1JHLL

Three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
DIELTQSPSYLVASPGETITINCRASKSISKSLAWYQEKPGKTNNLLIYSGSTLQSGIPSRFSGSGSGTDFTLTISSLEPEDFAMYICQQHNEYPWTFGGGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA D11.15 FV (LIGHT CHAIN)
publication title Three-dimensional structure of a heteroclitic antigen-antibody cross-reaction complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex(antibody-antigen)
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 1993-05-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jhlL00
4YR6A 3OXSA 3TZVC 3QXDA 1BZ7A 1QSFB 4GSDL 3NH7H 1L0QA 1BQHB 2AKRB 4X8XA 2BXYA 4U7MA 1IL1B 5I19L 2QHLA 3V4PH 4Z8FL 1FVCA 5MEPB 4M7LL 3IVKA 5CP7A 4ZYKB 4HUWA 2DQUL 4YGAB 4NUGH 1IGJA 3CVHB 3P4NA 2VC2H 4G43B 3GMMA 3WEXB 4Y4HB 4PRIB 1MLCB 4WI6A 4QWWD 2EDNA 3REWB 4AMKL 2UZYB 3VGAB 1MCCA 5HDBE 4LRNL 3C09C 3D3VB 2VDML 5H35A 2VKXA 2Z31C 4KDWA 4PJFF 5JR1H 2BVOB 3TIEA 3ULVC 1Q0XH 4HFUH 3T4AB 3LN4B 4OKVB 4S1DD 4GG6A 5C0GA 3DUSA 2DQGL 3O3BB 5GXBB 3G9VA 2OM5A 3S36X 5B39B 4IBLT 4V1DE 1DUYB 1EERB 4G8GE 3UTTB 3I75B 1OWWA 1F11B 5JW4N 1Q94B 3AU1A 3OZ9H 5J9PA 5F70A 2D0GA 4KJWD 4UI2A 1C1EL 5F7KC 1GJIA 3N06B 1IILE 3EJYD 5DJ0A 3ZDYF 2JK5B 3FT2B 5EU6B 3MV7A 3KXFE 1KN2L 3MV11 5ELIA 5T1LB 2VAAA 3ZHLA 4RFEA 4JFDB 3MLXH 3GJFB 4JFEB 5IHZA 1PY9A 2EECA 1XZ0A 2QQKL 3AROA 2I60H 4PJFB 2X4PA 1YPZA 5D7JA 2X89A 5EZOH 3TN0C 4LF3B 1MWAA 3O2WH 5IVZB 2EZ0D 4XP9L 2EE2A 1NFDA 3I6KA 5I15L 1FL3A 2XKNA 2CK2A 2OQJB 1F3JA 3AS0A 1GOFA 4AEHL 4Z7NE 4TN9A 5B38B 3ZE2E 5JW5B 4BM7A 5HVWA 1RZKC 3GHEL 4HUXB 4O5LH 3T2QA 3U2SA 1NUGA 1T66C 4IS6A 1UH4A 2G60H 2YUWA 2PXYB 3P73A 2Q8AL 4L3EA 5DD3H 5IB3B 1K8DB 1XCTA 4FFVC 5EU7C 3CFJB 3QHFH 1HDMB 3MBEC 1MJ7H 2P8MB 4NN6B 5DUBA 2P47B 1Q72L 3VWJB 5HHOB 5L0QB 2VN4A 1IAOA 1SEQH 1FG2A 3FQXA 1N7MH 5C7XH 4LU5L 3JWOC 4FABL 3MJ8A 4P23B 3NIFF 3QNXA 2OTWA 3AB0C 3O41A 4RFNB 3ARBC 3MUHL 4FTVE 3HAEG 3TCLA 1JIBA 4KKCC 2DWDB 1OARL 43CAB 1WTGT 4R4FH 4U2YA 1H0DA 2MWCA 4K94H 4Z7UA 1QPPA 2YPKA 5I1AB 3KJ4B 5E1HB 2JJSA 1CR9H 3JTSA 2NY0D 3KR3H 5JW3L 2OJEA 2VRAA 2J1KA 4PB0H 4XHJD 4P48A 2HFGL 1ES0B 4M1DL 3ARGC 3P30L 43C9B 5FGCE 3V6OA 5ABDE 1YNKL 3MPCA 1KCUL 4F57H 2ICEB 1JRHH 2DJUA 5EFIA 2OJZL 4JE4B 4HZAA 1Z9MA 4R97B 3L5HA 4AL8L 3IJYB 5D70H 5DJYB 2CDGB 5L2KB 1WIOA 1MAMH 1KLFA 3UDWA 5GSVB 3VG0H 4FQIH 3RWJB 4OT1H 3MRQA 4CVWA 2ZG3A 5BJTB 4ZTPH 1C5DB 5BO1H 1NCCL 3VXSA 3UBXA 5MEND 4Z7QF 4LCWB 4A6YL 5D1ZC 4NC1C 1G6RA 3L5XH 4KI5F 1IRAY 2B1AL 1JNHB 4RWYH 3X11A 3QEGL 4N1CA 5GPRA 1XIWB 1RZ8B 2EIDA 1Z9OA 4I48A 3NCJH 1JGUH 4M62L 3ZL4H 1CWVA 1ZV5A 4NZUH 5KANG 4F2MA 2P5WA 5I1CL 4LEOB 1G9EA 3V6BR 3W9DA 4KY1H 4YDLB 1MFBH 1OT1A 3GSQB 5ANMB 2ADFL 5EULV 5EC1A 5C0FA 4KAQH 1CL7L 4UB0L 3O2VL 2D4FA 1ZS8A 3EOTH 4BK5A 2IGFL 4NSKA 1B4JH 2MTPA 4HLZH 4M6AA 2D03L 3FB7A 4ODVL 2AK4A 3WN5A 5FUOH 2DL9A 3GIVA 3OKNA 5T3ZH 5LAXB 4AZ8A 2YD4A 4P4KC 2R29L 4JHBA 3SEPA 1J8KA 5IW1B 5DJCA 3P9WB 1XGUB 5SV4A 1RU9H 5GIRB 5HHQB 3WKNA 4WUKH 1CL7I 2DM4A 1QFPA 4FXKA 1J0HA 4Y5VB 2C5DC 25C8H 1U2HA 3W5MA 4J8RB 1JVKA 3JTTA 3WNNA 3BDXA 5SX5K 1EA9C 1I1FB 2DIJA 4OM0H 4D9RD 4HWEH 3LKOB 2X4OA 3D1MC 4Y8AA 5L6YH 4MMXC 4GKOA 3OHXA 3EO0B 4N5UA 2H2PD 4HV8A 1CBVL 1VGKB 4TNWK 4ONGL 2NXZC 1A1MA 3Q2CA 2EC9U 3VFRA 5IUSA 3NCMA 2CMRL 4X7SL 4J1UA 5KTEH 1S5IH 1CXEA 3DO3A 4M6OH 2FBJL 2AJ3A 3QJFA 2XV6B 1KXQE 3SDXE 4ONHB 2XTJB 3W0WB 5J1TC 4UAOB 1DEDA 12E8H 1FFOA 4NFBA 3RX7A 3TH4T 5MHSD 4TPRL 3BEWB 3K8MA 2H3NA 4H26B 4X98A 4PJ9C 3C60D 2E7HA 1KG0B 5A43C 1EAPB 1CXIA 5H37G 3QT2A 4L1HA 4JO1L 1I9EA 2NX5D 4I2XE 1XGRA 3FFCE 4JM2A 5KSAB 1NSNL 1MCOL 1KFAH 4KGLA 3C5ZB 2C4XA 1A9EB 3ZYIA 1QYGL 2GT9B 3ARVA 4XMKH 5ESAA 2ICWI 1KTLA 4WTZA 3PGDB 4XVSL 3RVTC 5K59E 1S8DA 4FHBD 1KPVA 4HQQH 5AZEL 1BBJA 5CEYB 4H8WH 3DBXA 4N5EC 1T89A 1P9MC 4HH9B 3LOWA 3PE9A 3PIQB 3UPRA 3HCVA 3Q6FA 3MMEB 1BBDH 1G7MB 3T0XA 2WWMD 2FIKB 3UXFA 3OXRA 1NC4B 4EN3C 3G5XA 4FQLL 4XB8A 4ZXBB 4OFKA 2NYYC 2F53E 4QRRB 5DJAB 4PJAA 2NMSA 4J12A 4LP4A 5FYLD 5I66B 5TDOB 3H7BB 1QQDA 4MJID 4LCYA 3VMOA 4PGCA 5D1QC 3TBTB 1FYTD 1ODAA 2AI0L 1MNUH 1C5BL 4GAYA 4OLVH 4OSUH 5BS0A 5KN5B 1CIDA 2AQ2A 2VDPL 5I74B 5E8EA 4OGZA 3QNYA 5SWZA 4HUUA 3L5JA 5JO5B 4FQ2L 4QRPB 4YHNA 4XB7A 4J7RA 3UYOD 3X14A 2ESVB 1CT8A 1MSPA 1OTUC 2BSTB 1T4KB 4U4BA 4LLMA 2OZ4A 1GZPB 4EDXB 3IU3A 1RUMH 2A9MH 2H8PB 3N1PC 5FYKE 5IFJB 1JV5B 4KRPD 2V5MA 1G1CA 3NFPA 4GT7A 3BKJL 3U9UA 1H3UA 4O2CA 3T4YB 2CIKA 3A6BH 1A5FH 3GEWB 3FN3A 4HWBA 4OZFA 3T2PA 4XBGB 4U6HA 1H8NA 1NUNB 1N4XL 1EIBA 1ZLSH 1WC7B 5CZVL 1VEPA 5DMKA 3MCLL 1BEYL 4UTAL 2F8VA 3VXQA 3B9KB 3GMLA 3NZ8A 5FHAH 4XNUH 4UQ3A 2V17H 4XNXH 5GGUB 3FN0H 3RUGB 1QA9B 4U6YA 4M1CD 2NX5A 3NH7L 3MV9B 3O3AB 2UUDK 5H2BB 2D9CA 4O2FB 3S98A 2XQYG 4RZCA 3MLUL 3V4PL 5FK9B 4YFDB 4M4PA 1C7TA 3DX7A 5IT2H 5MEOA 5EBGA 2QKIA 3VGFA 5FO8A 3P77A 4YO0A 4NUGL 1Q9OA 4AG4H 3OX8B 2FYYA 2VC2L 1OGAA 3GMQA 4TYUA 5CEZH 1F00I 1VHPA 3QIBD 4UZGA 3VXMB 5C0CB 2Y7QA 2FATH 4U7KA 5CZXD 4W4NA 1ZHLB 2B0SH 2W07A 3KPRD 5D7JC 5JR1L 1V7MH 3IXTB 3BPLC 5D7IF 1L7TH 1Q0XL 3AGVA 4HFUL 5DFTA 4Z0BH 4JZNA 2IC2A 3GHBH 5DRWB 1M6OA 