1JI7A

Crystal structure of tel sam polymer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDELYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerization of the SAM domain of TEL in leukemogenesis and transcriptional repression.
pubmed doi rcsb
molecule keywords ETS-RELATED PROTEIN TEL1
source organism Homo sapiens
molecule tags Transcription
total genus 20
structure length 77
sequence length 77
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1ji7A00
1SGGA 4NL9C 1UCVA 2E8MA 2EAOA 2F8KA 2F3NA 2DKZA 5JTIA 1JI7A 2QB0A 4NJ8A 2QKQA 3BS7A 3KKAC 4MHVA 1LKYB 1V38A 1OW5A 2KIVA 2EANA 2ESEA 3TADA 1V85A 2L5YA 1DXSA 2JV3A 1SV4A 1OXJA 1SXDA 2LMRA 2QB0B 1Z1VA 1X40A 3TADC 2KG5A 4PZOA 2Y9UA 2QB1A 3H8MA 1KW4A 2D3DA 3K1RB 1X66A 1WWVA 1PK1A 2K4PA 1X9XA 1F0MA 2QARB 1SXEA 2QARA 3SENA 2ES6A 2Y9TA 2DL0A 1B4FA 3BQ7A 2KSOB 2EAMA 2DKXA 1SV0A 2KSOA 5J8YA 3BS5A 3TACB 2YTUA 4PZNA 5L1MA 1B0XA 4IS7A 4RQNA 2E8OA 1COKA 4RQMA 2EAPA 1PK1B 1UQVA 2F44A 2E8PA 2B6GA 3IDWA 1SV0C 5J8YC 2D8CA 4NL9A 5F3XB 2LPEA 3HILA 2KE7A 1RG6A 2K60A 3BS5B 1LKYA 2GLEA 1WWUA 5KNIA 2FE9A 2E8NA 5JRTA 1PK3A 3SEIA 2KMDA 3KKAA 5JU5A
chains in the Genus database with same CATH superfamily
1SGGA 4B9NA 2HOIA 3WKAA 5DBAA 3VC8A 4UQGA 3GIJA 3RR8A 1QCKA 1NKBA 2GO7A 2JH1A 4DL6A 4ELUA 5EOZA 3HRDD 1DGJA 3TANA 3AQEA 4DCCA 1N48A 3IG8A 4PGYA 4C8OA 5DB8A 2H5XA 5J2FA 3B0YA 4JV2A 4RNOA 4RQ0A 3K1ZA 5CA7A 3C2LA 2K8AA 4M6WA 2KEYA 5J0QA 1QQ5A 4O3PA 3AL0B 5EWFA 1WCNA 4DFDA 1AQ6A 4R66A 2Y0SF 4KMOB 3PW0A 2C2DA 2N1RA 2KK0A 9ICEA 2V4QA 5EE1A 4PGXA 2FLNA 1L6NA 4ECQA 2PFQA 5KFSA 2W7OA 1Q3UA 3BQTA 4Z6DA 2AU0A 1B0XA 3EYZA 4C8MA 2KTQA 2RDIA 2HHTA 4FZNA 1BPXA 3MR3A 1UQVA 2B6GA 1S97A 2LI6A 4P4OA 5HMLA 2HDOA 5KTQA 4IR9A 3UMBA 5DB6A 5BOLA 9ICHA 3SAGA 4Y2TA 2GLEA 4YMOA 4DFMA 1RYSA 1ZYQA 2LYHA 4P0PB 2IOHA 1N56A 9ICUA 4M9LA 9ICBA 5KFIA 2EQYA 2JEGA 4Y2VA 2HHXA 2RHFA 4Y2JA 4DQSA 1CUKA 1L7NA 3RRGA 2ZUBA 3D6JA 2XGQA 2B0CA 3F2CA 5L1KA 4DL4A 1QH9A 4J9PA 1J2NA 3TFSA 4C8KA 1QLNA 1X42A 2MRLA 2L5YA 4FBUA 4KX5A 1IIPA 3SQIA 3THVA 1JIHA 3H7IA 2ZUDA 4QNLA 1T3QA 3C21A 1J2MA 2BCVA 5KFFA 3UMCA 3PVXA 1A0PA 3J81j 3H8MA 5AKKA 3FYHA 2WF7A 3SAFA 3ALRA 3EZ5A 1A6SA 3JPQA 1RQLA 2HW3A 2BCRA 2ZJAA 5EE9A 1D8BA 1ZQQA 3PW4A 3PSPA 4RU9A 1NK7A 2JEIA 4F93B 3I1YA 4FE3A 1MQ3A 3RB3A 1KFTA 1CI4A 1BPDA 5J2AA 3UXNA 2P35A 2WB1C 2RP5A 2WF8A 1SKRA 3SD7A 3SZ2A 2GH1A 2ISOA 3L5KA 2WF6A 4ECWA 3QU7A 1NJWA 2F44A 2KIWA 4RT3A 4KLJA 2DWQA 8ICYA 3UM9A 1NK6A 4J9MA 4QWCA 1VDVA 5KG7A 5KFQA 1NKEA 1L3UA 4KLUA 3KFUF 4ZH4A 3SV3A 5DQHA 3HT3A 1TK5A 4A8EA 3RR7A 2E8MA 8ICAA 1O08A 1KSPA 2WFAA 5J2EA 3EWAA 2IHMA 3IRUA 2WAQC 1FIQA 1Z3EB 2BHNA 8ICWA 2NRXA 5AHXA 4PL2A 4UB4A 1XWLA 2WB1F 2W9BA 1X9WA 2OYYA 1QSYA 3C29A 2KOBA 3T5LA 4R65A 2F1IA 3OHAA 2HOQA 3G6VA 3RJGA 3JPNA 1ZD5A 3RFAA 3C1ZA 3U26A 4CF5A 2J6TA 5G5HA 4F5QA 3FC4A 9ICNA 4ECUA 4QWEA 1PK1A 1WG8A 2FPMA 2K4PA 8ICBA 3QEBZ 1F5SA 5DLFA 4OCZA 2I9GA 1JXLA 2KJ5A 2EAMA 1SWWA 2YTUA 3OJSA 5E79U 4QZEA 7ICRA 1K5OA 8ICLA 1MSWD 3RAQA 3NGDA 2PKEA 2E8PA 4EBDA 8ICTA 2LHTA 5F3XB 4QWBA 5AIBA 4C7ZA 1RXVA 3WK8A 1FFUA 4OJ6A 3TKAA 2XIDA 1Z00B 5ALJA 3PX0A 1D9DA 5D4BA 2BGWA 2W9AA 4F91B 3WK7A 9ICJA 3GIIA 7ICLA 2F8LA 4C0ZA 4R63A 3A0BU 5C0YA 3SYZA 4F4ZA 1JMSA 4UBCA 5J2JA 5ALUA 2EAOA 3WKEA 3QYPA 2LYAA 1JI7A 2QB0A 2UVWA 1FEZA 2ZIUB 1V9PA 4US9A 3PSFA 1LKYB 3F5AA 5KT4A 4I28A 2I6XA 4K4GA 1NJXA 1BNOA 1N61A 3PSTA 3RH4A 1VJ5A 9ICSA 4YN4A 2LMRA 4GLXA 1Z1VA 1QTMA 1SL2A 2KKVA 4DWIA 5KFPA 3TADC 2KG5A 4AP9A 1ZQOA 5BPCA 1KW4A 7ICPA 2J6SA 4JMUA 4MEXA 1NK5A 2ATLA 3V6KA 4EELA 4YFKA 4LVSA 2QARB 4Y2XA 3GV5B 3FM9A 4P4MA 4J9KA 3BQ7A 2KSOB 5K4LA 3CNHA 4M6WB 2BKEA 1UT5A 3AEVA 2CN1A 3V72A 5IILA 1QSSA 2NRVA 3H4DA 4I2HA 5AKGA 5D49A 2QLTA 2D8CA 4DLEA 4UB3A 2Q4TA 5ALZA 3KHLA 1PZNA 2LBOA 2JGAA 5KFOA 4I2GA 5KNIA 3V7LA 4J9SA 5CB1A 4HYKA 2YQEA 2D6FC 2I1QA 5L9XA 7ICKA 8ICXA 4TUQA 3BDPA 1TAMA 2M0NA 3O0FA 2EZXA 2NYVA 3N4MB 1ZQMA 9ICOA 1JRPA 3BS7A 5DLGA 2WF9A 7ICJA 4LZGA 3MR5A 1AROP 4CCHA 1ZQPA 3MFIA 2HVIA 2HHWA 2P6RA 2YMPA 5AKIA 3K4GA 5ALSA 3RJIA 