1JICA

Solution nmr structure of recombinant sso7d with rnase activity, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords SSO7D
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1998-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jicA00
4ZK9B 2HDLA 4QUCA 5EKIA 3DEOA 4X3TA 2FINB 1MSHA 1J9OA 1EOTA 1NCVA 1AZQA 4CJ0B 2MP1A 4XT3B 1IKLA 2K01A 3H91A 2DY7A 1CA6A 1WTPA 5DNFA 1JE4A 2XIWA 1MSGA 2JYOA 2Q8TA 1EIGA 2L11A 1PLFA 5CORA 1G6ZA 1F2LA 1JICA 1IKMA 5CBAE 4IUPA 2H1EA 4IUUA 3G7LA 3KBXA 1TVXA 2VXWA 3KUPA 1HFNA 2X6GA 2HCIA 4OIKA 1HUNA 1PFBA 2M2LA 2FFKB 2RSNA 2CVRA 1RJTA 2K05A 3TN2A 1B3AA 1VMCA 1KNAA 5T1GA 2Q8RE 4IUQA 4DN4M 4ZKCB 1LV9A 1MGSA 2J7ZA 1WTXA 1F9SA 1NR4A 4X3UA 1PDQA 5T1IA 5CMDA 2NYZD 2L12A 4X3SA 3UI2A 1HRJA 5EPKA 3ONAB 2L1BA 1WTQA 1F9RA 1O7YA 1U4RA 2K04A 1RHPA 1CA5A 1E0BA 1DZ1A 1A15A 1X3PA 2B2VC 2B2TC 2B2WA 5EPLA 1RTNA 1O7ZA 2B2UC 2D9UA 4ZLTF 4HCSA 3FPUB 2K28A 3LWEA 4HEDA 4O42A 1BF4A 1XX8A 1EQTA 4ZAIA 5JJZA 1Q3LA 1F9PA 1RTOA 1C8CA 1EL0A 1BO0A 5EQ0A 2MPMA 2NZ1D 2L9HA 4OIJA 1M8AA 2KEDA 4CJ2C 3SVMA 2B2YC 1G91A 2B2WC 1IL8A 1DOKA 2B2VA 2X69A 3QO2A 2NWGA 2DY8A 2K03A 2FMMA 1MI2A 2L4NA 4IUTA 5E4WC 3IFDA 4XDXA 1NR2A 1WD1A 1AZPA 2EOTA 1CM9A 1ICWA 1NAPA 2FHTA 1F9QA 1VMPA 2R3ZA 5EPJA 3D6WA 1WTOA 2HCCA 2KUMA 3DEPA 3F2UA 1X32A 5EJWA 5CBEE 3FDTA 3I90A 4MN3A 1B53A 1DOMA 2RVLA 2N55A 1PFMA 3Q6SA 1WVLA 5AFWA 1WTWA 1BNZA 1DOLA 2KOLA 4U68A 2RA4A 4MHEA 3HP3A 5COYA 3R93A 3I8ZA 2B2UA 2HUGA 3P7JA 5E4XA 1WTRA 1QE6A 1ESRA 2EE1A 1QG7A 1U4MA 1PFNA 2X6LA 4CJ1B 1EIHA 2K1BA 2EPBA 2BDNA 1HA6A 3MWYW 4ZKBB 1DONA 4XT1B 2IL8A 4LMQD 3GV3A 1AP0A 4RWSC 1G2TA 1B4OA 1ML0D 2HDMA 3DM1A 3MTSA 1O80A 4RAUC 4R8IA 1WD0A 1RODA 1U4PA 4IURA 2JP1A 4X3KA 1X3QA 1HHVA 4NW2A 1B50A 1U4LA 1HUMA 3IL8A 1ILQA 1SSOA 5D14A 1HFGA 2SDFA 2MGSA 3TZDA 1GUWA 3N52A 2B2TA 1XYIA 4UAIA 1S4ZA 1WTVA 2FJ2A 3I3CA 4HSVA 2RSOA 4HAEA 4RA8A 4QUFA 1SAPA 2KVMA 5D65A 1J8IA 1SDFA 1BBXC 1QNKA 3I91A 4IUVA 2N88A 4R9WA 1B2TA 1KNEA 2KEEA 2KECA 2B2YA 1ILPA 1G2SA 2MJ8A 3GV6A 1ZXTA
chains in the Genus database with same CATH superfamily
5C44B 2I5LX 3T1YL 1S40A 1B9MA 5LL6S 2JA7H 1XMQL 1NCVA 4DK0A 4RGTA 2OCEA 3GDEA 4F88A 4NP5A 1VQLA 4PMBA 4DAYB 1JB7A 1YHQA 3HOUG 1Q82C 1KQSA 2HHHL 5C5MA 1N32Q 2ENBA 1SEBD 4IZ8A 1PYWD 3W3AA 1PXUA 3PO2H 1Q86C 5IWAQ 4HIOA 2WP8J 4A3BB 2EXZA 4LK1C 2F03A 3TEHB 3D4DA 3C46A 3P75A 1NR4A 3I4LA 5CMDA 1JORA 1SMYC 2F0VA 4GS3A 3GTGH 2R92H 2B2VC 4HTHA 2CQOA 4C3JH 1LT5D 4A3KH 4B9WA 2LXJA 5D3IB 3URYA 2K6AA 3CQZH 2RHSB 1K3BC 2F0DA 2PI2A 2PW7A 3VYTA 4DK1A 3K57A 4CJ2C 1Y8PB 1A62A 1J6QA 1STNA 1VQDA 1AZPA 2F0NA 3V2TA 1VMPA 4A3FG 2KHIA 2L5TA 2LS01 2EJFC 3PUWA 4GNXB 3ULPA 1K0SA 1FR3A 3TRZA 4KD4A 5M3MH 3CCVA 4K0KQ 1B53A 2F0GA 3UDIA 1D8LA 5JEAG 1IYUA 2CWAA 1DOLA 1TKWB 1BNZA 3MA2B 2HQEA 3KF6A 4KY5A 4KMUC 4XQNA 2LSSA 4BBRB 3PIPA 4LUOA 1D5MC 3M7GA 4OONA 1VQKA 2VNUD 3HRZC 2HDMA 3GTKH 4J6HA 3HOWH 1RODA 2KCMA 2JP1A 3R2IA 2UUCQ 4QY7A 1B50A 1JMCA 3CCJA 1EQVA 1Q1BA 4K5WA 1LT4D 1XYIA 2B63H 1S5DD 3S1RH 1YEZA 1C7YA 4DR5L 4JI5Q 4CDDC 3TP6A 1I4HA 4XQQA 3HOVH 3Q24A 4QUCA 4RMFA 4TVAB 3MC0B 3ULJA 4G57A 3DEOA 1EEID 1Q8IA 3TDQA 4Y7NH 4ULLA 2PMZE 1SYFA 3JAMi 1I4QA 3HOUB 1EQRA 3QG1A 3CHBD 2JYOA 1KAAA 2F52A 4LW1A 5K36G 4C2MB 4DR3L 1TIID 1NMGA 4AYBB 2A68C 1A8VA 1VQBA 2KHJA 1SRUA 4KY6A 4RGNA 2X6GA 1F2ZA 4DUZQ 1HH2P 2E2IH 2M2LA 1EZ8A 3HZXA 1VQIA 3FVQA 4RFBA 2N8NA 4DNIA 5CV7A 3KDFA 2IX3A 1KTKA 1ESFA 1EQQA 3IFTA 2A69C 2O5JC 4X3SA 3ONAB 2UXDQ 4P75A 1WTQA 1IW7C 5CGKA 1DM0B 4AH6A 1NY4A 5I9OA 1A15A 3GTJB 2ZXPA 3BG3A 2B2UC 3GQBA 3LX0A 2F0QA 1GUSA 2JA8H 4C3IB 2CQAA 1IBKQ 4M1UB 3RZOH 1IBLQ 5LMUL 2NWGA 4R1JA 3H94A 5G3LD 4A3GG 5E4WC 3PF4A 2R3ZA 2ZTEA 1J5EQ 1HR0L 2TMPA 1SNOA 3KLSA 5FLMG 2JEAI 1EU4A 2RCFA 4UP8A 1KDAA 2WACA 1VF7A 3I90A 5M5YH 2EYMA 2R61A 2AUKA 4DR6Q 1UWVA 2O4XA 5CV5A 4DR5Q 1XPRA 1MBYA 1EYDA 1PTOD 4POFA 2QCPX 3DLLA 4ME5A 2RDHA 1FNWA 4DV6Q 2CH4A 2AHOB 1M4VA 3CC2A 2UXBQ 1AP0A 5C4JB 1DD2A 2MHVA 4JI0L 3ERQA 2KHSA 1GUNA 3S14H 2PQEA 1YJNA 2Z4IA 2K32A 3B6YA 3RN5A 4FF4A 4Y52H 2UUBL 1U4LA 3HOUH 1STHA 3K5LA 5EBCA 1WTVA 5DLQE 2CCZA 4O0AA 1DGSA 3OOCA 2E8GA 3PO2G 1S5FD 1RD9D 3CCEA 4M8AA 4UP7A 1MSHA 1TT2A 1EOTA 3MVVA 2K01A 2ZXOA 3M3YH 1BCPF 2RKSA 1AE2A 2EY1A 2AUJD 2VS1A 1L0YB 2E5LL 2PNHA 4X66L 1QWYA 1HXYD 4A3KG 5GAEC 3MXGA 5EAYA 3BJUA 4LFCQ 1KL9A 5IT9E 4A3CG 3OW2A 2HQLA 3VR5A 4RHRA 5NUCA 1UE7A 1WYDA 5GAHC 4C56C 4YHHQ 3IRBA 3S2HB 5T1IA 4PZ7A 5JEAJ 2B29A 3J81L 1TR5A 1I6HB 1F9RA 4FNFA 4DNRB 1Y1VH 3L0OA 4OWWB 4KN4C 2NZOA 1PH3A 5E7NA 4DK6C 2BDOA 3K58A 1RTOA 1C8CA 2CFMA 1GUGA 4K8JA 2NB0A 1CSQA 2KEDA 1X55A 2B2VA 2X69A 1SYBA 3CQZB 1JJGA 1HR0W 2A5HA 3A8KE 4LUVA 3S17H 1R9TH 3EJIA 2KA7A 3M3YB 3KJOA 3MXPA 5IT9L 2VUMB 3HOWB 1EY5A 2DJFC 5IP7H 2EDGA 3QR8A 1LM0A 1FD7D 1K83B 1I4XA 4K2LA 4ZUJA 5HGTA 4OX9L 1HTPA 4CJ1B 5I2XA 5JAVA 4GLVB 1HA6A 1HTLD 4JI1Q 2Y0SB 4YWKA 4DFAA 4J1MA 1QZGA 3PQIA 1ENFA 2EJGC 2VB3X 4LUZA 4LFAQ 3PIO3 4RGOS 5LHY1 4DV1Q 3VR2A 1P8LA 4IALA 3J7AV 5ELNA 1ASYA 2PO4A 2RSOA 4POGA 2AQ1B 2UUCL 2BE5D 3RN2A 2ZTCA 4WFN3 1HCZA 4FYDA 1G2SA 3PO3B 2WB1G 2LKVA 1TWAH 4V0BA 1LUZA 2JA6H 3I7FA 4F8MA 2XIWA 1MSGA 3S2HH 1I3QB 4JV5Q 2OQ0A 1IBMQ 1VQEA 3T16A 1BCPB 3G7LA 1TVXA 2VXWA 4DV7L 1LT6D 1VQJA 4IQZA 4L63B 1LO5D 4NXNQ 1BDOA 1OO9B 2ZJRA 5LMUQ 2K05A 4R4TA 5EBDA 4C3IH 4WJ3M 1N8RC 4IUQA 2C35B 3VDYA 1I50H 3EBEA 4ZKCB 1VQPA 5I4DA 1YNXA 4KLKA 1QVCA 3EVQA 1Y1VB 2F4VQ 2JA6B 2I5MX 3J80L 1HNXL 5A2QE 3K7AH 1W2BA 3JC66 1UE5A 2K28A 3FPPA 2UUAL 4IJLA 1HZCA 3BZCA 4PZ8A 3CF5A 1E22A 1QOHA 1CI3M 2PCFB 4B3RQ 4MIUA 1NBWA 2H5XA 1Q7YC 5IWAL 2EOTA 3H3VH 4HMIA 1FL0A 3RZDB 2AWNA 5AJ3L 1UE6A 4LF9Q 1Q46A 2WAQG 5EJWA 4DV4L 5CBEE 4LF4L 1VDZA 4AIMA 3H6MA 2KOLA 4U68A 4JI2Q 1S5CD 2WFWA 1B3QA 1SJHD 1CKMA 2JSOA 1LT3D 5ELBA 1M1KC 4K14A 3CC7A 1DONA 4XT1B 5BN4A 2XN9C 4LF8Q 3DM1A 4JW0A 2YTVA 4R8IA 1YITA 2R7FA 1Q81C 1EEFD 5DM63 2NVQB 1CHPD 2EQSA 3S16H 1X9NA 4L5SA 5CV8A 2MGSA 4A76A 4OXPA 2PPBC 4R4IA 1N32L 4A75A 1EYGA 1EIFA 1WCMH 2K75A 4HSVA 4HCEA 1B44D 1KHIA 4QUFA 3HOZG 2M9VA 1U9RA 2N78A 1LTTD 2N88A 1MHWC 3GD7A 1VQ5A 2XNAC 2NVXH 1XTCD 5KEEA 3KF6B 1YNJC 2HT1A 3TSSA 5FO9B 2F4IA 3G6EA 1EYAA 1PHJA 3GTLH 4NKLA 3VA5A 1PFSA 1JE4A 2GVAA 1EIGA 2AMCB 1SNMA 4JI7Q 1EZ6A 2JA7B 3TQYA 1F2YA 2R93H 5KNCA 1SBBB 1FJGL 4A3DH 4TSSA 2F3IA 3G71A 3MHBA 5C0XH 1H95A 5T1GA 2Q8RE 5E3FA 4ABNA 1HNXQ 1MKHA 3HOXH 1YJ9A 1Y14B 2NYZD 2R7DA 5IYBG 5C5LA 3RUZA 4K6DA 1O7YA 1KC8C 2K04A 3P20A 1D1KA 3MXNA 4AYBE 3CAMA 4Q5VA 2A19A 1RTNA 3VYRA 2E75C 4HEDA 4H02A 1BF4A 4BXXG 5IGGA 2E2HH 4NXML 3R8BA 3JAML 1O78A 1BO0A 1VQHA 4GN5A 1IL8A 1DOKA 1OXSC 4FXGC 1BVSA 2FHTA 1N33Q 5BN5A 1SNQA 3I4NB 3HEJA 5J3BA 2DNCA 1Q8KA 4OWXB 2VUMG 5C44H 3CMEA 1YZ6A 3A5UA 2RF4A 3R93A 2EVBA 3SK5A 1GVPA 3UE0A 3S2DB 1X3GA 5M3FH 4CDCC 2DJGC 2KENA 2BDNA 3D4RA 1EY9A 1K83H 3CRKC 2B3GA 5EGTA 3NELA 2NZHA 3J81j 2NBFA 4K8IA 4K5VA 2ZM6Q 1CKOA 4KY7A 2C5CA 1ILQA 3H15A 1HFGA 1P16A 4JI1L 3IAYA 2F0SA 3GTOH 1SXTA 4A3JG 3HKSA 2WKCA 4CDEC 2Q2IA 4HJAA 5BR8Q 1XPUA 2E2HB 1T5EA 2KECA 3AFPA 3S1QB 4C3IG 3M7NA 3NTHA 4Z9CB 1L1OC 5EKIA 1GJXA 2BH2A 1AZQA 1CUKA 4CKEA 3E9IA 4XT3B 3H91A 4HIMA 1Y8OB 4ZCKA 1WTPA 5DNFA 3A7AB 3I4NG 2AQ3B 3ZYYX 4L6TB 4BY1H 3KBXA 4WORA 1Y69U 4X62L 3HOVB 4A93H 5LMNW 4J8QA 2RSNA 5M3FB 1RJTA 1RL2A 2HD3A 1WI5A 2ID0A 2F0PA 1LV9A 1WTXA 3RR5A 4F87A 4GNXC 3UI2A 2BA1A 3K8AA 4KI0A 1U4RA 4R4OA 5A2QL 3T1HL 5IGBA 1I5FA 3K0YA 4ZAIA 4DV6L 4QIWB 2NTSA 5LMNL 4LFCL 1ZYRC 4MTNA 2GA4B 3BDCA 3K80C 4G7OC 1IW7D 3OWEB 3PCOB 3F2UA 4RCNA 4HJ9A 1PH6A 1SMYD 1D5ZC 2VZAA 2F0WA 2OXPA 3TS2A 