1PZ5A 4QRSB 4LGRB 3VFOA 3MRJB 4K9EC 4FFZH 3GJFK 3MRCB 1IKNA 4LCCA 3OZ9L 1JL8A 4NC0B 4Q2ZB 3KPPB 4HKBB 3QDMA 4HZLB 3GSVB 1KUMA 4HF5H 4PJBE 2DIAA 2YPLD 3KPSB 3L95A 1MCSA 1ETZA 3MLXL 4PREA 5F71A 1AGEB 3SE9H 1TZGH 3CC5A 4EQ2A 2G75A 2HT4D 2I60L 1JGDB 5EZOL 1NCWH 2VTFA 3O2WL 2DQJH 2UUDH 4MQ7A 5INCA 4FZEH 1RVFH 1L6XA 4L8DA 3MA7B 5DD5L 1DUZA 4XXCA 2XG4A 2A6JA 5JTWA 3N1MC 1NPUA 1I8MB 5JHDE 1ZANH 1RJCA 1PKQA 2DKUA 3PP3H 2VLRB 4JFXA 5DGQA 4S1DC 5F7NC 1RJLB 3EFDH 4EI6A 5M7QA 2NY5H 2R2EB 4O5LL 2G5BB 3VFTA 1WEJH 1S9WA 4JY6A 2CD0A 3RZCB 1FNEA 3CSPA 5ID1A 2G60L 1LO5A 1SMAA 1HSAB 2JJSC 4H25B 5HGBA 4URTB 1HOCA 4X5XB 3U79A 5C0JA 4KJWC 5TH2A 3RY6C 3ZZ1A 2P49B 4JKMA 1Z2KA 1B4RA 5C0AE 3V6OC 5EIQA 1LK3H 3ZDZE 3C5JA 4C56E 3QHFL 3LEYH 1INQA 3O3DA 2IH1B 1AKJB 4PJDE 5FKAA 3PWUB 4E42A 1SEQL 3CUPA 1N7ML 3O45B 5C7XL 1YNTB 2FZ3A 4P5KA 3BKMH 1G6RL 4ZUUB 1MHCB 1D6VH 3LQZB 1ZT7A 2X4SB 4PTTB 4K94L 5GJSH 4K3GA 1K8IB 5ITFA 5HSFA 4OCSH 1LK2A 3MRBB 4PJEE 3UBXI 3KR3L 2D31B 4ACPA 3QG6A 3RIFF 4PB0L 2NZ9D 1YEKH 2BC4A 4BH7B 4Z0XA 5D2LE 4HS3A 3ZSTA 3MV8D 1KIQB 5A16A 4HLZG 1JRHL 5BRZE 2A6KB 4TSCH 4WTXA 4JN1H 3RA7H 4B7LA 3F7VA 5IB4A 5D70L 2AEIT 2HLFD 5CGTA 4F8QA 1MAML 4D8PB 3VG0L 3W81A 4FQIL 4OT1L 4X99A 2BVPA 4L4TB 5EN2A 2O61A 1CVSC 4GUPB 3UCRA 2B7DT 5GS3A 5BO1L 4UILL 5F89B 5D4QA 5JDSA 1ZEAL 3L5WA 4RRPG 3H9SB 3L5XL 2WAHA 1BAFL 4Z6AT 4E41D 4JPKL 5AAWA 4H5SB 1Q9LA 3IFLH 4HWNA 1J86A 2B5IB 3A0OA 4FZ8H 4WFGD 1BVZA 1ACYH 2YA1A 3W9EB 3NCJL 1JGUL 5AZ2H 3ZL4L 2NY0C 2EH7H 5SWQA 4NZUL 1KLUB 4XCYA 4OIAA 5LGJA 4C4KO 1R3LA 3HE7D 1YYMH 4KY1L 1MFBL 3VWKD 1E4JA 5FECB 5KS9E 1MPAH 1EJOL 4OJFH 1N5YH 1NGXA 1JCKA 3QUMB 4KAQL 4YK4C 1QSFE 4M8QA 3W2DL 1N64H 3EOTL 2LE9A 3MLRH 1I3VA 4OLWH 1B4JL 5DJ8A 3UPCA 5HBBA 4HIHB 5FUOL 1P84K 1AP2B 5T3ZL 5JOFA 4PJHE 2XA8L 3BDBA 2DBLL 1J05A 1D5XB 4HS8H 3ALXA 5IMLA 2EKSB 4TRPH 3TJHD 1XFPA 3Q6GH 3PV6B 4JFYB 2H9GA 1D5BB 1RU9L 5AD0B 4WUKL 4L3CA 2APXA 1UC6A 2N7BA 25C8L 4PRIE 1U3YA 3OPZH 3ME0A 4Y8DC 3B2UD 1X5YA 3Q5YA 3WFHB 3RWFB 5JXED 4OM0L 4HWEL 3B8SA 4F9PA 1FH5H 1UB5A 4JRYE 5L6YL 2NXYC 2C3VA 1U8QA 4DK3A 4JHZA 4NO0B 3BPCA 3HPLA 1NLDL 1T89C 2I27N 5IW3A 4PJ8B 5KTEL 4P2OD 1IGMH 3H9ZA 1HXYB 3QCUH 3TA3A 2P5EB 1S5IL 4M6OL 2K9UA 4NGHH 3QYCA 4GKNA 5EBWA 5L2JA 1N8ZA 3MFFB 4NYLA 3UTTE 1WBYB 1CFVH 2Q7YB 1CI5A 12E8L 2DB8A 5F7WC 3UZQA 2R69H 4UT6H 2EE9A 3BN9D 5C09B 1FZKB 3S35X 4G9FD 2Y07H 2Z4QA 5EU6E 1HZHH 4U6VH 2HLAB 1T04A 1YECH 4ZFGH 4DKFH 1DJSA 3D25B 4JFDE 1M05B 1EXUB 5EG6C 3ULVF 4DK6A 1H3WM 1KFAL 1MHEB 3O0RL 1GPOH 1T5XA 4Y2DB 1TCRA 4GBXD 4XMKL 2DWEB 4FS0A 5GGSA 1L9NA 4F58H 4PJFE 5MEQA 3HI1B 5I9QB 4HQQL 3HE7A 4H8WL 1G7HA 4YPJA 1A1OA 3QUYB 1JWUB 4XCCH 5JZ7C 3TO4B 3EDFA 1CICA 5KZCB 3ARDD 2GTWB 1SBBA 2Q86A 4M5ZH 2DQIH 4UU9A 3NTCH 4ZAKB 1UQSA 3ARFB 4OD1H 5I8KH 1QHPA 4KKBD 2YA0A 3D48R 2J12B 4PJCF 3ZDYE 2VZVA 3BSZH 3WNPA 1F4XH 2R39A 4IIQA 1S7TA 3WJLA 2D7PA 1MLBB 2X2YA 1OT2A 4CMMB 5CBAA 7FABH 5F9AC 2X7LA 3C60C 1MNUL 3I85A 4HULB 2VL4A 4MA7H 5T1DH 4OSUL 2QV2A 3AAZB 3TNNA 1SM3H 4FFWD 1OW0A 2ZKHH 1UFUA 5HHOE 3EFFB 3FFDB 2IPKA 1CGWA 2XRAH 1MI5D 4M3JA 4BZ2H 4PS4H 2D0FA 3HR5B 4B50A 4CVZB 1RUML 3PNWB 2A9ML 1IAIM 3VXUA 3QXWA 3GZKA 1MH5B 4AY0A 1U3JA 3A6BL 1G7JB 4YGVA 7CGTA 4PJCB 3SJVD 4X0KB 1R24B 3BPOC 5FB8A 4PBXA 1S9YA 1R5IA 3D18B 3DHJA 1ZLSL 3QUZA 3KPMB 3FO9A 3V7AE 4HSQA 4G9FA 2P24A 5FHAL 5F7LB 4XNXL 2V17L 1QUNA 1G7IA 3DX6B 3FN0L 5MERA 3BOVA 3BGFB 4XPBH 2BVUA 9CGTA 3SE4A 4X4MA 1SJXA 3EGSA 1BQHG 2KQMA 4M9PA 1WIPA 2IWGA 4F37F 3IDNB 4DQOH 1LDPH 2KZWA 5L2KE 1U95B 2W1NA 3IKCB 5TE4H 5IT2L 3L6FB 1ND0A 1IKNC 2J7LA 3FN9A 4LCWE 4WDIB 1ADQH 1ONQB 4K55A 4AG4L 2YBRA 1A1NB 4ZFFB 3AXLA 4HX1B 4WI2A 5CEZL 3MSPA 3OJMB 3MCKB 5D5MA 2ZSWB 2C4FT 2UYLA 1MRFH 1HSBB 3P4MA 3TNMB 2I9LB 5I1LB 1MFCH 1LP9F 1OLZA 3IJHA 4JN2B 5ENWB 3S5LB 3HE6D 4AEFA 4XMPH 1L7TL 4Z0BL 3GSUA 3GHBL 4JGMA 4ODXA 4XXCC 1BVKB 5ANME 1T83A 2DQEH 4M1CC 3GUTA 4FFZL 2XY1A 4QYOA 3R0NA 4Z77B 4P2RA 3EAKA 2AV1A 5GGSY 5LGHH 4LHUA 1GGIL 4E5XA 4GQPH 3UO1H 3B2VH 2FR4A 1W72B 2EC8A 3E6HB 4KXZH 3UTQB 5E5MA 5SWSA 2D7MA 1SEBA 4ZODA 4HF5L 4KI5E 5CJ5A 1DE4A 4V1DD 4HMCA 4G8GD 1FQ9C 5DEFB 4G8FA 5IK3B 3MA9H 1I8IB 3SE9L 1TZGL 1KEML 1LP9B 4YZFF 4ODUB 1A2YA 5B21A 1HINH 1NCWL 4YC2B 3R0MA 5T3XE 4E0RB 2DQJL 3VU2A 4ZOEA 1YMMA 5IR1A 4ENED 1RVFL 5FOJA 3IKKA 5GSRA 3HAEA 4YUEL 1CD8A 1AGCA 1NC2B 1OGTA 1PG7W 1ZANL 2EXYC 4MDJB 4U1SB 4XXDA 5B38G 3EFDL 4HXBH 5DA0B 3BZ4A 1H5BB 2FRGP 4ORGB 1UWGH 1PLGH 2RFXB 1QFOA 3IU4H 3PHQA 3OF6D 1OAKH 3E8UH 3MTRA 6FABL 4Z7WA 4PGZA 2GEEA 2XOTA 2JJVA 4JVUA 3D85D 2DLIA 2FX7L 5I1HL 5ACZA 5K9QI 3CDGA 3WLBA 3VI3F 1PDKA 3CLEH 4WCYH 5F93C 3MRHB 4K8RL 5EBLA 4LIQE 2YD2A 1EGJA 1LK3L 4E9LA 2DYPD 3PUCA 4DVRH 3T3ME 2HRPH 2IPTH 3LEYL 1TMCB 1FFPA 4NQDE 4N0FA 4JANB 1T5WB 4K8RC 3FKUS 1CXFA 4GW5A 3DMMB 4OCYL 3U36B 4XZUA 2LTQC 3V79C 4ALAH 2Z91B 3BKML 3W82A 5IVXF 1FL6B 2YD6A 3GBLA 4L4VB 5F9JA 1B6DA 3GIZH 5ETUB 5IMOB 3MNZB 2XQBH 3L3KB 3BQUD 3A6CL 3S3SA 5GJSL 4OCSL 1KB9J 2F54B 2EYTB 3V7AG 4GJTB 5D71H 2EDOA 5CJOH 2BNQA 1YEKL 3BIKB 4FTVD 4C4KT 3C87A 4PJGA 5A2FA 1MHHB 2DLHA 1UACH 