1H38A 4NLBA 3KZXA 5DG7A 2G5IB 2YN4A 3QU4A 5AI6A 2HI0A 5KG3A 5KFVA 1XS9D 5KL8B 1HUOA 4RT2A 4FBTA 3TI0A 3LYSA 4RQ1A 5KFLA 5TZVA 4UAVA 3BZCA 1U45A 2NO4A 5AKJA 2C2EA 2HHQA 5J2DA 3H4BA 3V7KA 4UAYA 2FMPA 4F2RA 2ES6A 4F71A 4F72A 3NVZA 3OSPA 5AM0A 2OXOA 1S10A 3UXPA 4M9HA 3EW9A 4DL3A 1SL0A 5L1MA 4F5RA 3H40A 5EWEA 4UB6U 3KHRA 4YR2A 4I2JA 2BQRA 4DQPA 2YB4A 2BQUA 2ODGA 3IDWA 1SV0C 2XGPA 5IIOA 4GC7A 5DGBA 4UAUA 1S8OA 1N5WA 1T3NA 3CW2C 3OGUA 4RPZA 5C5JA 4K4HA 2KE7A 8ICNA 2I5HA 1BPBA 2PFNA 4C4RA 2W3RA 3F53A 4B9VA 1ECWA 1RZTA 3IHQB 4BDPA 4QWAA 7ICMA 4KLTA 1NI3A 3PW7A 3HKZC 4DQIA 2A3VA 7ICTA 3IP4B 5AI5A 3MGIA 3L4PA 3SR6A 5J2CA 2ZIUA 3E58A 2K4EA 1V38A 2CXYA 5KFKA 2JHDA 3MR2A 4EBCA 1IM4A 4IR1A 4YXJA 1BPYA 7ICUA 4RPYA 4AYBC 2A1JA 5AKLA 4CRXA 4JUZA 2PI5A 5L1LA 4ED1A 1F44A 3NRWA 5KFRA 5KFCA 5KFHA 2OM6A 4MFCA 1NZPA 4ED2A 1UPHA 4BWMA 1S5LU 3Q8LA 4PZOA 4F2SA 3SAHA 3LVWA 3C28A 3M8RA 1YZ7A 1XNSA 1ZQKA 4EZ9A 1LVHA 1WWVA 5AM3A 2W9BB 5KAIU 1HUZA 3PO4A 2QARA 1IV8A 3T79A 1SIJA 2K89A 4QZCA 5D46A 3UQ0A 2Y1IA 2KSOA 3QUQA 1SWVA 2DQNB 4DLGA 7ICOA 2H3IA 2OHFA 4RQ3A 4Q8FA 9ICTA 3H0LB 2Z7JA 2EZYA 1RDFA 3M9OB 1NKCA 1PK1B 2GWSA 3N7PD 5CHGA 5IIMA 5KG1A 2G08A 4MEYA 5AK4A 3ZD9A 5J8YC 2XI9A 1S0NA 4NL9A 4NWIA 1ZQFA 5AIAA 2KNJA 5KFTA 4GIBA 2LM4A 2ZXIA 3BQ1A 1RG6A 1ZOLA 5ALKA 1WWUA 3TQ1A 4IRDA 3MGVA 2HHUA 1IXRA 5ALMA 8ICQA 2KP7A 5JU5A 9ICAA 1QSLA 4J9QA 1HJPA 1UCVA 1ZQZA 4C8NA 1P7DA 2VIXA 3RJJA 4RPXA 2F8KA 2H3FA 4G3IA 3QX7A 5HR7A 4Y2YA 5AI4A 4UB8U 3T5JA 2BCSA 1ZQSA 4KLQA 1NJZA 4Q45A 2MUTA 4I2AA 1OW5A 2NO5A 2E1FA 5HP4A 2ESEA 4OJOA 3H8SA 3GV8B 3RB4A 3AU2A 3GV7B 4JV0A 3T5KA 5DB7A 1N60A 3NVYA 3HPOA 2XY7A 3EPGA 3JPRA 4ECSA 1L8LA 1SB3C 2QB0B 3QZ8A 4QZBA 3N7SC 4B9TA 8ICSA 2YMQA 1X40A 2AHOB 2MU2A 1L7PA 3PV8A 8ICEA 3BZKA 4TQSA 4DFPA 4DFKA 2ZJ5A 3AM9A 4TURA 3FAHA 4U7CA 1C20A 3TAPA 4ECVA 1JX4A 1NOMA 4M9JA 3GIMA 4B9LA 3BS5A 2ZIXA 3TACB 2HHSA 4HAIA 4GFJA 2HVHA 1IG6A 4YVZA 4ED0A 4EBEA 5KFYA 4RQMA 4EENA 1N63A 3AUOA 2GOLA 4QZ9A 4ED3A 4KN4A 1TFRA 5KL1B 4Y2RA 5KFWA 2JEJA 4Q8EA 1U4BA 2E8NA 4B9UA 1LV5A 5KFDA 1WYGA 5ALIA 5HHHA 4MF2A 9ICPA 4RQ2A 4EX7A 2W8LA 3JPTA 1HEKA 5HNKA 1Z4NA 5JTIA 2ASLA 3N28A 5HHIA 4NXZA 3LDAA 2CRXA 3F5EA 4CF4A 3KKAC 4JB3A 2G07A 5ALDA 3RAXA 3V6JA 5J0XA 1LB2B 2H3ZA 4C8LA 4BWJA 4YD1A 1OXJA 9ICLA 1TK0A 4RUCA 2PXIA 1SKWA 4F4YA 2AGOA 5AM2A 4IQWA 4DL5A 3KHGA 1JXEA 5AI9A 2IHNA 2CPRA 2ZG6A 4J9RA 3WKDA 4E0DA 5G5GA 2K4IA 4DSKA 4ICAA 3QNMA 3NTUA 2DBYA 2VA3A 4O5EA 3IN5A 4YMMA 2AQ4A 4DSIA 5AM1A 5L1IA 3DEEA 1EXNA 3ONNA 4KLIA 3OJUA 1Z19A 7ICGA 3JPOA 4RQNA 2MA1A 4UBBA 3I28A 7ICFA 2KICA 2E8OA 3LWLA 1X9SA 4JWNA 1COKA 2EAPA 1SL1A 5ALFA 5AKZA 1FFVA 4KLDA 4ZOHC 2BDPA 1O03A 1BNPA 1NK8A 9ICRA 5DBCA 2IOFK 4KLFA 2KHVA 4O3RA 2XO7A 4ECZA 4OJLA 2HBMA 3RBEA 2DPIA 3RJFA 4DFJA 2WAQF 2ZTDA 3L3FX 2FPLA 5JRTA 4NM1A 3PZPA 4ECYA 3E0FA 4MFAA 4GC6A 3C1YA 3WK6A 2ZJ8A 2HSZA 4M2YA 5A0LA 4DQQA 3IG5A 1XU4A 5CP2A 1KDHA 1ZJMA 3PR4A 2UVRA 3MDAA 3SV4A 2G0AA 4QIWC 1D9FA 1RYRA 2O6KA 2FMSA 1TV9A 4M9NA 5EE0A 2KD1A 5KT6A 2ZTCA 2Q0ZX 3KHHA 3MABA 4PHAA 2YMMA 5J0RA 8ICCA 4DSJA 3QZ7A 1N62A 5KG5A 4FZLA 2JV3A 1ZQUA 1U49A 3GDXA 2BCUA 5KFEA 3CYMA 4O3OA 2ZIVA 1KFSA 5KFXA 1KKXA 1U9LA 4QZHA 4CE6A 5DQGA 2RDJA 2RRDA 1SZHA 1TAUA 3MBYA 4KLOA 2H3VA 2A1JB 1ZQWA 5ALPA 3AN1A 4I2BA 5KAFU 1RQNA 5ALLA 2E5SA 2DKXA 4Y2UA 5IIIA 4RNMA 1NK0A 4Q43A 2JZBA 4UW9A 5F9NA 3AU6A 2BZFA 4MF8A 1T94A 4M9GA 4KITB 3OPXA 2R8HA 3Q8QB 4QZIA 2W3SA 8ICRA 5ALXA 3WU2U 2DFLA 4USAA 1N5XA 2KZ3A 3CRXA 3ZDAA 4TUSA 1ZRMA 1ZQ1C 5J0SA 4FZMA 3JPSA 3TARA 1PK3A 5AKHA 3ICXA 2NV3A 4OD0A 4BJQA 4UASA 2BPGA 4ECTA 3G6YA 1KL9A 3TFRA 2C22A 3KTQA 4IQUA 3UMGA 1TAQA 2RQ5A 3QU2A 5J2BA 4EZ6A 4EYHB 8ICFA 3E2EA 4NJ8A 8ICJA 1KEJA 3LWMA 3QUCA 4P2HA 2XVTA 2LYBA 5ALQA 1BPZA 4PL1A 5DDMA 3M6KA 4O3SA 2HMXA 1JROA 3MR6A 1ZQBA 5CJ7A 1GO3F 2PFPA 5J2HA 2XY5A 1ZD3A 4RNNA 1PVQA 3GU3A 1NK9A 3M8SA 2WTFA 2BCQA 5J2IA 2V9WA 3GILA 3KD3A 2MUTB 4NLZA 3PR5B 5AM4A 5CRXA 1SKSA 9ICWA 3GZFA 4XA5A 3FDSA 3M9MB 3RBDA 3UXOA 4OO1J 5DQIA 4XUSA 3OHBA 4DOAA 1X9MA 4F50A 4BX9C 9ICVA 5AKYA 1PVPA 