA 3FZVA 3O6BB 4U0VA 2L4AA 1LDJA 2VC1A 3K1PA 2HWVA 3IRRA 2WC2A 2XV4S 2V1DA 2MH2A 3BY6A 1SAXA 3BJAA 5HDKA 2XAJA 1UFMA 3MZHA 2E7XA 2XGXA 3W6JB 4GYIA 4B09A 1Z6TA 4ME8A 4MEYF 1JHCA 4HOBA 4UV9A 2NS0A 1ZAOA 4RAYA 1R5HA 3RJPA 5D5VB 5JFRA 1HW5A 4HA8A 3RPQA 3T0YA 3JW4A 2ISYA 4U7DA 3GX4X 3CO7C 2NRAC 1CF7B 3P7NA 3F8BA 2HOEA 3F8CA 1F5TA 1HBXG 3ZMTA 3T1BA 3J81Z 4BH9A 3CO6C 4OMYA 2DU9A 2L02A 3ML6A 1YIOA 4JK1X 4CZZA 1WSUA 2FXAA 2OBPA 2E1CA 1IF1A 4M74A 4IRHA 5BQTA 1MKMA 1OYYA 1O3RA 4O6JA 4P55A 3T8RA 1XDSA 2EV6A 5LEJA 1YO5C 5HS9A 4HF2A 3DF8A 2MD5A 2H27A 3FWEA 3C7JA 1W7PB 2PMUA 4L9NA 1UHWA 1JXSA 2STWA 3KE2A 4HW0A 1T39A 1XSDA 3H3UA 5D5WB 1IN4A 1JGSA 3NRVA 4D0PA 4LB6B 2CWEA 4I2OA 2VE8A 2HEOA 4TV7A 3WTSC 2KKOA 4BYYA 4B8XA 4O5VA 1R58A 2FA5A 4YIIA 2E7WA 3MCZA 4XBFA 3J81K 2MC3A 1MJBA 5HLGA 3V8LA 3GFIA 5BOXA 3SXYA 4FHTA 2EA4A 1YS7A 3Q9SA 1P92A 1RI7A 4OMZA 2P7CB 3VOEA 1XCBA 4ZZLA 2MH9A 3J80Z 3CUQC 4N31A 1XCVA 1QO0D 5F64A 1ZLJA 1TNTA 5LGNA 3EUHA 3HTUA 2VBYA 1U5TA 2IW5A 3LQRA 4CHUA 3GO5A 1B4AA 1WRJA 4RB0A 4RAZA 3ECOA 1ZH5A 2ZNZA 2K86A 4IRIA 5CJ9A 3GLXA 1D5VA 3ZN1A 2IA0A 3O2PE 1SD5A 4KA4A 2A68F 1FSEA 1YW8A 2XRNA 2VOPA 2GZWA 1KYWA 3I53A 1EH6A 3ERED 5BPIA 2ZMEB 2DO7A 2OU2A 2Y0MA 5K1YA 1H0MA 2CQKA 1FPQA 4ETSA 1Q1HA 1J59A 1F1ZA 1S7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DFI A;  5JHU A;  3V7R A;  4IF4 A;  5ILU A;  3F6V A;  3SZT A;  1HKS A;  2DBB A;  2JPB A;  3E3V A;  1PP7 U;  3I5U A;  1O3S A;  4YFN F;  5ILS A;  5K5Q A;  3DPL C;  2RKH A;  2FE3 A;  3RYR A;  3WE3 A;  3KET A;  2ZCW A;  4LK0 F;  1D8K A;  2KIM A;  4HV6 A;  1QZY A;  2PLY A;  3TGN A;  4L18 B;  3KP5 A;  4IJA A;  2P4W A;  2PFB A;  1YG2 A;  1BI2 A;  1UB9 A;  3DPT A;  2XKO A;  4LLN A;  2VBX A;  1B9M A;  4LG0 B;  4UHT A;  5BPD A;  3ZN0 A;  1U78 A;  3FX3 A;  2FBK A;  3L09 A;  3FF5 A;  4WWC A;  3LA3 A;  1BBY A;  4Y15 A;  4LJZ F;  1STZ A;  4HBL A;  3FXQ A;  2COM A;  2QZ8 A;  4CIC A;  4A0X A;  3RI4 A;  3FXR A;  1XGS A;  2HGC A;  2V1U A;  2JRT A;  4UVC A;  4ESB A;  1L0O C;  2R3S A;  5AIP A;  2DK5 A;  1KQ8 A;  3WGG A;  2OQR A;  1YW9 A;  2CSO A;  3HOS A;  2ZME A;  2PG4 A;  2BBY A;  2K4B A;  2DQR A;  5ICC A;  1GXQ A;  1SFU A;  5ICG A;  1C0W A;  3E6B A;  2W85 A;  3JTG A;  4A0Y A;  4Q4Z F;  2P5K A;  4YIF A;  4KIF A;  3I0T A;  1FNN A;  1IW7 F;  2O0Y A;  4S05 A;  2PJP A;  4DQ2 A;  3MWM A;  2RVC A;  4U88 A;  2HNF A;  1T38 A;  1YS6 A;  4EV0 A;  5E18 F;  3HSE A;  5E1Z B;  2EFP A;  5JVT A;  5HS8 A;  1G3Y A;  2FML A;  1HKT A;  3KEQ A;  4RGX A;  4NV4 A;  1KU3 A;  2VON A;  2HQR A;  1YW7 A;  1XB4 A;  4KN7 X;  4I0B A;  4M6Y A;  2ACJ A;  5L3F A;  5KVR A;  1CF7 A;  2X0L A;  1WQ2 A;  2LF8 A;  1P6R A;  5TJJ A;  2V9V A;  4HX8 A;  1TLH B;  2ESH A;  3KZY A;  5LRS A;  1DPR A;  2QQ9 A;  2K7L A;  2A69 F;  3PQJ A;  3M8E A;  4PGH A;  3WTV C;  2QYO A;  4A2U A;  5A2Q Z;  2M87 A;  3DQV C;  4FT8 A;  3CUO A;  4OIO F;  5L3C A;  4GXO A;  3WTW C;  1DDN A;  2XAH A;  3C1D A;  4NQW A;  3WG9 A;  1WKM A;  2QLZ A;  4KN4 X;  3LAJ A;  5FFZ A;  3V7C A;  1R1T A;  2IVM A;  5D5U B;  3F8F A;  1FZP B;  1P4X A;  4AWX B;  4K2E A;  2IT0 A;  4RGS A;  1B59 A;  4Y17 A;  2OZU A;  1DP7 P;  1G3T A;  3E5X A;  1MDM A;  2FJR A;  3N4M A;  2OAZ A;  1R00 A;  4G7O F;  1Z05 A;  3ISP A;  5AON A;  1FP2 A;  3EYI A;  2G9W A;  2BE5 F;  2ZO4 A;  1BN5 A;  1D8J A;  3I58 A;  4MGR A;  1HST A;  2FOK A;  4M9S A;  3GEZ A;  3ZMS A;  4P9U A;  2JZY A;  2MLK A;  1O57 A;  4MEX F;  1LB2 A;  4WXC A;  1UST A;  2XUB A;  4GGG A;  2VE9 A;  4HX4 A;  1LDD A;  2FEZ A;  5CVV A;  3KEO A;  2VT3 A;  3RTR A;  3HRM A;  4LMY A;  2HTS A;  2M45 A;  2GAU A;  2X4H A;  2EWN A;  3EYY A;  3VOD A;  5EEH A;  3IRQ A;  2HFH A;  4HF0 A;  2NNN A;  1BOA A;  5E1W A;  4XLP F;  1I1G A;  2EB7 A;  4WX9 A;  1EH7 A;  5ED4 A;  2DTR A;  2LDU A;  4L0Y B;  2FF4 A;  4N9I A;  3TKY A;  1W5T A;  3QRF F;  2EFW A;  2WWY A;  5HDN A;  2XAG A;  3LAP A;  2HS5 A;  3EET A;  2YSR A;  5E17 F;  3K0L A;  1QZZ A;  2ADU A;  1LEA A;  1J75 A;  1P4W A;  4LGW A;  3WU0 A;  4ENJ A;  5LHG A;  4MQV A;  5L3B A;  3JSP A;  1ZRE A;  2H6B A;  4I02 A;  1T6S A;  4UUV A;  4K8W A;  4EJU A;  2EV0 A;  3R4K A;  1J5Y A;  4GYG A;  3HRS A;  2PEX A;  1KCA A;  2PQ8 A;  3G3Z A;  2L3D A;  1HW1 A;  1L3L A;  4L9V A;  1TW3 A;  4CYD A;  1IXC A;  1RUO A;  4XSZ F;  4AVP A;  1TQI A;  2K27 A;  2CGP A;  3J7A O;  2F2E A;  3S2W A;  2O8X A;  4GCV A;  5CVU A;  2UXN A;  3ULQ B;  3E6C C;  1ZLK A;  5FD6 A;  3FM5 A;  4Q47 A;  2EK5 A;  3LFK A;  4ASN A;  3R0J A;  3T8T A;  3LWF A;  3D0S A;  4G9Y A;  4G6D A;  3ZMU A;  4IVN A;  1FWZ A;  2WV0 A;  4F7Z A;  1KU2 A;  3M9A A;  1OPC A;  1LQ1 A;  2CFX A;  2PMH A;  1T98 A;  3KZZ A;  1J0R A;  3Q9V A;  4WXH A;  3ZMV A;  3CLO A;  1OMI A;  3IWZ A;  5E20 A;  2FRH A;  3GFL A;  2YR2 A;  4OIN F;  1HSJ A;  2QBY B;  3I4P A;  4G94 A;  2STT A;  1GVJ A;  1ZN2 A;  3RKX A;  1OR7 A;  2ZBK A;  4EJV A;  1U3E M;  3K1M A;  2M5W A;  3AAF A;  1FBS A;  1OYW A;  4WCG A;  1YFH A;  2FNA A;  1TQP A;  3CDH A;  2XKP A;  1U5T C;  4RB3 C;  4LB5 A;  2CO5 A;  5DEQ A;  3HRT A;  5LHI A;  3HIF A;  3IIQ A;  1V3F A;  2Z5U A;  3E5U A;  2GA2 A;  1UCR A;  1K78 A;  2HQN A;  5HOO A;  1FY7 A;  1KGS A;  3HSF A;  2RV8 A;  1ZG1 A;  1ON1 A;  2RN7 A;  3KCC A;  1F4K A;  1LDK B;  1WI9 A;  4EM1 A;  3FXU A;  2TDX A;  1IAW A;  2YX7 A;  4ENN A;  3WTZ A;  3ZP5 A;  2H6C A;  2RQP A;  2GXG A;  1OYI A;  3ZPL A;  2K4J A;  1XMA A;  2R7F A;  3HYI A;  1VTN C;  1TNS A;  1BI1 A;  3KP6 A;  1SMT A;  2RDP A;  3U2R A;  3V8J A;  2RGV A;  3WU1 B;  4L0Z B;  3FMS A;  4PGG A;  3HOT A;  4XRF A;  2LKP A;  3I71 A;  1GHC A;  3WTT C;  2P6S A;  1U5T B;  1KU9 A;  4Q5S F;  3TQN A;  3QPH A;  1JHE A;  5F6F A;  1RUN A;  4OIQ F;  1U2W A;  1BI0 A;  4KNY A;  3VEP A;  2FQ3 A;  4Y13 A;  5H20 A;  1IZ1 A;  5DCF A;  5D6E A;  1AWC A;  5D5X B;  2M30 A;  1TTY A;  1KYZ A;  3RPU A;  1U6G A;  4HAM A;  4RB2 C;  4L5I A;  3E6D A;  1ZYR F;  2FNP A;  4OU0 A;  4ZYH A;  2DQL A;  3OOP A;  1SD6 A;  2KRF A;  2A61 A;  1I1S A;  3BP8 A;  2FU4 A;  1JHH A;  2IJL A;  3JTH A;  4H0E A;  2Q8K A;  4IHS A;  1AOY A;  3I59 A;  3GYH X;  3R0A A;  3GFJ A;  3F72 A;  1LJ9 A;  1XGO A;  5FO5 A;  5D4R A;  5LBQ A;  5DV5 A;  3BJ6 A;  4P9F A;  1JHF A;  2V6C A;  3MZY A;  4EM0 B;  4BHC A;  4HDU A;  1OKR A;  4DNC A;  3RKY A;  1O7F A;  2K02 A;  1ZG5 A;  3F21 A;  1RIO H;  2W24 A;  5D4S A;  2FBI A;  3TOB A;  2IA1 A;  1QPM A;  1A04 A;  3EQL F;  1IRG A;  3TO7 A;  3ABT A;  1ZHF A;  1YYV A;  2J5P A;  1PDN C;  4L9T A;  4P96 A;  2PBI A;  3WE2 A;  1QQI A;  2P8T A;  1W5S A;  4QLC U;  1LEB A;  1D3Y A;  2Q2E A;  1G4D A;  4BNC A;  4HZF A;  4PDK A;  2NAZ A;  4YFX F;  1IRF A;  2QQA A;  2LF7 A;  5ICF A;  4U7B A;  4I0A A;  4BHP A;  3RKW A;  3F23 A;  3J80 K;  2EFN A;  4IXA A;  1XN7 A;  2A6H F;  4I7H A;  5LHH A;  3V4G A;  1B9N A;  1EV7 A;  2BV6 A;  2P7V B;  2MLG A;  2ELH A;  4FX0 A;  2O6G E;  1FYK A;  1Z9C A;  1IUY A;  1GXP A;  2IPQ X;  1T2K A;  2GA1 A;  2KIU A;  2KIF A;  1B12 A;  2BYV E;  4GO1 A;  3BRO A;  2DW4 A;  4OOI A;  3QU6 A;  4YG2 F;  3GFM A;  3QOP A;  2MBF A;  2XHK A;  4IPA A;  1ZG3 A;  2XRO A;  5ILV A;  4PZJ A;  3I54 