4MHEA 1A63A 1N36Q 3JAME 3VYSA 1IHZA 5G3LF 1S5BD 4BBRG 4DAVA 3HOVG 2PZUA 2K1BA 2JXMB 1Y1WG 4DR6L 2F1MA 3DHQA 1VQ7A 2CWPA 2XGTA 2JA9A 2L55A 1H9JA 2NN6I 2Z1CA 3H0GG 2MO1A 1PV4A 3I4MG 2K5NA 3MXNB 4EGVA 3KLSX 3WDNA 1V1OA 4DR2Q 1GUWA 2PQAB 1D6EC 5FJ8H 4P71A 1SAPA 4A3BH 4A3DG 4K2KA 3GP7A 4R4CA 1EWCA 1K3RA 1EY7A 2K5QA 2KEEA 1ZXTA 4P73A 4A3EB 3CPWA 4E6IA 5CYUA 1K8MA 4DAPA 3KBGA 3CCSA 1HNWQ 1X54A 2UXDL 1C4QA 3FRPB 1ICFB 1T9HA 1XWEA 4IPCA 1I50B 4QGUA 2IX0A 4EQ5A 1WJJA 2P5ZX 3PUZA 4BY7H 4DV3Q 4OO1H 2CW0C 1MJCA 2NVTB 1G8ZD 2ATWA 1IXRA 3SGIA 3I70A 1KNAA 3A8IE 4QL5A 2ASBA 1E2WA 5AJ3Q 4LF9L 1E24A 1MGSA 2J7ZA 1HZBA 4C2MH 1EWHA 2IW3A 1NSNS 1QB5D 2QKIC 2JN4A 3Q8DA 5C4HA 4IFDH 1EUJA 4X6AH 3HOZB 1QCBD 4LF7Q 4HCSA 3ER0A 4O42A 1RIPA 3S15B 1Q3LA 4LF5L 3S1NH 2UXCL 4DUZL 1HPCA 3V05A 2MPMA 3EIVA 3NP8A 4A3IH 2B2YC 2SEBD 4DR4L 5IOCA 4N8FA 1LTRD 1NAPA 2KUMA 1H9SA 3DM3A 5CV4A 3HKZG 1E7ZA 5CV6A 1NE3A 5HGQA 1MD2D 2H4OA 1WVLA 3KYHC 5C4XG 1E1OA 3FMCA 5I6YA 2NTTA 4JI6L 1QE6A 4A3EH 1ESRA 3ICEA 3NBHB 1YVCA 3D3RA 2R92G 1EIYB 2EPBA 3S15H 3J80E 4BBSG 4KKTA 3U9SA 3GV3A 4RWSC 4IOAA 4NPSA 4PV1C 1ML0D 1I6VC 1JR0D 3NBIA 3DUZA 4X64Q 2QW7A 4MTKA 3I4NH 3L9AX 4HIDA 3SXHA 3QIAA 1YJWA 2FJ2A 3RZOB 1PZID 5FOBB 2EYFA 4FXDA 4I7AA 1HNWL 1LABA 3QOLA 4CGYB 1B2TA 2EY2A 2V1CC 2WB1B 5JEAH 3T13A 3CW2C 5C4XB 3IKJA 1J9OA 2HHHQ 2F0TA 3MAQA 1BR9A 4XIGS 1YIJA 1ZEQX 3KFUA 1V8QA 1QVFA 2F0LA 3PV0A 2A6HD 5CORA 1G6ZA 3QJYA 2EZVA 3W5OA 5C3EH 3PIP3 4N9PA 3S17B 5IGEA 3AEVA 5C4JH 5KIXA 4QB4A 4H44C 1O7LA 5C3XA 3RLFA 1B3AA 4R8NA 1HZAA 2EYOA 3WWVA 4EQPA 4LF6Q 2R92B 3CMAA 4F7XA 3S1MH 1PRTF 2BCOA 2M00A 2Q8IB 2O5IC 4R4QA 4GOPC 3SK8A 4IFDJ 3F8TA 3G4SA 3TP8A 3CPFA 1CKNA 1CA5A 2BA0A 1X3PA 4A3JB 3KF8B 2D9UA 4X66Q 4GKJL 2E76C 3SE0A 3EN2A 1LTGD 1E3PA 1LACA 2I5HA 2K33A 3S9WA 1C9OA 4A3IB 4XYOA 4BBRH 5EQ0A 2I0QA 2LXKA 1QUQA 5FO8B 3S2DH 3DWQA 2QDBA 3BVMA 3SEBA 2JA5B 4JK1C 4WJ4A 2FMMA 2QDLA 2A1AA 3IFDA 4GN4B 3L2PA 3D6WA 4YHHL 2F0EA 1BBUA 4HJ7A 2F0KA 1EY6A 1E1TA 5AFWA 4JC0A 4AYBG 1BCPC 4L5TA 4A3LH 2XVSA 3VYUA 1GUOA 1QUQB 2XRSD 3F2BA 1C48A 1BQQT 1SR3A 1EIHA 4DF7A 3HKZB 1TU2B 2WB1E 2AKWB 2BH8A 5I9PA 3MFGA 1E2ZA 2D0OA 2J0TD 3KF8A 3M4YA 1Y1WB 2Z9HA 5GROA 4DK3C 1IYVA 1IZ6A 4KHVA 1OXXK 1J5EL 4GKKQ 1JOKA 4NW2A 2K52A 3IL8A 5JJIA 3X3MA 2SDFA 1YNND 5EKKA 4A3GH 2A6EC 5A35A 4UAIA 1S4ZA 2J4XA 4LF4Q 4MZ9A 4RHSA 2FXQA 5ELDA 2E2JH 5FLMH 5M5WH 1X6OA 1X3EA 1BBXC 1KABA 4L5RC 2YU9H 3D8GA 1SNDA 1B70B 4FVMA 2NVTH 1V1PA 2HDLA 2FINB 2JA5G 4L5QA 4CJ0B 2MP1A 1PTOF 3TREA 3W1GA 3BU2A 1CSPA 1JCKB 4DXFA 1FGUA 2RCNA 1PLFA 3DWPA 1MJEA 1TXYA 2XTIA 4IUPA 3J7A5 2G9HD 2QILA 5IYCH 3A54A 3QWNA 4H13C 2F0FA 5JOBA 1U0LA 1SFOB 3NHHA 4BY1B 3VR3A 4LJZC 2JK8A 4YY3L 1YHBA 1K73C 4NXNL 4X3UA 1KDCA 2WINB 1XMQQ 4YWLA 1JQYD 4RH6A 4DV5Q 1TWFH 1HJPA 1HZ9A 2B2WA 4XYQA 1Z9FA 2IY5B 3MZ5A 3PO3H 3FPUB 1TS2A 1CQFA 1VS0A 1FGBD 4QIWE 4DXGA 3OWFA 2K5DA 2Y0SG 2QEXA 1F9PA 4NDXA 1JWMD 3TP5A 1FJGQ 2VL6A 3PO2B 4CKBA 3K59A 2A8VA 2K03A 4RGMA 1CM9A 1SYEA 2CKZB 3H3VI 3T51B 1QVGA 3FDTA 1WCMG 1SNCA 5I6WA 2RA4A 5COYA 2Q2UA 1SJED 2HUGA 3NWTA 1QILA 2V4DA 1WTRA 1PH5A 1Z7TA 4DV0L 4OO1I 1JWUD 2E2JB 2PZTA 1UEBA 2IX1A 4JBWA 1YBYA 3ND9A 4HIKA 4DR2L 4HJ5A 4PQXA 5IGFA 3NENA 4PG3A 3GTPB 4GOPA 3CCMA 2EYPA 1D1IA 2F0HA 4A3CH 1JC7A 1L2FA 5IIFA 1VQMA 3I72A 5KYIA 1AN8A 2UU9Q 1T5XD 1V43A 4IJHA 3Q0AA 1STAA 3KDFB 2DN8A 5C0XJ 2VQFQ 5IGDA 3SHLA 1LTAD 5ISRA 1QNKA 4PZ6A 1KNEA 4TQUS 1D5XC 2B2YA 4LAAA 1EU3A 1ILPA 1VQNA 2MO0A 3M4QA 3PUYA 1PYSB 1B1ZA 1G291 2OTLA 5IYBH 4LFBQ 2DY7A 1RF2D 2Q8TA 1X3FA 3I2ZA 5IP9H 4B3MQ 1K8OA 1S5ED 2PW5A 4FP5D 1PFBA 3F1ZA 4JBKA 2EIFA 1HR0Q 3BZDB 2Z4HA 1Q90A 4DV3L 1R4PB 2NN6H 4YCUA 4FXKC 3H0GB 1RKNA 4LWCA 2BE5C 5EPKA 3H3VC 2R7ZB 4DNTB 3OHXC 1I4GA 1DXMA 3A8JE 2VUMH 1SLJA 3SK4A 4X65Q 3U4ZA 2B2TC 5JPNC 4JI3L 2OT2A 2KQ3A 2B8FA 1XPOA 3VR4A 5BN3A 3SDZA 1EQTA 3I55A 1KIXA 2NZ1D 3I4OA 4B3SL 2DY8A 4OGQC 3S16B 1A2UA 2NVQH 1OXTA 3C1FA 2HCCA 1V1PB 3A74A 3E5SA 5C3WA 4O1NA 3BDOA 3DXJC 4AQYL 1TWHB 5KYLA 4ME3A 3L3OC 4A3MB 4KTAA 5E4XA 3U4VA 4GKJQ 3GTMH 2I07B 1STYA 4DR7L 4NXMQ 1CZWA 1NMFA 2SNSA 1B4OA 3P1HA 4DR4Q 3NQIA 2I46A 1N9WA 4KHPQ 5IYDG 1WD0A 5FK9C 4DA2A 2VQFL 1IL2A 1Z6HA 2K5WA 1EOVA 3C3LA 3QB3A 1HHVA 3EQLC 5LL6X 4QMGA 2R7ZG 4Y7NB 4DV4Q 1VQCA 2PQAA 2MNAA 1L0XB 5C0XI 4DV2Q 1TWAB 2ICIA 4UP9A 4G4KA 1TQOA 3WOFA 4IUVA 2RDFA 4R9WA 2YYZA 4A3MH 3F2DA 4WRDA 1DJRD 1F2MA 5GQOA 4ZK9B 3G48A 3PSIA 2O2LD 4C3JG 2DGYA 1I6HH 1UUPA 1UAPA 2F0OA 2IHFA 2MUYA 3OTOL 1JICA 4P74A 2ZJQA 1BOSA 1BBWA 5TSSA 1KLGD 2F0MA 1PTOB 4OIKA 3UE1A 1HUNA 3T4AC 2YU9B 3D31A 1VMCA 3FKIH 1GXDC 4BBSB 1F9SA 2IWHA 5H1SE 3K7UC 1PRTC 1PH4A 2NUCA 4ZYSA 4RKBA 3K6OA 1RHPA 1IBKL 4FO2A 1PVOA 3NK9A 1VQ9A 1JB3A 3VA7A 3NWSA 4XTCS 4ILWA 3GTQH 1CFMA 1A3VA 1L1OB 1EL0A 4OIJA 2OQKA 4P72A 1RCVD 1W6KA 4XQJA 1CQVA 1NR2A 3NTKA 2R93G 3I4MH 3BDLA 2D2CC 4B08A 1SNPA 3T56B 1JE5A 4L8JA 4GNXA 3GTPH 4MN3A 2EYLA 2Z0SA 3Q6SA 3C1EA 2K5HA 3S1QH 3MEFA 4LF8L 4IOCA 2B2UA 2ZM6L 4JI4Q 3C2PA 1K8GA 3GTMB 1HQMC 2X6LA 1QG7A 2TSSA 2WAQB 2F0UA 5K5PA 1KLUD 2IHEA 4JYAQ 2WAQE 3BYYB 1RDPD 3K81C 4RG1A 1G2TA 1SE4A 3MTSA 1O80A 4DUYL 3AFQA 1U4PA 5DM73 3S14B 5D3DA 1FVIA 1W6JA 4WJWA 1D7QA 3CRLC 3KK7A 4IFDI 2YV5A 3DWAA 2WIIB 4PMCA 2B2TA 4K0KL 2IJ0A 3CU7A 4XXEA 3KJPA 4KD3A 3PUVA 3AU7A 1SDFA 5F2DA 4LFBL 4A3DB 4GLXA 2XWBB 4HSPA 5HURA 2CW0D 3HFZB 4JG2A 2PZWA 4C3JB 4JOIC 2AQ2B 4B3TQ 4OHJA 4YCVA 5M3FG 1DYQA 4IUNA 3AQQA 4C1NK 4DV5L 1C0AA 4EQNA 4APVA 1D2BA 1PZKD 1L1OA 1BXTA 4RCOA 4HN7A 5LMNQ 3KUPA 2NVXB 4KJNA 3GO5A 5M9OA 3N6RA 5KNDA 1CT1D 1TS4A 2D0PA 3J7AF 3OMCA 1SYGA 3K5NA 5JJLA 1JT8A 4K5XA 2EXDA 1I4PA 1XJVA 4HJ8A 2EJMA 4EQOA 4QF4A 4C3HH 1ENCA 1VF5C 1ENAA 5EPLA 2PI2E 1CZGA 2Q2HA 5C4XH 1H9RA 1KRSA 2KCTA 3SK6A 5EKLA 1E2VA 4IN3A 4DV7Q 4JYAL 5CC4A 1KAWA 3I56A 2WKDA 1OXUA 3QO2A 2PYKA 1MI2A 5ELCA 4NMZA 1OTCA 1XMOL 4BY7B 5IYDH 1F9QA 2XSCA 1HNZQ 4DU9A 1X32A 3HS0C 3R2TA 4OX9Q 3GTKB 4ID6A 2R7ZH 3D0FA 2RVLA 3SR1A 1PFMA 4CBVA 1PMRA 3J81c 1STEA 2JJQA 1PTOC 2IT1A 4A3MG 2HIVA 4H7BA 3S1RB 3U58A 2JA8B 1GHKA 3CCRA 1ET9A 4RKLA 2DUDA 5E1FA 1VQ8A 4IURA 1CTMA 2XWJB 4X3KA 1HNZL 5D14A 1R9TB 3E3XA 3FEWX 2QA4A 5IODA 3S1MB 2KBNA 4JI0Q 2JQOA 4AQYQ 1UE1A 1J8IA 1GO3E 1FNVA 3TBIB 3PUXA 1PH8A 4KN7C 4KKUA 1VQGA 3FKIG 1PTOH 3GV6A 2E2IB 1Y1VG 1SE3A 4JI7L 1XNQQ 5M5WB 2CHBD 4IPHA 3OIQA 4JI5L 3KLWA 3GTOB 2C9OA 1EWIA 3TMEA 1A2TA 4KHPL 2L11A 2D62A 3OYYA 3AB9A 2AWOA 1IKMA 2H1EA 4CKCA 2LY7A 4YCWA 5DEHA 2F0IA 1LTSD 4O2DA 4A93B 3K0XA 2EYHA 4DGZA 5L37A 2FFKB 4N8X1 5FJ8G 3PGZA 1S3OA 3JAMc 5IP7G 1XXGA 3X3NA 5FO7B 2K50A 2VQEL 4A3KB 2Z6KC 2L12A 3CKIB 4YIJA 3H09A 4B3TL 3KOJA 5K36H 1E0BA 1Y1WH 4JI4L 2L0CA 3LWUA 3PIOA 4JI6Q 4A3LG 4ZLTF 3H0GH 4B3RL 1Y8NB 4KKSA 1YNNC 1V1QA 3L7ZC 4BA2I 2A74C 4KHZA 2E2DC 2MQHA 1M8AA 2A69D 5FLXc 4OL7A 2B63B 1Q12A 3BYTB 3T1HQ 3NUCA 4IPDA 3GTQB 2IPKD 1WD1A 2N49A 4IPGA 3E0EA 2ALYB 2EY6A 3OIPA 4UPAA 3CXCA 1LTBD 4BS9A 1STGA 1TY0A 1N34Q 2SNMA 1I94Q 2N55A 1EY4A 3UDXA 3A56A 2UXBL 4NB3A 5IY0A 3E9HA 1K8AC 3M4PA 4LNQA 2JA8G 2R6GA 2EE1A 1FYCA 1U4MA 5ELOA 2UUAQ 4X64L 5FLXE 4IFDG 2OEOA 3MWYW 1M90C 4ZUIA 3EFXD 2GVBA 1TS3A 3K5OA 2RQXA 2ES2A 4OO1G 3A0JA 1WFQA 1SSOA 4K6LA 2ZTDA 3J7ZC 3GTLB 1N34L 3E0JA 4TRDA 1G6PA 3ULLA 4DV1L 1PH7A 5C4ZA 4I65A 1JWSD 2MJ8A 1F77A 3S24A 3Q22A 1GKHA 3Q23A 2R93B 4JVZA 1V9PA 1EY0A 3I73A 1YNJD 4X3TA 1IBML 2PNRC 2F0JA 1IKLA 4ALPA 3PF5A 3HOYB 4Q0FA 4DUYQ 3T53B 4KK7A 3ZJYC 4GKKL 4BBSH 4A3IG 4ZQ3A 4C3HG 1XNQL 2EYJA 2Q2TA 3PO3G 1KXLA 1NJIC 1NTGA 5KNBA 4DV2L 2HCIA 4DR1L 2SOBA 2BOSA 4YWMA 3J80i 3OSOA 3O13A 4B3SQ 1UNSA 1ONLA 