1LEKA 2YRPA 3GSNH 4TSCL 3VFUB 3RA7L 1WAAE 1R3KA 4UDUA 2IF7A 2YPVH 2WZPD 5E00B 4ORZC 1WSST 3U82B 2XFXB 3V6FB 2GSGB 4IRJB 4M7KL 3RHWK 3VFWA 4AH2A 3DRQA 4M7ZB 5FYJU 4RAUB 2KUTA 4MJ6A 3KXFA 3U48A 4WU5A 2ID5A 1OB1A 1CK0H 3DUUB 3SN6N 5DVOA 2DQCH 4X9BA 4L4JA 3PF2A 3T65B 3RI5F 1BFOB 5AWNH 3LRSA 2Q3AA 4KV5E 5GRZA 5DD6B 1I7TB 5FUCC 4NKQB 4U1HA 3WUZA 5GRYA 2WNGA 3IFLL 4JO2H 3NGBC 4NWUH 2VIRB 4NN5C 2OMNA 4DN3H 1KJMA 4P57B 4XBPB 3U46A 4Y5YA 2DI7A 5ICZB 4NQEA 2FL5A 2OK0H 5AZ2L 4PGDB 2J8UA 2EH7L 4JY5H 1DQQB 4TNVK 2M2DA 3JWDH 4WUUB 1YYML 3K0WA 1MPAL 3QR2A 4OJFL 1N5YL 3RUGE 1A6PA 5CSGA 1N64L 2E9JA 3LQMA 4D2NA 2YR3A 1IKFH 3V2AR 3QAZC 3MLRL 1TVBB 4UQ2B 3X3FH 3BMWA 3G5ZA 1P5UA 1TPXC 2EDRA 3FOMB 32C2A 3TA3C 2WLYA 5HI4C 5C0EA 3MLYH 4KH2A 2YEZB 4NRZB 1YN6A 1WWCA 3BIBX 3DECA 5HVHB 1WBZB 3RU8H 4TRPL 3SDYH 3Q6GL 1NBZA 3B5GA 3JZ7A 5I2IB 2HTKD 1I4FB 1X4YA 1DDHB 4P9HL 5ESVA 3VXME 4KK6C 5C0CE 4OTXH 3OPZL 4OUOA 4ZOAA 4D0DB 3LKNA 4P9HC 1NDGB 2H45A 4X4ZA 3BDYH 1AH1A 1FH5L 3SE3A 3DVGB 1MELA 2C7UA 3ULUE 3K1DA 5FA4A 3V5HA 1BX2A 3X12B 3HE7C 1T7WA 3VGGA 3ZMRA 4P4RA 5INDB 2DDQL 2Q76B 1HCVA 1IGML 3QCUL 3MODH 4Y5XB 4NGHL 2P45B 2DKSA 5T1MA 4XVTH 1CFVL 2ORBH 1FJ1B 2R4RH 1NQBA 3MQIA 3MRRB 4Q6IC 3LKRA 2R69L 4TTDD 2N4IA 2Y07L 4HMEA 4Y89A 2C1OB 3MRKB 1HZHL 4U6VL 3BUYB 5C6TH 3TJHC 3WJLC 1YECL 4YHLH 1N2RB 4ZFGL 3BHBA 4DKFL 1D5ZA 1QBAA 2Z35B 4GFTB 3M1BB 2ADIB 3ILPA 2HP4A 5I8CA 1GPOL 1DQDH 4MAYD 3GMNB 3ECBB 5E5RB 5FKPA 4XPAH 1C12A 1JN6B 1OW0C 4LVEA 2ATKB 3BPNC 2OP4H 1DLHB 3V0WH 4XCCL 4PLNC 1FAIH 1P7KA 3FFCD 3QA3A 1JPFA 2DI9A 1FP5A 1I1AB 2W9LA 1RUAH 4ZDHB 4Y0GA 2VLRE 4ODSH 2D0HA 4M5ZL 1CDYA 2DQIL 3WHE0 4P2OC 4WFFE 2YHGA 1UXSA 2Z8WC 4OD1L 4IRSB 3WNMA 5I8KL 1UZ6E 2Q3ZA 1S5HA 1YN7A 3QUXA 3LS5H 3BSZL 1F4XL 4LLAA 3WFCH 4PJ7A 3NCFB 3BN9C 2GSIB 3E3QE 2DQFA 2FX8H 4P49A 3V8CA 1U8MB 4WEUD 2XZQH 1TJHL 4LPCA 4UIKL 4WWKD 3FQRA 4MA7L 5T1DL 4DVBA 3SCMB 4YHIB 4GRLB 4Y2OA 3GGWA 2QADD 4EUPB 1NKOA 2WQ8A 1SM3L 3IAGC 1WBXB 2ZKHL 1CG9B 1XF5A 2VDLL 2FD6H 4GBXC 3U0PB 1SBSH 4XMLH 2ZG2A 4X6FB 1JI1A 1GGBH 4AQOA 3SE8H 4PS4L 5E0QA 4BZ2L 4YHYB 2N7AA 1P1ZB 3BVNB 3FAXA 1NAMB 2APBA 1MVUA 1LNUB 3QRGH 5DHXB 3LB6C 1QZ1A 3D0LA 5EOTB 1AIFA 3HLAB 3H9HA 5F96H 1UG9A 1QO3A 5KSUA 4ZOBA 2N1KA 4G7VH 4YAQA 3LPFA 5FYKD 3UYRH 3PQYB 2VDNH 2ITCA 2MQCA 5F3HA 4XPBL 1XF1A 4HHAB 1N0LA 4P3DB 3WNLA 2H32A 2PKDA 4DQOL 2CDEB 3Q3GA 4C83A 1LDPL 4AENA 3U0WH 5EU5A 1T83C 1X5LA 5TE4L 5C07A 1Z0NA 3HNSH 5DK0B 1U8LB 4M5YH 1FZJA 3CSYA 3SDAB 1XF2A 1DBAH 3LSOA 5CJQH 3CCHB 1ADQL 3NCYS 1OY3B 3LPGA 2FJHB 1E28B 4F3FA 2VKWA 4JDVA 3H9SE 1TZIA 4F37K 3KNBB 4PG9A 3VFPA 5E9DA 2FHFA 3MNWB 4ODHH 2WBJD 5J6GB 3K2MC 1HN1A 4OLYL 5E99L 1MRFL 4NCDA 2V5SA 1IAKB 1ZHNA 3PP4H 5D7SH 2DN7A 4KGJA 3OKMA 4YFLF 1S9XB 4NO5B 1VCAA 3OQ3B 4QO1A 2JIXA 4QLRA 4XMPL 3T0EA 2OMBA 5HHME 4HMDA 2FIRT 2F53A 3O6FD 3DNKA 1QP1A 1U36A 3MROA 2DQEL 3IDGB 5F1IB 2XWBB 3LKPA 3I2CH 4G5ZH 4MCZA 4MHHI 1RZ7L 4HGWA 2ZUVA 5AEAA 1ZVSB 4O4YH 3UO1L 3B2VL 5EC2B 5FA3B 2NCMA 1K5NB 3OKEB 3I02B 3ARYA 4I3RL 2JCCA 1H3GA 1MCHA 3V5KA 4HT1H 3KWWA 1H3TA 4MX7B 4WW2F 4JO3H 3UYPA 5JORB 3MA9L 2FECL 2AJUH 4D0BA 2LABA 2A6DB 1A7PH 1PVHA 2ZUSA 3KYMB 3QBTB 4PRHA 1U3ZA 2Y5TA 1G9MC 2YK1L 5IWLA 1UJ3A 3QDJD 4MQXC 1CDCA 3BP4A 4QRUA 3TWCH 1Z3GH 2CLRB 3IDMA 3M45A 1QFHA 3JWNC 3STZA 4I18A 4KXZI 3EBAA 3L1OL 4DUVA 4WO4A 1NDMB 1KBGH 1NGWA 3FQTB 3MO1B 5I73B 4NQCD 4EIZC 4J3UA 5F7FA 3P0YL 2NY4B 3D69A 1A6UH 2H1PH 3FRUB 3IXAB 1UWGL 2FECI 3IU4L 2C3XA 2P5EE 1OAKL 4MGXA 3E8UL 1XGYL 3OGCA 3VD3A 3HR6A 5D6CA 4DCQA 5JHDD 3SKUD 1P7QD 3VXPA 3MRMA 1OTTD 2VLJB 4WW2B 4ZUWB 4QTHB 5C09E 3QXAA 3CLEL 3QWRD 4WCYL 1W72H 4X9HA 3ARPA 1X5HA 3T09A 5F9DC 2HRPL 2IPTL 1VEMA 1T20B 1JPSH 3PHOB 3SKNA 3QZWB 1EEUA 5KSBE 3OAUL 2BMKB 3TBWA 3BAEH 4ERSH 1EUUA 3ULSA 3RWEA 2NZIA 1TENA 3JVGA 1ITCA 5C0AD 4ALAL 1J10A 3RPIA 3CD4A 4ENEC 3IDXH 3IRZA 3AMLA 2HA1A 4X7TA 5C0DA 1HQ4B 2EDDA 5MENB 3GIZL 4OKDA 5BXFB 3ZDXF 3FOLB 3RGVB 3M07A 4P46D 2XQBL 1RK1A 4LCIH 5LJYH 5F21B 4D0CB 4C59B 1RZGA 5D71L 4ELMF 4JFPA 1X6LA 4WNQA 5CJOL 2ZSVA 1T0NB 2E7BA 4YPGB 4Y5YC 2D2OA 3ZYOA 5LVEA 4RBPK 5CS7A 1YUHB 1UACL 5EU3B 3SO3B 3GSNL 4R9HA 4KPHH 3Q5TA 5KJRH 2YPVL 5DD0H 5JOEA 2AJXH 2RGSA 3QEHB 2W0LA 4JVWA 1MFAH 5BZWA 1FVDA 1R0AH 3O9WA 4J2XA 4LLVA 5LCVH 3LKSB 5BRZD 1CK0L 1XF3B 2DQCL 5AWNL 3KS0J 4HWZB 4LLWB 3N1FC 1QRND 4R0LB 5I16B 2E8YA 1JHTB 3IFPB 4ELMB 4JO2L 4NWUL 1OL0A 3BYYA 4DN3L 3LV3B 3WIFB 2HWZH 4NHCH 4X8JB 2OK0L 5H94B 2V7NB 4JY5L 4RAVA 3JWDL 3QWRA 4NUJB 1CE6B 5GISH 3JV4A 4GAJH 4RISH 3SE3C 3RDTA 3WLWC 1MY5A 1G9NH 4UOJA 2ICWJ 3MUGB 5CIPA 1IKFL 3X3FL 4G8EA 4BUGA 3TIDA 2OCFD 5C0IB 5I17B 4UT7H 3HZVB 3MLYL 2YRZA 4G6FD 1LHZA 1J1XH 4C56A 5HI5C 5LQBH 1GIGH 1QSFD 1R3HB 3IDYC 4OFDA 3SDYL 4PJDA 5ICXA 1PAMA 3OKDB 4P46A 4DUXA 2MFNA 5HHPA 3RJDA 1U8NB 1N59B 3X13A 4WV1B 3GB7B 4RGMC 4OTXL 2FB4H 2OXGA 1AE6H 1AO7B 4U1IA 3EOAA 3TFKD 3C5SB 4L8CB 3BDYL 3EYFA 3FMGH 4N9GB 3BMVA 5LBSH 3RVWD 5I6XC 1U91B 4DZBB 1B88A 4MZ3A 1J8HD 4PRID 4JFQA 2AXGA 4GRWF 4JFHE 1A6ZB 3TCXA 4PRPB 4XPGH 3AREA 1UENA 3QO1B 4JRYD 4LLQB 4XI5D 2R2BB 4ZPTB 1PG7H 