A;  2QWW A;  2ZXJ A;  5LLQ A;  3K9T A;  3E5Q A;  4U0W A;  5DCM A;  4O3M A;  1R1U A;  3FM3 A;  3FHZ A;  3L2C A;  2H09 A;  3G73 A;  3E6M A;  4FX4 A;  3BPX A;  3ELK A;  4KYW A;  1LNW A;  3DFG A;  3HTS B;  2RC4 A;  5FLX Z;  1Z7U A;  1MZB A;  4WK8 F;  1IXR C;  2UXX A;  2MA3 A;  3I59 B;  2HO0 A;  5ERI A;  2EFO A;  1XDU A;  2W84 A;  2FMY A;  1FYM A;  1ZRC A;  4A12 A;  4EM2 A;  5HS7 A;  2DK8 A;  1USS A;  2VN2 A;  2V79 A;  1QBJ A;  3KLN A;  2VBW A;  2O3F A;  3VFZ A;  3M8F A;  4M6X A;  3BWG A;  3RIR A;  3BZ6 A;  4CDG A;  1IN7 A;  3COA C;  4EMS A;  4MHG A;  2L01 A;  2CW0 F;  3GZ5 A;  2A6E F;  2YX4 A;  1Y0U A;  4KMF A;  4R79 A;  3KLO A;  4KFC A;  2ZKZ A;  2VC0 A;  4HLY A;  5H6R A;  4A6E A;  3BPV A;  2JPC A;  2HYF A;  1TW2 A;  5IT9 Z;  1SD7 A;  5J8F A;  2F5C A;  3RDI A;  1ZAR A;  2JT1 A;  5L3E A;  3P9K A;  2DI3 A;  2GQQ A;  1O3Q A;  2EFQ A;  1WWX A;  1PP8 F;  2W25 A;  5CVR A;  3CUQ B;  4ESF A;  4KIG A;  4RB1 A;  1IN6 A;  3BDD A;  4ZH4 F;  4ZYD A;  1S3J A;  3KP7 A;  1FT9 A;  3IL2 A;  4MQ9 F;  3TO6 A;  4ENM A;  1QGP A;  3HHH A;  3QAH A;  3VB2 A;  3KP4 A;  2HKX A;  1R22 A;  4EVI A;  5FB2 A;  1ZRD A;  1JE8 A;  1FC3 A;  5CLS A;  1DPU A;  2F5F A;  2GIV A;  1XSX A;  1IXS B;  3ZQ7 A;  4AIK A;  1FOK A;  2LNB A;  3IWF A;  4CO8 A;  5DDG A;  3EDP A;  4M72 A;  4UV8 A;  4HX7 A;  3P9I A;  5FD5 A;  4JBA A;  4G8X A;  3H3Z A;  3I64 A;  2Z99 A;  4HQE A;  1ON2 A;  4XSX F;  4EJT A;  1ZGA A;  3GZ6 A;  5FFX A;  3BOQ A;  1DUX C;  2F5E A;  2GXB A;  3WGH A;  4E70 A;  2ZJ2 A;  3S04 A;  2RNJ A;  3ECH A;  3ROU A;  2O61 A;  3P9C A;  4AIH A;  2AS5 F;  1XGM A;  1XD7 A;  2QEN A;  3O3K A;  4L9J A;  4XLN F;  2D2W A;  3PQK A;  4BHB A;  1ONV A;  1CGP A;  2XVC A;  2E1N A;  3RYP A;  1O7L A;  1W4M A;  2O03 A;  4LFU A;  2XAS A;  4M71 A;  4EGY A;  3R60 A;  2GWR A;  4I01 A;  2BGC A;  4PCQ A;  3L7W A;  4UNO A;  2P5V A;  1R36 A;  3LA7 A;  1FLI A;  4A0Z A;  2XIG A;  5J8C A;  1R7J A;  1J9I A;  3MFK A;  3ZMZ A;  1MDM B;  4KIB A;  4ON0 A;  1QNT A;  2OD5 A;  4ZYE A;  2B0L A;  2M1B A;  3D5L A;  3GVA A;  3MQ0 A;  3H92 A;  3CTA A;  1O3T A;  1TBX A;  2YPR A;  4M9Z A;  2KJC A;  4A5N A;  5JI6 A;  2LSO A;  2A07 F;  1E17 A;  3ZMD A;  3K69 A;  2FBH A;  2YU3 A;  3Q5F A;  2M8E A;  3JAM K;  5L3D A;  2D45 A;  2D1V A;  3ABU A;  4CXF A;  3WTX C;  2OQG A;  1ZRF A;  3BDN A;  2H94 A;  3KP2 A;  2FSW A;  3QP5 A;  5CYV A;  5DUI A;  3IKT A;  2VOO A;  3QU3 A;  2OA4 A;  4U0Y A;  4OIP F;  2NYX A;  2QVO A;  2IRF G;  2P5L C;  4BXU A;  5LGU A;  1E2X A;  3R6S A;  5LGT A;  4AD9 A;  5A2Q K;  5TRD A;  3CJN A;  3C3W A;  3F6O A;  3B73 A;  3L00 A;  1HW2 A;  2ESN A;  1IN8 A;  1UHM A;  3V8K A;  4M73 A;  4ENK A;  2JSC A;  2VXZ A;  1IN5 A;  1BM9 A;  1KU7 A;  3NEU A;  1G3W A;  1P2F A;  5L3G A;  4KIC A;  3DEU A;  5HLH A;  5DD4 A;  1I27 A;  5DCM B;  5F1R A;  4KUM A;  3F22 A;  3GXO A;  4HLX A;  4LLL A;  2QUF A;  1SFX A;  4UVB A;  1BC8 C;  1ULY A;  1LVA A;  1B1B A;  3WGI A;  4EJO A;  5JR3 A;  1YLF A;  1ZGJ A;  2C6Y A;  4ESJ A;  1Z1D A;  2EV5 A;  3PFI A;  3FMQ A;  1R23 A;  1SD4 A;  2UWM A;  5H6Q A;  3QP6 A;  4LK1 F;  1YTY A;  3L9F A;  4A5M A;  5K5O A;  1FYL A;  3REO A;  4AIJ A;  1G3S A;  1I5Z A;  2EA2 A;  1I4V A;  3V7S A;  1B6A A;  1T0F A;  4S04 A;  2FKD A;  3FMR A;  4BQA A;  4CGZ A;  3LQQ A;  6PAX A;  3BJO A;  4RS8 A;  2ZFW A;  1H9T A;  2ZNY A;  1S29 A;  3TDU C;  1RNL A;  2A3S A;  1MD0 A;  2PN6 A;  3GWZ A;  5FLX K;  3SQN A;  5DUK A;  3U9G A;  4BAY A;  4G7Z F;  2A5Y B;  4LD5 A;  1K6O A;  1YQA A;  3OV8 A;  1UMU A;  4JQF A;  4KMU X;  3F8N A;  1TQM A;  2AXL A;  4M9X A;  3K1N A;  4A6D A;  5FGM A;  3SHF A;  2Z9O A;  5D8K B;  4NHJ A;  3DP7 A;  2HKO A;  3B02 A;  4R1H A;  3HSR A;  2DPU A;  5AIQ A;  4N9H A;  2HTJ A;  1V4R A;  5HLI A;  3U1D A;  3M7G A;  2DAO A;  3DXJ F;  5E1X A;  3HUG A;  2HYG D;  2UZK A;  3JSO A;  1HKQ A;  2ISZ A;  1MJA A;  1KN9 A;  1R5G A;  1P4A A;  2EJR A;  1FSH A;  1S8N A;  5D8L B;  2HDC A;  1F39 A;  3M1E A;  4LLG F;  2R7D A;  5ICE A;  2WTE A;  4OIR F;  3SFZ A;  5IT3 A;  4IHT A;  5LRR A;  1AY9 A;  1PUE E;  2OZ6 A;  1I6X A;  1BIB A;  1KQ0 A;  1KQ9 A;  1HQC A;  2VT2 A;  2J5O A;  1J2X A;  2ETH A;  1HXD A;  1MGT A;  3GF2 A;  2XAF A;  1S6L A;  4Q48 A;  2VOD A;  3F3X A;  5HDG A;  2L54 A;  1K7A A;  2IA2 A;  1X3U A;  4YFK F;  2JTV A;  2VBZ A;  2DT5 A;  2L4M A;  4L5J A;  3TDZ C;  3TO9 A;  1R1V A;  1G6N A;  4IRG A;  2Z33 A;  2Q0O A;  5BS6 A;  5E8G A;  1MJ9 A;  3R61 A;  5IT9 K;  2D1H A;  3GUD A;  5K5R A;  2Y75 A;  1S7A A;  4WF2 A;  1FX7 A;  2DLL A;  4MTD A;  3W6K B;  2W57 A;  1FP1 D;  3KP3 A;  3KFW X;  1U8R A;  2G7U A;  3GW2 A;  1K79 A;  3N97 A;  3LST A;  2QBY A;  1J7K A;  2QM3 A;  1BC7 C;  1FBQ A;  4Z2Y A;  1Z91 A;  3IKV A;  4RGU A;  2F5D A;  4ZZD A;  2Z3Y A;  2HZT A;  4R8H A;  5DD8 A;  4HF1 A;  4MNU A;  4UVA A;  1T7D A;  2V1X A;  3QPT A;  3HRU A;  2NNY A;  1ODD A;  4MTE A;  1FBU A;  5DYM A;  1K78 B;  3SZP A;  1W7P D;  2BEO A;  4P5O A;  4HYE A;  4I98 B;  1RZ4 A;  5D6F A;  1Z6R A;  2P6T A;  2HR3 A;  2DPD A;  2PI0 A;  3F8M A;  3WOD F;  1H9G A;  4HDV A;  1XSV A;  2CYY A;  1BI3 A;  1XMK A;  3K2Z A;  5E8I A;  4RGR A;  3LA2 A;  1W7P A;  3TOA A;  5EEG A;  1REP C;  4KDP A;  4LG0 A;  3E97 A;  2G7H A;  2CG4 A;  5CVI A;  1KA8 A;  3IHU A;  3DKW A;  1BJA A;  1BIA A;  4EGZ A;  3IC7 A;  1EH8 A;  3JAM Z;  1NHA A;  2IP2 A;  4KT5 C;  3WTY C;  1F9N A;  4HV5 A;  3C18 A;  3DV8 A;  2QQB A;  5CVJ A;  3HHG A;  3NQO A;  4ZYG A;  4WXD A;  1XGN A;  5LEK A;  5J6X A;  5BMZ A;  4G6Q A;  3CUQ A;  4NB5 A;  4N0B A;  3MEX A;  2Y48 A;  5HVQ C;  1SMY F;  5KK1 A;  4UXN A;  4EJW A;  2KJB A;  4HQM A;  4QWQ A;  4G7H F;  4I09 A;  1SFE A;  3MAJ A;  4EQQ A;  3WTU C;  3T5X A;  2XAQ A;  3FZV A;  3O6B B;  4U0V A;  2L4A A;  1LDJ A;  2VC1 A;  3K1P A;  2HWV A;  3IRR A;  2WC2 A;  2XV4 S;  2V1D A;  2MH2 A;  3BY6 A;  1SAX A;  3BJA A;  5HDK A;  2XAJ A;  1UFM A;  3MZH A;  2E7X A;  2XGX A;  3W6J B;  4GYI A;  4B09 A;  1Z6T A;  4ME8 A;  4MEY F;  1JHC A;  4HOB A;  4UV9 A;  2NS0 A;  1ZAO A;  4RAY A;  1R5H A;  3RJP A;  5D5V B;  5JFR A;  1HW5 A;  4HA8 A;  3RPQ A;  3T0Y A;  3JW4 A;  2ISY A;  4U7D A;  3GX4 X;  3CO7 C;  2NRA C;  1CF7 B;  3P7N A;  3F8B A;  2HOE A;  3F8C A;  1F5T A;  1HBX G;  3ZMT A;  3T1B A;  3J81 Z;  4BH9 A;  3CO6 C;  4OMY A;  2DU9 A;  2L02 A;  3ML6 A;  1YIO A;  4JK1 X;  4CZZ A;  1WSU A;  2FXA A;  2OBP A;  2E1C A;  1IF1 A;  4M74 A;  4IRH A;  5BQT A;  1MKM A;  1OYY A;  1O3R A;  4O6J A;  4P55 A;  3T8R A;  1XDS A;  2EV6 A;  5LEJ A;  1YO5 C;  5HS9 A;  4HF2 A;  3DF8 A;  2MD5 A;  2H27 A;  3FWE A;  3C7J A;  1W7P B;  2PMU A;  4L9N A;  1UHW A;  1JXS A;  2STW A;  3KE2 A;  4HW0 A;  1T39 A;  1XSD A;  3H3U A;  5D5W B;  1IN4 A;  1JGS A;  3NRV A;  4D0P A;  4LB6 B;  2CWE A;  4I2O A;  2VE8 A;  2HEO A;  4TV7 A;  3WTS C;  2KKO A;  4BYY A;  4B8X A;  4O5V A;  1R58 A;  2FA5 A;  4YII A;  2E7W A;  3MCZ A;  4XBF A;  3J81 K;  2MC3 A;  1MJB A;  5HLG A;  3V8L A;  3GFI A;  5BOX A;  3SXY A;  4FHT A;  2EA4 A;  1YS7 A;  3Q9S A;  1P92 A;  1RI7 A;  4OMZ A;  2P7C B;  3VOE A;  1XCB A;  4ZZL A;  2MH9 A;  3J80 Z;  3CUQ C;  4N31 A;  1XCV A;  1QO0 D;  5F64 A;  1ZLJ A;  1TNT A;  5LGN A;  3EUH A;  3HTU A;  2VBY A;  1U5T A;  2IW5 A;  3LQR A;  4CHU A;  3GO5 A;  1B4A A;  1WRJ A;  4RB0 A;  4RAZ A;  3ECO A;  1ZH5 A;  2ZNZ A;  2K86 A;  4IRI A;  5CJ9 A;  3GLX A;  1D5V A;  3ZN1 A;  2IA0 A;  3O2P E;  1SD5 A;  4KA4 A;  2A68 F;  1FSE A;  1YW8 A;  2XRN A;  2VOP A;  2GZW A;  1KYW A;  3I53 A;  1EH6 A;  3ERE D;  5BPI A;  2ZME B;  2DO7 A;  2OU2 A;  2Y0M A;  5K1Y A;  1H0M A;  2CQK A;  1FPQ A;  4ETS A;  1Q1H A;  1J59 A;  1F1Z A;  1S7O A; 