3AMUA 5IE8A 5JVG3 2A73B 1N33L 3M9BA 1EFID 3EA6A 2K14A 3ERSX 1A0IA 4JI3Q 1PDQA 1TWGH 3CCLA 2YTXA 3W2DA 2L1BA 3NBHA 4U673 4A3EG 3HOYH 1AH9A 3TP7A 3J80c 1SROA 2VB2X 1N36L 2JE6I 1SN8A 3HOXB 3LWEA 5C6AA 4GZYC 2L9HA 4CHTB 3E6ZX 5C3EG 2QF7A 4JOIA 4GLAC 4UY8C 1SE2A 3OMGA 3STBD 3J81E 3UDFA 1WTOA 5EPJA 1QJOA 3HOZH 1YI2A 3CD6A 1I3QH 1U5KA 5GADC 2ZXRA 1WTWA 1L0WA 4J15A 5BR8L 1BUVT 1SMXA 3I8ZA 5I2YA 3MFYA 4QQBX 1A6XA 2Z6BA 3P7JA 3RMHA 3R3OA 3VR6A 1SFOH 1PFNA 4UHVA 2OWOA 2LMCB 4TKOB 4FF2A 1VQ4A 2KJXA 3HKZE 1YHAA 1TY2A 1GD7A 1HA5A 2K4KA 2Z6KA 1VQOA 2E5LQ 3TS0A 2OTJA 4JCVE 1LTID 1PH9A 5J22A 1S72A 1AW7A 4X62Q 1B9NA 3NQTA 3A7LA 4JBJA 2QEJC 3HOXG 5C44G 4DV0Q 4HAEA 1SYDA 4JV5L 3K7AB 1KD1C 4DR3Q 2OF1A 2NN6G 1PH1A 1BCPD 5C3EB 2K7VA 2L15A 4B3ML 1TWFB 1K28A 1Q1EA 1ASZA 1PH2A 2G9DA 3MEHA 4DKAC 1A3UA 1B8AA 1F2LA 4JI8L 3G6JB 3RZDH 4LF6L 1HFNA 5J1ZA 2VY3A 2G5DA 4EX5A 4OEMB 5KRUA 3BZKA 2ZT9C 3DMUA 4EVOA 3BVGA 3UDGA 3TN2A 3FHWA 2NVYB 1QNUA 1Z47A 3NTIA 3PMFA 1XTDA 3A5ZB 1QZHA 2DNEA 1EFWA 2A6ED 4PMWA 2KCCA 4X65L 4KJOA 2JA7G 1WCMB 3KLRA 1O7IA 4KV6A 2JA6G 5JJKA 5M3MB 1PRTB 5IGCA 1DZ1A 3ITPA 1H9MA 1JJ2A 2RHQB 1SYCA 4ODGA 4DPGA 2F3VA 1TWCH 4A4IA 3FKIB 3WOEA 1K0RA 4B9XA 3SVMA 1G91A 3CCQA 3NEMA 1LLRD 3D6CA 5FLXL 2ICEC 4DAMA 5CV9A 1FNUA 2L4NA 4IUTA 4QJFA 1ZKOA 1EYCA 1ICWA 1NNXA 2A6HC 4A3JH 2UUBQ 1HQRD 3DEPA 1WOCA 1R4QB 3QOJA 5ELEA 4JPBW 3NSWA 1DCZA 1UEAB 4G7ZC 4QCLA 3CCUA 4JBMA 3I4MB 1I4RA 3HP3A 1G51A 2JA5H 3RNUA 4HMJA 3TZUA 1H9KA 2ZJPA 5M5XB 1K9MC 1TWCB 2XRQD 4LF5Q 1GOZA 2CH4W 3AYHB 2IL8A 4C1NI 2B39A 2UU9L 2PMZB 4HR7B 4BY1G 4RAUC 1PA6A 1ET6A 1VQFA 1IBLL 5M5YB 4PNYA 1TS5A 5IYCG 1CHQD 1CKNB 4OELB 4BA1I 4A3FH 3M4OH 1X65A 4FF3A 1X3QA 4A93G 2VW9A 4JI8Q 5M3MG 3M85A 1PRTD 3TZDA 2MFIA 3F2CA 3W1BA 1SE8A 4G7HC 1STBA 3STBC 1VCIA 5ELFA 3K5MA 4RA8A 2KVMA 5D65A 2NVYH 4JI2L 3U50C 4LFAL 1XNRL 1VQAA 1H9SB 4MNOA 1MIUA 3NXWA 5IT9c 3OTOQ 1IYJB 1PZJD 5CR3A 4A3GB 4CDFC 2F3WA 1NUCA 3HOWG 4DAYA 1CA6A 2RBMA 2EY5A 1X56A 2Y0SE 1ZYRD 3HOYG 1AE3A 2Z8LA 4LF7L 3V96A 4S3SA 3BS1A 5CBAE 3OPOA 4IUUA 3CP0A 2B63G 2FMCA 5FKAC 2LFNA 1LTLA 2VQEQ 3MXUA 2CVRA 2D5DA 2YTYA 5GAGC 2F4VL 1OXVA 1A3TA 1XMOQ 1B7YB 3OW7A 4DN4M 4A3BG 5JPMC 1W3SA 4ZRZA 3J7YW 1JOQA 4UDUC 1HRJA 1TWHH 1VQ6A 1I94L 3BVZA 3RLNA 1WTHA 3ND8A 4YY3Q 3A55A 4GN3B 2WV6D 3J81i 2K5VA 1TWGB 1O7ZA 1GHJA 4H0LC 1XX8A 1EY8A 5JJZA 4FDBA 2E74C 3U9OA 3RLOA 3S1NB 4DR1Q 3LNNA 1AEXA 5JVH3 5IP9G 2B2WC 3HG9A 2KCNA 1JOOA 5C0XG 2N3SA 4BY7G 1JJCB 4I7ZC 4XDXA 1PYBA 3CC4A 1GUTA 4IO9A 1KDBA 3GTJH 4A3FB 3M4OB 1LYLA 5DAUA 3EROA 1GM5A 1DOMA 5J39A 3RD4A 4P2CB 2QGQA 1XNRQ 2B8GA 4V190 3NPPA 4BXXH 5M5XH 2RDGA 3D4WA 5HY6A 1CK1A 4ZKBB 2UXCQ 2A68D 4LMQD 4C3HB 3GTGB 4N9TA 4DR7Q 4FF1A 3LGJA 1AFPA 2GN5A 1HUMA 1BKBA 1KRTA 4OWTB 4GOPB 3HGBA 3N52A 3NE5B 3I3CA 3FP9A 3T1YQ 2JEBI 4BWGB 2HIXA 5KGUA 1II3A 3I91A
chains in the Genus database with same CATH topology
5C44B 1B9MA 5LL6S 1NCVA 4DK0A 4RGTA 4F88A 4NP5A 4PMBA 5C5MA 2ENBA 1SEBD 4IZ8A 1PYWD 3W3AA 1PXUA 2WP8J 4A3BB 2EXZA 4LK1C 2F03A 3D4DA 3C46A 3P75A 1NR4A 3I4LA 5CMDA 1JORA 1SMYC 2F0VA 2B2VC 4HTHA 1LT5D 4B9WA 5D3IB 3URYA 2K6AA 2F0DA 2PW7A 3VYTA 4DK1A 3K57A 4CJ2C 1Y8PB 1STNA 1AZPA 2F0NA 3V2TA 1VMPA 2L5TA 2LS01 2EJFC 3PUWA 1FR3A 4KD4A 1B53A 2F0GA 5JEAG 1IYUA 1BNZA 1DOLA 1TKWB 3MA2B 2HQEA 4KY5A 4KMUC 4XQNA 4BBRB 1D5MC 3M7GA 2VNUD 3HRZC 2HDMA 4J6HA 1RODA 2JP1A 3R2IA 1B50A 1EQVA 1Q1BA 4K5WA 1LT4D 1XYIA 1S5DD 3TP6A 1I4HA 4XQQA 3Q24A 4QUCA 3MC0B 4G57A 3DEOA 1EEID 1Q8IA 3TDQA 4ULLA 1SYFA 1I4QA 3HOUB 3QG1A 3CHBD 2JYOA 1KAAA 5K36G 4C2MB 1TIID 4AYBB 2A68C 4KY6A 4RGNA 2X6GA 1F2ZA 2M2LA 1EZ8A 3HZXA 3FVQA 4RFBA 5CV7A 2IX3A 1KTKA 1ESFA 3IFTA 2A69C 2O5JC 4X3SA 3ONAB 1WTQA 1IW7C 5CGKA 1DM0B 5I9OA 1A15A 3GTJB 2ZXPA 3BG3A 2B2UC 3GQBA 3LX0A 2F0QA 1GUSA 4C3IB 2CQAA 4M1UB 2NWGA 3H94A 5G3LD 5E4WC 2R3ZA 2TMPA 1SNOA 3KLSA 2JEAI 1EU4A 1KDAA 2WACA 1VF7A 3I90A 2EYMA 2R61A 2AUKA 2O4XA 5CV5A 1MBYA 1EYDA 1PTOD 2QCPX 4ME5A 2RDHA 1FNWA 1M4VA 1AP0A 5C4JB 1DD2A 2MHVA 3ERQA 2KHSA 1GUNA 2PQEA 2Z4IA 2K32A 4FF4A 1U4LA 1STHA 3K5LA 5EBCA 1WTVA 3OOCA 1S5FD 1RD9D 4M8AA 1MSHA 1TT2A 1EOTA 3MVVA 2K01A 2ZXOA 1BCPF 2RKSA 2EY1A 2AUJD 1L0YB 1QWYA 1HXYD 3MXGA 5IT9E 3VR5A 4RHRA 5NUCA 4C56C 3S2HB 5T1IA 5JEAJ 3J81L 1TR5A 1I6HB 1F9RA 4FNFA 4DNRB 4KN4C 2BDOA 3K58A 1RTOA 1C8CA 1GUGA 2NB0A 4K8JA 2KEDA 2B2VA 2X69A 1SYBA 3CQZB 2A5HA 3A8KE 3EJIA 2KA7A 3M3YB 3MXPA 5IT9L 2VUMB 3HOWB 1EY5A 2EDGA 1FD7D 1K83B 1I4XA 4K2LA 4ZUJA 5HGTA 1HTPA 4CJ1B 5I2XA 5JAVA 1HA6A 1HTLD 2Y0SB 4DFAA 4J1MA 1ENFA 2EJGC 2VB3X 3PIO3 4RGOS 5LHY1 3VR2A 4IALA 3J7AV 2PO4A 2RSOA 2AQ1B 2BE5D 4WFN3 1HCZA 4FYDA 1G2SA 3PO3B 2LKVA 4V0BA 4F8MA 2XIWA 1MSGA 1I3QB 3T16A 1BCPB 3G7LA 1TVXA 2VXWA 1LT6D 4IQZA 4L63B 1LO5D 1BDOA 1OO9B 2K05A 5EBDA 4IUQA 4ZKCB 5I4DA 3EVQA 1Y1VB 2JA6B 3J80L 5A2QE 2K28A 3FPPA 1QOHA 1CI3M 2PCFB 4MIUA 2EOTA 4HMIA 3RZDB 2AWNA 5EJWA 5CBEE 1VDZA 3H6MA 2KOLA 4U68A 1S5CD 1SJHD 2JSOA 1LT3D 5ELBA 4K14A 1DONA 4XT1B 5BN4A 2XN9C 3DM1A 4R8IA 1EEFD 5DM63 2NVQB 1CHPD 5CV8A 2MGSA 2PPBC 4HSVA 4HCEA 1B44D 4QUFA 2M9VA 1U9RA 1LTTD 2N88A 3GD7A 2XNAC 1XTCD 5KEEA 1YNJC 3TSSA 5FO9B 2F4IA 1EYAA 4NKLA 3VA5A 1JE4A 1EIGA 1SNMA 1EZ6A 2JA7B 1F2YA 5KNCA 1SBBB 4TSSA 3MHBA 5C0XH 5T1GA 2Q8RE 5E3FA 4ABNA 2NYZD 5C5LA 3RUZA 4K6DA 1O7YA 2K04A 3P20A 1D1KA 3MXNA 4Q5VA 1RTNA 3VYRA 2E75C 4HEDA 1BF4A 5IGGA 3R8BA 3JAML 1BO0A 1O78A 1IL8A 1DOKA 1OXSC 4FXGC 2FHTA 5BN5A 1SNQA 3I4NB 3HEJA 2DNCA 3R93A 2EVBA 3SK5A 3S2DB 2BDNA 3D4RA 1EY9A 3CRKC 5EGTA 2NBFA 4K8IA 4K5VA 4KY7A 2C5CA 1ILQA 1HFGA 3IAYA 2F0SA 1SXTA 2WKCA 2E2HB 1T5EA 2KECA 3S1QB 4C3IG 3M7NA 3NTHA 4Z9CB 5EKIA 1GJXA 1AZQA 4CKEA 4XT3B 3H91A 1Y8OB 1WTPA 5DNFA 3A7AB 2AQ3B 3ZYYX 4L6TB 3KBXA 4WORA 1Y69U 3HOVB 4J8QA 2RSNA 5M3FB 1RJTA 2ID0A 2F0PA 1LV9A 1WTXA 4F87A 3UI2A 2BA1A 4KI0A 1U4RA 5A2QL 5IGBA 3K0YA 4ZAIA 4QIWB 2NTSA 1ZYRC 2GA4B 3BDCA 4G7OC 1IW7D 3OWEB 3F2UA 4RCNA 1SMYD 1D5ZC 2F0WA 2OXPA 4MHEA 3JAME 3VYSA 1IHZA 5G3LF 1S5BD 4DAVA 2PZUA 2K1BA 2JXMB 2F1MA 3DHQA 2L55A 1H9JA 2NN6I 2Z1CA 4EGVA 3KLSX 3WDNA 1V1OA 1GUWA 1D6EC 1SAPA 4K2KA 3GP7A 1EWCA 1EY7A 2K5QA 2KEEA 1ZXTA 4A3EB 4E6IA 5CYUA 1K8MA 4DAPA 3KBGA 1C4QA 3FRPB 1XWEA 1I50B 2IX0A 3PUZA 4OO1H 2CW0C 2NVTB 1G8ZD 1KNAA 3I70A 3A8IE 1E2WA 1MGSA 2J7ZA 1EWHA 2IW3A 1NSNS 1QB5D 2QKIC 5C4HA 4IFDH 3HOZB 1QCBD 4HCSA 4O42A 3S15B 1Q3LA 1HPCA 3V05A 2MPMA 3NP8A 2B2YC 2SEBD 5IOCA 1LTRD 1NAPA 2KUMA 1H9SA 5CV4A 5CV6A 1MD2D 2H4OA 1WVLA 3FMCA 5I6YA 2NTTA 1QE6A 1ESRA 3D3RA 2EPBA 3J80E 4KKTA 3U9SA 3GV3A 4RWSC 4PV1C 1ML0D 1I6VC 1JR0D 3NBIA 3DUZA 3L9AX 3SXHA 3QIAA 3RZOB 2FJ2A 1PZID 5FOBB 2EYFA 4FXDA 1LABA 3QOLA 4CGYB 1B2TA 2EY2A 2WB1B 5JEAH 3T13A 5C4XB 3IKJA 1J9OA 2F0TA 3MAQA 1BR9A 4XIGS 1ZEQX 1V8QA 2F0LA 3PV0A 2A6HD 5CORA 1G6ZA 3QJYA 2EZVA 3PIP3 4N9PA 3S17B 5IGEA 5KIXA 4QB4A 4H44C 1O7LA 5C3XA 3RLFA 1B3AA 4R8NA 2EYOA 4EQPA 2R92B 4F7XA 1PRTF 2BCOA 2M00A 2Q8IB 2O5IC 3SK8A 4IFDJ 3TP8A 1CA5A 2BA0A 1X3PA 4A3JB 2D9UA 2E76C 3SE0A 1LTGD 1LACA 2K33A 3S9WA 4A3IB 4XYOA 5EQ0A 5FO8B 3DWQA 3SEBA 2QDBA 3BVMA 2JA5B 4JK1C 2FMMA 3IFDA 3D6WA 2F0EA 2F0KA 1EY6A 5AFWA 1BCPC 2XVSA 3VYUA 1GUOA 2XRSD 1C48A 1BQQT 1EIHA 4DF7A 3HKZB 1TU2B 5I9PA 3MFGA 1E2ZA 2J0TD 3KF8A 3M4YA 1Y1WB 1IYVA 4KHVA 1OXXK 1JOKA 4NW2A 3IL8A 3X3MA 2SDFA 1YNND 5EKKA 2A6EC 5A35A 4UAIA 1S4ZA 2J4XA 4RHSA 5ELDA 1BBXC 1KABA 3D8GA 1SNDA 4FVMA 1V1PA 2HDLA 2FINB 4CJ0B 2MP1A 1PTOF 1JCKB 4DXFA 1PLFA 3DWPA 4IUPA 2G9HD 2QILA 3A54A 3QWNA 4H13C 2F0FA 5JOBA 1SFOB 3NHHA 4BY1B 3VR3A 4LJZC 4X3UA 1KDCA 2WINB 1JQYD 4RH6A 2B2WA 4XYQA 3MZ5A 3FPUB 