3CDFA 2ORBL 4LPUA 2R4RL 4JPIA 1MCQA 5JA9A 1OSZA 3QHTC 2E6PA 4OFYD 1Z6JT 2DM7A 5DSCA 1MIMH 2E7CA 4L9DA 2IALA 5EUOF 3UTTD 3VXRA 3VCLA 4MB3A 1CLYH 1FYTB 3TT1H 1DQDL 2KL6A 5EU6D 1QR1B 3ZE0E 4CMHC 2UWEA 3L9RB 2QQQA 2B4CH 5JQHC 1MFNA 2OP4L 4GRWB 4ZUSB 5GGQH 3V0WL 1IC4H 1FAIL 3B6SB 3SGDH 4PGEA 2Y06H 4R2GC 1RUAL 3WUWB 4B5EA 2FWOA 4JRXA 3EYSH 1D9KB 4ODSL 4TSBH 4Y4FB 1UYWH 4OZIE 5DRZA 4FXGA 3EO1A 1J12A 4KRPB 1NGZB 1OHQA 2OL3A 5AYUL 1CDHA 1X5ZA 2AV7A 1EEYB 2A0LD 5GRWA 3LS5L 1WJ3A 3BP6B 3WFCL 1BQHA 5ESQA 1FN4A 2AKRA 3KYAA 1IL1A 1G7LB 5EUOB 2FX8L 5KVEH 1JBJA 3L3DA 2LAAA 4U1JB 5DURD 4H20H 3VFMB 5C08E 3MRLA 1IFHH 1I8LA 2PXYD 5IHBA 2XZCH 5JW4R 2BNUB 2IQAB 5ADOH 2FD6L 2V2XB 4MAYC 1FFNA 1FL5B 3NZHL 4XMLL 3EOBB 3HZMB 4GKSB 3WEXA 3FB6B 3MRGA 4Y4HA 3GSRB 4PRIA 1MLCA 3QRGL 4L4VE 3REWA 1VADB 4LBEA 3VWJD 3NFNB 4ZPVA 5C0RL 1W8OA 3D3VA 1R5WA 3LIZH 2APFA 4IOIB 4AK1A 2BVOA 5F96L 1U8HB 4G7VL 4P23D 4AEIH 3QIBB 3MLPA 1FE8H 3T4AA 3E6FB 3UYRL 2VDNL 1CGUA 3AY4A 1C16B 5IFHL 4OFYA 1FC1A 5B39A 2O93L 1JYVA 1DUYA 5JW4M 3UTTA 3I75A 4ONOA 3QCVH 5EU4B 1Q94A 4WWKC 2DF3A 3I9GH 4KK5C 3U0WL 5EH1A 2JK5A 3MZTA 3HNSL 2PTTB 2QADC 2R0KH 4KMTH 3G6JF 1T1ZB 5T1LA 4BH8B 3EYVB 1C7SA 4JFDA 5CJQL 4YHPB 2JB6B 3GJFA 3S88H 4JFEA 4H0IA 3GFUA 5L2KD 2YN5A 1XAUA 1U8IA 4PJFA 4MD4B 4ZUTB 5F1OB 2Z8VC 4HUVA 2YPLB 4NOBA 3WS6A 3REVA 4LCWD 4OIBA 3PP4L 2CUIA 4JAMA 5IWLC 2AJSH 1UJ3C 4WTWA 3WO3B 1NBVL 2FEDD 5B38A 3RBGA 3CFBA 5C8JB 4Z76B 1ZVHA 3P11H 3U0TB 4WUUE 4HUXA 1GCFA 4WO4C 1IJ9A 4HBQA 2HKHH 4N1HB 4X6CE 2QJDA 1U6AH 1MQKH 4G5ZL 3I2CL 3RY5A 1F4WH 3G6JB 1H8OA 3HA0A 4O4YL 5IB3A 1K8DA 3LHPH 2A6IB 2X42A 3WJJC 1GGUA 4K71B 1OF2A 4XNMB 1DN0B 1HHKB 2OI9C 4HT1L 2RCSH 4FG6D 1HDMA 2ITDB 3SDDB 3VWJA 5HHOA 3ZE1F 1KJVB 1X3DA 3QQ4B 4JO3L 3BXNB 2CRYA 2G9HB 3L3OB 4CADB 5T5NF 1HI6B 1A7PL 2Z92B 1BIIB 5HDLA 2WSKA 2R8SH 2CIIB 4KI5D 1JK8B 4MXQD 4QOKB 3TWCL 1Z3GL 2AJZA 4KK8C 5EBMA 3CFKA 2DWDA 1KCRL 43CAA 2VAJA 3FZUD 3ZTJH 3I6GB 3W39B 5JUEH 3T8XB 1TTFA 5I1AA 4APQB 4PJ5E 4R90H 1A6UL 1FORL 1KXTB 2H1PL 3O6FC 2VB5A 3DURB 1SJEB 2R2HB 1RK0B 1ES0A 1V5JA 43C9A 1KSRA 2HFTA 2ICEA 3OR6B 4WEBL 1N5AA 1IEBB 5DJYA 2CDGA 2HAZA 1RPQA 3HC3H 3RWJA 4JKLA 1C5DA 1TIUA 5HJ3A 3MV8B 1DL7L 2C1PB 3PWJB 3EO9H 3V0VB 2YWZA 3RNKB 1RAMA 1WFNA 5CJ8A 3BAEL 3QCTH 3QPXL 3MXWL 4ERSL 4JDZB 3VJ6B 4AM0B 4LGSB 2HG5B 3O9WC 3IDXL 1SY6A 1XIWA 1TZHB 1RZ8A 4HIIB 4NQDD 3VRJB 1QKZH 5FO9A 4FQHB 1HYRC 4F80A 3QQ9C 5KSAD 4QT5A 4LOUD 1A7QL 3FRPA 1EK3A 4LCIL 2MQ3A 2UZXB 4YXKH 2J88H 2R15A 3W5NA 1I7UA 4E41B 1DQJB 1KTDB 4OBSA 4LEOA 2NY2C 1FG9C 3GSQA 3TBYA 3IAQA 5EO0B 2VR4A 3GKWH 1UXWA 4HFWA 5ALCH 5DJ6B 3S7GA 3VXOB 3P0VH 5CCKH 4LEXH 1F97A 1KYOK 1Z5LB 1NL0H 2VDQH 3AC0A 1FRGH 1NC4D 5KJRL 4PY8I 5DD0L 1ITBB 4DFIA 2Y6SC 2VQUA 2AJXL 3D0VB 1FIEA 3RDTC 4K3DL 1LMKA 3VWKB 5LAXA 2VZTA 2OTUA 3F62A 3O4OB 1R0AL 5LCVL 4QY8A 4ELKB 4HKXB 3LQAC 5DRXB 3MJ9A 5GIRA 5HHQA 4GS7B 4LLUB 1JGEB 2CKBH 1RIUH 1KNOB 4XPTH 4XCNB 1NMCB 4J8RA 3F58H 1HQRA 1I1FA 2YSSA 1VEOA 2HT3C 4XCFH 1MCWW 4P46C 2BCKB 2CJUH 3MLZH 3LKOA 4QXUH 2HWZL 5JMOC 4NHCL 4X7FC 3VFSA 3EO0A 1MJ8L 4LSDA 2WQRA 1QEWB 1SJHA 1VGKA 5D1XA 3CVIH 1M71B 1T7VA 2VXVH 4ZS6D 4MQSB 3ZYJA 3PQYE 2F9BT 5GISL 4GAJL 4RISL 1IGYA 1RUPL 4CJ1A 1U42A 4U1KB 3SGEH 3S9DB 1G9NL 4ONHA 1EHLL 3QULB 3W0WA 3N1QC 5C2UB 1B9ZA 2CO7B 1TJIH 4HCRH 1IC5H 3EYOA 2JTDA 3BEWA 4LPWA 3TBSA 1AGBB 3AREC 2B8OT 1X5GA 3ESUF 2NY3C 1KG0A 1J1XL 1EAPA 5HY9B 1GIGL 3C6LD 5I71C 4R3SB 2W0KA 4UV4H 5EDXA 5KSAA 2CKBA 3C5ZA 1B0GB 5AUMB 2GT9A 3L7FA 3HC0B 3PGDA 2YUXA 3P40A 2X4NB 5CEYA 2AVGA 2FB4L 4PG2C 1AE6L 5IQ9B 4HH9A 3DYMA 3PIQA 1O0VA 2YA2A 3FMGL 5LBSL 3MMEA 1G7MA 1KELH 3QXUA 3WL9B 2OBGA 5C0CD 4G8IA 4ZXBA 2V9QA 4BQ9A 4QRRA 5DJAA 1G0XA 1CS6A 2XKSA 1BOYA 1W0WB 2OL3L 3I50H 3H7BA 3ARDB 1PBYA 5IHLB 1PG7L 3ULUD 2F58L 1KCSH 3V8OA 3TBTA 1IGTB 5GGVH 4Y1AA 4XPHH 3BIAX 3AS3A 3QDGB 4LKXA 5KN5A 1OQOA 5F7YC 1R5VB 5DK3A 1RJYA 4QXGH 3D2UB 1MIML 1XCQB 5CBEB 5JO5A 1I85C 3AUVA 3HG1B 4QRPA 3NMEA 4YHML 4KDTA 2ESVA 1CLYL 1RMFH 4DKDC 2BSTA 3TT1L 1T4KA 3O81A 4XH2B 2IAMD 1GZPA 4EDXA 2H8PA 5IFJA 2FGWH 1JV5A 3DYPA 2WLZA 3TFKC 5ADPH 2B4CL 4R4BB 4U05A 3RVWC 4LMQE 5GGQL 4WY7H 3T4YA 2WP3O 3OJ2C 3U9PH 2XN9E 4OLXH 2Y06L 4XBGA 1ZSDB 5EPMB 1CFSA 1U3HD 4Y4HC 1EX0A 5HYSB 3OBAA 3EYSL 4TSBL 1UYWL 1WC7A 4EZMA 4A6YB 5IG7A 2BOCA 3VGAC 3B9KA 3K74B 1PZUB 2YN3A 1KB9K 3IJSB 4M6NH 4MNQA 5GGUA 4LVOB 2AJYH 4J3TA 5EOCH 2KPNA 5CFHA 1J0IA 2VLRD 3MV9A 5H2BA 4JM4L 4UDTB 2VLJE 4N0UE 4WFFD 5E2WH 3AY4C 5KVEL 4F15B 5FK9A 3U6RB 4H20L 1HILB 1IZKA 4G6KH 4JGUA 1IFHL 4EUPG 3C6SA 4BUHA 1OVZA 2XZCL 2QHRH 4HUNB 3CPLB 5HYQA 3UTSB 5ADOL 4LSQL 2X9WA 3OX8A 4LPVA 2MCPH 5HDBF 2C3WA 4JCMA 3VXMA 1LO3L 3KYKH 5C0CA 1I3GH 4PRDB 1LE5B 2UY6A 4X5LA 4TUJA 1RZJH 3OSKA 2VL5A 1AKJD 4M6ML 4CN4A 5BV7L 2VXUH 3LIZL 3IXTA 1B6UA 4AEIL 1FE8L 4K7FB 5I8OH 3WS6C 1BVLB 5BVPH 5DRWA 2EKJA 4PR5B 4QRSA 2A0LC 2YD8A 3MRJA 4HDIA 4DJMA 1M7DA 1FBIH 3MRIB 1HH6A 3MOBH 4OCMC 5DC0A 3HE6B 1HH9B 1QTYT 5FV1L 1FV1B 1OPGH 3RWCA 3QCVL 2W38A 3FQUB 3QH3A 2HH0H 4HXAL 5ERWB 4N8VB 1B2WH 3I9GL 1CTOA 1X4ZA 4HKBA 3KYNA 3GSVA 