#chains in the Genus database with same CATH topology
 2EZI A;  2IEK A;  5IPA A;  1GDT A;  1IDZ A;  3CQZ J;  2DFI A;  2RAE A;  2VI6 A;  3SDG A;  5JHU A;  5B1B H;  3W2V A;  3V7R A;  4IF4 A;  5ILU A;  2KQR A;  3F6V A;  3SZT A;  1HKS A;  2DBB A;  2JPB A;  1H88 C;  2IBD A;  3E3V A;  1HDD C;  1PP7 U;  3I5U A;  1O3S A;  1YJ9 I;  3WHC A;  3OYE A;  4YFN F;  1WCM J;  2GBY A;  3DPL C;  5ILS A;  2RKH A;  5K5Q A;  2FE3 A;  3RYR A;  4D7M A;  3WE3 A;  3KET A;  2ZCW A;  4LK0 F;  1D8K A;  3LL7 A;  3CP2 A;  2KIM A;  4HV6 A;  1QZY A;  2WA0 A;  2PLY A;  2W00 A;  3TGN A;  5F0H A;  4KT6 A;  4L18 B;  3JRB A;  2RNG A;  3KP5 A;  4IJA A;  2P4W A;  2PFB A;  4P1W A;  1NK3 P;  4DJA A;  2NVU B;  4A3K J;  1YG2 A;  2M9H A;  4XMY A;  1BI2 A;  1UB9 A;  1V5E A;  3DPT A;  2XKO A;  1ZR4 A;  4LLN A;  3VYR B;  1M1E B;  2VBX A;  1NH3 A;  1GV2 A;  1MBH A;  2BY2 A;  1B9M A;  4LG0 B;  3CDI A;  3CCY A;  1ZK8 A;  5HNF A;  1SEU A;  4UHT A;  5BPD A;  1K4T A;  5M3M J;  3L2V A;  3S2D J;  1MMA A;  3ZN0 A;  2EQR A;  1U78 A;  3FX3 A;  1IO2 A;  2FBK A;  3H5R A;  4X0G A;  4PFP A;  3L09 A;  3FF5 A;  4WWC A;  4PJL A;  1KON A;  3LA3 A;  3LSH A;  1BBY A;  4I6Z A;  4Y15 A;  4LJZ F;  3FXM A;  1STZ A;  4HBL A;  3W6V A;  2CV2 A;  3FXQ A;  2COM A;  2R7Q A;  1RET A;  2QZ8 A;  5LD2 C;  1Z3Y A;  4CIC A;  4QIW N;  3M4O J;  2JJ7 A;  3AG2 H;  4IL6 C;  2K3F A;  3DBL B;  2LC2 A;  2L9R A;  4A0X A;  3RI4 A;  3FXR A;  1XGS A;  2HGC A;  3A03 A;  2Y2Z A;  2E2H J;  2JRT A;  4HSR A;  1MW7 A;  2BY1 A;  4EEF G;  2V1U A;  2L9V A;  4UVC A;  2CQN A;  1WFX A;  3OYB A;  4FE7 A;  4ESB A;  1L0O C;  2R3S A;  5AIP A;  2DK5 A;  1KQ8 A;  5J1U A;  3WGG A;  2OQR A;  1B72 A;  4HEA 2;  1O4X A;  1YW9 A;  3P5J A;  2CSO A;  2K9Q A;  3HOS A;  2ZME A;  3GTK J;  2PG4 A;  2DOD A;  2BBY A;  1N75 A;  2HU9 A;  2K4B A;  1QA6 A;  4IQJ A;  2DQR A;  1TZL A;  5ICC A;  1GXQ A;  3E1S A;  1HLV A;  3J7Y J;  3JRD A;  1SFU A;  2AHQ A;  5FLV A;  4DYR A;  5ICG A;  1C0W A;  1WJB A;  3E6B A;  2W85 A;  4GFB A;  2ZJQ F;  3PJR A;  3JTG A;  4C2T A;  4A0Y A;  4Q4Z F;  2P5K A;  4YIF A;  1K6Y A;  3I0T A;  4KIF A;  4OWR B;  3K70 D;  3AG4 H;  3OY9 A;  1FNN A;  1IW7 F;  2O0Y A;  3TL4 X;  3LSJ A;  4S05 A;  4RMN A;  2PJP A;  3BTI A;  4YEL A;  4DQ2 A;  2WAE A;  5GAG J;  3MWM A;  1QPI A;  2OF7 A;  2RVC A;  4U88 A;  3G4S I;  1AKH B;  2HNF A;  3DU5 A;  3PL8 A;  1T38 A;  1YS6 A;  2LP0 A;  4EV0 A;  3HSE A;  5E18 F;  5E1Z B;  1YX3 A;  2EFP A;  4HG2 A;  3QYF A;  5JVT A;  2M4G A;  1MND A;  5HS8 A;  3DKY A;  1G3Y A;  3BG9 A;  2FML A;  1HKT A;  3KEQ A;  4RGX A;  4NV4 A;  2R7R A;  3Q0U A;  1KU3 A;  2VON A;  2HQR A;  1VQ4 I;  1DP3 A;  1YW7 A;  1XB4 A;  4A3L J;  2CMP A;  4KN7 X;  4I0B A;  4M6Y A;  2ACJ A;  5L3F A;  3UKG A;  5KVR A;  1CF7 A;  2M7A A;  2X0L A;  3G2B A;  2X6W A;  1WQ2 A;  3U21 A;  2I5U A;  2LF8 A;  1P6R A;  5TJJ A;  2V9V A;  4DBR A;  4HX8 A;  1TWH J;  1TLH B;  2OCC H;  3ZRG A;  3RZO J;  2ESH A;  3KZY A;  5LRS A;  3W2W A;  1DPR A;  2QQ9 A;  4E7Z A;  1X1A A;  1EA3 A;  2K7L A;  2A69 F;  3PQJ A;  3AFH A;  3M8E A;  4PGH A;  4QTR A;  3WTV C;  2QYO A;  4MO7 A;  4A2U A;  5A2Q Z;  2M87 A;  3DQV C;  2XSJ C;  2H1K A;  3VYT B;  5FRM A;  1OR7 C;  4FT8 A;  2IGO A;  3OWT A;  3CUO A;  4OIO F;  5L3C A;  1OCO H;  2IS6 A;  3BR0 A;  2NVY J;  3DCF A;  3H5A A;  2XDV A;  1I6H J;  1X3Z B;  4GXO A;  3WTW C;  1DDN A;  2XAH A;  3C1D A;  5E3L A;  3I4M J;  2HPI A;  3M8J A;  4F55 A;  3S1M J;  4NQW A;  3WG9 A;  2TCT A;  1WKM A;  3FXO A;  2QLZ A;  5CQE A;  3GTG J;  2DA2 A;  4KN4 X;  1FOX A;  3LAJ A;  5FFZ A;  3V7C A;  3OYI A;  2R7V A;  2XB5 A;  5B5E C;  1X1D A;  3TP3 A;  2Y30 A;  1R1T A;  4QPQ A;  1LE8 B;  2IAI A;  2IVM A;  3RQ4 A;  1Z7L A;  3F8F A;  5D5U B;  1P4X A;  4FTH A;  1FZP B;  3HG9 A;  4AWX B;  4K2E A;  2IT0 A;  4RGS A;  1B59 A;  2XGE A;  2ZB9 A;  4Y17 A;  2W7N A;  2OZU A;  4D5F A;  4IKF A;  1DP7 P;  2X9D A;  1G3T A;  2HZD A;  3E5X A;  3TBI A;  1MDM A;  2FJR A;  3N4M A;  2OAZ A;  1R00 A;  2BHZ A;  3L2R A;  3ZOB A;  4XID A;  4G7O F;  1Y8R B;  1Z05 A;  4BL0 B;  3ISP A;  1JT6 A;  2V9K A;  2ME6 A;  2DOA A;  1S72 I;  5AON A;  1FP2 A;  5EDN A;  1QRY A;  3M1C A;  3EYI A;  1A6Q A;  2G9W A;  2BE5 F;  2ID3 A;  4Y3O A;  2ZO4 A;  1BN5 A;  3FHN A;  1D8J A;  3ERM A;  3I58 A;  4ZDL A;  4MGR A;  4M3E A;  3S16 J;  1HST A;  2FOK A;  4M9S A;  3GEZ A;  4CUG A;  3OS1 A;  2E19 A;  1T56 A;  2Y0S N;  3ZMS A;  3LSI A;  3MMY B;  4P9U A;  1VQN I;  2JZY A;  2MLK A;  1O57 A;  4MEX F;  1LB2 A;  4WXC A;  1ZGW A;  1R6R A;  1UST A;  2XUB A;  3PUB A;  4GGG A;  2BY0 A;  2WY7 Q;  2VE9 A;  4HX4 A;  1LDD A;  2FEZ A;  2K9N A;  5CVV A;  5HOD A;  1TC3 C;  2EBI A;  3KEO A;  2VT3 A;  3RTR A;  1JKO C;  1BR2 A;  2FOW A;  3HRM A;  4LMY A;  2HTS A;  2A5W A;  2M45 A;  2GAU A;  4D5C A;  3ZCO A;  2X4H A;  2EWN A;  3AG3 H;  3EYY A;  5EEH A;  3VOD A;  3IRQ A;  2HFH A;  2VXD A;  4HF0 A;  4BJ5 C;  2NNN A;  1BOA A;  2M7B A;  5E1W A;  4XLP F;  1I1G A;  3LOC A;  4BAC A;  3BG7 A;  2EB7 A;  3HL2 A;  4WX9 A;  1EH7 A;  2PJR A;  5ED4 A;  2MAB A;  1A31 A;  3JR9 A;  2DTR A;  2LDU A;  4L0Y B;  2FF4 A;  3A0H C;  4N9I A;  3TKY A;  1W5T A;  3QRF F;  4AID A;  3IAM 2;  2EFW A;  1A5J A;  3CDL A;  3S93 A;  4XOR A;  2F4I A;  2WWY A;  3DBR B;  2R7O A;  4HRI A;  3BR5 A;  1PUF A;  5HDN A;  4DYC A;  2XAG A;  3LAP A;  3CCR I;  1SFK A;  2HS5 A;  3EET A;  2DT6 A;  3VDX A;  2YSR A;  5E17 F;  3NWT A;  3K0L A;  1QZZ A;  2ADU A;  1LEA A;  2IGM A;  5E3N A;  4NC8 A;  5FKK A;  1J75 A;  1P4W A;  4LGW A;  3WU0 A;  4ENJ A;  5LHG A;  4MQV A;  2QSH X;  5L3B A;  4UUS A;  5C44 J;  3OYF A;  3JSP A;  1ETX A;  1ZRE A;  2H6B A;  4I02 A;  4ZTJ A;  5FRO A;  1T6S A;  4XL9 A;  4UUV A;  4K8W A;  4EJU A;  4BE0 A;  2EV0 A;  3R4K A;  5KNL A;  1PVE A;  4HNT A;  3C2G A;  1J5Y A;  4GYG A;  4D9J A;  4BDZ A;  2R7Z J;  3HRS A;  2PEX A;  5DM6 F;  1KCA A;  2M8G X;  1N78 A;  2PQ8 A;  3FXL A;  3G3Z A;  2L3D A;  1HW1 A;  4BE2 A;  1L3L A;  4L9V A;  1TW3 A;  4CYD A;  2DTZ A;  1IXC A;  3GZN B;  1FJL A;  1RUO A;  4XSZ F;  4AVP A;  1TQI A;  2K27 A;  2R7U A;  2CGP A;  1JUM A;  3J7A O;  2DMQ A;  2F2E A;  4KIS A;  1YHQ I;  4UB8 C;  2HQ5 A;  3S2W A;  2O8X A;  1RRJ A;  2LRD A;  4GCV A;  4CZC A;  5CVU A;  2UXN A;  3ULQ B;  3E6C C;  3S2H J;  2CUJ A;  1ZLK A;  5FD6 A;  2VKD A;  3FM5 A;  4Q47 A;  2EK5 A;  3DEE A;  3LFK A;  4ASN A;  3R0J A;  3T8T A;  2BW3 B;  4CCK A;  3LWF A;  3D0S A;  4G9Y A;  4XRS A;  3JRE A;  3CCS I;  4G6D A;  3ZMU A;  4IVN A;  5GAD J;  4A3J J;  1FWZ A;  2WV0 A;  4II3 A;  4F7Z A;  1KU2 A;  1SVL A;  3M9A A;  4Y4R A;  1OPC A;  1LQ1 A;  2YS9 