1L7OA 1ZQIA 1ZQJA 1ZQDA 4F8RA 4CGZA 4Q44A 5KFGA 5J0YA 5HR6A 3BQ0A 4KLSA 1KLNA 4M0AA 3GFKB 1S76D 5ALTA 1YT3A 2JEFA 1X6IA 5AK6A 4KLHA 4PH5A 5CEHA 3NRZA 4Y2PA 4Z6CA 2KKPA 3Q8PB 3BS5B 2ZIXB 3BQ2A 2R18A 2YY6A 7ICVA 4PGQA 5JUMA 1OUQA 8ICKA 5KFZA 3SEIA 1Q8KA 2MSNA 2VA8A 4Y2SA 2AGQA 1DK2A 4O0IA 3TAQA 5ALHA 4UB1A 1WUDA 5J0TA 3V7JA 2QKQA 2DF4B 5ALGA 2VANA 4ED6A 4O3NA 4EX6A 3ZDCA 1KRPA 3UQ2A 5FP0A 3PSIA 1ZD4A 2G09A 1ED1A 3M1YA 4YXMA 4TUPA 4I2FA 3M6ZA 3TADA 2OCEA 3PO5A 4NLGA 3SMVA 3ED5A 3WK9A 3DV9A 1SXDA 3R9KA 3HX0A 5DG8A 5KT3A 2FLPA 5KFNA 1L7MA 2LKYA 2WF5A 2Y9UA 1ZRNA 4QZ8A 3GIKA 3UPQA 1X66A 2IA6A 4F92B 4NM2A 1ZQTA 3GQCA 2JH7A 5KT7A 4DF4A 1L5UA 4JK1A 4DS4A 2XC9A 3B9JA 4I2DA 2F77X 2R8IA 2RLTA 4CF3A 1TVAA 5ALWA 4P0QB 3IM1A 3ISDA 5GTHU 3PW5A 9ICGA 1SZPA 4FO6A 4J9LA 2MAXA 3D2NA 3WKCA 4B9MA 3OSNA 1DRGA 5KFJA 5KT2A 3HKZF 3ZDEA 7ICIA 2ZUCA 5BOMA 5DBBA 2UVVA 1D8YA 1S0VA 2HHVA 8ICOA 3H8WA 5EWGA 4M04A 2KMDA 2BPFA 3EPIA 2C2RA 4G9BA 4YD2A 4YQWA 4DSFA 3M7DA 2UVUA 2A1AA 1UA1A 4UATA 5AKEA 5J29A 4AYBF 2A19A 4IQVA 1NNLA 4KLEA 7ICNA 3RH6A 4DL2A 4PPXA 1N2XA 3NUQA 4F4XA 2R8KA 9ICIA 2NRTA 5DKWA 5ALYA 2ISPA 1ZD2P 3N97B 1RXWA 2W7PA 3A0HU 2F2AB 5J0UA 2H3QA 4QZFA 3WK4A 1MC8A 5KFMA 2KHQA 1WCLA 3Q8RB 2ASJA 9ICMA 4BUGA 3HJEA 5IINA 2ZIWA 8ICMA 2DPJA 4OJPA 2FPKA 2W03A 2HBKA 2KVCA 8ICUA 3Q8MA 3ZI4A 3SENA 3RJHA 2EDUA 3PMLA 4FFDA 3C23A 1XO0A 4EEKA 1SV0A 2ZIVB 4XRHA 4ELTA 4IS7A 5KFBA 4Z6EA 3LVVA 1BPEA 1TKDA 4DS5A 2AXTU 3HWTA 1NK4A 3Q8SB 4J9OA 4I2IA 3JPPA 1CRXA 3DDHA 3RF9A 1A76A 4I29A 2VJ5A 1KTQA 5KG0A 4RZRA 8ICGA 2W54A 2JXJA 3QUBA 3HW8A 2LPEA 4F4WA 8ICIA 3HILA 5ALRA 1M6YA 2W9CA 1XSNA 3D2QA 2JZBB 1UT8A 1L3TA 5ALNA 4RQ4A 2BPCA 3MFHA 4DOCA 2C28A 3G6XA 4I27A 2AGPA 3RTVA 1KBUA 4BXOA 4C80A 1JALA 2HBJA 2FJ6A 4QZDA 4QZAA 1MN8A 2PI4A 2EANA 8ICZA 4ED8A 2KJ9A 1MQ2A 1V97A 3NVWA 1U48A 2DGZA 2KZZA 4YR3A 1S0OA 2PMZC 1ZETA 2FDRA 1XO1A 5T14A 2K8CB 1KQQA 4F5PA 1FO4A 2W55A 1KN5A 4NY8A 4NLCA 3C5GA 2XCPA 1Z4OA 3C5FA 2XY6A 2D3DA 4R8UA 3K1RB 3KBBA 5ALOA 3EUB2 4NV0A 4LJXA 2BQ3A 4KN7A 4FS1A 4CDGA 4QJFB 3T5HA 2V4RA 9ICCA 1ZQCA 5J8YA 1HIWA 1PUZA 3F2BA 3K75D 2WHEA 3HP6A 5EE3A 4QW8A 3PMNA 3S6JA 7ICQA 2HBLA 4U6PA 4P0QA 3WK5A 5TISU 2VJ4A 4P4PA 4C4SA 1XSLA 3PX6A 1ZJNA 2KFNA 2F1JA 1NJYA 7ICEA 2FLLA 2PMZF 2OWOA 4BGDA 3ETLA 3ISBA 1ZQGA 2FE9A 1MA7A 5J2GA 4O3MA 4NLKA 1K1SA 3QU9A 2ALZA 3RRHA 5DG9A 4DEZA 5CR0A 2HCFA 5ALVA 4OJ5A 2LM1A 2DKZA 1JN3A 4RQ8A 4UAWA 2XCAA 4UARA 4ED7A 1T8EA 3ZDDA 4ELVA 1S0MA 2VKQA 4YMNA 1RYUA 2G5HB 5AICA 1T7PA 3Q8KA 3NASA 4I2CA 4GXKA 1DXSA 5J0WA 1SV4A 1Y88A 1ZQYA 3ISCA 5DDYA 2G06A 3QE9Y 2P6UA 4GXIA 1QQ7A 3QEAZ 2R8JA 3KOOA 4WJ3B 9ICFA 4XQ8A 2Y1JA 1NZBA 8ICVA 1ZQXA 2QB1A 3LK9A 1ZXIA 4PHEA 5HMMA 5CWRA 5L1JA 5J0PA 5KFAA 2W8KA 3D2SA 3CP8A 1B43A 1QQ6A 5AK3A 4YCXA 1PVRA 2K8BB 5IIJA 3MGHA 1SXEA 3IV6A 4JWMA 4MFFA 5J2KA 1L8OA 5KG6A 3RB0A 1T4GA 9ICKA 4PHPA 1CEZA 1BGXT 3ZD8A 1UA0A 3C2KA 2BR0A 5DB9A 4P0PA 4O5CA 4IRKA 4GXJA 1DOQA 1URJA 4KLMA 1ZQVA 3OTQA 3AQFA 2F76X 1TE2A 1ZQNA 5KT5A 5IIKA 3PNCA 3NVVA 4QIWF 3F2DA 1JUDA 3KKAA 4LZDA 2BDUA 3H0MB 4UAZA 5J0OA 4I2EA 3N7RC 3QUTA 4X5VA 2F1HA 5GTIU 3PY8A 2F3NA 3C2MA 3MC1A 2HOFA 4O5KA 2EZZA 4YR0A 2YX8A 4DSLA 2IOFA 3ORYA 2PFOA 1X2IA 5AKXA 3T3FA 2KN7A 4C7YA 2B21A 4DOBA 2ASDA 4M47A 9ICXA 4TQRA 2P66A 3AMZA 2E3TA 3WKBA 4F3OA 2AJQA 4RQ6A 8ICPA 5ALEA 1DGSA 1J97A 2E1EA 4RUAA 1ZQEA 2W04A 2JMGA 2W9MA 1X9XA 4IL6U 2M9NA 2Y9TA 1ZQLA 1RM6C 2DL0A 4RQ7A 2ZIWB 3RJKA 3RJEA 4K4IA 2K4HA 1L3VA 4DO9A 5KG2A 4PHDA 4DQRA 2FMQA 3ETRA 3KZIU 1D8LA 3V6HA 4B9SA 2JR5A 4F5OA 4ECXA 2NRWA 1S77D 1S9FA 4CNQA 4PJ0U 2AH5A 3NS1A 5DGAA 2YMLA 3RB6A 5F9LA 4QWDA 2FI1A 4DF8A 1COOA 4Z6FA 1VLBA 4EEYA 3H8JA 2KZMA 4J03A 2OEHA 1Q46A 3VCBA 4KLGA 4ECRA 4NL9C 4FS2A 1BVSA 2ZXHA 2KVSA 4O9MA 2KJ8A 4KLLA 1KFDA 3ZDBA 2KV2A 2KFZA 2W11A 4F4KA 1Q3VA 2W9CB 4DSEA 4MHVA 3BJYA 1TK8A 1RPLA 2KIVA 3PW2A 7ICHA 1U47A 2OH2A 1DK3A 4ACOA 5KFUA 1V85A 2J6UA 1B22A 3H0RB 5H2FU 4F5NA 4QW9A 3SI8A 4KTQA 4BXOB 1ZQAA 4J9NA 5AM5A 4KX3A 4KMUA 3I76A 2IMWP 2ZTEA 3PX4A 4UB5A 1L3SA 1ZQRA 2W43A 5KG4A 4YP3A 4IC9A 4O3QA 4C4TA 1XSPA 7ICSA 3QXGA 2YB1A 1UHUA 1F0MA 1Z1BA 5B5EU 1A77A 4Y2QA 4NLNA 2NRZA 4QZGA 1B4FA 3RH5A 5B66U 1Z00A 4DL7A 4PZNA 1K1QA 4IQTA 2DUYA 3MDCA 5AI0A 3QU5A 4R8UB 5AI8A 2R8GA 4RQ5A 4B6JA 4UB2A 2JRZA 2IBKA 1ZQHA 3M9NB 2EH9A 3B0XA 2XICA 1YZ6A 2K60A 2AQ0A 2Y0SC 4YG2A 1X6JA 4JV1A 8ICHA 1LKYA 4IRCA 9ICQA 1XC9A 1C7YA 5AK5A 4R64A 4US8A 2VA2A 4EYIB