1TS2A 1CQFA 4DXGA 1FGBD 3OWFA 2K5DA 1F9PA 4NDXA 1JWMD 3TP5A 3PO2B 4CKBA 3K59A 2K03A 4RGMA 1CM9A 1SYEA 3T51B 3FDTA 1SNCA 5I6WA 2RA4A 5COYA 1SJED 2HUGA 3NWTA 1QILA 2V4DA 1WTRA 1Z7TA 4OO1I 1JWUD 2E2JB 2PZTA 2IX1A 4JBWA 3ND9A 4PQXA 5IGFA 3GTPB 2EYPA 1D1IA 2F0HA 1JC7A 5IIFA 3I72A 5KYIA 1AN8A 1T5XD 1V43A 3Q0AA 1STAA 2DN8A 5C0XJ 5IGDA 3SHLA 1LTAD 5ISRA 1QNKA 1KNEA 4TQUS 1D5XC 2B2YA 4LAAA 1EU3A 1ILPA 3PUYA 1B1ZA 1G291 2DY7A 1RF2D 2Q8TA 1K8OA 1S5ED 2PW5A 4FP5D 1PFBA 3BZDB 2Z4HA 1Q90A 1R4PB 2NN6H 4FXKC 3H0GB 1RKNA 2BE5C 5EPKA 3H3VC 2R7ZB 4DNTB 3OHXC 1I4GA 1DXMA 3A8JE 3SK4A 2B2TC 5JPNC 2OT2A 2KQ3A 2B8FA 3VR4A 5BN3A 3SDZA 1EQTA 2NZ1D 2DY8A 4OGQC 3S16B 1A2UA 1OXTA 3C1FA 2HCCA 1V1PB 3E5SA 5C3WA 4O1NA 3BDOA 3DXJC 1TWHB 5KYLA 3L3OC 4A3MB 4KTAA 5E4XA 2I07B 1STYA 1CZWA 2SNSA 1B4OA 3P1HA 3NQIA 2I46A 1WD0A 5FK9C 4DA2A 1Z6HA 2K5WA 3C3LA 3QB3A 1HHVA 3EQLC 5LL6X 4QMGA 4Y7NB 1L0XB 5C0XI 1TWAB 2ICIA 4G4KA 1TQOA 3WOFA 4IUVA 2RDFA 4R9WA 2YYZA 4WRDA 1DJRD 1F2MA 4ZK9B 2O2LD 4C3JG 1UUPA 1UAPA 2F0OA 2MUYA 1JICA 1BOSA 5TSSA 1KLGD 2F0MA 1PTOB 4OIKA 1HUNA 3T4AC 2YU9B 3D31A 1VMCA 1GXDC 4BBSB 1F9SA 2IWHA 1PRTC 2NUCA 4ZYSA 4RKBA 3K6OA 1RHPA 4FO2A 3NK9A 1JB3A 3VA7A 3NWSA 4XTCS 4ILWA 1CFMA 1A3VA 1EL0A 4OIJA 1RCVD 1W6KA 4XQJA 1CQVA 1NR2A 3NTKA 3BDLA 2D2CC 4B08A 1SNPA 3T56B 4L8JA 4MN3A 2EYLA 3Q6SA 3C1EA 2B2UA 3C2PA 3GTMB 1HQMC 2X6LA 1QG7A 2TSSA 2WAQB 2F0UA 5K5PA 1KLUD 3BYYB 1RDPD 1G2TA 1SE4A 3MTSA 1O80A 1U4PA 5DM73 3S14B 5D3DA 1W6JA 4WJWA 3CRLC 3KK7A 4IFDI 3DWAA 2WIIB 4PMCA 2B2TA 2IJ0A 3CU7A 4XXEA 4KD3A 3PUVA 3AU7A 1SDFA 5F2DA 4A3DB 2XWBB 4HSPA 5HURA 2CW0D 2PZWA 4C3JB 2AQ2B 4OHJA 1DYQA 4IUNA 4C1NK 4EQNA 1D2BA 1PZKD 1BXTA 4RCOA 4HN7A 3KUPA 2NVXB 4KJNA 3GO5A 5M9OA 3N6RA 5KNDA 1CT1D 1TS4A 3J7AF 3OMCA 1SYGA 3K5NA 4K5XA 1I4PA 2EJMA 4EQOA 4QF4A 1ENCA 1VF5C 1ENAA 5EPLA 1CZGA 1H9RA 3SK6A 5EKLA 1E2VA 4IN3A 5CC4A 2WKDA 1OXUA 3QO2A 2PYKA 1MI2A 5ELCA 4NMZA 4BY7B 1F9QA 2XSCA 4DU9A 1X32A 3HS0C 3R2TA 3GTKB 4ID6A 2RVLA 3SR1A 1PFMA 4CBVA 1PMRA 1STEA 1PTOC 2IT1A 4H7BA 3S1RB 2JA8B 1GHKA 1ET9A 4RKLA 5E1FA 4IURA 1CTMA 2XWJB 4X3KA 5D14A 1R9TB 3FEWX 5IODA 3S1MB 1J8IA 1FNVA 3TBIB 3PUXA 4KN7C 4KKUA 1PTOH 3GV6A 2E2IB 1SE3A 5M5WB 2CHBD 3OIQA 3GTOB 2C9OA 3TMEA 1A2TA 2L11A 2D62A 3AB9A 2AWOA 1IKMA 2H1EA 4CKCA 2LY7A 5DEHA 2F0IA 1LTSD 4A93B 2EYHA 4DGZA 2FFKB 1XXGA 3X3NA 5FO7B 4A3KB 2L12A 3CKIB 4YIJA 3H09A 5K36H 1E0BA 2L0CA 3LWUA 4ZLTF 1Y8NB 4KKSA 1YNNC 3L7ZC 4BA2I 2A74C 4KHZA 2E2DC 1M8AA 2A69D 4OL7A 2B63B 1Q12A 3BYTB 3NUCA 3GTQB 2IPKD 1WD1A 2EY6A 3OIPA 1LTBD 4BS9A 1STGA 1TY0A 2SNMA 2N55A 1EY4A 3A56A 2R6GA 2EE1A 1FYCA 1U4MA 5FLXE 4IFDG 2OEOA 3MWYW 4ZUIA 3EFXD 1TS3A 3K5OA 2RQXA 4OO1G 1SSOA 4K6LA 3GTLB 3E0JA 4TRDA 5C4ZA 4I65A 3Q22A 1JWSD 1F77A 2MJ8A 3Q23A 2R93B 1EY0A 3I73A 1YNJD 4X3TA 2PNRC 2F0JA 1IKLA 3HOYB 4Q0FA 3T53B 4KK7A 4ZQ3A 4C3HG 2EYJA 5KNBA 2HCIA 2SOBA 2BOSA 3OSOA 3O13A 1UNSA 1ONLA 3AMUA 5JVG3 2A73B 1EFID 3EA6A 1PDQA 3W2DA 2L1BA 3NBHA 4U673 3TP7A 2VB2X 2JE6I 3HOXB 3LWEA 5C6AA 4GZYC 2L9HA 4CHTB 3E6ZX 2QF7A 1SE2A 3OMGA 3J81E 1WTOA 5EPJA 1QJOA 2ZXRA 1WTWA 1BUVT 3I8ZA 5I2YA 1A6XA 3MFYA 3P7JA 3RMHA 3R3OA 3VR6A 1PFNA 2LMCB 4TKOB 4FF2A 2KJXA 1TY2A 1HA5A 1LTID 5J22A 1AW7A 1B9NA 3NQTA 3A7LA 2QEJC 4HAEA 1SYDA 3K7AB 2OF1A 2NN6G 1BCPD 5C3EB 2K7VA 1TWFB 1Q1EA 2G9DA 3MEHA 1A3UA 1F2LA 3G6JB 1HFNA 5J1ZA 5KRUA 2ZT9C 3DMUA 4EVOA 3BVGA 3TN2A 2NVYB 1QNUA 1Z47A 3NTIA 3PMFA 2DNEA 2A6ED 4PMWA 2KCCA 4KJOA 1WCMB 3KLRA 4KV6A 5M3MB 1PRTB 5IGCA 1DZ1A 3ITPA 1H9MA 1SYCA 4ODGA 2F3VA 3FKIB 3WOEA 4B9XA 3SVMA 1G91A 1LLRD 3D6CA 5FLXL 2ICEC 5CV9A 1FNUA 2L4NA 4IUTA 1ZKOA 1EYCA 1ICWA 2A6HC 1HQRD 3DEPA 1R4QB 3QOJA 5ELEA 3NSWA 1DCZA 1UEAB 4G7ZC 4QCLA 3I4MB 1I4RA 3HP3A 4HMJA 3TZUA 1H9KA 5M5XB 1TWCB 2XRQD 1GOZA 2IL8A 4C1NI 2B39A 2PMZB 4HR7B 5M5YB 4RAUC 1ET6A 4PNYA 1TS5A 1CHQD 4BA1I 4FF3A 1X3QA 3M85A 1PRTD 3TZDA 4G7HC 1STBA 3K5MA 1VCIA 5ELFA 4RA8A 2KVMA 5D65A 1H9SB 3NXWA 1PZJD 5CR3A 4A3GB 2F3WA 1NUCA 1CA6A 4DAYA 2RBMA 2EY5A 1ZYRD 2Z8LA 3V96A 4S3SA 3BS1A 5CBAE 3OPOA 4IUUA 2FMCA 5FKAC 2LFNA 3MXUA 2CVRA 2D5DA 1OXVA 1A3TA 3OW7A 4DN4M 5JPMC 4ZRZA 3J7YW 1JOQA 4UDUC 1HRJA 3BVZA 3ND8A 3A55A 2WV6D 1TWGB 1O7ZA 1GHJA 4H0LC 1XX8A 1EY8A 5JJZA 2E74C 3U9OA 3S1NB 3LNNA 1AEXA 5JVH3 2B2WC 3HG9A 2KCNA 1JOOA 5C0XG 4I7ZC 4XDXA 1GUTA 1KDBA 4A3FB 3M4OB 5DAUA 3EROA 1DOMA 5J39A 3RD4A 4P2CB 2B8GA 4V190 3NPPA 2RDGA 3D4WA 1CK1A 4ZKBB 2A68D 4LMQD 4C3HB 3GTGB 4N9TA 4FF1A 1AFPA 1HUMA 3HGBA 3N52A 3NE5B 3I3CA 2JEBI 4BWGB 5KGUA 1II3A 3I91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZK9 B;  2HDL A;  4QUC A;  5EKI A;  3DEO A;  4X3T A;  2FIN B;  1MSH A;  1J9O A;  1EOT A;  1NCV A;  1AZQ A;  4CJ0 B;  2MP1 A;  4XT3 B;  1IKL A;  2K01 A;  3H91 A;  2DY7 A;  1CA6 A;  1WTP A;  5DNF A;  1JE4 A;  2XIW A;  1MSG A;  2JYO A;  2Q8T A;  1EIG A;  2L11 A;  1PLF A;  5COR A;  1G6Z A;  1F2L A;  1JIC A;  1IKM A;  5CBA E;  4IUP A;  2H1E A;  4IUU A;  3G7L A;  3KBX A;  1TVX A;  2VXW A;  3KUP A;  1HFN A;  2X6G A;  2HCI A;  4OIK A;  1HUN A;  1PFB A;  2M2L A;  2FFK B;  2RSN A;  2CVR A;  1RJT A;  2K05 A;  3TN2 A;  1B3A A;  1VMC A;  1KNA A;  5T1G A;  2Q8R E;  4IUQ A;  4DN4 M;  4ZKC B;  1LV9 A;  1MGS A;  2J7Z A;  1WTX A;  1F9S A;  1NR4 A;  4X3U A;  1PDQ A;  5T1I A;  5CMD A;  2NYZ D;  2L12 A;  4X3S A;  3UI2 A;  1HRJ A;  5EPK A;  3ONA B;  2L1B A;  1WTQ A;  1F9R A;  1O7Y A;  1U4R A;  2K04 A;  1RHP A;  1CA5 A;  1E0B A;  1DZ1 A;  1A15 A;  1X3P A;  2B2V C;  2B2T C;  2B2W A;  5EPL A;  1RTN A;  1O7Z A;  2B2U C;  2D9U A;  4ZLT F;  4HCS A;  3FPU B;  2K28 A;  3LWE A;  4HED A;  4O42 A;  1BF4 A;  1XX8 A;  1EQT A;  4ZAI A;  5JJZ A;  1Q3L A;  1F9P A;  1RTO A;  1C8C A;  1EL0 A;  1BO0 A;  5EQ0 A;  2MPM A;  2NZ1 D;  2L9H A;  4OIJ A;  1M8A A;  2KED A;  4CJ2 C;  3SVM A;  2B2Y C;  1G91 A;  2B2W C;  1IL8 A;  1DOK A;  2B2V A;  2X69 A;  3QO2 A;  2NWG A;  2DY8 A;  2K03 A;  2FMM A;  1MI2 A;  2L4N A;  4IUT A;  5E4W C;  3IFD A;  4XDX A;  1NR2 A;  1WD1 A;  1AZP A;  2EOT A;  1CM9 A;  1ICW A;  1NAP A;  2FHT A;  1F9Q A;  1VMP A;  2R3Z A;  5EPJ A;  3D6W A;  1WTO A;  2HCC A;  2KUM A;  3DEP A;  3F2U A;  1X32 A;  5EJW A;  5CBE E;  3FDT A;  3I90 A;  4MN3 A;  1B53 A;  1DOM A;  2RVL A;  2N55 A;  1PFM A;  3Q6S A;  1WVL A;  5AFW A;  1WTW A;  1BNZ A;  1DOL A;  2KOL A;  4U68 A;  2RA4 A;  4MHE A;  3HP3 A;  5COY A;  3R93 A;  3I8Z A;  2B2U A;  2HUG A;  3P7J A;  5E4X A;  1WTR A;  1QE6 A;  1ESR A;  2EE1 A;  1QG7 A;  1U4M A;  1PFN A;  2X6L A;  4CJ1 B;  1EIH A;  2K1B A;  2EPB A;  2BDN A;  1HA6 A;  3MWY W;  4ZKB B;  1DON A;  4XT1 B;  2IL8 A;  4LMQ D;  3GV3 A;  1AP0 A;  4RWS C;  1G2T A;  1B4O A;  1ML0 D;  2HDM A;  3DM1 A;  3MTS A;  1O80 A;  4RAU C;  4R8I A;  1WD0 A;  1ROD A;  1U4P A;  4IUR A;  2JP1 A;  4X3K A;  1X3Q A;  1HHV A;  4NW2 A;  1B50 A;  1U4L A;  1HUM A;  3IL8 A;  1ILQ A;  1SSO A;  5D14 A;  1HFG A;  2SDF A;  2MGS A;  3TZD A;  1GUW A;  3N52 A;  2B2T A;  1XYI A;  4UAI A;  1S4Z A;  1WTV A;  2FJ2 A;  3I3C A;  4HSV A;  2RSO A;  4HAE A;  4RA8 A;  4QUF A;  1SAP A;  2KVM A;  5D65 A;  1J8I A;  1SDF A;  1BBX C;  1QNK A;  3I91 A;  4IUV A;  2N88 A;  4R9W A;  1B2T A;  1KNE A;  2KEE A;  2KEC A;  2B2Y A;  1ILP A;  1G2S A;  2MJ8 A;  3GV6 A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 5C44 B;  2I5L X;  3T1Y L;  1S40 A;  1B9M A;  5LL6 S;  2JA7 H;  1XMQ L;  1NCV A;  4DK0 A;  4RGT A;  2OCE A;  3GDE A;  4F88 A;  4NP5 A;  1VQL A;  4PMB A;  4DAY B;  1JB7 A;  1YHQ A;  3HOU G;  1Q82 C;  1KQS A;  2HHH L;  5C5M A;  1N32 Q;  2ENB A;  1SEB D;  4IZ8 