A;  4DZP A;  2H8W A;  2CFX A;  2PMH A;  2V1N A;  1T98 A;  3DWL E;  1J0R A;  3KZZ A;  5GTH C;  3KYL A;  4V19 K;  3Q9V A;  4WXH A;  5JLX A;  2K9L A;  3DTK A;  3ZMV A;  1E3H A;  2JA2 A;  3CLO A;  3DBH B;  1B72 B;  1OMI A;  3IWZ A;  5E20 A;  2FRH A;  3FKJ A;  3GFL A;  2L9N A;  4JYK A;  2DFE A;  1VZ0 A;  2YR2 A;  1LFB A;  3FK7 A;  5TIS C;  1ETQ A;  4XLC A;  4OIN F;  3PM1 A;  1HSJ A;  4HNV A;  5B3S H;  4W1U A;  4AC0 A;  2QBY B;  1I3A A;  3I4P A;  4G94 A;  1WHU A;  2STT A;  1GVJ A;  1ZN2 A;  3SEZ A;  1QVU A;  3RKX A;  1A6I A;  4BEH A;  1W36 C;  3ABM H;  1OR7 A;  1B8I B;  2ZBK A;  4EJV A;  2Q1Z B;  2ZXW H;  4OAY A;  1U3E M;  3K1M A;  2E1M B;  2M2E A;  2M5W A;  1J09 A;  4J19 A;  2MG4 A;  4PK4 A;  1Y39 A;  2JA8 J;  3AAF A;  5GP9 A;  1FBS A;  1OYW A;  3A01 A;  4XNF A;  1NTC A;  4WCG A;  5EG0 B;  3NWS A;  2GLO A;  3SZG A;  1X2M A;  4PSW A;  3OYL A;  2GXA A;  2VL8 A;  1YFH A;  2FNA A;  1TQP A;  1ETK A;  3CDH A;  2XKP A;  2IS1 A;  1U5T C;  4RB3 C;  4B3X A;  4LB5 A;  1SC7 A;  2CO5 A;  3FKI J;  2KMU A;  2CS3 A;  2VQL A;  3HRT A;  5DEQ A;  5LHI A;  3K4L A;  5M3F J;  3HIF A;  3IIQ A;  1V3F A;  2Z5U A;  1WH7 A;  2DXI A;  3E5U A;  3B6A A;  2A05 A;  2GA2 A;  3HKZ A;  4JX6 A;  1UCR A;  4M3F A;  3VPR A;  2HQN A;  5HOO A;  1K78 A;  1FY7 A;  3H9J A;  1KGS A;  2YUS A;  3HSF A;  5IYB J;  5K7Z A;  3JRA A;  4XK4 A;  2RV8 A;  4XKV A;  1ZG1 A;  1Z0X A;  1QZE A;  1ON1 A;  3BZK A;  3S1R J;  4M3G A;  2RN7 A;  3KCC A;  3OYJ A;  1F4K A;  1LDK B;  1HCR A;  1WI9 A;  3CJQ B;  4EM1 A;  2E35 A;  3FXU A;  4LIU A;  1Y56 A;  5TGT A;  2TDX A;  1IAW A;  2YX7 A;  4ENN A;  3WTZ A;  3ZP5 A;  1XX5 A;  2H6C A;  3OYH A;  2RQP A;  2XF6 A;  2K5C A;  1DGW Y;  4CSW A;  1D0X A;  2JUC A;  2GXG A;  3W2A A;  1OYI A;  1W0T A;  2K4J A;  1VTN C;  1XMA A;  2R7F A;  3HYI A;  3ZPL A;  1TNS A;  1BI1 A;  3KP6 A;  3RQI A;  1SMT A;  2RDP A;  3U2R A;  3V8J A;  2RGV A;  5K7H A;  3WU1 B;  5FKL A;  4L0Z B;  1HA8 A;  3FMS A;  4PGG A;  2LMD A;  3NAU A;  3UNG C;  4IHW A;  1S5L C;  1YX5 A;  3ZR8 X;  3HBL A;  3HOT A;  4XRF A;  4BJT A;  1U0J A;  2LKP A;  1MH3 A;  2ZSH B;  2VB6 A;  1K83 J;  3I71 A;  3MKY B;  1GHC A;  4XN3 A;  3WTT C;  2P6S A;  3MN2 A;  1JGG A;  1U5T B;  5M5W J;  1KU9 A;  4UB6 C;  3CES A;  4Q5S F;  3K4C A;  4XN0 A;  2ICW G;  2R7T A;  1IDY A;  3TQN A;  4F3Q A;  1WJA A;  1DGR M;  3QPH A;  4XLF A;  1JHE A;  4XRS G;  3PNY A;  5F6F A;  1RUN A;  1MMG A;  4OIQ F;  1I3Q J;  4RM2 A;  1U2W A;  1BI0 A;  4KNY A;  3VEP A;  5LFA A;  3VYS B;  1OCC H;  2FQ3 A;  4Y13 A;  5H20 A;  1IZ1 A;  4J01 A;  1PJR A;  5D6E A;  5DCF A;  1AWC A;  5D5X B;  2M30 A;  1TTY A;  1KYZ A;  3QPS A;  1JT0 A;  3RPU A;  1U6G A;  4HAM A;  5DTD A;  4RB2 C;  3G1M A;  4L5I A;  1U9O A;  3E6D A;  1ZYR F;  2CQX A;  2AQE A;  2FNP A;  5C4J J;  4UY8 I;  4OU0 A;  4ZYH A;  1RR8 C;  2EIJ H;  2DQL A;  3OOP A;  1SD6 A;  2FJ1 A;  2KRF A;  3QQA A;  2A61 A;  3BR1 A;  5CKT A;  1I1S A;  3BP8 A;  2FU4 A;  5EGO A;  1JHH A;  3IV5 A;  3BG3 A;  2NOG A;  2W82 A;  2IJL A;  3JTH A;  1QHH D;  2DA1 A;  2Q8K A;  4DBQ A;  4H0E A;  4PFO A;  2HQA A;  2OC6 A;  4IHS A;  3H0G J;  3OIO A;  4A3B J;  2OV7 A;  3HOZ J;  3CMM A;  1AOY A;  1RKT A;  3O8H A;  5EEA A;  3I59 A;  3CF5 F;  5IY5 H;  3GYH X;  3R0A A;  3TW7 A;  3GFJ A;  3F72 A;  3GTJ J;  1LJ9 A;  1XGO A;  1VND A;  2XRL A;  2FUG 2;  5FO5 A;  4C2M J;  5D4R A;  5LBQ A;  2X51 A;  5DV5 A;  2OJE D;  3BJ6 A;  4P9F A;  1JHF A;  1P9Q C;  2AO9 A;  1D0Z A;  1X2N A;  2V6C A;  3MZY A;  1Y6I A;  3CC7 I;  4EM0 B;  4BHC A;  3HB9 A;  5GPC A;  1OKR A;  4BBR J;  4HDU A;  1Y1W J;  4DNC A;  3RKY A;  1FMW A;  3BLY A;  1O7F A;  2K02 A;  4DIQ A;  1U9N A;  1ZG5 A;  3F21 A;  2P0W A;  2VJJ A;  3LSP A;  3MKZ A;  2W24 A;  1RIO H;  1X4P A;  5D4S A;  3FXJ A;  3KIO A;  3QOD A;  5FKN A;  5J3L A;  2DA5 A;  3OS0 A;  1OFC X;  2FBI A;  3PSI A;  1APL C;  5F0F A;  3TOB A;  2R5Y A;  2DJI A;  2Y69 H;  2IA1 A;  1CQT A;  4PJN A;  2R5Y B;  1GT0 C;  1JKP C;  1QPM A;  2BXZ A;  1A04 A;  2BXY A;  2HOA A;  4ZDO A;  3OSG A;  3EQL F;  4BGD A;  1IRG A;  3DLL F;  3TO7 A;  3OIQ A;  3ABT A;  5IP9 J;  1RC9 A;  1ZHF A;  1YYV A;  2J5P A;  1PDN C;  4L9T A;  3A02 A;  1MMS A;  3FBN B;  2M0M A;  2KFD A;  4P96 A;  2HDD A;  4W97 A;  4DGW B;  2PBI A;  3WE2 A;  1QQI A;  3GBG A;  2P8T A;  1W5S A;  1E3O C;  4QLC U;  1LEB A;  1D3Y A;  5J4Y A;  2Q2E A;  1G4D A;  4LG3 A;  4BNC A;  3DTI A;  2WAQ N;  4HZF A;  4PDK A;  2NAZ A;  4YFX F;  5J4V A;  1IRF A;  2QQA A;  2LKX A;  2LF7 A;  4E7S A;  5ICF A;  3A4C A;  3KPH A;  5H2F C;  4U7B A;  4I0A A;  3CCQ I;  1A35 A;  4BHP A;  1E0E A;  1YIT I;  1EKE A;  1MNM C;  1MBE A;  3RKW A;  3F23 A;  3ESW B;  3HKZ N;  1TL8 A;  3J80 K;  2EFN A;  4IXA A;  1XN7 A;  2A6H F;  1X1P A;  4I7H A;  2QGU A;  1Q1V A;  3V4G A;  5LHH A;  1B9N A;  1EV7 A;  2BV6 A;  2P7V B;  2MLG A;  4ABZ A;  2ELH A;  4FX0 A;  4PJJ A;  2O6G E;  5GTI C;  1FYK A;  1Z9C A;  1SAN A;  4A3D J;  1IUY A;  1GXP A;  4E4H A;  2IPQ X;  4D7N A;  4XKC A;  2JVG A;  1T2K A;  2GA1 A;  2KIU A;  2KIF A;  1B12 A;  2BYV E;  3Q3S A;  4GO1 A;  4AVZ A;  1IUF A;  3BRO A;  4LIV A;  4ZYA A;  2DW4 A;  4OOI A;  1ETV A;  3QU6 A;  3ZQG A;  4QPO A;  1X1B A;  4MFE A;  4YG2 F;  3GFM A;  3QOP A;  2MBF A;  2XHK A;  2E2J J;  2ME0 A;  2Q2E B;  4IPA A;  5FRN A;  3HEF A;  2LD5 A;  1ZG3 A;  3J7Z I;  3GTQ J;  2OPT A;  3L2U A;  3BCA A;  5HLT A;  2XRO A;  2GOX B;  2TRT A;  5ILV A;  4PZJ A;  1VQ8 I;  3I54 A;  2QWW A;  2ZXJ A;  5LLQ A;  4CCJ A;  2W48 A;  3JRF A;  3K9T A;  3E5Q A;  2H8R A;  4U0W A;  2HI3 A;  2HVQ A;  3H35 A;  5DCM A;  4O3M A;  1R1U A;  3FM3 A;  3FXK A;  3FHZ A;  3L2C A;  2KIQ A;  2H09 A;  3C2H A;  2L7K A;  3N05 A;  3E6M A;  5IOY A;  2KDZ A;  3G73 A;  2VJI A;  4FX4 A;  2LRE A;  3BPX A;  3ELK A;  4KYW A;  2X1D A;  1LNW A;  2R93 J;  1ETY A;  3ZQQ A;  1YI2 I;  2XGD A;  2QEX I;  1IGN A;  3DFG A;  5IP6 A;  2HXI A;  2RC4 A;  3H1C A;  3HTS B;  1WJ5 A;  5FLX Z;  1Z7U A;  2L5Q A;  1WPK A;  1ZR2 A;  1MZB A;  4WK8 F;  3S17 J;  1IXR C;  2UXX A;  2MA3 A;  3I59 B;  5FKO A;  1R49 A;  3DPU A;  2R5Z A;  2HO0 A;  4IO9 F;  5ERI A;  2EFO A;  5E3M A;  1XDU A;  2W84 A;  2QSF X;  2CQ7 A;  4Y33 A;  2FMY A;  1FYM A;  1X3W B;  1BR1 A;  1ZRC A;  1OJL A;  2LG4 A;  2VQH A;  4A12 A;  4EM2 A;  3LSR A;  2R0Q C;  3H5N A;  5HS7 A;  2DK8 A;  1USS A;  2VN2 A;  2HVS A;  2K85 A;  3PSF A;  2V79 A;  2OCE A;  4Z6Y A;  1MBJ A;  1QBJ A;  3KLN A;  5E79 C;  4M3B A;  1ZEL A;  2VBW A;  2O3F A;  1HOM A;  2QA4 I;  4IEJ A;  3VFZ A;  3M8F A;  3RPU D;  3ONQ A;  4M6X A;  4B44 A;  4A69 C;  3HOY J;  3CJR B;  2JA7 J;  3BWG A;  2UV1 A;  3RIR A;  4OAZ A;  3BZ6 A;  4CDG A;  3OYG A;  1IN7 A;  3LFU A;  1JTY A;  3GTP J;  3COA C;  3I3L A;  4EMS A;  3OS2 A;  4MHG A;  2LH9 A;  2L01 A;  2CW0 F;  3GZ5 A;  1I50 J;  2A6E F;  2YX4 A;  1Y0U A;  4KMF A;  2AXT C;  4R79 A;  3KLO A;  2HPM A;  4KFC A;  2ZKZ A;  2VC0 A;  1WJF A;  2DOF A;  2ZFU A;  2LY2 A;  3GLL A;  5H6R A;  4HLY A;  4A6E A;  3BPV A;  2JPC A;  2HYF A;  2Y31 A;  3E7L A;  2DYS H;  1TW2 A;  2QCO A;  5IT9 Z;  1SD7 A;  5J8F A;  2F5C A;  3RDI A;  1ZAR A;  2JT1 A;  