chains in the Genus database with same CATH topology
1SGGA 4NL9C 1UCVA 2E8MA 2EAOA 2F8KA 2F3NA 2DKZA 5JTIA 1JI7A 2QB0A 4NJ8A 2QKQA 3BS7A 3KKAC 4MHVA 1LKYB 1V38A 1OW5A 2KIVA 2EANA 2ESEA 3TADA 1V85A 2L5YA 1DXSA 2JV3A 1SV4A 1OXJA 1SXDA 2LMRA 2QB0B 1Z1VA 1X40A 3TADC 2KG5A 4PZOA 2Y9UA 2QB1A 3H8MA 1KW4A 2D3DA 3K1RB 1X66A 1WWVA 1PK1A 2K4PA 1X9XA 1F0MA 2QARB 1SXEA 2QARA 3SENA 2ES6A 2Y9TA 2DL0A 1B4FA 3BQ7A 2KSOB 2EAMA 2DKXA 1SV0A 2KSOA 5J8YA 3BS5A 3TACB 2YTUA 4PZNA 5L1MA 1B0XA 4IS7A 4RQNA 2E8OA 1COKA 4RQMA 2EAPA 1PK1B 1UQVA 2F44A 2E8PA 2B6GA 3IDWA 1SV0C 5J8YC 2D8CA 4NL9A 5F3XB 2LPEA 3HILA 2KE7A 1RG6A 2K60A 3BS5B 1LKYA 2GLEA 1WWUA 5KNIA 2FE9A 2E8NA 5JRTA 1PK3A 3SEIA 2KMDA 3KKAA 5JU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SGG A;  4NL9 C;  1UCV A;  2E8M A;  2EAO A;  2F8K A;  2F3N A;  2DKZ A;  5JTI A;  1JI7 A;  2QB0 A;  4NJ8 A;  2QKQ A;  3BS7 A;  3KKA C;  4MHV A;  1LKY B;  1V38 A;  1OW5 A;  2KIV A;  2EAN A;  2ESE A;  3TAD A;  1V85 A;  2L5Y A;  1DXS A;  2JV3 A;  1SV4 A;  1OXJ A;  1SXD A;  2LMR A;  2QB0 B;  1Z1V A;  1X40 A;  3TAD C;  2KG5 A;  4PZO A;  2Y9U A;  2QB1 A;  3H8M A;  1KW4 A;  2D3D A;  3K1R B;  1X66 A;  1WWV A;  1PK1 A;  2K4P A;  1X9X A;  1F0M A;  2QAR B;  1SXE A;  2QAR A;  3SEN A;  2ES6 A;  2Y9T A;  2DL0 A;  1B4F A;  3BQ7 A;  2KSO B;  2EAM A;  2DKX A;  1SV0 A;  2KSO A;  5J8Y A;  3BS5 A;  3TAC B;  2YTU A;  4PZN A;  5L1M A;  1B0X A;  4IS7 A;  4RQN A;  2E8O A;  1COK A;  4RQM A;  2EAP A;  1PK1 B;  1UQV A;  2F44 A;  2E8P A;  2B6G A;  3IDW A;  1SV0 C;  5J8Y C;  2D8C A;  4NL9 A;  5F3X B;  2LPE A;  3HIL A;  2KE7 A;  1RG6 A;  2K60 A;  3BS5 B;  1LKY A;  2GLE A;  1WWU A;  5KNI A;  2FE9 A;  2E8N A;  5JRT A;  1PK3 A;  3SEI A;  2KMD A;  3KKA A;  5JU5 A; 
#chains in the Genus database with same CATH topology
 1SGG A;  4B9N A;  2HOI A;  3WKA A;  5DBA A;  3VC8 A;  4UQG A;  3GIJ A;  3RR8 A;  1QCK A;  1NKB A;  2GO7 A;  2JH1 A;  4DL6 A;  4ELU A;  5EOZ A;  3HRD D;  1DGJ A;  3TAN A;  3AQE A;  4DCC A;  1N48 A;  3IG8 A;  4PGY A;  4C8O A;  5DB8 A;  2H5X A;  5J2F A;  3B0Y A;  4JV2 A;  4RNO A;  4RQ0 A;  3K1Z A;  5CA7 A;  3C2L A;  2K8A A;  4M6W A;  2KEY A;  5J0Q A;  1QQ5 A;  4O3P A;  3AL0 B;  5EWF A;  1WCN A;  4DFD A;  1AQ6 A;  4R66 A;  2Y0S F;  4KMO B;  3PW0 A;  2C2D A;  2N1R A;  2KK0 A;  9ICE A;  2V4Q A;  5EE1 A;  4PGX A;  2FLN A;  1L6N A;  4ECQ A;  2PFQ A;  5KFS A;  2W7O A;  1Q3U A;  3BQT A;  4Z6D A;  2AU0 A;  1B0X A;  3EYZ A;  4C8M A;  2KTQ A;  2RDI A;  2HHT A;  4FZN A;  1BPX A;  3MR3 A;  1UQV A;  2B6G A;  1S97 A;  2LI6 A;  4P4O A;  5HML A;  2HDO A;  5KTQ A;  4IR9 A;  3UMB A;  5DB6 A;  5BOL A;  9ICH A;  3SAG A;  4Y2T A;  2GLE A;  4YMO A;  4DFM A;  1RYS A;  1ZYQ A;  2LYH A;  4P0P B;  2IOH A;  1N56 A;  9ICU A;  4M9L A;  9ICB A;  5KFI A;  2EQY A;  2JEG A;  4Y2V A;  2HHX A;  2RHF A;  4Y2J A;  4DQS A;  1CUK A;  1L7N A;  3RRG A;  2ZUB A;  3D6J A;  2XGQ A;  2B0C A;  3F2C A;  5L1K A;  4DL4 A;  1QH9 A;  4J9P A;  1J2N A;  3TFS A;  4C8K A;  1QLN A;  1X42 A;  2MRL A;  2L5Y A;  4FBU A;  4KX5 A;  1IIP A;  3SQI A;  3THV A;  1JIH A;  3H7I A;  2ZUD A;  4QNL A;  1T3Q A;  3C21 A;  1J2M A;  2BCV A;  5KFF A;  3UMC A;  3PVX A;  1A0P A;  3J81 j;  3H8M A;  5AKK A;  3FYH A;  2WF7 A;  3SAF A;  3ALR A;  3EZ5 A;  1A6S A;  3JPQ A;  1RQL A;  2HW3 A;  2BCR A;  2ZJA A;  5EE9 A;  1D8B A;  1ZQQ A;  3PW4 A;  3PSP A;  4RU9 A;  1NK7 A;  2JEI A;  4F93 B;  3I1Y A;  4FE3 A;  1MQ3 A;  3RB3 A;  1KFT A;  1CI4 A;  1BPD A;  5J2A A;  3UXN A;  2P35 A;  2WB1 C;  2RP5 A;  2WF8 A;  1SKR A;  3SD7 A;  3SZ2 A;  2GH1 A;  2ISO A;  3L5K A;  2WF6 A;  4ECW A;  3QU7 A;  1NJW A;  2F44 A;  2KIW A;  4RT3 A;  4KLJ A;  