A;  1PYW D;  3W3A A;  1PXU A;  3PO2 H;  1Q86 C;  5IWA Q;  4HIO A;  2WP8 J;  4A3B B;  2EXZ A;  4LK1 C;  2F03 A;  3TEH B;  3D4D A;  3C46 A;  3P75 A;  1NR4 A;  3I4L A;  5CMD A;  1JOR A;  1SMY C;  2F0V A;  4GS3 A;  3GTG H;  2R92 H;  2B2V C;  4HTH A;  2CQO A;  4C3J H;  1LT5 D;  4A3K H;  4B9W A;  2LXJ A;  5D3I B;  3URY A;  2K6A A;  3CQZ H;  2RHS B;  1K3B C;  2F0D A;  2PI2 A;  2PW7 A;  3VYT A;  4DK1 A;  3K57 A;  4CJ2 C;  1Y8P B;  1A62 A;  1J6Q A;  1STN A;  1VQD A;  1AZP A;  2F0N A;  3V2T A;  1VMP A;  4A3F G;  2KHI A;  2L5T A;  2LS0 1;  2EJF C;  3PUW A;  4GNX B;  3ULP A;  1K0S A;  1FR3 A;  3TRZ A;  4KD4 A;  5M3M H;  3CCV A;  4K0K Q;  1B53 A;  2F0G A;  3UDI A;  1D8L A;  5JEA G;  1IYU A;  2CWA A;  1DOL A;  1TKW B;  1BNZ A;  3MA2 B;  2HQE A;  3KF6 A;  4KY5 A;  4KMU C;  4XQN A;  2LSS A;  4BBR B;  3PIP A;  4LUO A;  1D5M C;  3M7G A;  4OON A;  1VQK A;  2VNU D;  3HRZ C;  2HDM A;  3GTK H;  4J6H A;  3HOW H;  1ROD A;  2KCM A;  2JP1 A;  3R2I A;  2UUC Q;  4QY7 A;  1B50 A;  1JMC A;  3CCJ A;  1EQV A;  1Q1B A;  4K5W A;  1LT4 D;  1XYI A;  2B63 H;  1S5D D;  3S1R H;  1YEZ A;  1C7Y A;  4DR5 L;  4JI5 Q;  4CDD C;  3TP6 A;  1I4H A;  4XQQ A;  3HOV H;  3Q24 A;  4QUC A;  4RMF A;  4TVA B;  3MC0 B;  3ULJ A;  4G57 A;  3DEO A;  1EEI D;  1Q8I A;  3TDQ A;  4Y7N H;  4ULL A;  2PMZ E;  1SYF A;  3JAM i;  1I4Q A;  3HOU B;  1EQR A;  3QG1 A;  3CHB D;  2JYO A;  1KAA A;  2F52 A;  4LW1 A;  5K36 G;  4C2M B;  4DR3 L;  1TII D;  1NMG A;  4AYB B;  2A68 C;  1A8V A;  1VQB A;  2KHJ A;  1SRU A;  4KY6 A;  4RGN A;  2X6G A;  1F2Z A;  4DUZ Q;  1HH2 P;  2E2I H;  2M2L A;  1EZ8 A;  3HZX A;  1VQI A;  3FVQ A;  4RFB A;  2N8N A;  4DNI A;  5CV7 A;  3KDF A;  2IX3 A;  1KTK A;  1ESF A;  1EQQ A;  3IFT A;  2A69 C;  2O5J C;  4X3S A;  3ONA B;  2UXD Q;  4P75 A;  1WTQ A;  1IW7 C;  5CGK A;  1DM0 B;  4AH6 A;  1NY4 A;  5I9O A;  1A15 A;  3GTJ B;  2ZXP A;  3BG3 A;  2B2U C;  3GQB A;  3LX0 A;  2F0Q A;  1GUS A;  2JA8 H;  4C3I B;  2CQA A;  1IBK Q;  4M1U B;  3RZO H;  1IBL Q;  5LMU L;  2NWG A;  4R1J A;  3H94 A;  5G3L D;  4A3G G;  5E4W C;  3PF4 A;  2R3Z A;  2ZTE A;  1J5E Q;  1HR0 L;  2TMP A;  1SNO A;  3KLS A;  5FLM G;  2JEA I;  1EU4 A;  2RCF A;  4UP8 A;  1KDA A;  2WAC A;  1VF7 A;  3I90 A;  5M5Y H;  2EYM A;  2R61 A;  2AUK A;  4DR6 Q;  1UWV A;  2O4X A;  5CV5 A;  4DR5 Q;  1XPR A;  1MBY A;  1EYD A;  1PTO D;  4POF A;  2QCP X;  3DLL A;  4ME5 A;  2RDH A;  1FNW A;  4DV6 Q;  2CH4 A;  2AHO B;  1M4V A;  3CC2 A;  2UXB Q;  1AP0 A;  5C4J B;  1DD2 A;  2MHV A;  4JI0 L;  3ERQ A;  2KHS A;  1GUN A;  3S14 H;  2PQE A;  1YJN A;  2Z4I A;  2K32 A;  3B6Y A;  3RN5 A;  4FF4 A;  4Y52 H;  2UUB L;  1U4L A;  3HOU H;  1STH A;  3K5L A;  5EBC A;  1WTV A;  5DLQ E;  2CCZ A;  4O0A A;  1DGS A;  3OOC A;  2E8G A;  3PO2 G;  1S5F D;  1RD9 D;  3CCE A;  4M8A A;  4UP7 A;  1MSH A;  1TT2 A;  1EOT A;  3MVV A;  2K01 A;  2ZXO A;  3M3Y H;  1BCP F;  2RKS A;  1AE2 A;  2EY1 A;  2AUJ D;  2VS1 A;  1L0Y B;  2E5L L;  2PNH A;  4X66 L;  1QWY A;  1HXY D;  4A3K G;  5GAE C;  3MXG A;  5EAY A;  3BJU A;  4LFC Q;  1KL9 A;  5IT9 E;  4A3C G;  3OW2 A;  2HQL A;  3VR5 A;  4RHR A;  5NUC A;  1UE7 A;  1WYD A;  5GAH C;  4C56 C;  4YHH Q;  3IRB A;  3S2H B;  5T1I A;  4PZ7 A;  5JEA J;  2B29 A;  3J81 L;  1TR5 A;  1I6H B;  1F9R A;  4FNF A;  4DNR B;  1Y1V H;  3L0O A;  4OWW B;  4KN4 C;  2NZO A;  1PH3 A;  5E7N A;  4DK6 C;  2BDO A;  3K58 A;  1RTO A;  1C8C A;  2CFM A;  1GUG A;  4K8J A;  2NB0 A;  1CSQ A;  2KED A;  1X55 A;  2B2V A;  2X69 A;  1SYB A;  3CQZ B;  1JJG A;  1HR0 W;  2A5H A;  3A8K E;  4LUV A;  3S17 H;  1R9T H;  3EJI A;  2KA7 A;  3M3Y B;  3KJO A;  3MXP A;  5IT9 L;  2VUM B;  3HOW B;  1EY5 A;  2DJF C;  5IP7 H;  2EDG A;  3QR8 A;  1LM0 A;  1FD7 D;  1K83 B;  1I4X A;  4K2L A;  4ZUJ A;  5HGT A;  4OX9 L;  1HTP A;  4CJ1 B;  5I2X A;  5JAV A;  4GLV B;  1HA6 A;  1HTL D;  4JI1 Q;  2Y0S B;  4YWK A;  4DFA A;  4J1M A;  1QZG A;  3PQI A;  1ENF A;  2EJG C;  2VB3 X;  4LUZ A;  4LFA Q;  3PIO 3;  4RGO S;  5LHY 1;  4DV1 Q;  3VR2 A;  1P8L A;  4IAL A;  3J7A V;  5ELN A;  1ASY A;  2PO4 A;  2RSO A;  4POG A;  2AQ1 B;  2UUC L;  2BE5 D;  3RN2 A;  2ZTC A;  4WFN 3;  1HCZ A;  4FYD A;  1G2S A;  3PO3 B;  2WB1 G;  2LKV A;  1TWA H;  4V0B A;  1LUZ A;  2JA6 H;  3I7F A;  4F8M A;  2XIW A;  1MSG A;  3S2H H;  1I3Q B;  4JV5 Q;  2OQ0 A;  1IBM Q;  1VQE A;  3T16 A;  1BCP B;  3G7L A;  1TVX A;  2VXW A;  4DV7 L;  1LT6 D;  1VQJ A;  4IQZ A;  4L63 B;  1LO5 D;  4NXN Q;  1BDO A;  1OO9 B;  2ZJR A;  5LMU Q;  2K05 A;  4R4T A;  5EBD A;  4C3I H;  4WJ3 M;  1N8R C;  4IUQ A;  2C35 B;  3VDY A;  1I50 H;  3EBE A;  4ZKC B;  1VQP A;  5I4D A;  1YNX A;  4KLK A;  1QVC A;  3EVQ A;  1Y1V B;  2F4V Q;  2JA6 B;  2I5M X;  3J80 L;  1HNX L;  5A2Q E;  3K7A H;  1W2B A;  3JC6 6;  1UE5 A;  2K28 A;  3FPP A;  2UUA L;  4IJL A;  1HZC A;  3BZC A;  4PZ8 A;  3CF5 A;  1E22 A;  1QOH A;  1CI3 M;  2PCF B;  4B3R Q;  4MIU A;  1NBW A;  2H5X A;  1Q7Y C;  5IWA L;  2EOT A;  3H3V H;  4HMI A;  1FL0 A;  3RZD B;  2AWN A;  5AJ3 L;  1UE6 A;  4LF9 Q;  1Q46 A;  2WAQ G;  5EJW A;  4DV4 L;  5CBE E;  4LF4 L;  1VDZ A;  4AIM A;  3H6M A;  2KOL A;  4U68 A;  4JI2 Q;  1S5C D;  2WFW A;  1B3Q A;  1SJH D;  1CKM A;  2JSO A;  1LT3 D;  5ELB A;  1M1K C;  4K14 A;  3CC7 A;  1DON A;  4XT1 B;  5BN4 A;  2XN9 C;  4LF8 Q;  3DM1 A;  4JW0 A;  2YTV A;  4R8I A;  1YIT A;  2R7F A;  1Q81 C;  1EEF D;  5DM6 3;  2NVQ B;  1CHP D;  2EQS A;  3S16 H;  1X9N A;  4L5S A;  5CV8 A;  2MGS A;  4A76 A;  4OXP A;  2PPB C;  4R4I A;  1N32 L;  4A75 A;  1EYG A;  1EIF A;  1WCM H;  2K75 A;  4HSV A;  4HCE A;  1B44 D;  1KHI A;  4QUF A;  3HOZ G;  2M9V A;  1U9R A;  2N78 A;  1LTT D;  2N88 A;  1MHW C;  3GD7 A;  1VQ5 A;  2XNA C;  2NVX H;  1XTC D;  5KEE A;  3KF6 B;  1YNJ C;  2HT1 A;  3TSS A;  5FO9 B;  2F4I A;  3G6E A;  1EYA A;  1PHJ A;  3GTL H;  4NKL A;  3VA5 A;  1PFS A;  1JE4 A;  2GVA A;  1EIG A;  2AMC B;  1SNM A;  4JI7 Q;  1EZ6 A;  2JA7 B;  3TQY A;  1F2Y A;  2R93 H;  5KNC A;  1SBB B;  1FJG L;  4A3D H;  4TSS A;  2F3I A;  3G71 A;  3MHB A;  5C0X H;  1H95 A;  5T1G A;  2Q8R E;  5E3F A;  4ABN A;  1HNX Q;  1MKH A;  3HOX H;  1YJ9 A;  1Y14 B;  2NYZ D;  2R7D A;  5IYB G;  5C5L A;  3RUZ A;  4K6D A;  1O7Y A;  1KC8 C;  2K04 A;  3P20 A;  1D1K A;  3MXN A;  4AYB E;  3CAM A;  4Q5V A;  2A19 A;  1RTN A;  3VYR A;  2E75 C;  4HED A;  4H02 A;  1BF4 A;  4BXX G;  5IGG A;  2E2H H;  4NXM L;  3R8B A;  3JAM L;  1O78 A;  1BO0 A;  1VQH A;  4GN5 A;  1IL8 A;  1DOK A;  1OXS C;  4FXG C;  1BVS A;  2FHT A;  1N33 Q;  5BN5 A;  1SNQ A;  3I4N B;  3HEJ A;  5J3B A;  2DNC A;  1Q8K A;  4OWX B;  2VUM G;  5C44 H;  3CME A;  1YZ6 A;  3A5U A;  2RF4 A;  3R93 A;  2EVB A;  3SK5 A;  1GVP A;  3UE0 A;  3S2D B;  1X3G A;  5M3F H;  4CDC C;  2DJG C;  2KEN A;  2BDN A;  3D4R A;  1EY9 A;  1K83 H;  3CRK C;  2B3G A;  5EGT A;  3NEL A;  2NZH A;  3J81 j;  2NBF A;  4K8I A;  4K5V A;  2ZM6 Q;  1CKO A;  4KY7 A;  2C5C A;  1ILQ A;  3H15 A;  1HFG A;  1P16 A;  4JI1 L;  3IAY A;  2F0S A;  3GTO H;  1SXT A;  4A3J G;  3HKS A;  2WKC A;  4CDE C;  2Q2I A;  4HJA A;  5BR8 Q;  1XPU A;  2E2H B;  1T5E A;  2KEC A;  3AFP A;  3S1Q B;  4C3I G;  3M7N A;  3NTH A;  4Z9C B;  1L1O C;  5EKI A;  1GJX A;  2BH2 A;  1AZQ A;  1CUK A;  4CKE A;  3E9I A;  4XT3 B;  3H91 A;  4HIM A;  1Y8O B;  4ZCK A;  1WTP A;  5DNF A;  3A7A B;  3I4N G;  2AQ3 B;  3ZYY X;  4L6T B;  4BY1 H;  3KBX A;  4WOR A;  1Y69 U;  4X62 L;  3HOV B;  4A93 H;  5LMN W;  4J8Q A;  2RSN A;  5M3F B;  1RJT A;  1RL2 A;  2HD3 A;  1WI5 A;  2ID0 A;  2F0P A;  1LV9 A;  1WTX A;  3RR5 A;  4F87 A;  4GNX C;  