5L3E A;  4F91 B;  3P9K A;  2DI3 A;  2M0C A;  1SAU A;  2GQQ A;  2IS4 A;  4PJ0 C;  1O3Q A;  5F0C A;  3D5R C;  3DTE A;  2EFQ A;  1QU3 A;  1WWX A;  1PP8 F;  2JUG A;  1UAA A;  2W25 A;  5CVR A;  3CUQ B;  4ESF A;  5J1Y A;  4KIG A;  3VYU B;  3BZC A;  1IN6 A;  1D1C A;  3BDD A;  4ZH4 F;  1RR7 A;  3BC8 A;  4RB1 A;  1GUU A;  4BXF A;  1ITY A;  4BQQ A;  4ZYD A;  5KAI C;  1S3J A;  3K4B A;  1FT9 A;  3KP7 A;  3IL2 A;  4MQ9 F;  3TO6 A;  4ENM A;  1QGP A;  3HHH A;  2L7Z A;  3QAH A;  1YRN B;  5M5X J;  3VB2 A;  2KRC A;  3KP4 A;  2HKX A;  1R22 A;  4EVI A;  1OCT C;  1SVM A;  5FB2 A;  1ZRD A;  4C3I J;  2CRG A;  1JE8 A;  1MSE C;  1FC3 A;  4FET A;  4A3F J;  5CLS A;  3GME A;  1DPU A;  2F5F A;  1HDP A;  1S9H A;  2GIV A;  5KHD A;  3E0J B;  1LE8 A;  1XSX A;  1IXS B;  3ZQ7 A;  2X6O A;  5J47 A;  4AIK A;  1FOK A;  2LNB A;  2MFZ A;  3IWF A;  1DQU A;  1IV8 A;  5EGO B;  4FAS D;  4CO8 A;  2CW8 A;  1OQY A;  2ZME C;  5DDG A;  3HZJ A;  3EDP A;  3U1K A;  4ZJZ A;  4M72 A;  4UV8 A;  4HX7 A;  4JX5 A;  1IG7 A;  3P9I A;  3IUO A;  3CF2 A;  5FD5 A;  2N8G A;  1B8I A;  1FMV A;  4JBA A;  4GDF A;  2KHM A;  3KZI C;  4G8X A;  3H3Z A;  3I64 A;  2BVL A;  2Z99 A;  4IOC F;  2V6E A;  4HQE A;  5F04 A;  5DM7 F;  1LKX A;  3IH3 A;  4XKB A;  2QSG X;  2Y0S A;  1ON2 A;  4XSX F;  4EJT A;  1ZGA A;  3LSM A;  2VPR A;  4I76 A;  3GZ6 A;  1N77 A;  5FFX A;  1Z77 A;  3BOQ A;  2VLA A;  2F5E A;  1DUX C;  2GXB A;  3HOU J;  1JI8 A;  5M5Y J;  3HOX J;  4X1E A;  3WGH A;  1ZQ3 P;  1XMX A;  4E70 A;  3GCM A;  2ZJ2 A;  3OR1 C;  2EZK A;  2RNJ A;  3S04 A;  3ECH A;  3ROU A;  2O61 A;  2V7F A;  3P9C A;  4AIH A;  3WU2 C;  3OYC A;  2AS5 F;  1XGM A;  1XD7 A;  2QEN A;  3O3K A;  4L9J A;  1VQL I;  4XLN F;  3I4N J;  1T0F C;  2D2W A;  1H89 C;  3GTL J;  2K9S A;  4BU2 A;  4ZTF A;  4MFD A;  1YE9 A;  3PQK A;  9ANT A;  1EJ9 A;  3AG1 H;  3EUA A;  3KYD B;  4II2 A;  3VSK A;  1BOB A;  3HC7 A;  1PYV A;  3OL3 A;  1ONV A;  4XLH A;  4BHB A;  1JJ8 C;  2GIZ A;  1CGP A;  2QQ8 A;  2XVC A;  2E1N A;  4A3M J;  4BJ6 C;  3ASO H;  3RYP A;  1O7L A;  1W4M A;  2DMP A;  2O03 A;  4LFU A;  2F6C A;  2XAS A;  1UG0 A;  4M71 A;  5CQG A;  5GAH J;  2HNH A;  3PFY A;  1W0U A;  1AU7 A;  2DDA A;  2L2O A;  2V4J C;  1JJ6 C;  4EGY A;  3CCL I;  3R60 A;  4XRM A;  2GWR A;  4RLF A;  3A0B C;  2X6Y A;  4I01 A;  1HC8 A;  2VUM J;  2BGC A;  3BR2 A;  3O8G A;  4PCQ A;  3L7W A;  4UNO A;  1JTX A;  2P5V A;  4BUP A;  4XLA A;  2EIN H;  1R36 A;  3LA7 A;  4XR6 A;  1FLI A;  4A0Z A;  2RQQ A;  2XIG A;  5J8C A;  2JN6 A;  1IRZ A;  2F48 A;  1EF4 A;  1R7J A;  1J9I A;  5JVG F;  3MFK A;  3ZMZ A;  2QKL B;  1MDM B;  1NK2 P;  4KIB A;  3L2Q A;  3WG7 H;  2R92 J;  2XPW A;  2WAD A;  3JRC A;  4ON0 A;  5J40 A;  5FKM A;  3MVP A;  5F27 A;  1QNT A;  2OD5 A;  4ZYE A;  2F4M B;  3J7A Y;  1OCZ H;  4NC7 A;  3PO3 J;  2B0L A;  2VJ5 A;  2M1B A;  2PX9 A;  2X85 A;  4E7J A;  3D5L A;  3GVA A;  4E7H A;  2QKM B;  3MQ0 A;  3H92 A;  4AUX A;  2FQ4 A;  4Y52 J;  1ERD A;  3DKX A;  2B63 J;  3CTA A;  1O3T A;  1Z3X A;  1TBX A;  1P7I A;  2YPR A;  4RBO A;  4M9Z A;  1TWA J;  1TWF J;  2X1C A;  3K6G A;  2KJC A;  1R4M B;  4A5N A;  3HDD A;  5JI6 A;  2Z2S B;  2UUZ A;  3QYB A;  2LSO A;  2R7X A;  3BT9 A;  2A07 F;  1E17 A;  2CFO A;  3VWB A;  3L2W A;  5EZH A;  3ZMD A;  3K69 A;  2FBH A;  3KYC B;  2YU3 A;  1OLT A;  1LUJ B;  1JUS A;  4A3C J;  2VQG A;  1UHS A;  3F0C A;  3BG6 A;  4XKW A;  3OIP A;  1LPQ A;  5KCM A;  3Q5F A;  2A6T A;  2M8E A;  3JAM K;  1WI3 A;  5L3D A;  2D45 A;  2D1V A;  3TP0 A;  3ABU A;  4CXF A;  1TT0 A;  3WTX C;  2OQG A;  1ZRF A;  4A3G J;  3BDN A;  2KT0 A;  1WJC A;  2H94 A;  3KP2 A;  2FSW A;  2WB1 A;  2XF5 A;  3QP5 A;  5CYV A;  5IYD J;  3OMY A;  5DUI A;  3IKT A;  1D0Y A;  1NG7 A;  5DS9 A;  2Y9Z A;  2VOO A;  3QU3 A;  2OA4 A;  2CJJ A;  4U0Y A;  3OYN A;  4LOC A;  4OIP F;  3OOU A;  2NYX A;  2QVO A;  3H0D A;  2OUM A;  3K4N A;  2IRF G;  3ZQC A;  2P5L C;  2XC7 A;  4BXU A;  5LGU A;  1E2X A;  3R6S A;  2HOS A;  2VJ4 A;  5LGT A;  4AD9 A;  2BY3 A;  5A2Q K;  5TRD A;  1WZ2 A;  1XC5 A;  2CV1 A;  2HVR A;  3CJN A;  3C3W A;  2RRE A;  3F6O A;  3HPG A;  3B73 A;  4ITV A;  3L00 A;  1HW2 A;  1T33 A;  2ESN A;  1IN8 A;  1UHM A;  2VIX A;  3QYE A;  4B48 A;  3V8K A;  4M73 A;  1VQ6 I;  4ENK A;  2JSC A;  2VXZ A;  1IN5 A;  1ZTR A;  3K10 A;  1BM9 A;  2NOJ B;  3MD2 A;  3NEU A;  1KU7 A;  4GRI A;  1G3W A;  1MBF A;  1P2F A;  3ASN H;  5IOZ A;  3PNV A;  5L3G A;  1R9T J;  3JRH A;  2ZXI A;  3B6C A;  2WBM A;  4FE4 A;  4KIC A;  3HGY A;  3DEU A;  3M3Y J;  3FIS A;  3ABK H;  2JK3 A;  2NVX J;  1XG1 A;  4C3H J;  4C9Y A;  5HLH A;  2XF7 A;  5DD4 A;  4NQW B;  1I27 A;  5DCM B;  5F1R A;  1X4O A;  4KUM A;  3F22 A;  3GXO A;  2E5N A;  1VQ5 I;  4HLX A;  4LLL A;  2QUF A;  1FIP A;  1ENH A;  1NG6 A;  1SFX A;  4C3J J;  4X6A J;  1W36 D;  3HJE A;  4UVB A;  1BC8 C;  2BW3 A;  1ULY A;  1LVA A;  2X1E A;  4DW6 A;  4BBS J;  1FTZ A;  1B1B A;  2BHY A;  4FQG A;  3WGI A;  4EJO A;  5JR3 A;  1YLF A;  1ZGJ A;  2C6Y A;  2ZJR F;  4ESJ A;  1X1C A;  1Z1D A;  2E5Z A;  2EV5 A;  3FMQ A;  3PFI A;  1UG2 A;  1Y0N A;  1R23 A;  1SD4 A;  3I55 I;  1ETO A;  2OTJ I;  2KPM A;  2CH0 A;  4FCY A;  2UWM A;  5H6Q A;  4CA0 A;  3QP6 A;  4LK1 F;  1YTY A;  3L9F A;  4A5M A;  5K5O A;  1W5C C;  1FYL A;  3REO A;  4AIJ A;  2XAU A;  1G3S A;  3PIP F;  1I5Z A;  1V5G A;  2IS2 A;  2HYJ A;  2EA2 A;  2L0K A;  3OYM A;  4HNU A;  1I4V A;  3MZ8 A;  3V7S A;  1B6A A;  1T0F A;  4S04 A;  4JP0 A;  3LSK A;  2FKD A;  3FMR A;  3S8P A;  4S0H B;  4BQA A;  3LQQ A;  4A3I J;  4CGZ A;  6PAX A;  3BJO A;  3OYA A;  4RS8 A;  4C30 A;  3LNQ A;  1F36 A;  2ZFW A;  1XTA A;  4CCL A;  1H9T A;  1D1A A;  2ZNY A;  3S3N A;  1S29 A;  3TDU C;  4KIT B;  5JHF A;  1VI0 A;  1RNL A;  2A3S A;  1MD0 A;  2PN6 A;  2NS8 A;  1IJW C;  4PSX A;  2JWT A;  3GWZ A;  2M3A A;  3FK6 A;  5FLX K;  2ZSI B;  3SQN A;  4ANJ A;  5DUK A;  3U9G A;  4BAY A;  3L1P A;  4MLO A;  2L9S A;  2A5Y B;  4G7Z F;  5EZG A;  4XLE A;  4LD5 A;  1K6O A;  1Z67 A;  1YQA A;  3OV8 A;  4BKX A;  1W1W E;  1UMU A;  2XPU A;  2DMT A;  4JQF A;  2GM4 A;  3CC4 I;  1OIS A;  2D5V A;  2YU9 J;  2DDB A;  2GOM A;  4KMU X;  3IH2 A;  3F8N A;  3CCV I;  2KRH A;  1TQM A;  2HDW A;  4G6T B;  1R5I D;  3LSG A;  2E2I J;  1MH4 A;  3K4K A;  2MW8 A;  2AXL A;  3S14 J;  4M9X A;  3K1N A;  4A6D A;  1MNE A;  2W4S A;  4BY1 J;  1VQO I;  2Z16 A;  5FGM A;  3SHF A;  1HF0 A;  3VSL A;  2Z9O A;  5D8K B;  4NHJ A;  2EZH A;  3LMM A;  1WJD A;  2L7M P;  2Y9Y A;  3PO2 J;  2NVQ J;  3DP7 A;  2HKO A;  1LFU P;  1WH5 A;  1N25 A;  3B02 A;  4R1H A;  3HSR A;  3S3M A;  5AIQ A;  5HNH A;  2DPU A;  4E7I A;  4N9H A;  3CCU I;  4NNJ A;  4PJM A;  4N4O B;  2LBF A;  2HTJ A;  4AYB A;  1V4R A;  5HLI A;  3C2B A;  3U1D A;  3K2A A;  3M7G A;  1IV6 A;  3H36 A;  2DAO A;  3DXJ F;  2M34 A;  5E1X A;  3QOE A;  3I9V 2;  3HUG A;  3CCM I;  2VPL A;  2HYG D;  4RAF A;  1FIA A;  3JSO A;  3MKW B;  2UZK A;  1HKQ A;  3S15 J;  1G8X A;  2V9P A;  2ZXH A;  1MJA A;  2ISZ A;  1KN9 A;  1MIJ A;  1BW6 A;  1R5G A;  1P4A A;  2EJR A;  3EPZ A;  4ZC3 A;  1FSH A;  1S8N A;  4IHX A;  5D8L B;  1S7E A;  2DFF A;  1Y8Q B;  2HDC A;  1F39 A;  3M1E A;  4LLG F;  