2DWQ A;  8ICY A;  3UM9 A;  1NK6 A;  4J9M A;  4QWC A;  1VDV A;  5KG7 A;  5KFQ A;  1NKE A;  1L3U A;  4KLU A;  3KFU F;  4ZH4 A;  3SV3 A;  5DQH A;  3HT3 A;  1TK5 A;  4A8E A;  3RR7 A;  2E8M A;  8ICA A;  1O08 A;  1KSP A;  2WFA A;  5J2E A;  3EWA A;  2IHM A;  3IRU A;  2WAQ C;  1FIQ A;  1Z3E B;  2BHN A;  8ICW A;  2NRX A;  5AHX A;  4PL2 A;  4UB4 A;  1XWL A;  2WB1 F;  2W9B A;  1X9W A;  2OYY A;  1QSY A;  3C29 A;  2KOB A;  3T5L A;  4R65 A;  2F1I A;  3OHA A;  2HOQ A;  3G6V A;  3RJG A;  3JPN A;  1ZD5 A;  3RFA A;  3C1Z A;  3U26 A;  4CF5 A;  2J6T A;  5G5H A;  4F5Q A;  3FC4 A;  9ICN A;  4ECU A;  4QWE A;  1PK1 A;  1WG8 A;  2FPM A;  2K4P A;  8ICB A;  3QEB Z;  1F5S A;  5DLF A;  4OCZ A;  2I9G A;  1JXL A;  2KJ5 A;  2EAM A;  1SWW A;  2YTU A;  3OJS A;  5E79 U;  4QZE A;  7ICR A;  1K5O A;  8ICL A;  1MSW D;  3RAQ A;  3NGD A;  2PKE A;  2E8P A;  4EBD A;  8ICT A;  2LHT A;  5F3X B;  4QWB A;  5AIB A;  4C7Z A;  1RXV A;  3WK8 A;  1FFU A;  4OJ6 A;  3TKA A;  2XID A;  1Z00 B;  5ALJ A;  3PX0 A;  1D9D A;  5D4B A;  2BGW A;  2W9A A;  4F91 B;  3WK7 A;  9ICJ A;  3GII A;  7ICL A;  2F8L A;  4C0Z A;  4R63 A;  3A0B U;  5C0Y A;  3SYZ A;  4F4Z A;  1JMS A;  4UBC A;  5J2J A;  5ALU A;  2EAO A;  3WKE A;  3QYP A;  2LYA A;  1JI7 A;  2QB0 A;  2UVW A;  1FEZ A;  2ZIU B;  1V9P A;  4US9 A;  3PSF A;  1LKY B;  3F5A A;  5KT4 A;  4I28 A;  2I6X A;  4K4G A;  1NJX A;  1BNO A;  1N61 A;  3PST A;  3RH4 A;  1VJ5 A;  9ICS A;  4YN4 A;  2LMR A;  4GLX A;  1Z1V A;  1QTM A;  1SL2 A;  2KKV A;  4DWI A;  5KFP A;  3TAD C;  2KG5 A;  4AP9 A;  1ZQO A;  5BPC A;  1KW4 A;  7ICP A;  2J6S A;  4JMU A;  4MEX A;  1NK5 A;  2ATL A;  3V6K A;  4EEL A;  4YFK A;  4LVS A;  2QAR B;  4Y2X A;  3GV5 B;  3FM9 A;  4P4M A;  4J9K A;  3BQ7 A;  2KSO B;  5K4L A;  3CNH A;  4M6W B;  2BKE A;  1UT5 A;  3AEV A;  2CN1 A;  3V72 A;  5IIL A;  1QSS A;  2NRV A;  3H4D A;  4I2H A;  5AKG A;  5D49 A;  2QLT A;  2D8C A;  4DLE A;  4UB3 A;  2Q4T A;  5ALZ A;  3KHL A;  1PZN A;  2LBO A;  2JGA A;  5KFO A;  4I2G A;  5KNI A;  3V7L A;  4J9S A;  5CB1 A;  4HYK A;  2YQE A;  2D6F C;  2I1Q A;  5L9X A;  7ICK A;  8ICX A;  4TUQ A;  3BDP A;  1TAM A;  2M0N A;  3O0F A;  2EZX A;  2NYV A;  3N4M B;  1ZQM A;  9ICO A;  1JRP A;  3BS7 A;  5DLG A;  2WF9 A;  7ICJ A;  4LZG A;  3MR5 A;  1ARO P;  4CCH A;  1ZQP A;  3MFI A;  2HVI A;  2HHW A;  2P6R A;  2YMP A;  5AKI A;  3K4G A;  5ALS A;  3RJI A;  1H38 A;  4NLB A;  3KZX A;  5DG7 A;  2G5I B;  2YN4 A;  3QU4 A;  5AI6 A;  2HI0 A;  5KG3 A;  5KFV A;  1XS9 D;  5KL8 B;  1HUO A;  4RT2 A;  4FBT A;  3TI0 A;  3LYS A;  4RQ1 A;  5KFL A;  5TZV A;  4UAV A;  3BZC A;  1U45 A;  2NO4 A;  5AKJ A;  2C2E A;  2HHQ A;  5J2D A;  3H4B A;  3V7K A;  4UAY A;  2FMP A;  4F2R A;  2ES6 A;  4F71 A;  4F72 A;  3NVZ A;  3OSP A;  5AM0 A;  2OXO A;  1S10 A;  3UXP A;  4M9H A;  3EW9 A;  4DL3 A;  1SL0 A;  5L1M A;  4F5R A;  3H40 A;  5EWE A;  4UB6 U;  3KHR A;  4YR2 A;  4I2J A;  2BQR A;  4DQP A;  2YB4 A;  2BQU A;  2ODG A;  3IDW A;  1SV0 C;  2XGP A;  5IIO A;  4GC7 A;  5DGB A;  4UAU A;  1S8O A;  1N5W A;  1T3N A;  3CW2 C;  3OGU A;  4RPZ A;  5C5J A;  4K4H A;  2KE7 A;  8ICN A;  2I5H A;  1BPB A;  2PFN A;  4C4R A;  2W3R A;  3F53 A;  4B9V A;  1ECW A;  1RZT A;  3IHQ B;  4BDP A;  4QWA A;  7ICM A;  4KLT A;  1NI3 A;  3PW7 A;  3HKZ C;  4DQI A;  2A3V A;  7ICT A;  3IP4 B;  5AI5 A;  3MGI A;  3L4P A;  3SR6 A;  5J2C A;  2ZIU A;  3E58 A;  2K4E A;  1V38 A;  2CXY A;  5KFK A;  2JHD A;  3MR2 A;  4EBC A;  1IM4 A;  4IR1 A;  4YXJ A;  1BPY A;  7ICU A;  4RPY A;  4AYB C;  2A1J A;  5AKL A;  4CRX A;  4JUZ A;  2PI5 A;  5L1L A;  4ED1 A;  1F44 A;  3NRW A;  5KFR A;  5KFC A;  5KFH A;  2OM6 A;  4MFC A;  1NZP A;  4ED2 A;  1UPH A;  4BWM A;  1S5L U;  3Q8L A;  4PZO A;  4F2S A;  3SAH A;  3LVW A;  3C28 A;  3M8R A;  1YZ7 A;  1XNS A;  1ZQK A;  4EZ9 A;  1LVH A;  1WWV A;  5AM3 A;  2W9B B;  5KAI U;  1HUZ A;  3PO4 A;  2QAR A;  1IV8 A;  3T79 A;  1SIJ A;  2K89 A;  4QZC A;  5D46 A;  3UQ0 A;  2Y1I A;  2KSO A;  3QUQ A;  1SWV A;  2DQN B;  4DLG A;  7ICO A;  2H3I A;  2OHF A;  4RQ3 A;  4Q8F A;  9ICT