4LPTA 4Z7VA 5JPMA 2L0DA 3Q48A 2PXYC 5FAAA 2R0KL 2LU3A 3HFMH 4KMTL 3G5VB 3KPSA 4P9MH 5E2UL 5E2TL 2D7NA 1BOGB 3DRTB 1GAFH 5L7XL 3DXAD 5B3NA 1JGVH 4YXHH 1JGDA 4NN6C 3QFJE 4P5TA 5D7IA 2X4UB 3VWJC 5L0QC 3MA7A 2GITB 4G8GB 4MNGB 1YJDL 4LARH 3ZKMD 1U92B 2AJSL 3H9SD 5CILH 3MREB 4U0QB 4X9FA 2ZP0T 4WHCA 1CLOL 1RJLA 4RFNC 1YJDC 3DYOA 2I24N 1NAKH 3SGJC 5IKCA 1B0RB 2R2EA 3P11L 1T1YB 3NCYP 2G5BA 4PP1D 5GS1B 4HKJB 2HKHL 3RZCA 5DHVB 5FM5O 3KJ4C 2VXQH 4H25A 1F4WL 4X5XA 2H6PB 2GJ6E 3HZKA 4GRMB 3LHPL 1HHHA 1S78C 1E4XH 5HHMD 1XEDA 2EE3A 1MCPH 3NA9H 3HPJA 2RCSL 5DFVD 5IM7A 1TITA 4NKMB 1DBJL 4LDEB 4R97C 2X4QB 2XACC 1WZ1H 3BX7C 2AXJA 3O45A 1VGEH 1CGSH 3KYOA 5T5FH 3FT3B 5C6PB 2VDRL 1X5JA 3QXDB 5ISZE 2DYPB 4ZUUA 3QPQD 4GMTL 1MHCA 1KPUA 1OP5H 5GGTA 3K4AA 1AO7E 3RVXD 3HUJA 2AABH 2F74B 2X4SA 2D9QB 2NTFA 1FVCB 2I07B 2VWEC 1K8IA 1HXMB 4MXWL 1FO0A 3MRBA 4R90L 2IBZY 3WIHA 1XIWC 1WV7T 5CP7B 4BH7A 4HUWB 4PRPE 1IGJB 1FDLH 4JFFB 2K7QA 2HFEB 3P4NB 1KIQA 3MBXL 3U4AA 4NO3A 4X6DF 2Y1VA 1A3RL 3BQUB 3E2HB 3O4LD 3IFOB 2E9IA 5IB1B 4ODTH 4DFHA 4KZDH 4YDLC 1F2XK 3HNVH 1NMBH 4XP6H 3HC3L 1BZ9A 2P5ED 1KC5H 5GRVL 4L4TA 1O7VA 2HN7A 4GUPA 4L8SA 5H35B 4NCC2 3EO9L 5I76A 3I3BA 3BYTA 1NFDF 3QCTL 1YY8B 4GG6B 1FYTE 1E4WH 1JGLH 5C0GB 4LSPH 3H9SA 3MJ9L 5C09D 4KI5C 1MCBA 4BYHA 4MXQC 1UA6H 2IBGA 1F8TH 5EA0H 4H5SA 3C8KA 2DQHH 4H1LH 3X3GH 3FZUC 4GRWE 4ZD3L 3NN8B 5CKGA 5J9PB 2O5XL 1WWBX 3W9EA 4Y2DD 4Y5VC 5DJ0B 4ESKA 4N8PA 4FNLL 1KLUA 1UKTA 3PHSA 4X6DB 4YX2L 4YXKL 2J88L 1EFXD 3SQBA 1S9VB 1BHGA 2DMBA 2VAAB 3QUYD 4RFEB 5FO7B 2Q8BH 3GKWL 4YXLH 3DVNB 5ALCL 4RIRB 5CCKL 4LEXL 4EI5A 4XNZB 1NL0L 2VDQL 1FRGL 3BPLB 5EUOE 3RAJH 3ROLA 3TYGH 3UP1A 2R9HD 1NFDB 4HIHA 5IW6A 4OI7A 4RA0C 2BY3A 1TVHB 2XTJC 3C2SA 4TUOB 4IJ3B 2IQ9H 1D5XA 4UAOC 2EKSA 5CJXA 4JFYA 1BD2E 1D5BA 4OLUL 5AD0A 4UUJB 3GO1H 4XCEB 3F6LA 1S9KC 2DIBA 1S7XB 1W0VB 3VA2C 3JXAA 3U2SB 2CKBL 5T1KD 4O51A 3TVMD 2ZNWA 4S1SH 4O2EA 4XPTL 4HIJA 5CUSH 3FO1A 3F58L 4JB9H 4XCFL 3WFHA 5KSAC 1AD9B 3UJIH 3RWFA 3C5ZC 2CJUL 3MLZL 3B4NA 1XCTB 4IMLB 4QXUL 2JJWA 4CDGC 4NO0A 3DJ9A 2XICA 3L7EA 4Q9QL 2FBOJ 3HS0B 3CVIL 4PJ8A 3SDXF 2VXVL 4FQCH 2AEWA 4F7EA 1HXYA 2P5EA 5IB5A 4L1DA 5IROA 1D5MA 1FG2B 3FQXB 2FEEL 4RMUA 3MJ8B 2P42B 3BUTA 4R7NB 4ZXBC 3BEVB 3QNXB 4HCRL 1TJIL 2A38A 2E9BA 1IC5L 4GH7B 4OUUA 2X9YA 1FZKA 1PFCA 5E94B 2GI7A 5F44A 5TE6H 2HLAA 1H0DB 4TSAH 4Q97A 4JY4B 3TZVA 2ED7A 2W9EH 3D25A 3OG6B 5K59F 1EXUA 2OJEB 1F45A 4UV4L 1MHEA 1MY7A 4KVNH 2FEEI 4G9DA 5KVFH 5I74C 3HI1A 4B0MM 1HEZA 1E27B 3AVEA 2V2TB 1JWUA 4KDTC 4XC3H 3QDHA 4NM8H 5F9WB 3TO4A 1CFQA 2A1WH 3SKMB 1J1PH 3MRQB 1KELL 1DVFD 2YD5A 1IGIH 4ZAKA 2VR9A 3ARFA 4WJ5B 2B1HH 1DEEA 3T2OA 3VXSB 4I2XB 4XHQA 5HD8D 1HK6A 3MRFB 3CDCA 3FFCB 4DOHB 3I50L 1DBML 1MOEA 1KCLA 1RQ5A 2CSPA 4Y4KD 5JIHA 1YYLH 1KCSL 4O9HL 4CMMA 4ZNCD 3B9KC 3LS4H 2D4DA 3OJDB 4JFHD 5GGVL 4KC3B 4XPHL 4LQ1A 4NM4H 3U4BH 4I48B 4JREB 3GI9H 2RJMA 1RZKH 3AAZA 4QXGL 5KBNC 5C0ND 3QWOB 5F1KC 2P5WB 4OCRH 4AEHH 3EFFA 5HYIA 1QLEH 1NJ9B 1RMFL 4U49A 1BFTA 5C0FB 4BFBD 3HR5A 2BJML 4QHUB 3U7YH 1D7FA 4QOKE 1MH5A 4OCXH 1MCEA 4WY7L 4HK0A 1G7JA 3FB7B 4PJCA 2GW5A 3U9PL 3WN5B 2IMNA 3OKNB 3WUWG 4IDLA 1R24A 3D18A 3KPMA 5I75B 3S36L 3JWOH 1YZZA 2GK0B 1Q72H 1BJ1H 4YNYB 4YBQD 1NC2D 3DX6A 2Z0BA 3BJ91 3ULUC 2BHUA 5EOCL 1IEAA 4NDMB 1MJJB 2PW1B 3IDNA 4QNPF 3ZE1E 3JTTB 2IPUK 3ESVF 1U95A 3ZKND 3IKCA 4JM2F 2A74B 2B2XH 3V7MA 1NCTA 3V52H 4NRYA 4HIXH 4G6KL 4KTDH 3AFLA 4OV6F 5IMMB 3O8XD 1L0XA 1A1MB 1ONQA 2QHRL 1RIHH 2EEDA 5JW3H 1A1NA 3H7LA 2MCPL 4M7JL 2XT1B 2CR3A 1WCQA 3O3UN 4M1DH 2AJ3B 4N0CD 5C08D 3KYKL 3MCKA 3F6IA 1I3GL 3DI2B 2ZSWA 4NOFA 3TNMA 1HSBA 2I9LA 3MBEA 1FFOB 4XWGH 2CUMA 2IMMA 3DMMD 2H3NB 2VXUL 5ENWA 3S5LA 3MLVH 1IBGH 4U2ZA 2WBJB 4LRIA 2J4WH 5I8OL 5HXMA 2J6EH 5BVPL 1UKQA 1JYNA 4Q6YA 2NW2A 1KIPA 4JM2B 5TFSH 3H2WA 2DLTA 1VA9A 1QNZL 2C3HA 1FBIL 3MOBL 5D96B 3WNKA 4DEPB 4EJ1C 1S8DB 1KPVB 4PJBF 1OPGL 4QRTB 2A83A 3FONA 2HH0L 3E6HA 1B2WL 3UTQA 5HGGS 3RZCC 4G6AC 3Q6FB 4QHKI 5D7LA 3RGHA 5HI3D 2Z8SA 3GMRA 4M62H 1NCNA 4DGYH 3E3QC 2PTUA 5IK3A 4P9ML 4MAUH 1I8IA 1UVQA 2MPAH 1LP9A 4ODUA 4IRJD 1OM3H 4PJAB 5D9SB 2ARWA 4YXHL 4W81A 4EQ3A 5DVLA 3DLQR 5DMGD 5F6IB 4ZNEA 1EJ6A 4OF6A 5E5UB 3LRGA 5GGTL 4PGCB 5F88B 1NC2A 2X70B 3WYRA 2X1QA 4LARL 4I0PB 4L8BB 3IT8D 3TYFA 4U1SA 5CILL 2J6EA 3QDJB 4ORGA 1H5BA 4PJBB 1FO0L 1SYSB 1NAKL 2R29H 4W68A 2RFXA 4I3GA 5SWZB 5C2BH 4NNXB 1HYSC 4NKOA 4HPOH 1CT8B 2DLFL 4NQCB 2VXQL 3LEXB 3KS0H 3IU3B 3ZDZF 3FT4B 5KAQF 2VLME 1W2KT 3FHAA 1E4XL 3NFPB 2APVA 1U8JB 5GJTH 1VACB 1AXTH 1KJ2A 2CIKB 3MRHA 1JTOA 3NA9L 1QSEE 1A3QA 4U6XA 2FNBA 3CH1A 4PIRF 2R0WL 3S96B 4UBDC 1CTNA 4NC2B 3LVEA 4OF7A 5FGSA 2IANA 5DMKB 1CBVH 1Q9WB 2BERA 4ONGH 3U36A 2W92A 4IDJL 3VXQB 4CU7A 3GMLB 5IEKA 1VGEL 4ZO9A 5IESL 5HYJE 1FL6A 2MOVA 1DLFH 4U6YB 2FBJH 4FQQA 4L4VA 1E4XI 4ZSOA 1V3KA 5ETUA 1IARB 1NFIB 1P69B 5IMOA 3MNZA 4RZCB 5IJVB 3L3KA 1S7UB 1A4JA 4PLJC 1TQBB 3DX7B 5D2LF 2F54A 2I5YH 2EYTA 2ADGB 2QQNH 1FGNL 2QKIB 5E8NA 3IETB 2B5IC 5FO8B 2AERT 1BGXL 4YO0B 1FDLL 1K9TA 4NNPH 4U1MB 5SV3A 4C57C 4KI1A 2FYYB 1NUDA 3QRFM 1MHHA 1NSNH 