3UI2 A;  2BA1 A;  3K8A A;  4KI0 A;  1U4R A;  4R4O A;  5A2Q L;  3T1H L;  5IGB A;  1I5F A;  3K0Y A;  4ZAI A;  4DV6 L;  4QIW B;  2NTS A;  5LMN L;  4LFC L;  1ZYR C;  4MTN A;  2GA4 B;  3BDC A;  3K80 C;  4G7O C;  1IW7 D;  3OWE B;  3PCO B;  3F2U A;  4RCN A;  4HJ9 A;  1PH6 A;  1SMY D;  1D5Z C;  2VZA A;  2F0W A;  2OXP A;  3TS2 A;  4MHE A;  1A63 A;  1N36 Q;  3JAM E;  3VYS A;  1IHZ A;  5G3L F;  1S5B D;  4BBR G;  4DAV A;  3HOV G;  2PZU A;  2K1B A;  2JXM B;  1Y1W G;  4DR6 L;  2F1M A;  3DHQ A;  1VQ7 A;  2CWP A;  2XGT A;  2JA9 A;  2L55 A;  1H9J A;  2NN6 I;  2Z1C A;  3H0G G;  2MO1 A;  1PV4 A;  3I4M G;  2K5N A;  3MXN B;  4EGV A;  3KLS X;  3WDN A;  1V1O A;  4DR2 Q;  1GUW A;  2PQA B;  1D6E C;  5FJ8 H;  4P71 A;  1SAP A;  4A3B H;  4A3D G;  4K2K A;  3GP7 A;  4R4C A;  1EWC A;  1K3R A;  1EY7 A;  2K5Q A;  2KEE A;  1ZXT A;  4P73 A;  4A3E B;  3CPW A;  4E6I A;  5CYU A;  1K8M A;  4DAP A;  3KBG A;  3CCS A;  1HNW Q;  1X54 A;  2UXD L;  1C4Q A;  3FRP B;  1ICF B;  1T9H A;  1XWE A;  4IPC A;  1I50 B;  4QGU A;  2IX0 A;  4EQ5 A;  1WJJ A;  2P5Z X;  3PUZ A;  4BY7 H;  4DV3 Q;  4OO1 H;  2CW0 C;  1MJC A;  2NVT B;  1G8Z D;  2ATW A;  1IXR A;  3SGI A;  3I70 A;  1KNA A;  3A8I E;  4QL5 A;  2ASB A;  1E2W A;  5AJ3 Q;  4LF9 L;  1E24 A;  1MGS A;  2J7Z A;  1HZB A;  4C2M H;  1EWH A;  2IW3 A;  1NSN S;  1QB5 D;  2QKI C;  2JN4 A;  3Q8D A;  5C4H A;  4IFD H;  1EUJ A;  4X6A H;  3HOZ B;  1QCB D;  4LF7 Q;  4HCS A;  3ER0 A;  4O42 A;  1RIP A;  3S15 B;  1Q3L A;  4LF5 L;  3S1N H;  2UXC L;  4DUZ L;  1HPC A;  3V05 A;  2MPM A;  3EIV A;  3NP8 A;  4A3I H;  2B2Y C;  2SEB D;  4DR4 L;  5IOC A;  4N8F A;  1LTR D;  1NAP A;  2KUM A;  1H9S A;  3DM3 A;  5CV4 A;  3HKZ G;  1E7Z A;  5CV6 A;  1NE3 A;  5HGQ A;  1MD2 D;  2H4O A;  1WVL A;  3KYH C;  5C4X G;  1E1O A;  3FMC A;  5I6Y A;  2NTT A;  4JI6 L;  1QE6 A;  4A3E H;  1ESR A;  3ICE A;  3NBH B;  1YVC A;  3D3R A;  2R92 G;  1EIY B;  2EPB A;  3S15 H;  3J80 E;  4BBS G;  4KKT A;  3U9S A;  3GV3 A;  4RWS C;  4IOA A;  4NPS A;  4PV1 C;  1ML0 D;  1I6V C;  1JR0 D;  3NBI A;  3DUZ A;  4X64 Q;  2QW7 A;  4MTK A;  3I4N H;  3L9A X;  4HID A;  3SXH A;  3QIA A;  1YJW A;  2FJ2 A;  3RZO B;  1PZI D;  5FOB B;  2EYF A;  4FXD A;  4I7A A;  1HNW L;  1LAB A;  3QOL A;  4CGY B;  1B2T A;  2EY2 A;  2V1C C;  2WB1 B;  5JEA H;  3T13 A;  3CW2 C;  5C4X B;  3IKJ A;  1J9O A;  2HHH Q;  2F0T A;  3MAQ A;  1BR9 A;  4XIG S;  1YIJ A;  1ZEQ X;  3KFU A;  1V8Q A;  1QVF A;  2F0L A;  3PV0 A;  2A6H D;  5COR A;  1G6Z A;  3QJY A;  2EZV A;  3W5O A;  5C3E H;  3PIP 3;  4N9P A;  3S17 B;  5IGE A;  3AEV A;  5C4J H;  5KIX A;  4QB4 A;  4H44 C;  1O7L A;  5C3X A;  3RLF A;  1B3A A;  4R8N A;  1HZA A;  2EYO A;  3WWV A;  4EQP A;  4LF6 Q;  2R92 B;  3CMA A;  4F7X A;  3S1M H;  1PRT F;  2BCO A;  2M00 A;  2Q8I B;  2O5I C;  4R4Q A;  4GOP C;  3SK8 A;  4IFD J;  3F8T A;  3G4S A;  3TP8 A;  3CPF A;  1CKN A;  1CA5 A;  2BA0 A;  1X3P A;  4A3J B;  3KF8 B;  2D9U A;  4X66 Q;  4GKJ L;  2E76 C;  3SE0 A;  3EN2 A;  1LTG D;  1E3P A;  1LAC A;  2I5H A;  2K33 A;  3S9W A;  1C9O A;  4A3I B;  4XYO A;  4BBR H;  5EQ0 A;  2I0Q A;  2LXK A;  1QUQ A;  5FO8 B;  3S2D H;  3DWQ A;  2QDB A;  3BVM A;  3SEB A;  2JA5 B;  4JK1 C;  4WJ4 A;  2FMM A;  2QDL A;  2A1A A;  3IFD A;  4GN4 B;  3L2P A;  3D6W A;  4YHH L;  2F0E A;  1BBU A;  4HJ7 A;  2F0K A;  1EY6 A;  1E1T A;  5AFW A;  4JC0 A;  4AYB G;  1BCP C;  4L5T A;  4A3L H;  2XVS A;  3VYU A;  1GUO A;  1QUQ B;  2XRS D;  3F2B A;  1C48 A;  1BQQ T;  1SR3 A;  1EIH A;  4DF7 A;  3HKZ B;  1TU2 B;  2WB1 E;  2AKW B;  2BH8 A;  5I9P A;  3MFG A;  1E2Z A;  2D0O A;  2J0T D;  3KF8 A;  3M4Y A;  1Y1W B;  2Z9H A;  5GRO A;  4DK3 C;  1IYV A;  1IZ6 A;  4KHV A;  1OXX K;  1J5E L;  4GKK Q;  1JOK A;  4NW2 A;  2K52 A;  3IL8 A;  5JJI A;  3X3M A;  2SDF A;  1YNN D;  5EKK A;  4A3G H;  2A6E C;  5A35 A;  4UAI A;  1S4Z A;  2J4X A;  4LF4 Q;  4MZ9 A;  4RHS A;  2FXQ A;  5ELD A;  2E2J H;  5FLM H;  5M5W H;  1X6O A;  1X3E A;  1BBX C;  1KAB A;  4L5R C;  2YU9 H;  3D8G A;  1SND A;  1B70 B;  4FVM A;  2NVT H;  1V1P A;  2HDL A;  2FIN B;  2JA5 G;  4L5Q A;  4CJ0 B;  2MP1 A;  1PTO F;  3TRE A;  3W1G A;  3BU2 A;  1CSP A;  1JCK B;  4DXF A;  1FGU A;  2RCN A;  1PLF A;  3DWP A;  1MJE A;  1TXY A;  2XTI A;  4IUP A;  3J7A 5;  2G9H D;  2QIL A;  5IYC H;  3A54 A;  3QWN A;  4H13 C;  2F0F A;  5JOB A;  1U0L A;  1SFO B;  3NHH A;  4BY1 B;  3VR3 A;  4LJZ C;  2JK8 A;  4YY3 L;  1YHB A;  1K73 C;  4NXN L;  4X3U A;  1KDC A;  2WIN B;  1XMQ Q;  4YWL A;  1JQY D;  4RH6 A;  4DV5 Q;  1TWF H;  1HJP A;  1HZ9 A;  2B2W A;  4XYQ A;  1Z9F A;  2IY5 B;  3MZ5 A;  3PO3 H;  3FPU B;  1TS2 A;  1CQF A;  1VS0 A;  1FGB D;  4QIW E;  4DXG A;  3OWF A;  2K5D A;  2Y0S G;  2QEX A;  1F9P A;  4NDX A;  1JWM D;  3TP5 A;  1FJG Q;  2VL6 A;  3PO2 B;  4CKB A;  3K59 A;  2A8V A;  2K03 A;  4RGM A;  1CM9 A;  1SYE A;  2CKZ B;  3H3V I;  3T51 B;  1QVG A;  3FDT A;  1WCM G;  1SNC A;  5I6W A;  2RA4 A;  5COY A;  2Q2U A;  1SJE D;  2HUG A;  3NWT A;  1QIL A;  2V4D A;  1WTR A;  1PH5 A;  1Z7T A;  4DV0 L;  4OO1 I;  1JWU D;  2E2J B;  2PZT A;  1UEB A;  2IX1 A;  4JBW A;  1YBY A;  3ND9 A;  4HIK A;  4DR2 L;  4HJ5 A;  4PQX A;  5IGF A;  3NEN A;  4PG3 A;  3GTP B;  4GOP A;  3CCM A;  2EYP A;  1D1I A;  2F0H A;  4A3C H;  1JC7 A;  1L2F A;  5IIF A;  1VQM A;  3I72 A;  5KYI A;  1AN8 A;  2UU9 Q;  1T5X D;  1V43 A;  4IJH A;  3Q0A A;  1STA A;  3KDF B;  2DN8 A;  5C0X J;  2VQF Q;  5IGD A;  3SHL A;  1LTA D;  5ISR A;  1QNK A;  4PZ6 A;  1KNE A;  4TQU S;  1D5X C;  2B2Y A;  4LAA A;  1EU3 A;  1ILP A;  1VQN A;  2MO0 A;  3M4Q A;  3PUY A;  1PYS B;  1B1Z A;  1G29 1;  2OTL A;  5IYB H;  4LFB Q;  2DY7 A;  1RF2 D;  2Q8T A;  1X3F A;  3I2Z A;  5IP9 H;  4B3M Q;  1K8O A;  1S5E D;  2PW5 A;  4FP5 D;  1PFB A;  3F1Z A;  4JBK A;  2EIF A;  1HR0 Q;  3BZD B;  2Z4H A;  1Q90 A;  4DV3 L;  1R4P B;  2NN6 H;  4YCU A;  4FXK C;  3H0G B;  1RKN A;  4LWC A;  2BE5 C;  5EPK A;  3H3V C;  2R7Z B;  4DNT B;  3OHX C;  1I4G A;  1DXM A;  3A8J E;  2VUM H;  1SLJ A;  3SK4 A;  4X65 Q;  3U4Z A;  2B2T C;  5JPN C;  4JI3 L;  2OT2 A;  2KQ3 A;  2B8F A;  1XPO A;  3VR4 A;  5BN3 A;  3SDZ A;  1EQT A;  3I55 A;  1KIX A;  2NZ1 D;  3I4O A;  4B3S L;  2DY8 A;  4OGQ C;  3S16 B;  1A2U A;  2NVQ H;  1OXT A;  3C1F A;  2HCC A;  1V1P B;  3A74 A;  3E5S A;  5C3W A;  4O1N A;  3BDO A;  3DXJ C;  4AQY L;  1TWH B;  5KYL A;  4ME3 A;  3L3O C;  4A3M B;  4KTA A;  5E4X A;  3U4V A;  4GKJ Q;  3GTM H;  2I07 B;  1STY A;  4DR7 L;  4NXM Q;  1CZW A;  1NMF A;  2SNS A;  1B4O A;  3P1H A;  4DR4 Q;  3NQI A;  2I46 A;  1N9W A;  4KHP Q;  5IYD G;  1WD0 A;  5FK9 C;  4DA2 A;  2VQF L;  1IL2 A;  1Z6H A;  2K5W A;  1EOV A;  3C3L A;  3QB3 A;  1HHV A;  3EQL C;  5LL6 X;  4QMG A;  2R7Z G;  4Y7N B;  4DV4 Q;  1VQC A;  2PQA A;  2MNA A;  1L0X B;  5C0X I;  4DV2 Q;  1TWA B;  2ICI A;  4UP9 A;  4G4K A;  1TQO A;  3WOF A;  4IUV A;  2RDF A;  4R9W A;  2YYZ A;  4A3M H;  3F2D A;  4WRD A;  1DJR D;  1F2M A;  5GQO A;  4ZK9 B;  3G48 A;  3PSI A;  2O2L D;  4C3J G;  2DGY A;  1I6H H;  1UUP A;  1UAP A;  2F0O A;  2IHF A;  2MUY A;  3OTO L;  1JIC A;  4P74 A;  2ZJQ A;  1BOS A;  1BBW A;  5TSS A;  1KLG D;  2F0M A;  1PTO B;  4OIK A;  3UE1 A;  1HUN A;  3T4A C;  2YU9 B;  3D31 A;  1VMC A;  3FKI H;  1GXD C;  4BBS B;  1F9S A;  2IWH A;  5H1S E;  3K7U C;  1PRT C;  1PH4 A;  2NUC A;  4ZYS A;  4RKB A;  3K6O A;  1RHP A;  1IBK L;  4FO2 A;  1PVO A;  3NK9 A;  1VQ9 A;  1JB3 A;  3VA7 A;  3NWS A;  4XTC S;  4ILW A;  3GTQ H;  1CFM A;  1A3V A;  1L1O B;  1EL0 A;  4OIJ A;  2OQK A;  4P72 A;  1RCV D;  1W6K A;  4XQJ A;  1CQV