1RKW A;  2R7D A;  4F93 B;  5B1A H;  5ICE A;  2WTE A;  4OIR F;  3SFZ A;  5IT3 A;  4IHT A;  5LRR A;  1AY9 A;  3BCB A;  1PUE E;  2OZ6 A;  1I6X A;  2G0E A;  1BJZ A;  4M6V A;  1BIB A;  1KQ0 A;  3TED A;  1KQ9 A;  1BA5 A;  4HST A;  1HQC A;  3DEW A;  2VT2 A;  2J5O A;  1J2X A;  2ETH A;  1HXD A;  3S1Q J;  1MGT A;  3GF2 A;  1VQK I;  2XAF A;  1VQ9 I;  4AU7 A;  1S6L A;  4Q48 A;  2VOD A;  2MSY A;  4RDU A;  3F3X A;  5HDG A;  3SDB A;  2L54 A;  5C4X J;  1G2H A;  2VKV A;  1K7A A;  2IA2 A;  1X3U A;  2BZT A;  4YFK F;  1VFC A;  3DLA A;  3S32 A;  3HUG B;  2JTV A;  4NUB A;  2VBZ A;  4MIM A;  3ZQL A;  2DT5 A;  4AM3 A;  2L4M A;  4L5J A;  4H4K C;  3BG5 A;  3TDZ C;  2WY8 Q;  1VQM I;  3TO9 A;  1R1V A;  3M07 A;  2H1L A;  5FLM J;  1G6N A;  3CMA I;  4CCM A;  1G59 A;  4IRG A;  2Z33 A;  1IRX A;  2Q0O A;  1F43 A;  5BS6 A;  3FBI B;  5E8G A;  1MJ9 A;  3R61 A;  1UJ8 A;  5IT9 K;  2D1H A;  3GUD A;  2Y75 A;  5K5R A;  4IZZ A;  1S7A A;  2L7F P;  1MBG A;  4WF2 A;  4UUS B;  1FX7 A;  2EPF A;  3W3C A;  2XSD C;  2Z1D A;  2DLL A;  4MTD A;  3W6K B;  2W57 A;  1FP1 D;  3D5S C;  3KP3 A;  3KFW X;  3I56 I;  5J1R A;  4G12 A;  3IAS 2;  1U8R A;  2KZV A;  3BTJ A;  2JVH A;  1TT5 B;  1IC8 A;  2G7U A;  4XOP A;  3GW2 A;  1MBK A;  1K79 A;  3N97 A;  2EZL A;  3LST A;  4IQ4 A;  4CCO A;  2QBY A;  3BR3 A;  1J7K A;  2QM3 A;  1R71 A;  1BC7 C;  1DU0 A;  1FBQ A;  3D1N I;  4L5E A;  4Z2Y A;  2OTL I;  1Z91 A;  3IKV A;  4PUS A;  1T08 B;  3A2K A;  2E34 A;  2VKH A;  4RGU A;  4IOA F;  5EF6 A;  2F5D A;  3G6E I;  4ZZD A;  2COB A;  2Z3Y A;  2HZT A;  4R8H A;  5DD8 A;  1FEX A;  1I39 A;  3MKL A;  4HF1 A;  1WVR A;  3IH4 A;  3HPH A;  2B7E A;  3ZQH A;  4MNU A;  4UVA A;  1T7D A;  1BR4 A;  2V1X A;  3QPT A;  2E71 A;  4B43 A;  3HRU A;  3S1N J;  2EIL H;  2NNY A;  1ODD A;  1QVT A;  4MTE A;  3CD6 I;  1FBU A;  5DYM A;  2JRM A;  1K78 B;  3SZP A;  2LKS A;  4I99 C;  1W7P D;  2BEO A;  4P5O A;  4FIS A;  4HYE A;  2KL4 A;  4I98 B;  2VKE A;  2BOL A;  1X19 A;  1RZ4 A;  5D6F A;  1E3P A;  1Z6R A;  3TMO A;  2CW7 A;  2V26 A;  2P6T A;  1YJW I;  1FOW A;  2HR3 A;  2DPD A;  2DA3 A;  2E60 A;  3JRI A;  2PI0 A;  3F8M A;  4B4C A;  3WOD F;  1H9G A;  4HDV A;  4NC6 A;  2VQC A;  4IHY A;  1XSV A;  2CYY A;  1BI3 A;  2DMN A;  1K61 A;  2K40 A;  1XMK A;  4KJZ A;  2DA6 A;  3EUK L;  3K2Z A;  2XB0 X;  5E8I A;  4RGR A;  3LA2 A;  1W7P A;  2KDO A;  3TOA A;  2K3P A;  5EEG A;  1REP C;  3V42 A;  4EAT A;  1OCP A;  2PJR B;  1SFO J;  4KDP A;  1X58 A;  2DA7 A;  4LG0 A;  1BL0 A;  3E97 A;  1SVO A;  2G7H A;  2DN0 A;  2CG4 A;  1DU6 A;  5CVI A;  2O8K A;  5C3E J;  3ZXS A;  3SEQ A;  5BNG A;  5F08 A;  2PMZ N;  1KA8 A;  3IHU A;  4YRV A;  3DKW A;  1BJA A;  1BIA A;  2DMU A;  4EGZ A;  3IC7 A;  1EH8 A;  3JAM Z;  1NHA A;  2IP2 A;  3KEY A;  2BVM A;  4KT5 C;  1ACI A;  3WTY C;  1F9N A;  2ELJ A;  2NS7 A;  3C18 A;  4HV5 A;  1MMD A;  1ZKG A;  1D1B A;  2QQB A;  3DV8 A;  3NAR A;  5CVJ A;  3HHG A;  5GPA A;  3NQO A;  4ZYG A;  1JUP A;  4WXD A;  1XGN A;  5LEK A;  1Y1V J;  5J6X A;  4YIR X;  2P81 A;  5BMZ A;  4BS9 A;  4YEJ A;  3G1L A;  4G6Q A;  3CUQ A;  4NB5 A;  2E1M C;  3RZD J;  4N0B A;  3MEX A;  2Y48 A;  4DYQ A;  3BR6 A;  3EUH C;  2ZJP F;  5HVQ C;  3K7A J;  1SMY F;  5KK1 A;  4UXN A;  3X2Q H;  2ID6 A;  2IXS A;  2KJB A;  4EJW A;  3AL0 C;  3OSF A;  4B3A A;  2F5V A;  3H9G A;  2DFH A;  4HQM A;  4XIC A;  3FDY A;  4QWQ A;  4G7H F;  3DU6 A;  4I09 A;  2I8D A;  1SFE A;  3MAJ A;  4EQQ A;  4XON A;  3WTU C;  3T5X A;  2WB1 N;  5IP7 J;  2XAQ A;  3FZV A;  2ECB A;  3O6B B;  5CPR B;  4UUT A;  1XS9 A;  1VF9 A;  4U0V A;  2L4A A;  2VAS A;  1LDJ A;  3BQY A;  2VC1 A;  3PNT A;  2LOO A;  2IGK A;  2X48 A;  5KAF C;  1T8I A;  2IGN A;  3K1P A;  2HWV A;  3IRR A;  2WC2 A;  5F1J A;  2XV4 S;  2ECC A;  2MH2 A;  2V1D A;  3BY6 A;  1SAX A;  3BJA A;  1RES A;  5HDK A;  2DJN A;  1YJN I;  4Y7N J;  2E36 A;  2XAJ A;  1UFM A;  4F52 A;  3MZH A;  2E7X A;  2XGX A;  3CZ6 A;  2F4O B;  1UMQ A;  3W6J B;  2O5R A;  2NXN B;  4GYI A;  4B09 A;  2LFB A;  1Z6T A;  4ME8 A;  4MEY F;  3H3V K;  1JHC A;  4HOB A;  3TW6 A;  2MD0 A;  3BTL A;  4UV9 A;  4N4N B;  4CCN A;  2NS0 A;  4BQN A;  1ZAO A;  1ORK A;  4V2G A;  1FTT A;  4RAY A;  3AL0 B;  3RSN A;  2WV1 A;  1R5H A;  1PUF B;  3RJP A;  2WAF A;  3JCU C;  5D5V B;  4HPQ A;  3SFI A;  5JFR A;  1JKR C;  1HW5 A;  4HA8 A;  3AKZ A;  3RPQ A;  3T0Y A;  3JW4 A;  1Z21 A;  2LBF B;  2ISY A;  1UZC A;  2X6X A;  2XGC A;  1YRN A;  3SYT A;  4U7D A;  2DT7 B;  4B1R A;  3GX4 X;  4D1Q A;  3CO7 C;  2NRA C;  2HXO A;  1CF7 B;  3P7N A;  4CYC B;  3F8B A;  2HOE A;  3F8C A;  2CUE A;  3CP8 A;  1HBX G;  1F5T A;  3ZMT A;  3T1B A;  2R7W A;  1V54 H;  3HXL A;  3ZQI A;  3J81 Z;  4M3D A;  3G71 I;  2JA6 J;  4BH9 A;  1V5F A;  4IHV A;  3CO6 C;  4OMY A;  2DU9 A;  3OYD A;  3A1Y A;  3HGG A;  2L02 A;  3ML6 A;  4E6K G;  1YIO A;  4JK1 X;  4CZZ A;  3PIO F;  1POG A;  2WAQ A;  1WSU A;  2FXA A;  3OR2 C;  3GTM J;  2OBP A;  4XQF A;  2E1C A;  1IF1 A;  2LR8 A;  4M74 A;  3K4J A;  1VQP I;  1U8B A;  4IRH A;  5BQT A;  1MMN A;  1MKM A;  3G1O A;  2R5Z B;  2EIK H;  3BQZ A;  1OYY A;  5JLW A;  1O3R A;  4O6J A;  4P55 A;  4BY7 J;  3T8R A;  5FJ8 J;  1XDS A;  4JOM A;  3CCJ I;  2EV6 A;  5LEJ A;  1YO5 C;  2I10 A;  4NBQ A;  5HS9 A;  4BEH B;  4HF2 A;  2W1O A;  4A3E J;  3RKQ A;  3DF8 A;  4E7L A;  2MD5 A;  2H27 A;  2K9M A;  3RCO A;  3FWE A;  5B66 C;  3Q0V A;  3C7J A;  4RA2 A;  3S3O A;  2DOE A;  4C2U A;  3K4M A;  3IP4 B;  3CMY A;  2KZG A;  1W7P B;  2PMU A;  4L9N A;  2LVS A;  1H8A C;  2JQ7 A;  3OL4 A;  2CU7 A;  2LTP A;  1UHW A;  1AKH A;  3H9Q A;  1JKQ C;  1JXS A;  2STW A;  3KE2 A;  2KIS A;  1WJE A;  4HW0 A;  3A01 B;  2FX0 A;  2DCE A;  2HOT A;  4IX7 A;  3HOV J;  1T39 A;  1XSD A;  2NVT J;  1YOV B;  2ZC2 A;  3H3U A;  5D5W B;  1K4S A;  1IN4 A;  3ZQF A;  1JGS A;  2JMW A;  2XPV A;  3NRV A;  1LVK A;  4NDL A;  4D0P A;  4LB6 B;  2CWE A;  3PUF A;  4I2O A;  2LK2 A;  2VE8 A;  1AHD P;  1TWC J;  4BXX J;  2CQQ A;  3K70 C;  2M4K A;  1AA7 A;  2HEO A;  4TV7 A;  3QPL A;  3WTS C;  2EH3 A;  3GTO J;  3BTC A;  2KKO A;  4BYY A;  4E7K A;  4B8X A;  4O5V A;  1R58 A;  2DA4 A;  2FA5 A;  1A36 A;  2CUF A;  2DYR H;  4JX4 A;  4XM3 A;  4YII A;  2E7W A;  1BW5 A;  3MCZ A;  4RAG A;  4XBF A;  3J81 K;  2MC3 A;  4LIT A;  2JA5 J;  1MJB A;  5HLG A;  1TWG J;  3F9K A;  3V8L A;  2LY9 A;  5IYC J;  3GFI A;  4V2F A;  3JRG A;  5BOX A;  3SXY A;  1RPW A;  2KP6 A;  4BE1 A;  4FHT A;  4CYC A;  2EA4 A;  2PMZ A;  1YS7 A;  1MSF C;  3QWL A;  3Q9S A;  1ETW A;  2LYC A;  3UR3 C;  4RM3 A;  2MC4 A;  2LLK A;  1P92 A;  1RI7 A;  4OMZ A;  1YIJ I;  2P7C B;  3VOE A;  4DOZ A;  3SJM A;  2CUZ A;  2MGQ A;  1XPX A;  3CME I;  2R4G A;  2ELK A;  3ABL H;  1XCB A;  3HM5 A;  3OYK A;  1P7J A;  1GVD A;  2FD5 A;  4ZZL A;  2MH9 A;  2R7S A;  3J80 Z;  3CUQ C;  5EYR A;  4N31 A;  4A93 J;  1XCV A;  2JSP A;  1QO0 D;  1VQ7 I;  4F92 B;  5F64 A;  5GAE J;  1QHG A;  1ZLJ A;  1TNT A;  3CC2 I;  3EUH A;  3HTU A;  5LGN A;  2VBY A;  1FOY A;  1U5T A;  2IW5 A;  3LQR A;  4CHU A;  5K7F A;  2QF7 A;  3GO5 A;  1B4A A;  2E1O A;  1WRJ A;  4RB0 A;  4RAZ A;  1KZH A;  3Q0W A;  5EG0 A;  3ECO A;  4CH7 A;  1ZH5 A;  4AYB N;  4U87 A;  3CCE I;  2O9L A;  5E3O A;  3KX2 A;  1LFP A;  2ZNZ A;  1GV5 A;  2AQF A;  2K86 A;  4IRI A;  5CJ9 A;  3GLX A;  1D5V A;  3ZN1 A;  2IA0 A;  1D5Y A;  3HOW J;  4J00 A;  3O2P E;  2EIM H;  4B47 A;  1SD5 A;  1TP4 A;  4KA4 A;  2A68 F;  1FSE A;  2XRN A;  1YW8 A;  4RLQ A;  2VOP A;  1WGX A;  4QSH A;  3WHB A;  2GZW A;  1KYW A;  4ZDP A;  3I53 A;  1T95 A;  2B9S A;  4BDY A;  3CJT B;  1EH6 A;  3ERE D;  5BPI A;  2CV0 A;  2O7O A;  2ZME B;  4XOT A;  1OCR H;  4DZJ A;  5EJC A;  2DO7 A;  4BQO A;  3CLQ A;  2OU2 A;  3ZGK A;  2Y0M A;  1GLN A;  2KLO A;  1UEL B;  2MYS A;  5K1Y A;  1H0M A;  2CQK A;  1FPQ A;  3FIW A;  1Q1H A;  4ETS A;  2LY1 A;  1R4N B;  1J59 A;  1F1Z A;  1V55 H;  1S7O A; 