2DM2A 2GTZA 3VFUA 3ZKQD 4PJ5D 3CFIC 4ODTL 1JPTH 5HHVH 2VQ1B 3GRWA 5E00A 3DROA 5F6HI 3HNVL 3V6FA 2X4RA 4PJXE 3QDGE 4RAUA 4IMKA 3WFZA 1KC5L 2HJFB 4CKVX 5IVXA 1P2CA 5MI0B 1URLA 3HG1E 3DUUA 1UM5L 1E4WL 1JGLL 1M6OB 4LSPL 3QEQA 1I7RB 1I7TA 2VOTA 3QPQC 2OSLA 4PTUB 1UA6L 5J3HC 1F8TL 5D2LB 5CJXC 4PJ9A 3RVXC 5HHNA 3IAPA 2DQHL 3X3GL 5C70A 2VIRA 1ERNA 5BRZB 4LCCB 4Q74A 1R3JA 2PO6B 4N0YH 3WIIH 5KS9F 4PGDA 1DQQA 4WI8A 1QRNB 2APWA 1YA5A 2VDPH 4WUUA 1ETZB 4PREB 4YXLL 1C08A 4R7DB 4AEEA 4MA1B 3CC5B 1IQDB 1S7QA 2G75B 1I1AD 4PJHF 3S35H 4PJ8C 2ENYA 1FSKB 5SX4I 1TVBA 3RAJL 1KGCE 3TYGL 4YDKH 2FLRT 3FOMA 2Y9RT 5IROC 1DUZB 4IRSD 4DN4L 5DMYA 2YEZA 4NRZA 3QIUD 5FEBA 1PKQB 1MVFA 2IQ9L 4JGJA 1WBZA 4NHUB 5IBLD 1N4XH 1A22B 1JWMB 1LO0L 1I4FA 3GO1L 3STLA 3UTSE 2DS4A 2Z9TA 1IM9A 3K46A 4OD3L 3GNMH 1MCRA 1S9WB 5D1QA 2IFFH 4JY6B 2GFBB 4OB5L 4QTIH 1AGFB 5KS9B 1FNEB 3SCMD 2E7MA 4S1SL 3GMOB 4GRLD 1WTLA 5CUSL 3DO7B 4JB9L 5DLMH 1NDGA 1HHGB 3NA4A 3UJIL 4PY7B 5BW7A 2EO1A 5D6DC 4Y2DC 1RY7B 4N8CH 5JHLL 4JKPH 4Y16D 4MQTB 3DVGA 4PB9H 4S1QH 5GS0C 2ZUQB 3ZO0A 5BQ7A 3MLUH 5I9QC 4HC1A 3SOBH 4PJHB 3QUYC 5C0BE 3RWGB 4FQCL 5INDA 2Q76A 5FKAB 4RNRA 3TO4C 4P2YA 1P4BH 3ARZA 2ERJB 3ET9F 2IBZX 2WWKO 2FZ3B 4ETQA 1D6EA 4GKZB 4I1NB 4NQXB 2DBJA 4X83A 2NR6D 3ARFC 5E6ID 4FN0A 4ZAKC 4BFIA 2R9HC 2AAVA 5IVNA 5E03A 1J8HB 3LDBB 2BNRA 3MRRA 5CLTA 3PQYD 3PG2A 1RUQL 1MWAH 4DKEH 3ULVL 1CQYA 3NAAH 2VSDA 3PWPA 2ZUTA 5TE6L 2C1OA 3MRKA 5DS8B 2KH2B 5TDPB 3V6ZB 3VG9B 4HJJH 3BUYA 4HJ0D 4JRYB 4TSAL 3BW9B 4LNRA 4JPVH 5ITFB 2OR8A 3INUL 2W9EL 3VFGH 4YEEA 1M7IA 1RHHB 2Z35A 4P3CH 4K9EH 3QG6B 2ADIA 1EPFA 4LKCB 4KVNL 5JNYA 1V3MA 3GMNA 3T3PE 5KVFL 5CD5D 1FLRH 1JN6A 3SDAD 1K4DA 5DUML 3JV0A 3LY6A 1DLHA 4MNGE 4XC3L 4S10A 4NM8L 2A1WL 4PLKC 1JF5A 2CK0H 1I1AA 1J1PL 4X99B 2BVPB 4MWFA 1IGIL 2XZZA 2AXFB 1P53A 2B1HL 3RTQB 4IRSA 4XGZB 5JDSB 3BT2H 5GZOD 3V4VH 1H3XA 1X5IA 1YYLL 4ZOCA 1U8MA 3LS4L 3CX2A 1EO5A 1RFDH 2E6JA 5BOZG 4V2BA 3RWIB 5DD5H 2X9XA 3BGFC 4LVNB 4NM4L 3U4BL 3GI9L 4JJ5B 1RZKL 4YHIA 4GRLA 5FDWB 4F33B 5CLWA 4EUPA 5SWQB 1WBXA 4OCRL 5LGJB 1QLEL 1R3LB 3U0PA 4ODBD 4FXLA 3OWEA 5DURB 4H88H 3RL2A 3U7YL 4NQVA 4M8QB 1NAMA 1LNUA 4BFGA 5GGRB 5A1AA 4OCXL 1G7QA 1KTRL 3SBWC 5EZJB 3HLAA 1D5IH 2SEBB 1F13A 3LCYA 5HYSG 1K3ZA 4Q9RL 1J05B 5IMLB 3JWOL 5HD8C 2HMIC 5IVOA 3MFGB 4JFFE 3VDCA 2XN9D 4Q0XH 2NY4D 5FYJH 3QHZH 2APTA 4LRIC 4P3DA 1G6RH 3LH2H 5EUKA 2P46B 3WMSA 2CDEA 2HVJA 2B2XL 1ORQB 2ZUXA 3V52L 1Q9KA 5IJKA 1U8LA 4HIXL 4BQBA 4KTDL 1U8QB 3SDAA 3BPCB 2A77H 1UADC 4JFOA 3CCHA 1U2CA 2VLJD 1RIHL 4Q58C 2VN7A 1E28A 4GG6E 2C26A 2XPGB 1DTUA 3RY6A 3KNBA 2JKXA 1YY9D 3MNWA 4NFCA 3ZHKA 2M1KA 5EBWB 1WT5A 4GAFB 1N8ZB 4CW1B 4JQVC 2D3VA 4G6JH 1IAKA 4XWGL 4NPYB 3BE1H 4YC2C 3HI5H 3MLVL 4X6DE 1IBGL 4U3XA 5BVJB 1LEGB 1YEHH 3MV7E 1FNSL 2J4WL 4UILH 1SYVB 2J6EL 5FOBB 5TFSL 2W65B 3IDGA 4OF3A 3RGVD 3ZTNH 2XWBA 1T5XB 1ZEAH 1TCRB 2PW2A 1FZMB 1EHXA 4I0CC 1ZVSA 4NP4H 1H5BC 1BAFH 4WU7B 4JPKH 5EC2A 5FA3A 4N8VG 1K5NA 1QBLH 2EDTA 1NFDE 1UT9A 4MD5A 1WZLA 1CICB 1KJ2L 5I1IH 1KLGA 1PYWB 4MX7A 2Q86B 1XH3B 4DGYL 2AW2A 4PGBB 5JORA 4MAUL 3RL1B 2A6DA 1T7YA 3IRPX 2MPAL 4N0CC 1OM3L 1EJOH 2WIMA 3C8HA 4IIQB 2CLRA 2K7PA 3RKPA 3W2DH 5JPNB 4L3EE 2LFGA 4EXKA 3DMMC 3L3IB 3FQTA 3MO1A 5F7UA 1DQLH 1Z9SA 3AM8A 3UTZB 3FRUA 3QFJD 3KPTA 1RURH 3IXAA 2XA8H 5CWSB 5DRNB 2DBLH 5C2BL 1YEJH 5IBUB 4YDVB 1FAKT 2IPKB 4HPOL 3DGGA 1D3CA 3ES6B 2AS5M 1HIML 5GRJH 1KB5A 3T3MF 2VLJA 4WW2A 3HKFA 2LVEA 4J3XA 2EDKA 5GJTL 5C9JB 4PLOB 1AXTL 5A2KH 4YGVB 4NJ9L 2DMKA 5E8PA 5HVGB 3O11B 4ZTOL 1R5IB 3PHOA 2J8HA 3QZWA 3QUZB 2GJ6D 2BMKA 4IRJC 1NLDH 3S97C 4M7ZC 4IMKC 3CX5J 1JFQH 1ORSB 1XGQA 3Q1SH 2IJ0C 1DLFL 1QBMH 2P8PA 3EUUA 2FO4B 3EGSB 1HQ4A 3NFSL 5MENA 4PY8J 3P9MA 5BXFA 2EDHA 3FOLA 4WHYG 1J1OH 1JF6A 3P2TA 3MGTB 4NZTH 4MNHB 3VGDA 5KVMC 4D0CA 1ND0B 2I5YL 5ISZD 3VXSE 2QQNL 3T77B 4AT6B 1AO7D 1WAAF 4NQDB 1WZMA 1T0MB 4NNPL 5FYJE 4DOHE 3AXLB 3O0RH 4HW6A 5J56B 3FO2A 2FLBT 5EU3A 2P44B 4KQ3H 1JPTL 5HHVL 5DK2B 2OZ4H 3P4MB 4OCWH 1JZ6A 4PRPD 4PPTA 1JZ5A 4GQ9H 3EDEA 4KV5F 4ZG1A 1UM4H 1ZA6A 3LKSA 3QIWD 4HWBH 4OZFH 1A47A 2P5WE 5TGBB 4CU8A 1VFOA 1XF3A 5E70A 1XR9B 3GSUB 4PV9B 4GLRI 4KFZC 4LLWA 3DX8B 1MIEL 4NRXB 2H26A 4R0LA 1KEGL 3WFEH 5I16A 3IF1B 5HVHC 1NMAH 1JHTA 4W4OA 3IFPA 2AV1B 4ELMA 4LHUB 3LV3A 4N0YL 1CF8L 3WIFA 1JZ3A 2AK4E 4Z7WF 5C92A 3WIIL 5H94A 2EIEA 5E6ZA 4X80H 2BDNL 4BKLA 3RUGF 5M95B 1DE4B 4NZDA 2ZCLH 5BW7C 2UY7A 2RR3A 4OLEA 4X5WB 1A2YB 2WWKT 2O5YH 1F3RB 1D9KD 4Y4FD 3S35L 1J7VR 3QQ3A 4YDKL 1YMMB 5IR1B 4XTRC 2YUZA 3FB8A 5I17A 4JDTH 1M7XA 4FQXD 3BGAA 4Y5XC 3RBSA 4X4XB 2X10A 3HZVA 4XC1H 1GOHA 5DO2D 3HMWH 1IVLA 3B9VA 3G08B 3ROOA 4XXDB 3MLSH 5IHUH 1CE1H 3OKDA 1CDJA 2PR4H 2DMCA 3GNML 4G42A 2IFFL 1N59A 3UJJL 4Z7WB 3C60A 4QTIL 1OSPL 4WV1A 1UB6A 4BSWB 2YUVA 3GB7A 3MJ7A 1F02I 3ULUF 5DLML 3C6LB 1NEZB 4U33A 5TE7L 1BD2D 4N9GA 4N8CL 5T3ZE 2E8ZA 3PL6D 4JKPL 4PB9L 4S1QL 5KG9B 1U91A 5EBLB 4DZBA 3QUKB 4JLRA 1VB9A 2X09A 3SOBL 4Z78A 3PP3K 4NN7B 4QNPE 1A6ZA 2MHAA 2WUCH 1P4BL 1U0QA 1I1AC 3QO1A 4LLQA 2R2BA 4ZPTA 3OB0H 4KJPD 1Z9LA 2WUBH 3H6JA 1JWSA 1TNMA 