A;  1NR2 A;  3NTK A;  2R93 G;  3I4M H;  3BDL A;  2D2C C;  4B08 A;  1SNP A;  3T56 B;  1JE5 A;  4L8J A;  4GNX A;  3GTP H;  4MN3 A;  2EYL A;  2Z0S A;  3Q6S A;  3C1E A;  2K5H A;  3S1Q H;  3MEF A;  4LF8 L;  4IOC A;  2B2U A;  2ZM6 L;  4JI4 Q;  3C2P A;  1K8G A;  3GTM B;  1HQM C;  2X6L A;  1QG7 A;  2TSS A;  2WAQ B;  2F0U A;  5K5P A;  1KLU D;  2IHE A;  4JYA Q;  2WAQ E;  3BYY B;  1RDP D;  3K81 C;  4RG1 A;  1G2T A;  1SE4 A;  3MTS A;  1O80 A;  4DUY L;  3AFQ A;  1U4P A;  5DM7 3;  3S14 B;  5D3D A;  1FVI A;  1W6J A;  4WJW A;  1D7Q A;  3CRL C;  3KK7 A;  4IFD I;  2YV5 A;  3DWA A;  2WII B;  4PMC A;  2B2T A;  4K0K L;  2IJ0 A;  3CU7 A;  4XXE A;  3KJP A;  4KD3 A;  3PUV A;  3AU7 A;  1SDF A;  5F2D A;  4LFB L;  4A3D B;  4GLX A;  2XWB B;  4HSP A;  5HUR A;  2CW0 D;  3HFZ B;  4JG2 A;  2PZW A;  4C3J B;  4JOI C;  2AQ2 B;  4B3T Q;  4OHJ A;  4YCV A;  5M3F G;  1DYQ A;  4IUN A;  3AQQ A;  4C1N K;  4DV5 L;  1C0A A;  4EQN A;  4APV A;  1D2B A;  1PZK D;  1L1O A;  1BXT A;  4RCO A;  4HN7 A;  5LMN Q;  3KUP A;  2NVX B;  4KJN A;  3GO5 A;  5M9O A;  3N6R A;  5KND A;  1CT1 D;  1TS4 A;  2D0P A;  3J7A F;  3OMC A;  1SYG A;  3K5N A;  5JJL A;  1JT8 A;  4K5X A;  2EXD A;  1I4P A;  1XJV A;  4HJ8 A;  2EJM A;  4EQO A;  4QF4 A;  4C3H H;  1ENC A;  1VF5 C;  1ENA A;  5EPL A;  2PI2 E;  1CZG A;  2Q2H A;  5C4X H;  1H9R A;  1KRS A;  2KCT A;  3SK6 A;  5EKL A;  1E2V A;  4IN3 A;  4DV7 Q;  4JYA L;  5CC4 A;  1KAW A;  3I56 A;  2WKD A;  1OXU A;  3QO2 A;  2PYK A;  1MI2 A;  5ELC A;  4NMZ A;  1OTC A;  1XMO L;  4BY7 B;  5IYD H;  1F9Q A;  2XSC A;  1HNZ Q;  4DU9 A;  1X32 A;  3HS0 C;  3R2T A;  4OX9 Q;  3GTK B;  4ID6 A;  2R7Z H;  3D0F A;  2RVL A;  3SR1 A;  1PFM A;  4CBV A;  1PMR A;  3J81 c;  1STE A;  2JJQ A;  1PTO C;  2IT1 A;  4A3M G;  2HIV A;  4H7B A;  3S1R B;  3U58 A;  2JA8 B;  1GHK A;  3CCR A;  1ET9 A;  4RKL A;  2DUD A;  5E1F A;  1VQ8 A;  4IUR A;  1CTM A;  2XWJ B;  4X3K A;  1HNZ L;  5D14 A;  1R9T B;  3E3X A;  3FEW X;  2QA4 A;  5IOD A;  3S1M B;  2KBN A;  4JI0 Q;  2JQO A;  4AQY Q;  1UE1 A;  1J8I A;  1GO3 E;  1FNV A;  3TBI B;  3PUX A;  1PH8 A;  4KN7 C;  4KKU A;  1VQG A;  3FKI G;  1PTO H;  3GV6 A;  2E2I B;  1Y1V G;  1SE3 A;  4JI7 L;  1XNQ Q;  5M5W B;  2CHB D;  4IPH A;  3OIQ A;  4JI5 L;  3KLW A;  3GTO B;  2C9O A;  1EWI A;  3TME A;  1A2T A;  4KHP L;  2L11 A;  2D62 A;  3OYY A;  3AB9 A;  2AWO A;  1IKM A;  2H1E A;  4CKC A;  2LY7 A;  4YCW A;  5DEH A;  2F0I A;  1LTS D;  4O2D A;  4A93 B;  3K0X A;  2EYH A;  4DGZ A;  5L37 A;  2FFK B;  4N8X 1;  5FJ8 G;  3PGZ A;  1S3O A;  3JAM c;  5IP7 G;  1XXG A;  3X3N A;  5FO7 B;  2K50 A;  2VQE L;  4A3K B;  2Z6K C;  2L12 A;  3CKI B;  4YIJ A;  3H09 A;  4B3T L;  3KOJ A;  5K36 H;  1E0B A;  1Y1W H;  4JI4 L;  2L0C A;  3LWU A;  3PIO A;  4JI6 Q;  4A3L G;  4ZLT F;  3H0G H;  4B3R L;  1Y8N B;  4KKS A;  1YNN C;  1V1Q A;  3L7Z C;  4BA2 I;  2A74 C;  4KHZ A;  2E2D C;  2MQH A;  1M8A A;  2A69 D;  5FLX c;  4OL7 A;  2B63 B;  1Q12 A;  3BYT B;  3T1H Q;  3NUC A;  4IPD A;  3GTQ B;  2IPK D;  1WD1 A;  2N49 A;  4IPG A;  3E0E A;  2ALY B;  2EY6 A;  3OIP A;  4UPA A;  3CXC A;  1LTB D;  4BS9 A;  1STG A;  1TY0 A;  1N34 Q;  2SNM A;  1I94 Q;  2N55 A;  1EY4 A;  3UDX A;  3A56 A;  2UXB L;  4NB3 A;  5IY0 A;  3E9H A;  1K8A C;  3M4P A;  4LNQ A;  2JA8 G;  2R6G A;  2EE1 A;  1FYC A;  1U4M A;  5ELO A;  2UUA Q;  4X64 L;  5FLX E;  4IFD G;  2OEO A;  3MWY W;  1M90 C;  4ZUI A;  3EFX D;  2GVB A;  1TS3 A;  3K5O A;  2RQX A;  2ES2 A;  4OO1 G;  3A0J A;  1WFQ A;  1SSO A;  4K6L A;  2ZTD A;  3J7Z C;  3GTL B;  1N34 L;  3E0J A;  4TRD A;  1G6P A;  3ULL A;  4DV1 L;  1PH7 A;  5C4Z A;  4I65 A;  1JWS D;  2MJ8 A;  1F77 A;  3S24 A;  3Q22 A;  1GKH A;  3Q23 A;  2R93 B;  4JVZ A;  1V9P A;  1EY0 A;  3I73 A;  1YNJ D;  4X3T A;  1IBM L;  2PNR C;  2F0J A;  1IKL A;  4ALP A;  3PF5 A;  3HOY B;  4Q0F A;  4DUY Q;  3T53 B;  4KK7 A;  3ZJY C;  4GKK L;  4BBS H;  4A3I G;  4ZQ3 A;  4C3H G;  1XNQ L;  2EYJ A;  2Q2T A;  3PO3 G;  1KXL A;  1NJI C;  1NTG A;  5KNB A;  4DV2 L;  2HCI A;  4DR1 L;  2SOB A;  2BOS A;  4YWM A;  3J80 i;  3OSO A;  3O13 A;  4B3S Q;  1UNS A;  1ONL A;  3AMU A;  5IE8 A;  5JVG 3;  2A73 B;  1N33 L;  3M9B A;  1EFI D;  3EA6 A;  2K14 A;  3ERS X;  1A0I A;  4JI3 Q;  1PDQ A;  1TWG H;  3CCL A;  2YTX A;  3W2D A;  2L1B A;  3NBH A;  4U67 3;  4A3E G;  3HOY H;  1AH9 A;  3TP7 A;  3J80 c;  1SRO A;  2VB2 X;  1N36 L;  2JE6 I;  1SN8 A;  3HOX B;  3LWE A;  5C6A A;  4GZY C;  2L9H A;  4CHT B;  3E6Z X;  5C3E G;  2QF7 A;  4JOI A;  4GLA C;  4UY8 C;  1SE2 A;  3OMG A;  3STB D;  3J81 E;  3UDF A;  1WTO A;  5EPJ A;  1QJO A;  3HOZ H;  1YI2 A;  3CD6 A;  1I3Q H;  1U5K A;  5GAD C;  2ZXR A;  1WTW A;  1L0W A;  4J15 A;  5BR8 L;  1BUV T;  1SMX A;  3I8Z A;  5I2Y A;  3MFY A;  4QQB X;  1A6X A;  2Z6B A;  3P7J A;  3RMH A;  3R3O A;  3VR6 A;  1SFO H;  1PFN A;  4UHV A;  2OWO A;  2LMC B;  4TKO B;  4FF2 A;  1VQ4 A;  2KJX A;  3HKZ E;  1YHA A;  1TY2 A;  1GD7 A;  1HA5 A;  2K4K A;  2Z6K A;  1VQO A;  2E5L Q;  3TS0 A;  2OTJ A;  4JCV E;  1LTI D;  1PH9 A;  5J22 A;  1S72 A;  1AW7 A;  4X62 Q;  1B9N A;  3NQT A;  3A7L A;  4JBJ A;  2QEJ C;  3HOX G;  5C44 G;  4DV0 Q;  4HAE A;  1SYD A;  4JV5 L;  3K7A B;  1KD1 C;  4DR3 Q;  2OF1 A;  2NN6 G;  1PH1 A;  1BCP D;  5C3E B;  2K7V A;  2L15 A;  4B3M L;  1TWF B;  1K28 A;  1Q1E A;  1ASZ A;  1PH2 A;  2G9D A;  3MEH A;  4DKA C;  1A3U A;  1B8A A;  1F2L A;  4JI8 L;  3G6J B;  3RZD H;  4LF6 L;  1HFN A;  5J1Z A;  2VY3 A;  2G5D A;  4EX5 A;  4OEM B;  5KRU A;  3BZK A;  2ZT9 C;  3DMU A;  4EVO A;  3BVG A;  3UDG A;  3TN2 A;  3FHW A;  2NVY B;  1QNU A;  1Z47 A;  3NTI A;  3PMF A;  1XTD A;  3A5Z B;  1QZH A;  2DNE A;  1EFW A;  2A6E D;  4PMW A;  2KCC A;  4X65 L;  4KJO A;  2JA7 G;  1WCM B;  3KLR A;  1O7I A;  4KV6 A;  2JA6 G;  5JJK A;  5M3M B;  1PRT B;  5IGC A;  1DZ1 A;  3ITP A;  1H9M A;  1JJ2 A;  2RHQ B;  1SYC A;  4ODG A;  4DPG A;  2F3V A;  1TWC H;  4A4I A;  3FKI B;  3WOE A;  1K0R A;  4B9X A;  3SVM A;  1G91 A;  3CCQ A;  3NEM A;  1LLR D;  3D6C A;  5FLX L;  2ICE C;  4DAM A;  5CV9 A;  1FNU A;  2L4N A;  4IUT A;  4QJF A;  1ZKO A;  1EYC A;  1ICW A;  1NNX A;  2A6H C;  4A3J H;  2UUB Q;  1HQR D;  3DEP A;  1WOC A;  1R4Q B;  3QOJ A;  5ELE A;  4JPB W;  3NSW A;  1DCZ A;  1UEA B;  4G7Z C;  4QCL A;  3CCU A;  4JBM A;  3I4M B;  1I4R A;  3HP3 A;  1G51 A;  2JA5 H;  3RNU A;  4HMJ A;  3TZU A;  1H9K A;  2ZJP A;  5M5X B;  1K9M C;  1TWC B;  2XRQ D;  4LF5 Q;  1GOZ A;  2CH4 W;  3AYH B;  2IL8 A;  4C1N I;  2B39 A;  2UU9 L;  2PMZ B;  4HR7 B;  4BY1 G;  4RAU C;  1PA6 A;  1ET6 A;  1VQF A;  1IBL L;  5M5Y B;  4PNY A;  1TS5 A;  5IYC G;  1CHQ D;  1CKN B;  4OEL B;  4BA1 I;  4A3F H;  3M4O H;  1X65 A;  4FF3 A;  1X3Q A;  4A93 G;  2VW9 A;  4JI8 Q;  5M3M G;  3M85 A;  1PRT D;  3TZD A;  2MFI A;  3F2C A;  3W1B A;  1SE8 A;  4G7H C;  1STB A;  3STB C;  1VCI A;  5ELF A;  3K5M A;  4RA8 A;  2KVM A;  5D65 A;  2NVY H;  4JI2 L;  3U50 C;  4LFA L;  1XNR L;  1VQA A;  1H9S B;  4MNO A;  1MIU A;  3NXW A;  5IT9 c;  3OTO Q;  1IYJ B;  1PZJ D;  5CR3 A;  4A3G B;  4CDF C;  2F3W A;  1NUC A;  3HOW G;  4DAY A;  1CA6 A;  2RBM A;  2EY5 A;  1X56 A;  2Y0S E;  1ZYR D;  3HOY G;  1AE3 A;  2Z8L A;  4LF7 L;  3V96 A;  4S3S A;  3BS1 A;  5CBA E;  3OPO A;  4IUU A;  3CP0 A;  2B63 G;  2FMC A;  5FKA C;  2LFN A;  1LTL A;  2VQE Q;  3MXU A;  2CVR A;  2D5D A;  2YTY A;  5GAG C;  2F4V L;  1OXV A;  1A3T A;  1XMO Q;  1B7Y B;  3OW7 A;  4DN4 M;  4A3B G;  5JPM C;  1W3S A;  4ZRZ A;  3J7Y W;  1JOQ A;  4UDU C;  1HRJ A;  1TWH H;  1VQ6 A;  1I94 L;  3BVZ A;  3RLN A;  1WTH A;  3ND8 A;  4YY3 Q;  3A55 A;  4GN3 B;  2WV6 D;  3J81 i;  2K5V A;  1TWG B;  1O7Z A;  1GHJ A;  4H0L C;  1XX8 A;  1EY8 A;  5JJZ A;  4FDB A;  2E74 C;  3U9O A;  3RLO A;  3S1N B;  4DR1 Q;  3LNN A;  1AEX A;  5JVH 3;  5IP9 G;  2B2W C;  3HG9 A;  2KCN A;  1JOO A;  5C0X G;  2N3S A;  4BY7 G;  1JJC B;  4I7Z C;  4XDX A;  1PYB A;  3CC4 A;  1GUT A;  4IO9 A;  1KDB A;  3GTJ H;  4A3F B;  3M4O B;  1LYL A;  5DAU A;  3ERO A;  1GM5 A;  1DOM A;  5J39 A;  3RD4 A;  4P2C B;  2QGQ A;  1XNR Q;  2B8G A;  4V19 0;  3NPP A;  4BXX H;  5M5X H;  2RDG A;  3D4W A;  5HY6 A;  1CK1 A;  4ZKB B;  2UXC Q;  2A68 D;  4LMQ D;  4C3H B;  3GTG B;  4N9T A;  4DR7 Q;  4FF1 A;  3LGJ A;  1AFP A;  2GN5 A;  1HUM A;  1BKB A;  1KRT A;  4OWT B;  4GOP B;  3HGB A;  3N52 A;  3NE5 B;  3I3C A;  3FP9 A;  3T1Y Q;  2JEB I;  4BWG B;  2HIX A;  5KGU A;  1II3 A;  3I91 A; 