A;  3H0L B;  2Z7J A;  2EZY A;  1RDF A;  3M9O B;  1NKC A;  1PK1 B;  2GWS A;  3N7P D;  5CHG A;  5IIM A;  5KG1 A;  2G08 A;  4MEY A;  5AK4 A;  3ZD9 A;  5J8Y C;  2XI9 A;  1S0N A;  4NL9 A;  4NWI A;  1ZQF A;  5AIA A;  2KNJ A;  5KFT A;  4GIB A;  2LM4 A;  2ZXI A;  3BQ1 A;  1RG6 A;  1ZOL A;  5ALK A;  1WWU A;  3TQ1 A;  4IRD A;  3MGV A;  2HHU A;  1IXR A;  5ALM A;  8ICQ A;  2KP7 A;  5JU5 A;  9ICA A;  1QSL A;  4J9Q A;  1HJP A;  1UCV A;  1ZQZ A;  4C8N A;  1P7D A;  2VIX A;  3RJJ A;  4RPX A;  2F8K A;  2H3F A;  4G3I A;  3QX7 A;  5HR7 A;  4Y2Y A;  5AI4 A;  4UB8 U;  3T5J A;  2BCS A;  1ZQS A;  4KLQ A;  1NJZ A;  4Q45 A;  2MUT A;  4I2A A;  1OW5 A;  2NO5 A;  2E1F A;  5HP4 A;  2ESE A;  4OJO A;  3H8S A;  3GV8 B;  3RB4 A;  3AU2 A;  3GV7 B;  4JV0 A;  3T5K A;  5DB7 A;  1N60 A;  3NVY A;  3HPO A;  2XY7 A;  3EPG A;  3JPR A;  4ECS A;  1L8L A;  1SB3 C;  2QB0 B;  3QZ8 A;  4QZB A;  3N7S C;  4B9T A;  8ICS A;  2YMQ A;  1X40 A;  2AHO B;  2MU2 A;  1L7P A;  3PV8 A;  8ICE A;  3BZK A;  4TQS A;  4DFP A;  4DFK A;  2ZJ5 A;  3AM9 A;  4TUR A;  3FAH A;  4U7C A;  1C20 A;  3TAP A;  4ECV A;  1JX4 A;  1NOM A;  4M9J A;  3GIM A;  4B9L A;  3BS5 A;  2ZIX A;  3TAC B;  2HHS A;  4HAI A;  4GFJ A;  2HVH A;  1IG6 A;  4YVZ A;  4ED0 A;  4EBE A;  5KFY A;  4RQM A;  4EEN A;  1N63 A;  3AUO A;  2GOL A;  4QZ9 A;  4ED3 A;  4KN4 A;  1TFR A;  5KL1 B;  4Y2R A;  5KFW A;  2JEJ A;  4Q8E A;  1U4B A;  2E8N A;  4B9U A;  1LV5 A;  5KFD A;  1WYG A;  5ALI A;  5HHH A;  4MF2 A;  9ICP A;  4RQ2 A;  4EX7 A;  2W8L A;  3JPT A;  1HEK A;  5HNK A;  1Z4N A;  5JTI A;  2ASL A;  3N28 A;  5HHI A;  4NXZ A;  3LDA A;  2CRX A;  3F5E A;  4CF4 A;  3KKA C;  4JB3 A;  2G07 A;  5ALD A;  3RAX A;  3V6J A;  5J0X A;  1LB2 B;  2H3Z A;  4C8L A;  4BWJ A;  4YD1 A;  1OXJ A;  9ICL A;  1TK0 A;  4RUC A;  2PXI A;  1SKW A;  4F4Y A;  2AGO A;  5AM2 A;  4IQW A;  4DL5 A;  3KHG A;  1JXE A;  5AI9 A;  2IHN A;  2CPR A;  2ZG6 A;  4J9R A;  3WKD A;  4E0D A;  5G5G A;  2K4I A;  4DSK A;  4ICA A;  3QNM A;  3NTU A;  2DBY A;  2VA3 A;  4O5E A;  3IN5 A;  4YMM A;  2AQ4 A;  4DSI A;  5AM1 A;  5L1I A;  3DEE A;  1EXN A;  3ONN A;  4KLI A;  3OJU A;  1Z19 A;  7ICG A;  3JPO A;  4RQN A;  2MA1 A;  4UBB A;  3I28 A;  7ICF A;  2KIC A;  2E8O A;  3LWL A;  1X9S A;  4JWN A;  1COK A;  2EAP A;  1SL1 A;  5ALF A;  5AKZ A;  1FFV A;  4KLD A;  4ZOH C;  2BDP A;  1O03 A;  1BNP A;  1NK8 A;  9ICR A;  5DBC A;  2IOF K;  4KLF A;  2KHV A;  4O3R A;  2XO7 A;  4ECZ A;  4OJL A;  2HBM A;  3RBE A;  2DPI A;  3RJF A;  4DFJ A;  2WAQ F;  2ZTD A;  3L3F X;  2FPL A;  5JRT A;  4NM1 A;  3PZP A;  4ECY A;  3E0F A;  4MFA A;  4GC6 A;  3C1Y A;  3WK6 A;  2ZJ8 A;  2HSZ A;  4M2Y A;  5A0L A;  4DQQ A;  3IG5 A;  1XU4 A;  5CP2 A;  1KDH A;  1ZJM A;  3PR4 A;  2UVR A;  3MDA A;  3SV4 A;  2G0A A;  4QIW C;  1D9F A;  1RYR A;  2O6K A;  2FMS A;  1TV9 A;  4M9N A;  5EE0 A;  2KD1 A;  5KT6 A;  2ZTC A;  2Q0Z X;  3KHH A;  3MAB A;  4PHA A;  2YMM A;  5J0R A;  8ICC A;  4DSJ A;  3QZ7 A;  1N62 A;  5KG5 A;  4FZL A;  2JV3 A;  1ZQU A;  1U49 A;  3GDX A;  2BCU A;  5KFE A;  3CYM A;  4O3O A;  2ZIV A;  1KFS A;  5KFX A;  1KKX A;  1U9L A;  4QZH A;  4CE6 A;  5DQG A;  2RDJ A;  2RRD A;  1SZH A;  1TAU A;  3MBY A;  4KLO A;  2H3V A;  2A1J B;  1ZQW A;  5ALP A;  3AN1 A;  4I2B A;  5KAF U;  1RQN A;  5ALL A;  2E5S A;  2DKX A;  4Y2U A;  5III A;  4RNM A;  1NK0 A;  4Q43 A;  2JZB A;  4UW9 A;  5F9N A;  3AU6 A;  2BZF A;  4MF8 A;  1T94 A;  4M9G A;  4KIT B;  3OPX A;  2R8H A;  3Q8Q B;  4QZI A;  2W3S A;  8ICR A;  5ALX A;  3WU2 U;  2DFL A;  4USA A;  1N5X A;  2KZ3 A;  3CRX A;  3ZDA A;  4TUS A;  1ZRM A;  1ZQ1 C;  5J0S A;  4FZM A;  3JPS A;  3TAR A;  1PK3 A;  5AKH A;  3ICX A;  2NV3 A;  4OD0 A;  4BJQ A;  4UAS A;  2BPG A;  4ECT A;  3G6Y A;  1KL9 A;  3TFR A;  2C22 A;  3KTQ A;  4IQU A;  3UMG A;  1TAQ A;  2RQ5 A;  3QU2 A;  5J2B A;  4EZ6 A;  4EYH B;  8ICF A;  3E2E A;  4NJ8 A;  8ICJ A;  1KEJ A;  3LWM A;  3QUC A;  4P2H A;  2XVT A;  2LYB A;  5ALQ A;  1BPZ A;  4PL1 A;  5DDM A;  3M6K A;  4O3S A;  2HMX A;  1JRO A;  3MR6 A;  1ZQB A;  5CJ7 A;  1GO3 F;  2PFP