#chains in the Genus database with same CATH homology
 2DFI A;  5JHU A;  3V7R A;  4IF4 A;  5ILU A;  3F6V A;  3SZT A;  1HKS A;  2DBB A;  2JPB A;  3E3V A;  1PP7 U;  3I5U A;  1O3S A;  4YFN F;  5ILS A;  5K5Q A;  3DPL C;  2RKH A;  2FE3 A;  3RYR A;  3WE3 A;  3KET A;  2ZCW A;  4LK0 F;  1D8K A;  2KIM A;  4HV6 A;  1QZY A;  2PLY A;  3TGN A;  4L18 B;  3KP5 A;  4IJA A;  2P4W A;  2PFB A;  1YG2 A;  1BI2 A;  1UB9 A;  3DPT A;  2XKO A;  4LLN A;  2VBX A;  1B9M A;  4LG0 B;  4UHT A;  5BPD A;  3ZN0 A;  1U78 A;  3FX3 A;  2FBK A;  3L09 A;  3FF5 A;  4WWC A;  3LA3 A;  1BBY A;  4Y15 A;  4LJZ F;  1STZ A;  4HBL A;  3FXQ A;  2COM A;  2QZ8 A;  4CIC A;  4A0X A;  3RI4 A;  3FXR A;  1XGS A;  2HGC A;  2V1U A;  2JRT A;  4UVC A;  4ESB A;  1L0O C;  2R3S A;  5AIP A;  2DK5 A;  1KQ8 A;  3WGG A;  2OQR A;  1YW9 A;  2CSO A;  3HOS A;  2ZME A;  2PG4 A;  2BBY A;  2K4B A;  2DQR A;  5ICC A;  1GXQ A;  1SFU A;  5ICG A;  1C0W A;  3E6B A;  2W85 A;  3JTG A;  4A0Y A;  4Q4Z F;  2P5K A;  4YIF A;  4KIF A;  3I0T A;  1FNN A;  1IW7 F;  2O0Y A;  4S05 A;  2PJP A;  4DQ2 A;  3MWM A;  2RVC A;  4U88 A;  2HNF A;  1T38 A;  1YS6 A;  4EV0 A;  5E18 F;  3HSE A;  5E1Z B;  2EFP A;  5JVT A;  5HS8 A;  1G3Y A;  2FML A;  1HKT A;  3KEQ A;  4RGX A;  4NV4 A;  1KU3 A;  2VON A;  2HQR A;  1YW7 A;  1XB4 A;  4KN7 X;  4I0B A;  4M6Y A;  2ACJ A;  5L3F A;  5KVR A;  1CF7 A;  2X0L A;  1WQ2 A;  2LF8 A;  1P6R A;  5TJJ A;  2V9V A;  4HX8 A;  1TLH B;  2ESH A;  3KZY A;  5LRS A;  1DPR A;  2QQ9 A;  2K7L A;  2A69 F;  3PQJ A;  3M8E A;  4PGH A;  3WTV C;  2QYO A;  4A2U A;  5A2Q Z;  2M87 A;  3DQV C;  4FT8 A;  3CUO A;  4OIO F;  5L3C A;  4GXO A;  3WTW C;  1DDN A;  2XAH A;  3C1D A;  4NQW A;  3WG9 A;  1WKM A;  2QLZ A;  4KN4 X;  3LAJ A;  5FFZ A;  3V7C A;  1R1T A;  2IVM A;  5D5U B;  3F8F A;  1FZP B;  1P4X A;  4AWX B;  4K2E A;  2IT0 A;  4RGS A;  1B59 A;  4Y17 A;  2OZU A;  1DP7 P;  1G3T A;  3E5X A;  1MDM A;  2FJR A;  3N4M A;  2OAZ A;  1R00 A;  4G7O F;  1Z05 A;  3ISP A;  5AON A;  1FP2 A;  3EYI A;  2G9W A;  2BE5 F;  2ZO4 A;  1BN5 A;  1D8J A;  3I58 A;  4MGR A;  1HST A;  2FOK A;  4M9S A;  3GEZ A;  3ZMS A;  4P9U A;  2JZY A;  2MLK A;  1O57 A;  4MEX F;  1LB2 A;  4WXC A;  1UST A;  2XUB A;  4GGG A;  2VE9 A;  4HX4 A;  1LDD A;  2FEZ A;  5CVV A;  3KEO A;  2VT3 A;  3RTR A;  3HRM A;  4LMY A;  2HTS A;  2M45 A;  2GAU A;  2X4H A;  2EWN A;  3EYY A;  3VOD A;  5EEH A;  3IRQ A;  2HFH A;  4HF0 A;  2NNN A;  1BOA A;  5E1W A;  4XLP F;  1I1G A;  2EB7 A;  4WX9 A;  1EH7 A;  5ED4 A;  2DTR A;  2LDU A;  4L0Y B;  2FF4 A;  4N9I A;  3TKY A;  1W5T A;  3QRF F;  2EFW A;  2WWY A;  5HDN A;  2XAG A;  3LAP A;  2HS5 A;  3EET A;  2YSR A;  5E17 F;  3K0L A;  1QZZ A;  2ADU A;  1LEA A;  1J75 A;  1P4W A;  4LGW A;  3WU0 A;  4ENJ A;  5LHG A;  4MQV A;  5L3B A;  3JSP A;  1ZRE A;  2H6B A;  4I02 A;  1T6S A;  4UUV A;  4K8W A;  4EJU A;  2EV0 A;  3R4K A;  1J5Y A;  4GYG A;  3HRS A;  2PEX A;  1KCA A;  2PQ8 A;  3G3Z A;  2L3D A;  1HW1 A;  1L3L A;  4L9V A;  1TW3 A;  4CYD A;  1IXC A;  1RUO A;  4XSZ F;  4AVP A;  1TQI A;  2K27 A;  2CGP A;  3J7A O;  2F2E A;  3S2W A;  2O8X A;  4GCV A;  5CVU A;  2UXN A;  3ULQ B;  3E6C C;  1ZLK A;  5FD6 A;  3FM5 A;  4Q47 A;  2EK5 A;  3LFK A;  4ASN A;  3R0J A;  3T8T A;  3LWF A;  3D0S A;  4G9Y A;  4G6D A;  3ZMU A;  4IVN A;  1FWZ A;  2WV0 A;  4F7Z A;  1KU2 A;  3M9A A;  1OPC A;  1LQ1 A;  2CFX A;  2PMH A;  1T98 A;  3KZZ A;  1J0R A;  3Q9V A;  4WXH A;  3ZMV A;  3CLO A;  1OMI A;  3IWZ A;  5E20 A;  2FRH A;  3GFL A;  2YR2 A;  4OIN F;  1HSJ A;  2QBY B;  3I4P A;  4G94 A;  2STT A;  1GVJ A;  1ZN2 A;  3RKX A;  1OR7 A;  2ZBK A;  4EJV A;  1U3E M;  3K1M A;  2M5W A;  3AAF A;  1FBS A;  1OYW A;  4WCG A;  1YFH A;  2FNA A;  1TQP A;  3CDH A;  2XKP A;  1U5T C;  4RB3 C;  4LB5 A;  2CO5 A;  5DEQ A;  3HRT A;  5LHI A;  3HIF A;  3IIQ A;  1V3F A;  2Z5U A;  3E5U A;  2GA2 A;  1UCR A;  1K78 A;  2HQN A;  5HOO A;  1FY7 A;  1KGS A;  3HSF A;  2RV8 A;  1ZG1 A;  1ON1 A;  2RN7 A;  3KCC A;  1F4K A;  1LDK B;  1WI9 A;  4EM1 A;  3FXU A;  2TDX A;  1IAW A;  2YX7 A;  4ENN A;  3WTZ A;  3ZP5 A;  2H6C A;  2RQP A;  2GXG A;  1OYI A;  3ZPL A;  2K4J A;  1XMA A;  2R7F A;  3HYI A;  1VTN C;  1TNS A;  1BI1 A;  3KP6 A;  1SMT A;  2RDP A;  3U2R A;  3V8J A;  2RGV A;  3WU1 B;  4L0Z B;  3FMS A;  4PGG A;  3HOT A;  4XRF A;  2LKP A;  3I71 A;  1GHC A;  3WTT C;  2P6S A;  1U5T B;  1KU9 A;  4Q5S F;  3TQN A;  3QPH A;  1JHE A;  5F6F A;  1RUN A;  4OIQ F;  1U2W A;  1BI0 A;  4KNY A;  3VEP A;  2FQ3 A;  4Y13 A;  5H20 A;  1IZ1 A;  5DCF A;  5D6E A;  1AWC A;  5D5X B;  2M30 A;  1TTY A;  1KYZ A;  3RPU A;  1U6G A;  4HAM A;  4RB2 C;  4L5I A;  3E6D A;  1ZYR F;  2FNP A;  4OU0 A;  4ZYH A;  2DQL A;  3OOP A;  1SD6 A;  2KRF A;  2A61 A;  1I1S A;  3BP8 A;  2FU4 A;  1JHH A;  2IJL A;  3JTH A;  4H0E A;  2Q8K A;  4IHS A;  1AOY A;  3I59 A;  3GYH X;  3R0A A;  3GFJ A;  3F72 A;  1LJ9 A;  1XGO A;  5FO5 A;  5D4R A;  5LBQ A;  5DV5 A;  3BJ6 A;  4P9F A;  1JHF A;  2V6C A;  3MZY A;  4EM0 B;  4BHC A;  4HDU A;  1OKR A;  4DNC A;  3RKY A;  1O7F A;  2K02 A;  1ZG5 A;  3F21 A;  1RIO H;  2W24 A;  5D4S A;  2FBI A;  3TOB A;  2IA1 A;  1QPM A;  1A04 A;  3EQL F;  1IRG A;  3TO7 A;  3ABT A;  1ZHF A;  1YYV A;  2J5P A;  1PDN C;  4L9T A;  4P96 A;  2PBI A;  3WE2 A;  1QQI A;  2P8T A;  1W5S A;  4QLC U;  1LEB A;  1D3Y A;  2Q2E A;  1G4D A;  4BNC A;  4HZF A;  4PDK A;  2NAZ A;  4YFX F;  1IRF A;  2QQA A;  2LF7 A;  5ICF A;  4U7B A;  4I0A A;  4BHP A;  3RKW A;  3F23 A;  3J80 K;  2EFN A;  4IXA A;  1XN7 A;  2A6H F;  4I7H A;  5LHH A;  3V4G A;  1B9N A;  1EV7 A;  2BV6 A;  2P7V B;  2MLG A;  2ELH A;  4FX0 A;  2O6G E;  1FYK A;  1Z9C A;  1IUY A;  1GXP A;  2IPQ X;  1T2K A;  2GA1 A;  2KIU A;  2KIF A;  1B12 A;  2BYV E;  4GO1 A;  3BRO A;  2DW4 A;  4OOI A;  3QU6 A;  4YG2 F;  3GFM A;  3QOP A;  2MBF A;  2XHK A;  4IPA A;  1ZG3 A;  2XRO A;  5ILV A;  4PZJ A;  3I54 A;  2QWW A;  2ZXJ A;  5LLQ A;  3K9T A;  3E5Q A;  4U0W A;  5DCM A;  4O3M A;  1R1U A;  3FM3 A;  3FHZ A;  3L2C A;  2H09 A;  3G73 A;  3E6M A;  4FX4 A;  3BPX A;  3ELK A;  4KYW A;  1LNW A;  3DFG A;  3HTS B;  2RC4 A;  5FLX Z;  1Z7U A;  1MZB A;  4WK8 F;  1IXR C;  2UXX A;  2MA3 A;  3I59 B;  2HO0 A;  5ERI A;  2EFO A;  1XDU A;  2W84 A;  2FMY A;  1FYM A;  1ZRC A;  4A12 A;  4EM2 A;  5HS7 A;  2DK8 A;  1USS A;  2VN2 A;  2V79 A;  1QBJ A;  3KLN A;  2VBW A;  2O3F A;  3VFZ A;  3M8F A;  4M6X A;  3BWG A;  3RIR A;  3BZ6 A;  4CDG A;  1IN7 A;  3COA C;  