1AQKL 4IRSC 5F9JB 2LU4A 4NO2B 1MWAL 4DKEL 3NAAL 4EVNA 1H9VA 3OKKA 1CGYA 4HJJL 3PWNB 5IBLC 1HHIA 2BOBB 2W60A 4JPVL 5ID0B 3VFGL 4MJIA 4P3CL 4K9EL 4M8VA 3I6LE 1CGXA 1YNLH 1FYTA 3SY0A 4MSWA 4PJAE 3SCMC 4GRLC 4PJGB 2YKLH 2P48B 3FQWB 1FLRL 3L9RA 1LEKB 2BFVH 1C5CH 4UDUB 1U8OB 1NANI 1GGIH 3B6SA 4NQSA 2ED8A 2CK0L 1BECA 3DRQB 5CSZB 4YHYC 1UZ6F 5BS0E 4LDOB 2IAMB 4GXUM 2A73B 2JF1A 3QDJE 4MJ6B 3UBXG 3BKCH 3MUY1 5SWZE 1NGZA 3MR9B 5F7DA 2R23B 1EEYA 2NR6C 3BT2L 3VDBA 5JW4Q 4NQCE 1KEMH 3V4VL 1U3HB 4I5BB 3VGBA 2NQCA 2VE6A 2Z93B 1ZAGA 3LD8B 5EUOA 4QWWC 3QI9B 4XNQB 1RFDL 3RPKA 2WINB 4U1JA 1KJMB 4YUEH 4HJ0C 3VFMA 3BO8B 1VERA 3OMZA 3CSBA 5E1AA 2XXMB 2RHEA 3SKOA 4LPXA 2BNUA 2IQAA 2V2XA 5EO1B 2W91A 3IDIB 1FL5A 5E2VH 1GC1C 3HZMA 4GKSA 5IJKC 3FB6A 4KKAD 3GSRA 4H88L 3SDAC 6FABH 4ZUVB 3GSNB 1VADA 1BFVH 3SDDD 1G1YA 4NZJA 3C9NB 4J23A 1EEQA 3NFNA 2FX7H 3TH2T 5I1HH 1S7RB 32C2B 1JPST 3EJYC 1BQUA 1MFEH 4K7PY 3LAFA 4IOIA 2R4SH 1D5IL 2DQDH 2R56H 4GAGH 5C0EB 3KHOA 4K8RH 4YH6A 1WT5C 3QIBA 3E6FA 4YIQB 1NEUA 4QOKD 1UM6L 3RJQB 1NBZB 3BH8A 1C16A 1ZGLB 1PJ9A 4HUKB 3KDMA 4X6EB 4LNVA 4BSVA 5E8OB 4G7YH 4OCYH 3KPRA 1DP0A 4Q0XL 5FYJL 3QHZL 4APQD 2EZ0C 5DC4B 3LH2L 2ENSA 3UPAA 3LN5B 5J11B 2VUYA 2LAGB 2QSCH 2PTTA 1UGNA 5E24E 3BGMB 3LEVL 2JB5H 3A6CH 2A77L 4BH8A 3V5HB 1BX2B 3QNZB 3EYVA 4GXVH 4YHPA 2JB6A 4I4WB 3RHWF 3H3KA 3T1FB 1X6NA 4MCYB 5IV2A 2MSPA 4IHOA 3FO0H 4ZUTA 1IM3B 2EDXA 3J8F7 2JE8A 2YPLA 1PGRB 2HVKA 4K07A 4G6JL 3KPQA 4L29B 3LKRB 3LRHA 3U4EB 1S7SB 1AR2A 3BE1L 4M7KH 3DXAB 3LZFH 3HI5L 5M94B 5HGAA 1QRNE 8CGTA 4PYHA 4RA3A 4XVJH 4EXPX 1YEHL 4R6UA 5C8JA 1H3PH 4LL9A 1R6VA 1RULH 3NPSB 2G5RA 4HIEB 4R96B 2FJFB 5I73C 3NCEB 1CQKA 5IIEB 3SHSA 3ZTNL 2NY4C 3PABB 3AM8C 4QHNB 5CEZE 3G6JA 4TNVF 1XR8B 1VFBA 4NP4L 5CSBA 2A6IA 2NY6B 1KB5L 1QBLL 1DN0A 1CYGA 1TCMA 3BWUC 5I1IL 1PKQE 3MGOB 4ETYA 4RX4D 5K9KA 2Z31D 4XAKE 1EEZA 1YEDB 4WW2C 4Q7DA 1KJVA 3QQ4A 4ZO8A 4DTGH 3BXNA 4GOSA 4XHJC 2EDLA 2G9HA 2YWYA 3F8UB 3L3OA 5HHMB 1HI6A 2CDFB 1YY9C 1YQ2A 3R8BB 3DSNA 4KKLD 2CIIA 2HTLD 3QUXB 1JK8A 1FNFA 1FNGB 4I0KA 4PJ7B 5DJ2B 1ZT1B 1LE9B 4KQ4H 5DQDL 5DEZA 2AK1H 4OF0A 4OZHF 1DQLL 3I6GA 3FQRB 3ARSA 4JG1H 4F7CB 5E4EB 3AS2A 3GGWB 1RURL 3B83A 4KHXH 1SJEA 3KLAA 4OCNC 2R2HA 2AEQH 3RGVC 3OAZK 1YEJL 5MP6H 1MQ8A 4Z7OF 1NGQL 3HMXA 4P2QB 3DV4B 4P9HH 3H3BC 3D39D 1I9RH 5GRJL 3SO5A 1LEIB 5B8CB 5IMKA 1J8HE 1IEHA 1P5VA 1JZ8A 3GK8L 3CSGA 1TTUA 5KSBF 4OFVA 3TF7C 5LGKA 1KJ3H 1TLKA 1HNGA 3SO3C 3MV8A 3SQOH 5FCUH 2C1PA 5KSUB 2RAMA 1Y6MR 3PWJA 3T04D 3O4LB 3V0VA 1HKLH 2L7UA 3RNKA 3MYJB 3DIFB 2VLMD 3WO4B 4WW1B 1ZWIB 2ITCB 3VRIB 4OZHB 4JDZA 2DDQH 3VJ6A 4AM0A 2VERN 2HG5A 1JFQL 2ZUWA 5ILTH 1QSED 3Q1SL 1R3IH 2BY0A 1NGYA 2WIIB 1QBML 1T66D 4WFEE 4K2UL 4FQHA 1BWWA 1NLBL 4MJ4A 4J3SA 1J1OL 8FABB 2VXTL 3GSWB 4KK9D 4R0LC 5D7KE 4NZTL 3GM8A 4Z5RA 5HYJD 1F3DH 4FFVD 4W4OC 4E41A 1DQJA 1UWXK 1KTKE 2BSRB 5KAQG 2X05A 3LSOB 3TV3H 5DJ6A 2J5LB 3VXOA 5KSBB 2V7HA 4JDVB 2VZOA 1E6JH 4JO4H 1Z5LA 4PG9B 1I1YB 5E9DB 4FA8A 3MOQA 3SPVA 4KQ3L 1EFXB 5DDHB 3GBNH 1FIGH 5KOVC 2OZ4L 4OCWL 3D0VA 3VWKA 1ZHNB 3ARBD 3HZYB 5CJBA 3OKMB 4KKCD 4GQ9L 3VGEA 2H2PC 1ZMYA 1ZLVH 1UM4L 1LILA 3G04A 4HWBL 2JIXB 4ELKA 4HKXA 3T0EB 4N90E 3OAZH 3VE0B 3X17A 2VDOH 4LLUA 1JGEA 1NCDH 2CO6B 3QDGD 1KNOA 3C8DA 2P43B 3FTGA 4Q6IA 3WFEL 1NMAL 5DVNA 1KCVH 4HGWB 1F6AB 3D2UD 1J0YA 1JMZA 2BCKA 3HG1D 2HKFH 2EDWA 3TJEL 2VABB 4WV1C 1TJHH 4UIKH 3RIAK 1NCUA 5T1KB 3BD3A 1QEWA 4X80L 3F5WB 3TVMB 1M71A 2ZCLL 2DLGA 3O6KH 4WHDA 4XX1E 2DTSA 5JXEA 2WBKA 4U1KA 4D0BB 2VDLH 1GZQB 3QULA 5D1ZD 3FL7A 2Y5TB 1MF2H 2O5YL 2R1WA 3BP4B 4LFHG 2R0ZH 4OLZH 3IDMB 3STZB 4I18B 5JLZA 4P2OA 4JDTL 3QJHA 4XC1L 2VLKB 2XYCA 5J13B 3HMWL 1MCDA 1MCIA 2WWMC 4TVPH 1UWXH 5FYLL 4R3SA 4RMVA 1EDQA 1UH3A 3MLSL 5IHUL 1CE1L 1KGCD 4LSUH 1B0GA 1QLFA 2PR4L 3GKZA 3CZJA 3HC0A 3QEUA 3MGAA 2X4NA 3MV01 3T0BA 2D7TH 5IQ9A 1FZOB 3VXPB 4RFOH 1I9JL 1TDQA 2QR0B 3UTSD 1F4YH 4NBZB 1A9BB 3MLWH 5DJDB 1L6ZA 4GBXA 3DGCR 3WL9A 3SGKA 4KWUA 4YQXH 4P4KD 3SKNB 2R1YB 2WUCL 1W0WA 2CLVB 3MOAH 1D9KC 4Y4FC 3ARDA 1RIVH 4H0HB 4NKDB 1DVFB 4HS6A 4KRPC 2ZG1A 2WUBL 5C0BD 1IGTA 4YWGH 5K9QG 1AHWB 4LASH 2BSSB 4OLYH 5DO2C 5E99H 1DSFL 2GJJA 1R5VA 1RK1B 3HAEH 1WCBB 5CBEA 4Y4KB 3RVVD 3ZE0F 3Q0HA 4JFPB 1YNLL 2NXZD 3VW3H 1BM3H 4Y88A 2AEPH 2YKLL 2MJWA 2BFVL 2ARJA 1RZ7H 1C5CL 4OZIF 3WE6A 3MXVH 5I0DA 1A6WL 3MJ6A 4PFEA 1ZSDA 5EPMA 5E7BA 4I3RH 5CMAB 5HYSA 1MI5A 1A8JH 5EIVA 5BZWB 1EVUA 3IGAB 4A6YA 5I18H 4MS8D 3BKCL 1EGJH 3RWHB 1ED3A 1G9MH 5EOCJ 1A6TB 4KJPC 1MUJB 2PCPB 1FYHB 3SJVA 3QIBC 5DYOB 4UDTA 4LVHB 2YK1H 1X7QB 3VXUE 3B5HA 2GCYB 5CZXC 4LGPB 3U6RA 3RNQA 3L1OH 1UCBL 3BISA 1FGVH 1FNHA 2PYED 4N9OB 5F9OH 3P0YH 3EZJB 1YEEH 3ZKXB 1XF4A 3CPLA 4OZIB 4MXVE 4QHLA 5FDYA 4EN3D 2R0LL 3CFEA 3MUJA 5E2VL 2GUOB 2NYYD 3B43A 4KMQA 4PBVC 1XGYH 4PRDA 1LE5A 4X4ME 3U7AA 1BFVL 1FNAA 3CNKA 3O8XB 2NLJA 4G8EB 1VKXB 3VI4E 1MFEL 2R4SL 2R56L 2DQDL 4GAGL 4QHKJ 1Y6NR 4K7FA 5C08B 5A2LH 1BVLA 4PR5A 2BRRH 4XX1G 1K2DB 1QFUH 1P7HL 1A6AB 2IBBA 3OAUH 1FFRA 3MRIA 2HT4C 4G7YL 3R06A 5HHPB 1HH9A 3HE6A 2K1MA 1ZHBA 1NBYB 5D5ME 4N8VA 4U1IB 3P0GB 