A;  5J2H A;  2XY5 A;  1ZD3 A;  4RNN A;  1PVQ A;  3GU3 A;  1NK9 A;  3M8S A;  2WTF A;  2BCQ A;  5J2I A;  2V9W A;  3GIL A;  3KD3 A;  2MUT B;  4NLZ A;  3PR5 B;  5AM4 A;  5CRX A;  1SKS A;  9ICW A;  3GZF A;  4XA5 A;  3FDS A;  3M9M B;  3RBD A;  3UXO A;  4OO1 J;  5DQI A;  4XUS A;  3OHB A;  4DOA A;  1X9M A;  4F50 A;  4BX9 C;  9ICV A;  5AKY A;  1PVP A;  1L7O A;  1ZQI A;  1ZQJ A;  1ZQD A;  4F8R A;  4CGZ A;  4Q44 A;  5KFG A;  5J0Y A;  5HR6 A;  3BQ0 A;  4KLS A;  1KLN A;  4M0A A;  3GFK B;  1S76 D;  5ALT A;  1YT3 A;  2JEF A;  1X6I A;  5AK6 A;  4KLH A;  4PH5 A;  5CEH A;  3NRZ A;  4Y2P A;  4Z6C A;  2KKP A;  3Q8P B;  3BS5 B;  2ZIX B;  3BQ2 A;  2R18 A;  2YY6 A;  7ICV A;  4PGQ A;  5JUM A;  1OUQ A;  8ICK A;  5KFZ A;  3SEI A;  1Q8K A;  2MSN A;  2VA8 A;  4Y2S A;  2AGQ A;  1DK2 A;  4O0I A;  3TAQ A;  5ALH A;  4UB1 A;  1WUD A;  5J0T A;  3V7J A;  2QKQ A;  2DF4 B;  5ALG A;  2VAN A;  4ED6 A;  4O3N A;  4EX6 A;  3ZDC A;  1KRP A;  3UQ2 A;  5FP0 A;  3PSI A;  1ZD4 A;  2G09 A;  1ED1 A;  3M1Y A;  4YXM A;  4TUP A;  4I2F A;  3M6Z A;  3TAD A;  2OCE A;  3PO5 A;  4NLG A;  3SMV A;  3ED5 A;  3WK9 A;  3DV9 A;  1SXD A;  3R9K A;  3HX0 A;  5DG8 A;  5KT3 A;  2FLP A;  5KFN A;  1L7M A;  2LKY A;  2WF5 A;  2Y9U A;  1ZRN A;  4QZ8 A;  3GIK A;  3UPQ A;  1X66 A;  2IA6 A;  4F92 B;  4NM2 A;  1ZQT A;  3GQC A;  2JH7 A;  5KT7 A;  4DF4 A;  1L5U A;  4JK1 A;  4DS4 A;  2XC9 A;  3B9J A;  4I2D A;  2F77 X;  2R8I A;  2RLT A;  4CF3 A;  1TVA A;  5ALW A;  4P0Q B;  3IM1 A;  3ISD A;  5GTH U;  3PW5 A;  9ICG A;  1SZP A;  4FO6 A;  4J9L A;  2MAX A;  3D2N A;  3WKC A;  4B9M A;  3OSN A;  1DRG A;  5KFJ A;  5KT2 A;  3HKZ F;  3ZDE A;  7ICI A;  2ZUC A;  5BOM A;  5DBB A;  2UVV A;  1D8Y A;  1S0V A;  2HHV A;  8ICO A;  3H8W A;  5EWG A;  4M04 A;  2KMD A;  2BPF A;  3EPI A;  2C2R A;  4G9B A;  4YD2 A;  4YQW A;  4DSF A;  3M7D A;  2UVU A;  2A1A A;  1UA1 A;  4UAT A;  5AKE A;  5J29 A;  4AYB F;  2A19 A;  4IQV A;  1NNL A;  4KLE A;  7ICN A;  3RH6 A;  4DL2 A;  4PPX A;  1N2X A;  3NUQ A;  4F4X A;  2R8K A;  9ICI A;  2NRT A;  5DKW A;  5ALY A;  2ISP A;  1ZD2 P;  3N97 B;  1RXW A;  2W7P A;  3A0H U;  2F2A B;  5J0U A;  2H3Q A;  4QZF A;  3WK4 A;  1MC8 A;  5KFM A;  2KHQ A;  1WCL A;  3Q8R B;  2ASJ A;  9ICM A;  4BUG A;  3HJE A;  5IIN A;  2ZIW A;  8ICM A;  2DPJ A;  4OJP A;  2FPK A;  2W03 A;  2HBK A;  2KVC A;  8ICU A;  3Q8M A;  3ZI4 A;  3SEN A;  3RJH A;  2EDU A;  3PML A;  4FFD A;  3C23 A;  1XO0 A;  4EEK A;  1SV0 A;  2ZIV B;  4XRH A;  4ELT A;  4IS7 A;  5KFB A;  4Z6E A;  3LVV A;  1BPE A;  1TKD A;  4DS5 A;  2AXT U;  3HWT A;  1NK4 A;  3Q8S B;  4J9O A;  4I2I A;  3JPP A;  1CRX A;  3DDH A;  3RF9 A;  1A76 A;  4I29 A;  2VJ5 A;  1KTQ A;  5KG0 A;  4RZR A;  8ICG A;  2W54 A;  2JXJ A;  3QUB A;  3HW8 A;  2LPE A;  4F4W A;  8ICI A;  3HIL A;  5ALR A;  1M6Y A;  2W9C A;  1XSN A;  3D2Q A;  2JZB B;  1UT8 A;  1L3T A;  5ALN A;  4RQ4 A;  2BPC A;  3MFH A;  4DOC A;  2C28 A;  3G6X A;  4I27 A;  2AGP A;  3RTV A;  1KBU A;  4BXO A;  4C80 A;  1JAL A;  2HBJ A;  2FJ6 A;  4QZD A;  4QZA A;  1MN8 A;  2PI4 A;  2EAN A;  8ICZ A;  4ED8 A;  2KJ9 A;  1MQ2 A;  1V97 A;  3NVW A;  1U48 A;  2DGZ A;  2KZZ A;  4YR3 A;  1S0O A;  2PMZ C;  1ZET A;  2FDR A;  1XO1 A;  5T14 A;  2K8C B;  1KQQ A;  4F5P A;  1FO4 A;  2W55 A;  1KN5 A;  4NY8 A;  4NLC A;  3C5G A;  2XCP A;  1Z4O A;  3C5F A;  2XY6 A;  2D3D A;  4R8U A;  3K1R B;  3KBB A;  5ALO A;  3EUB 2;  4NV0 A;  4LJX A;  2BQ3 A;  4KN7 A;  4FS1 A;  4CDG A;  4QJF B;  3T5H A;  2V4R A;  9ICC A;  1ZQC A;  5J8Y A;  1HIW A;  1PUZ A;  3F2B A;  3K75 D;  2WHE A;  3HP6 A;  5EE3 A;  4QW8 A;  3PMN A;  3S6J A;  7ICQ A;  2HBL A;  4U6P A;  4P0Q A;  3WK5 A;  5TIS U;  2VJ4 A;  4P4P A;  4C4S A;  1XSL A;  3PX6 A;  1ZJN A;  2KFN A;  2F1J A;  1NJY A;  7ICE A;  2FLL A;  2PMZ F;  2OWO A;  4BGD A;  3ETL A;  3ISB A;  1ZQG A;  2FE9 A;  1MA7 A;  5J2G A;  4O3M A;  4NLK A;  1K1S A;  3QU9 A;  2ALZ A;  3RRH A;  5DG9 A;  4DEZ A;  5CR0 A;  2HCF A;  5ALV A;  4OJ5 A;  2LM1 A;  2DKZ A;  1JN3 A;  4RQ8 A;  4UAW A;  2XCA A;  4UAR A;  4ED7 A;  1T8E A;  