4EMS A;  4MHG A;  2L01 A;  2CW0 F;  3GZ5 A;  2A6E F;  2YX4 A;  1Y0U A;  4KMF A;  4R79 A;  3KLO A;  4KFC A;  2ZKZ A;  2VC0 A;  4HLY A;  5H6R A;  4A6E A;  3BPV A;  2JPC A;  2HYF A;  1TW2 A;  5IT9 Z;  1SD7 A;  5J8F A;  2F5C A;  3RDI A;  1ZAR A;  2JT1 A;  5L3E A;  3P9K A;  2DI3 A;  2GQQ A;  1O3Q A;  2EFQ A;  1WWX A;  1PP8 F;  2W25 A;  5CVR A;  3CUQ B;  4ESF A;  4KIG A;  4RB1 A;  1IN6 A;  3BDD A;  4ZH4 F;  4ZYD A;  1S3J A;  3KP7 A;  1FT9 A;  3IL2 A;  4MQ9 F;  3TO6 A;  4ENM A;  1QGP A;  3HHH A;  3QAH A;  3VB2 A;  3KP4 A;  2HKX A;  1R22 A;  4EVI A;  5FB2 A;  1ZRD A;  1JE8 A;  1FC3 A;  5CLS A;  1DPU A;  2F5F A;  2GIV A;  1XSX A;  1IXS B;  3ZQ7 A;  4AIK A;  1FOK A;  2LNB A;  3IWF A;  4CO8 A;  5DDG A;  3EDP A;  4M72 A;  4UV8 A;  4HX7 A;  3P9I A;  5FD5 A;  4JBA A;  4G8X A;  3H3Z A;  3I64 A;  2Z99 A;  4HQE A;  1ON2 A;  4XSX F;  4EJT A;  1ZGA A;  3GZ6 A;  5FFX A;  3BOQ A;  1DUX C;  2F5E A;  2GXB A;  3WGH A;  4E70 A;  2ZJ2 A;  3S04 A;  2RNJ A;  3ECH A;  3ROU A;  2O61 A;  3P9C A;  4AIH A;  2AS5 F;  1XGM A;  1XD7 A;  2QEN A;  3O3K A;  4L9J A;  4XLN F;  2D2W A;  3PQK A;  4BHB A;  1ONV A;  1CGP A;  2XVC A;  2E1N A;  3RYP A;  1O7L A;  1W4M A;  2O03 A;  4LFU A;  2XAS A;  4M71 A;  4EGY A;  3R60 A;  2GWR A;  4I01 A;  2BGC A;  4PCQ A;  3L7W A;  4UNO A;  2P5V A;  1R36 A;  3LA7 A;  1FLI A;  4A0Z A;  2XIG A;  5J8C A;  1R7J A;  1J9I A;  3MFK A;  3ZMZ A;  1MDM B;  4KIB A;  4ON0 A;  1QNT A;  2OD5 A;  4ZYE A;  2B0L A;  2M1B A;  3D5L A;  3GVA A;  3MQ0 A;  3H92 A;  3CTA A;  1O3T A;  1TBX A;  2YPR A;  4M9Z A;  2KJC A;  4A5N A;  5JI6 A;  2LSO A;  2A07 F;  1E17 A;  3ZMD A;  3K69 A;  2FBH A;  2YU3 A;  3Q5F A;  2M8E A;  3JAM K;  5L3D A;  2D45 A;  2D1V A;  3ABU A;  4CXF A;  3WTX C;  2OQG A;  1ZRF A;  3BDN A;  2H94 A;  3KP2 A;  2FSW A;  3QP5 A;  5CYV A;  5DUI A;  3IKT A;  2VOO A;  3QU3 A;  2OA4 A;  4U0Y A;  4OIP F;  2NYX A;  2QVO A;  2IRF G;  2P5L C;  4BXU A;  5LGU A;  1E2X A;  3R6S A;  5LGT A;  4AD9 A;  5A2Q K;  5TRD A;  3CJN A;  3C3W A;  3F6O A;  3B73 A;  3L00 A;  1HW2 A;  2ESN A;  1IN8 A;  1UHM A;  3V8K A;  4M73 A;  4ENK A;  2JSC A;  2VXZ A;  1IN5 A;  1BM9 A;  1KU7 A;  3NEU A;  1G3W A;  1P2F A;  5L3G A;  4KIC A;  3DEU A;  5HLH A;  5DD4 A;  1I27 A;  5DCM B;  5F1R A;  4KUM A;  3F22 A;  3GXO A;  4HLX A;  4LLL A;  2QUF A;  1SFX A;  4UVB A;  1BC8 C;  1ULY A;  1LVA A;  1B1B A;  3WGI A;  4EJO A;  5JR3 A;  1YLF A;  1ZGJ A;  2C6Y A;  4ESJ A;  1Z1D A;  2EV5 A;  3PFI A;  3FMQ A;  1R23 A;  1SD4 A;  2UWM A;  5H6Q A;  3QP6 A;  4LK1 F;  1YTY A;  3L9F A;  4A5M A;  5K5O A;  1FYL A;  3REO A;  4AIJ A;  1G3S A;  1I5Z A;  2EA2 A;  1I4V A;  3V7S A;  1B6A A;  1T0F A;  4S04 A;  2FKD A;  3FMR A;  4BQA A;  4CGZ A;  3LQQ A;  6PAX A;  3BJO A;  4RS8 A;  2ZFW A;  1H9T A;  2ZNY A;  1S29 A;  3TDU C;  1RNL A;  2A3S A;  1MD0 A;  2PN6 A;  3GWZ A;  5FLX K;  3SQN A;  5DUK A;  3U9G A;  4BAY A;  4G7Z F;  2A5Y B;  4LD5 A;  1K6O A;  1YQA A;  3OV8 A;  1UMU A;  4JQF A;  4KMU X;  3F8N A;  1TQM A;  2AXL A;  4M9X A;  3K1N A;  4A6D A;  5FGM A;  3SHF A;  2Z9O A;  5D8K B;  4NHJ A;  3DP7 A;  2HKO A;  3B02 A;  4R1H A;  3HSR A;  2DPU A;  5AIQ A;  4N9H A;  2HTJ A;  1V4R A;  5HLI A;  3U1D A;  3M7G A;  2DAO A;  3DXJ F;  5E1X A;  3HUG A;  2HYG D;  2UZK A;  3JSO A;  1HKQ A;  2ISZ A;  1MJA A;  1KN9 A;  1R5G A;  1P4A A;  2EJR A;  1FSH A;  1S8N A;  5D8L B;  2HDC A;  1F39 A;  3M1E A;  4LLG F;  2R7D A;  5ICE A;  2WTE A;  4OIR F;  3SFZ A;  5IT3 A;  4IHT A;  5LRR A;  1AY9 A;  1PUE E;  2OZ6 A;  1I6X A;  1BIB A;  1KQ0 A;  1KQ9 A;  1HQC A;  2VT2 A;  2J5O A;  1J2X A;  2ETH A;  1HXD A;  1MGT A;  3GF2 A;  2XAF A;  1S6L A;  4Q48 A;  2VOD A;  3F3X A;  5HDG A;  2L54 A;  1K7A A;  2IA2 A;  1X3U A;  4YFK F;  2JTV A;  2VBZ A;  2DT5 A;  2L4M A;  4L5J A;  3TDZ C;  3TO9 A;  1R1V A;  1G6N A;  4IRG A;  2Z33 A;  2Q0O A;  5BS6 A;  5E8G A;  1MJ9 A;  3R61 A;  5IT9 K;  2D1H A;  3GUD A;  5K5R A;  2Y75 A;  1S7A A;  4WF2 A;  1FX7 A;  2DLL A;  4MTD A;  3W6K B;  2W57 A;  1FP1 D;  3KP3 A;  3KFW X;  1U8R A;  2G7U A;  3GW2 A;  1K79 A;  3N97 A;  3LST A;  2QBY A;  1J7K A;  2QM3 A;  1BC7 C;  1FBQ A;  4Z2Y A;  1Z91 A;  3IKV A;  4RGU A;  2F5D A;  4ZZD A;  2Z3Y A;  2HZT A;  4R8H A;  5DD8 A;  4HF1 A;  4MNU A;  4UVA A;  1T7D A;  2V1X A;  3QPT A;  3HRU A;  2NNY A;  1ODD A;  4MTE A;  1FBU A;  5DYM A;  1K78 B;  3SZP A;  1W7P D;  2BEO A;  4P5O A;  4HYE A;  4I98 B;  1RZ4 A;  5D6F A;  1Z6R A;  2P6T A;  2HR3 A;  2DPD A;  2PI0 A;  3F8M A;  3WOD F;  1H9G A;  4HDV A;  1XSV A;  2CYY A;  1BI3 A;  1XMK A;  3K2Z A;  5E8I A;  4RGR A;  3LA2 A;  1W7P A;  3TOA A;  5EEG A;  1REP C;  4KDP A;  4LG0 A;  3E97 A;  2G7H A;  2CG4 A;  5CVI A;  1KA8 A;  3IHU A;  3DKW A;  1BJA A;  1BIA A;  4EGZ A;  3IC7 A;  1EH8 A;  3JAM Z;  1NHA A;  2IP2 A;  4KT5 C;  3WTY C;  1F9N A;  4HV5 A;  3C18 A;  3DV8 A;  2QQB A;  5CVJ A;  3HHG A;  3NQO A;  4ZYG A;  4WXD A;  1XGN A;  5LEK A;  5J6X A;  5BMZ A;  4G6Q A;  3CUQ A;  4NB5 A;  4N0B A;  3MEX A;  2Y48 A;  5HVQ C;  1SMY F;  5KK1 A;  4UXN A;  4EJW A;  2KJB A;  4HQM A;  4QWQ A;  4G7H F;  4I09 A;  1SFE A;  3MAJ A;  4EQQ A;  3WTU C;  3T5X A;  2XAQ A;  3FZV A;  3O6B B;  4U0V A;  2L4A A;  1LDJ A;  2VC1 A;  3K1P A;  2HWV A;  3IRR A;  2WC2 A;  2XV4 S;  2V1D A;  2MH2 A;  3BY6 A;  1SAX A;  3BJA A;  5HDK A;  2XAJ A;  1UFM A;  3MZH A;  2E7X A;  2XGX A;  3W6J B;  4GYI A;  4B09 A;  1Z6T A;  4ME8 A;  4MEY F;  1JHC A;  4HOB A;  4UV9 A;  2NS0 A;  1ZAO A;  4RAY A;  1R5H A;  3RJP A;  5D5V B;  5JFR A;  1HW5 A;  4HA8 A;  3RPQ A;  3T0Y A;  3JW4 A;  2ISY A;  4U7D A;  3GX4 X;  3CO7 C;  2NRA C;  1CF7 B;  3P7N A;  3F8B A;  2HOE A;  3F8C A;  1F5T A;  1HBX G;  3ZMT A;  3T1B A;  3J81 Z;  4BH9 A;  3CO6 C;  4OMY A;  2DU9 A;  2L02 A;  3ML6 A;  1YIO A;  4JK1 X;  4CZZ A;  1WSU A;  2FXA A;  2OBP A;  2E1C A;  1IF1 A;  4M74 A;  4IRH A;  5BQT A;  1MKM A;  1OYY A;  1O3R A;  4O6J A;  4P55 A;  3T8R A;  1XDS A;  2EV6 A;  5LEJ A;  1YO5 C;  5HS9 A;  4HF2 A;  3DF8 A;  2MD5 A;  2H27 A;  3FWE A;  3C7J A;  1W7P B;  2PMU A;  4L9N A;  1UHW A;  1JXS A;  2STW A;  3KE2 A;  4HW0 A;  1T39 A;  1XSD A;  3H3U A;  5D5W B;  1IN4 A;  1JGS A;  3NRV A;  4D0P A;  4LB6 B;  2CWE A;  4I2O A;  2VE8 A;  2HEO A;  4TV7 A;  3WTS C;  2KKO A;  4BYY A;  4B8X A;  4O5V A;  1R58 A;  2FA5 A;  4YII A;  2E7W A;  3MCZ A;  4XBF A;  3J81 K;  2MC3 A;  1MJB A;  5HLG A;  3V8L A;  3GFI A;  5BOX A;  3SXY A;  4FHT A;  2EA4 A;  1YS7 A;  3Q9S A;  1P92 A;  1RI7 A;  4OMZ A;  2P7C B;  3VOE A;  1XCB A;  4ZZL A;  2MH9 A;  3J80 Z;  3CUQ C;  4N31 A;  1XCV A;  1QO0 D;  5F64 A;  1ZLJ A;  1TNT A;  5LGN A;  3EUH A;  3HTU A;  2VBY A;  1U5T A;  2IW5 A;  3LQR A;  4CHU A;  3GO5 A;  1B4A A;  1WRJ A;  4RB0 A;  4RAZ A;  3ECO A;  1ZH5 A;  2ZNZ A;  2K86 A;  4IRI A;  5CJ9 A;  3GLX A;  1D5V A;  3ZN1 A;  2IA0 A;  3O2P E;  1SD5 A;  4KA4 A;  2A68 F;  1FSE A;  1YW8 A;  2XRN A;  2VOP A;  2GZW A;  1KYW A;  3I53 A;  1EH6 A;  3ERE D;  5BPI A;  2ZME B;  2DO7 A;  2OU2 A;  2Y0M A;  5K1Y A;  1H0M A;  2CQK A;  1FPQ A;  4ETS A;  1Q1H A;  1J59 A;  1F1Z A;  1S7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...