2ZPKH 1NFKA 4PRNB 2QSCL 1A7OH 4JFFD 4IM8A 1L0YA 3G5VA 3S37X 2JB5L 2UWEF 2EDQA 5JOPD 5C1MB 2ADJB 4GXVL 4K71C 4X7EC 1BOGA 2HFFB 1T2QH 4R4ND 5DD1H 5A3ID 5FF6B 4KJYB 4FQJH 3FO0L 3SDDC 5CGYD 2X4UA 4P2RE 1QPXA 4YHKH 4V1DA 1T21B 2GITA 4G8GA 1KT2B 1A7RL 4MA8L 3DV6A 3MRPB 1UZ8B 1VFUA 1U92A 2V2WB 3TPUA 2YOCA 5SWSE 1BJ8A 3LZFL 3MREA 4X6CF 4TULH 2XWTB 4XVJL 4LLDB 1H3PL 1T1YA 5GS1A 3VXRB 1RULL 5HPOA 5H37H 2FJGB 3VCLB 5IFAH 1WUNT 1ROWA 5J1AA 5DHVA 3DI3B 4APQC 1OOAA 4GRMA 2UWEB 3MV7D 1S7WA 1F2QA 1YMME 3OR7B 1T1WB 2GAZB 3OF6A 4I77H 1GH7A 4FQPA 4PGEB 4TOYL 4NKMA 3GMPB 1CFNB 3CJJA 2FWOB 2X4QA 3TM6A 1HWHB 3D85A 5DRZB 2X89D 3NIDF 4DTGL 4FXGB 1HHJB 1G7PB 2NZ9C 5C86A 2PYFA 1U58B 3KVQA 4Z7WE 3IFNH 2DI8A 3FT3A 1Y0LA 4X6CB 5F7EL 2DYPA 5ESQB 4CUCA 4YDJB 1FN4B 4KQ4L 5F6HJ 2HLFC 2F74A 2AK1L 1QRKA 4GW1B 3L3DB 1Q0YL 2I07A 3P3YA 1HXMA 4JG1L 1WWAX 3MRLB 4RMQA 3VH8B 4KHXL 2XA3A 4L3ED 4K7PX 2AEQL 3RWDB 4MDIB 3TH3T 4LSRH 5IBUG 5MP6L 2NNAB 4JFFA 2HFEA 2RBLA 3SDCB 2GYSA 1FFNB 5DTFB 5JIPA 1ACZA 1O7SA 3BQUA 3IFOA 2QEJA 5IB1A 3MRGB 1AD0B 1BZQK 1I9RL 3BH9A 4LBEB 2O5ZH 2W9DH 5ALBH 1AY1L 4MJ5B 4FTVA 4ZPVB 3UROR 1KJ3L 1R5WB 3SQOL 5FCUL 3TO2B 3ALPA 3S3PA 1HKLL 4BZ1H 4PJ5B 4WFHE 2I9TA 4QCIA 1YY8A 2BNQE 3VWKC 4OGYL 4KKLC 4D3CH 4LK4A 1T03H 2HTLC 3O4OC 4ONFH 2VISB 3B3IB 5DI8B 5ILTL 4PJGE 3U30B 1R3IL 4X9GA 3UTPE 4NQTA 4OI8A 1P4LB 1Q1JH 3NN8A 4GS7C 4NQUA 1PSKH 4O58H 3G6AA 1KENH 2QSVA 3EYQD 1JHKH 4PGJA 5KSVB 1E4KA 2Y36H 4X6DA 1NMCC 1S9VA 1AXIB 5CZKA 5C9KA 5FO7A 3BZEB 3DVNA 3TV3L 1DANU 4RIRA 5BZDA 4RGNB 1U8IB 1U93B 1E6JL 4JO4L 5ACMA 2NY1B 1EAJA 1T3FA 3B2UC 1MCWM 1ZXQA 1FIGL 3GBNL 1I9IH 3FQNB 2EYSB 3VXSD 3WSQH 4HUVB 3REVB 5BV7B 5JXEC 4KJQD 4XAWH 5FYJD 1TVHA 2L4OA 4JAMB 4OF8A 5HGHB 4NQEE 4TUOA 4WI3A 4HEME 5DR5H 2J8UE 3HRPA 3HRZB 2VLLB 4UUJA 3CFBB 4XCEA 1MCKA 1S7XA 2VDOL 4JFZL 1W0VA 2DTMH 5AYUH 1NCDL 4LCUA 1IAMA 3BESR 2VSCA 2DJ4A 1BF8A 4S2SA 3QIUB 3NABH 1I3RB 1KCVL 4POZD 5E4IA 4LHUG 2KZ1B 1AD9A 2P5WD 1QLRB 1JNJA 2HKFL 4KK9C 1YMHA 4NT6B 4IMLA 1OF2B 2IG2H 5F1NA 2H32H 1EO8H 5DJZA 1EMTH 4ZMAT 3ISWA 1JNLH 3HS0A 2XXCB 4KROB 4PRBB 3O6KL 1CD1A 4Y16B 2AK4D 3SGKC 4MHHG 3NZHH 2CUHA 1A6VH 1MF2L 3MLTA 4R7NA 3BEVA 1ZKAA 3MRDA 2R0ZL 4OLZL 3RX5A 5J12B 3MX0A 2AJZB 4XP1H 2RB8A 3CFKB 4MD0B 5EBMB 1JZ7A 3BWAB 5E94A 3BD5A 4X4YA 3ARDC 5C0RH 2H2SD 4FP8L 1J0JA 4JY4A 1JE6A 1CVRA 4TVPL 5EO9B 4G80B 4ISVB 2XNAA 4OZ4B 5E6IB 1T2JA 5C3TA 2RIKA 1X5XA 4LSUL 5E08H 4KKBC 4WGVB 2GJZB 3KPLA 2OX5A 5IOPB 1N3NB 5I1KH 3WXVH 5IFHH 1E27A 2V2TA 2D7TL 1J5OH 3SDXA 4CN1A 1NEZG 4JVPA 1N5AB 4RFOL 3SKMA 1F4YL 1JF1A 1U8PB 1A64A 3MLWL 3DXAE 3ARQA 4MAYA 1JUFA 4WJ5A 5TF0A 5HJ3B 4FFWC 2JJUA 4YQXL 4BK4A 4I2XA 1ZTXH 4X6BB 5J06A 1KIUA 3MRFA 3FFCA 2P8LA 3MOAL 2F5AL 5T3ZD 4S0TD 1RIVL 2EC9T 2R1XB 4M93B 3MNVB 1I8KB 4YWGL 1FNLA 4FMFA 5FO9B 3OJDA 3K2UL 5FYKH 4LASL 3O6MH 5BMFH 4JM2D 4LVOC 4QT5B 2X6MA 4C55A 1ZA3B 2NXYD 1PW3A 3QWOA 1I7UB 3EIFA 1NBVH 4F15C 1NJ9A 4PP2A 3TBYB 4P5MB 1UXWB 4HFWB 4JHAL 3VW3L 4WWKA 1BQSA 5EZLB 3WHXB 1BM3L 1CD9B 3N9GH 4QHUA 1FFQA 2AEPL 3O3EB 2XTLA 5D93B 4PJ7E 3CX5K 3MXVL 2XWJA 2V9RA 4BA8A 3I6LD 2ICES 5CHNB 1NGPH 2OTUB 5GRUH 3BP7A 5I18L 1EGJL 1BJ1J 4QY8B 2GK0A 3VD9A 1G9ML 1BWMA 4YNYA 3V5DA 4P2QE 2YD3A 5D2NB 4I0PD 3C08H 5BS0D 4NDMA 1MJJA 2PW1A 4MA3A 4L9LB 3PWVB 1HQRB 2YSSB 5SWZD 2A74A 5ICYB 4Y7MA 5JQ6H 4XP5H 4G6MH 4OD2A 1KCRH 3VFSB 5JZ7D 5IMMA 1DFBL 1FGVL 3RVVC 2XN9B 3HE6C 4U3HA 3JUZA 3PGFH 3O4LE 4PUBH 5F9OL 4O00A 1YEEL 1SJHB 5D1XB 1FORH 5I1DB 4OZHE 1IGYB 3WJJA 2Y72A 4NZRH 2DJSA 2X44D 4WEBH 1T1XA 3EYOB 4WEMB 4QXTA 1FCCA 1IZJA 4N0UB 4DGVH 4Z7OE 1I1CA 3TBSB 5C07E 3G5YB 1JHLH 1EBAA 3CLFH 4MS8C 1AQDB 2WBJA 3MYZA 5KANI 1DL7H 3M17B 2BRRL 1QFUL 4KUCD 4CN6A 3CZFB 1S7VB 2CKBB 4RMWA 2VR5A 2EYRB 3QPXH 3MXWH 4RRPA 4MB4A 3L7FB 4HJGA 1KIRB 2ZOKB 5E9DE 1TQCB 4QRTA 5GS1C 2W0FA 1ZT4B 1CDIA 2PTVA 2VITB 3O6FA 2ZPKL 3VXNB 4TTGA 4WI9A 4KRLB 5FHBH 1A7OL 4U0RB 4NCC1 1OGAD 1A7QH 3UEZA 1NKRA 1AGDB 4HK3N 3T0EE 4G8IB 1CXHA 3D6GA 4RCAA 2F8XC 1T2QL 1U8KB 5AYQA 5E95B 5DD1L 3MRNB 5D9SA 4FQJL 4AIZB 4YHKL 4ZFOA 5SX5H 5F88A 2X70A 2CRMA 5CIPH 3S4SB 4I0PA 1KACB 4L8BA 4Y1AB 2JCCE 1LD9A 3BZFB 4LKXB 4K3DH 3LQAH 4TULL 1RJYB 2HJLA 3QDJA 4PJBA 5CEXB 1SYSA 4NNXA 1MREL 2HYMA 5IFAL 2G2RA 3PV7A 2BVQB 1J87A 2PO6D 2CXKA 4YFEA 4NQCA 3LEXA 4Q9CA 3QDMD 1XGTB 4PRHE 5C3LD 4EOWH 4FRWA 5L8LB 3FT4A 3QFJB 4KRMB 1U8JA 5DJXB 1VACA 1PKOA 4F9LA 4I77L 2VLKE 4M7LT 1E6OH 2EDJA 3BQUC 3E2HC 1CFSB 3S96A 5CEZD 1KPRB 5JHDA 1P7QA 2ATPB 2FSEA 3JV6A 1MJ8H 1JMXA 1Q9WA 4R4NC 5A3IC 4LFHD 2BOCB 5IG7B 1TFHA 4XWOD 1XGPA 5CGYC 4MNQB 4UIMA 3IFNL 1RUPH 1JPGA 4U1NB 1ZGLP 4XRCB 1EHLH 4XAKD 3HI6H 2GHWB 1FC2D 1NFIA 2GJ6B 5IJVA 1RJZB 1S7UA 3UMTA 5DZNA 4MLIA 5C0AA 4ODWB 3KLDA 1XMWA 5IB2B 2ADGA 3S8WA 3THMH 3IETA 3C6SB 2IH3B 5J6HA 3WFDH 3LKQB 4LSRL 5HYQB 4U1MA 5HGDA 1E4KC 4Z7VF 3DPBA 4BQ6A 5EB9A 2VQ1A 5ISZB 3EHBD 4TUJB 2O5ZL 2W9DL 4M61B 5ALBL 2VL5B 2UV3A 2HJFA 4XNZC 1SQ2N 2X4TA 3FCTA 3K3QA 2Q6WA 2ZOLB 2EXYD 1DQMH 4BZ1L 4PJEA 5TJWK 4D3CL 1T03L 1I7RA 2WV3A 4ONFL 4HDIB 4PTUA 4IJ3C 1M7DB 5D2LA 2OL3H 4BSJA 1A3LH 1HH6B