3ZDD A;  4ELV A;  1S0M A;  2VKQ A;  4YMN A;  1RYU A;  2G5H B;  5AIC A;  1T7P A;  3Q8K A;  3NAS A;  4I2C A;  4GXK A;  1DXS A;  5J0W A;  1SV4 A;  1Y88 A;  1ZQY A;  3ISC A;  5DDY A;  2G06 A;  3QE9 Y;  2P6U A;  4GXI A;  1QQ7 A;  3QEA Z;  2R8J A;  3KOO A;  4WJ3 B;  9ICF A;  4XQ8 A;  2Y1J A;  1NZB A;  8ICV A;  1ZQX A;  2QB1 A;  3LK9 A;  1ZXI A;  4PHE A;  5HMM A;  5CWR A;  5L1J A;  5J0P A;  5KFA A;  2W8K A;  3D2S A;  3CP8 A;  1B43 A;  1QQ6 A;  5AK3 A;  4YCX A;  1PVR A;  2K8B B;  5IIJ A;  3MGH A;  1SXE A;  3IV6 A;  4JWM A;  4MFF A;  5J2K A;  1L8O A;  5KG6 A;  3RB0 A;  1T4G A;  9ICK A;  4PHP A;  1CEZ A;  1BGX T;  3ZD8 A;  1UA0 A;  3C2K A;  2BR0 A;  5DB9 A;  4P0P A;  4O5C A;  4IRK A;  4GXJ A;  1DOQ A;  1URJ A;  4KLM A;  1ZQV A;  3OTQ A;  3AQF A;  2F76 X;  1TE2 A;  1ZQN A;  5KT5 A;  5IIK A;  3PNC A;  3NVV A;  4QIW F;  3F2D A;  1JUD A;  3KKA A;  4LZD A;  2BDU A;  3H0M B;  4UAZ A;  5J0O A;  4I2E A;  3N7R C;  3QUT A;  4X5V A;  2F1H A;  5GTI U;  3PY8 A;  2F3N A;  3C2M A;  3MC1 A;  2HOF A;  4O5K A;  2EZZ A;  4YR0 A;  2YX8 A;  4DSL A;  2IOF A;  3ORY A;  2PFO A;  1X2I A;  5AKX A;  3T3F A;  2KN7 A;  4C7Y A;  2B21 A;  4DOB A;  2ASD A;  4M47 A;  9ICX A;  4TQR A;  2P66 A;  3AMZ A;  2E3T A;  3WKB A;  4F3O A;  2AJQ A;  4RQ6 A;  8ICP A;  5ALE A;  1DGS A;  1J97 A;  2E1E A;  4RUA A;  1ZQE A;  2W04 A;  2JMG A;  2W9M A;  1X9X A;  4IL6 U;  2M9N A;  2Y9T A;  1ZQL A;  1RM6 C;  2DL0 A;  4RQ7 A;  2ZIW B;  3RJK A;  3RJE A;  4K4I A;  2K4H A;  1L3V A;  4DO9 A;  5KG2 A;  4PHD A;  4DQR A;  2FMQ A;  3ETR A;  3KZI U;  1D8L A;  3V6H A;  4B9S A;  2JR5 A;  4F5O A;  4ECX A;  2NRW A;  1S77 D;  1S9F A;  4CNQ A;  4PJ0 U;  2AH5 A;  3NS1 A;  5DGA A;  2YML A;  3RB6 A;  5F9L A;  4QWD A;  2FI1 A;  4DF8 A;  1COO A;  4Z6F A;  1VLB A;  4EEY A;  3H8J A;  2KZM A;  4J03 A;  2OEH A;  1Q46 A;  3VCB A;  4KLG A;  4ECR A;  4NL9 C;  4FS2 A;  1BVS A;  2ZXH A;  2KVS A;  4O9M A;  2KJ8 A;  4KLL A;  1KFD A;  3ZDB A;  2KV2 A;  2KFZ A;  2W11 A;  4F4K A;  1Q3V A;  2W9C B;  4DSE A;  4MHV A;  3BJY A;  1TK8 A;  1RPL A;  2KIV A;  3PW2 A;  7ICH A;  1U47 A;  2OH2 A;  1DK3 A;  4ACO A;  5KFU A;  1V85 A;  2J6U A;  1B22 A;  3H0R B;  5H2F U;  4F5N A;  4QW9 A;  3SI8 A;  4KTQ A;  4BXO B;  1ZQA A;  4J9N A;  5AM5 A;  4KX3 A;  4KMU A;  3I76 A;  2IMW P;  2ZTE A;  3PX4 A;  4UB5 A;  1L3S A;  1ZQR A;  2W43 A;  5KG4 A;  4YP3 A;  4IC9 A;  4O3Q A;  4C4T A;  1XSP A;  7ICS A;  3QXG A;  2YB1 A;  1UHU A;  1F0M A;  1Z1B A;  5B5E U;  1A77 A;  4Y2Q A;  4NLN A;  2NRZ A;  4QZG A;  1B4F A;  3RH5 A;  5B66 U;  1Z00 A;  4DL7 A;  4PZN A;  1K1Q A;  4IQT A;  2DUY A;  3MDC A;  5AI0 A;  3QU5 A;  4R8U B;  5AI8 A;  2R8G A;  4RQ5 A;  4B6J A;  4UB2 A;  2JRZ A;  2IBK A;  1ZQH A;  3M9N B;  2EH9 A;  3B0X A;  2XIC A;  1YZ6 A;  2K60 A;  2AQ0 A;  2Y0S C;  4YG2 A;  1X6J A;  4JV1 A;  8ICH A;  1LKY A;  4IRC A;  9ICQ A;  1XC9 A;  1C7Y A;  5AK5 A;  4R64 A;  4US8 A;  2VA2 A;  4EYI B; 
#chains in the Genus database with same CATH homology
 1SGG A;  4NL9 C;  1UCV A;  2E8M A;  2EAO A;  2F8K A;  2F3N A;  2DKZ A;  5JTI A;  1JI7 A;  2QB0 A;  4NJ8 A;  2QKQ A;  3BS7 A;  3KKA C;  4MHV A;  1LKY B;  1V38 A;  1OW5 A;  2KIV A;  2EAN A;  2ESE A;  3TAD A;  1V85 A;  2L5Y A;  1DXS A;  2JV3 A;  1SV4 A;  1OXJ A;  1SXD A;  2LMR A;  2QB0 B;  1Z1V A;  1X40 A;  3TAD C;  2KG5 A;  4PZO A;  2Y9U A;  2QB1 A;  3H8M A;  1KW4 A;  2D3D A;  3K1R B;  1X66 A;  1WWV A;  1PK1 A;  2K4P A;  1X9X A;  1F0M A;  2QAR B;  1SXE A;  2QAR A;  3SEN A;  2ES6 A;  2Y9T A;  2DL0 A;  1B4F A;  3BQ7 A;  2KSO B;  2EAM A;  2DKX A;  1SV0 A;  2KSO A;  5J8Y A;  3BS5 A;  3TAC B;  2YTU A;  4PZN A;  5L1M A;  1B0X A;  4IS7 A;  4RQN A;  2E8O A;  1COK A;  4RQM A;  2EAP A;  1PK1 B;  1UQV A;  2F44 A;  2E8P A;  2B6G A;  3IDW A;  1SV0 C;  5J8Y C;  2D8C A;  4NL9 A;  5F3X B;  2LPE A;  3HIL A;  2KE7 A;  1RG6 A;  2K60 A;  3BS5 B;  1LKY A;  2GLE A;  1WWU A;  5KNI A;  2FE9 A;  2E8N A;  5JRT A;  1PK3 A;  3SEI A;  2KMD A;  3KKA A;  5JU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...