#chains in the Genus database with same CATH homology
 5C44 B;  1B9M A;  5LL6 S;  1NCV A;  4DK0 A;  4RGT A;  4F88 A;  4NP5 A;  4PMB A;  5C5M A;  2ENB A;  1SEB D;  4IZ8 A;  1PYW D;  3W3A A;  1PXU A;  2WP8 J;  4A3B B;  2EXZ A;  4LK1 C;  2F03 A;  3D4D A;  3C46 A;  3P75 A;  1NR4 A;  3I4L A;  5CMD A;  1JOR A;  1SMY C;  2F0V A;  2B2V C;  4HTH A;  1LT5 D;  4B9W A;  5D3I B;  3URY A;  2K6A A;  2F0D A;  2PW7 A;  3VYT A;  4DK1 A;  3K57 A;  4CJ2 C;  1Y8P B;  1STN A;  1AZP A;  2F0N A;  3V2T A;  1VMP A;  2L5T A;  2LS0 1;  2EJF C;  3PUW A;  1FR3 A;  4KD4 A;  1B53 A;  2F0G A;  5JEA G;  1IYU A;  1BNZ A;  1DOL A;  1TKW B;  3MA2 B;  2HQE A;  4KY5 A;  4KMU C;  4XQN A;  4BBR B;  1D5M C;  3M7G A;  2VNU D;  3HRZ C;  2HDM A;  4J6H A;  1ROD A;  2JP1 A;  3R2I A;  1B50 A;  1EQV A;  1Q1B A;  4K5W A;  1LT4 D;  1XYI A;  1S5D D;  3TP6 A;  1I4H A;  4XQQ A;  3Q24 A;  4QUC A;  3MC0 B;  4G57 A;  3DEO A;  1EEI D;  1Q8I A;  3TDQ A;  4ULL A;  1SYF A;  1I4Q A;  3HOU B;  3QG1 A;  3CHB D;  2JYO A;  1KAA A;  5K36 G;  4C2M B;  1TII D;  4AYB B;  2A68 C;  4KY6 A;  4RGN A;  2X6G A;  1F2Z A;  2M2L A;  1EZ8 A;  3HZX A;  3FVQ A;  4RFB A;  5CV7 A;  2IX3 A;  1KTK A;  1ESF A;  3IFT A;  2A69 C;  2O5J C;  4X3S A;  3ONA B;  1WTQ A;  1IW7 C;  5CGK A;  1DM0 B;  5I9O A;  1A15 A;  3GTJ B;  2ZXP A;  3BG3 A;  2B2U C;  3GQB A;  3LX0 A;  2F0Q A;  1GUS A;  4C3I B;  2CQA A;  4M1U B;  2NWG A;  3H94 A;  5G3L D;  5E4W C;  2R3Z A;  2TMP A;  1SNO A;  3KLS A;  2JEA I;  1EU4 A;  1KDA A;  2WAC A;  1VF7 A;  3I90 A;  2EYM A;  2R61 A;  2AUK A;  2O4X A;  5CV5 A;  1MBY A;  1EYD A;  1PTO D;  2QCP X;  4ME5 A;  2RDH A;  1FNW A;  1M4V A;  1AP0 A;  5C4J B;  1DD2 A;  2MHV A;  3ERQ A;  2KHS A;  1GUN A;  2PQE A;  2Z4I A;  2K32 A;  4FF4 A;  1U4L A;  1STH A;  3K5L A;  5EBC A;  1WTV A;  3OOC A;  1S5F D;  1RD9 D;  4M8A A;  1MSH A;  1TT2 A;  1EOT A;  3MVV A;  2K01 A;  2ZXO A;  1BCP F;  2RKS A;  2EY1 A;  2AUJ D;  1L0Y B;  1QWY A;  1HXY D;  3MXG A;  5IT9 E;  3VR5 A;  4RHR A;  5NUC A;  4C56 C;  3S2H B;  5T1I A;  5JEA J;  3J81 L;  1TR5 A;  1I6H B;  1F9R A;  4FNF A;  4DNR B;  4KN4 C;  2BDO A;  3K58 A;  1RTO A;  1C8C A;  1GUG A;  2NB0 A;  4K8J A;  2KED A;  2B2V A;  2X69 A;  1SYB A;  3CQZ B;  2A5H A;  3A8K E;  3EJI A;  2KA7 A;  3M3Y B;  3MXP A;  5IT9 L;  2VUM B;  3HOW B;  1EY5 A;  2EDG A;  1FD7 D;  1K83 B;  1I4X A;  4K2L A;  4ZUJ A;  5HGT A;  1HTP A;  4CJ1 B;  5I2X A;  5JAV A;  1HA6 A;  1HTL D;  2Y0S B;  4DFA A;  4J1M A;  1ENF A;  2EJG C;  2VB3 X;  3PIO 3;  4RGO S;  5LHY 1;  3VR2 A;  4IAL A;  3J7A V;  2PO4 A;  2RSO A;  2AQ1 B;  2BE5 D;  4WFN 3;  1HCZ A;  4FYD A;  1G2S A;  3PO3 B;  2LKV A;  4V0B A;  4F8M A;  2XIW A;  1MSG A;  1I3Q B;  3T16 A;  1BCP B;  3G7L A;  1TVX A;  2VXW A;  1LT6 D;  4IQZ A;  4L63 B;  1LO5 D;  1BDO A;  1OO9 B;  2K05 A;  5EBD A;  4IUQ A;  4ZKC B;  5I4D A;  3EVQ A;  1Y1V B;  2JA6 B;  3J80 L;  5A2Q E;  2K28 A;  3FPP A;  1QOH A;  1CI3 M;  2PCF B;  4MIU A;  2EOT A;  4HMI A;  3RZD B;  2AWN A;  5EJW A;  5CBE E;  1VDZ A;  3H6M A;  2KOL A;  4U68 A;  1S5C D;  1SJH D;  2JSO A;  1LT3 D;  5ELB A;  4K14 A;  1DON A;  4XT1 B;  5BN4 A;  2XN9 C;  3DM1 A;  4R8I A;  1EEF D;  5DM6 3;  2NVQ B;  1CHP D;  5CV8 A;  2MGS A;  2PPB C;  4HSV A;  4HCE A;  1B44 D;  4QUF A;  2M9V A;  1U9R A;  1LTT D;  2N88 A;  3GD7 A;  2XNA C;  1XTC D;  5KEE A;  1YNJ C;  3TSS A;  5FO9 B;  2F4I A;  1EYA A;  4NKL A;  3VA5 A;  1JE4 A;  1EIG A;  1SNM A;  1EZ6 A;  2JA7 B;  1F2Y A;  5KNC A;  1SBB B;  4TSS A;  3MHB A;  5C0X H;  5T1G A;  2Q8R E;  5E3F A;  4ABN A;  2NYZ D;  5C5L A;  3RUZ A;  4K6D A;  1O7Y A;  2K04 A;  3P20 A;  1D1K A;  3MXN A;  4Q5V A;  1RTN A;  3VYR A;  2E75 C;  4HED A;  1BF4 A;  5IGG A;  3R8B A;  3JAM L;  1BO0 A;  1O78 A;  1IL8 A;  1DOK A;  1OXS C;  4FXG C;  2FHT A;  5BN5 A;  1SNQ A;  3I4N B;  3HEJ A;  2DNC A;  3R93 A;  2EVB A;  3SK5 A;  3S2D B;  2BDN A;  3D4R A;  1EY9 A;  3CRK C;  5EGT A;  2NBF A;  4K8I A;  4K5V A;  4KY7 A;  2C5C A;  1ILQ A;  1HFG A;  3IAY A;  2F0S A;  1SXT A;  2WKC A;  2E2H B;  1T5E A;  2KEC A;  3S1Q B;  4C3I G;  3M7N A;  3NTH A;  4Z9C B;  5EKI A;  1GJX A;  1AZQ A;  4CKE A;  4XT3 B;  3H91 A;  1Y8O B;  1WTP A;  5DNF A;  3A7A B;  2AQ3 B;  3ZYY X;  4L6T B;  3KBX A;  4WOR A;  1Y69 U;  3HOV B;  4J8Q A;  2RSN A;  5M3F B;  1RJT A;  2ID0 A;  2F0P A;  1LV9 A;  1WTX A;  4F87 A;  3UI2 A;  2BA1 A;  4KI0 A;  1U4R A;  5A2Q L;  5IGB A;  3K0Y A;  4ZAI A;  4QIW B;  2NTS A;  1ZYR C;  2GA4 B;  3BDC A;  4G7O C;  1IW7 D;  3OWE B;  3F2U A;  4RCN A;  1SMY D;  1D5Z C;  2F0W A;  2OXP A;  4MHE A;  3JAM E;  3VYS A;  1IHZ A;  5G3L F;  1S5B D;  4DAV A;  2PZU A;  2K1B A;  2JXM B;  2F1M A;  3DHQ A;  2L55 A;  1H9J A;  2NN6 I;  2Z1C A;  4EGV A;  3KLS X;  3WDN A;  1V1O A;  1GUW A;  1D6E C;  1SAP A;  4K2K A;  3GP7 A;  1EWC A;  1EY7 A;  2K5Q A;  2KEE A;  1ZXT A;  4A3E B;  4E6I A;  5CYU A;  1K8M A;  4DAP A;  3KBG A;  1C4Q A;  3FRP B;  1XWE A;  1I50 B;  2IX0 A;  3PUZ A;  4OO1 H;  2CW0 C;  2NVT B;  1G8Z D;  1KNA A;  3I70 A;  3A8I E;  1E2W A;  1MGS A;  2J7Z A;  1EWH A;  2IW3 A;  1NSN S;  1QB5 D;  2QKI C;  5C4H A;  4IFD H;  3HOZ B;  1QCB D;  4HCS A;  4O42 A;  3S15 B;  1Q3L A;  1HPC A;  3V05 A;  2MPM A;  3NP8 A;  2B2Y C;  2SEB D;  5IOC A;  1LTR D;  1NAP A;  2KUM A;  1H9S A;  5CV4 A;  5CV6 A;  1MD2 D;  2H4O A;  1WVL A;  3FMC A;  5I6Y A;  2NTT A;  1QE6 A;  1ESR A;  3D3R A;  2EPB A;  3J80 E;  4KKT A;  3U9S A;  3GV3 A;  4RWS C;  4PV1 C;  1ML0 D;  1I6V C;  1JR0 D;  3NBI A;  3DUZ A;  3L9A X;  3SXH A;  3QIA A;  3RZO B;  2FJ2 A;  1PZI D;  5FOB B;  2EYF A;  4FXD A;  1LAB A;  3QOL A;  4CGY B;  1B2T A;  2EY2 A;  2WB1 B;  5JEA H;  3T13 A;  5C4X B;  3IKJ A;  1J9O A;  2F0T A;  3MAQ A;  1BR9 A;  4XIG S;  1ZEQ X;  1V8Q A;  2F0L A;  3PV0 A;  2A6H D;  5COR A;  1G6Z A;  3QJY A;  2EZV A;  3PIP 3;  4N9P A;  3S17 B;  5IGE A;  5KIX A;  4QB4 A;  4H44 C;  1O7L A;  5C3X A;  3RLF A;  1B3A A;  4R8N A;  2EYO A;  4EQP A;  2R92 B;  4F7X A;  1PRT F;  2BCO A;  2M00 A;  2Q8I B;  2O5I C;  3SK8 A;  4IFD J;  3TP8 A;  1CA5 A;  2BA0 A;  1X3P A;  4A3J B;  2D9U A;  2E76 C;  3SE0 A;  1LTG D;  1LAC A;  2K33 A;  3S9W A;  4A3I B;  4XYO A;  5EQ0 A;  5FO8 B;  3DWQ A;  3SEB A;  2QDB A;  3BVM A;  2JA5 B;  4JK1 C;  2FMM A;  3IFD A;  3D6W A;  2F0E A;  2F0K A;  1EY6 A;  5AFW A;  1BCP C;  2XVS A;  3VYU A;  1GUO A;  2XRS D;  1C48 A;  1BQQ T;  1EIH A;  4DF7 A;  3HKZ B;  1TU2 B;  5I9P A;  3MFG A;  1E2Z A;  2J0T D;  3KF8 A;  3M4Y A;  1Y1W B;  1IYV A;  4KHV A;  1OXX K;  1JOK A;  4NW2 A;  3IL8 A;  3X3M A;  2SDF A;  1YNN D;  5EKK A;  2A6E C;  5A35 A;  4UAI A;  1S4Z A;  2J4X A;  4RHS A;  5ELD A;  1BBX C;  1KAB A;  3D8G A;  1SND A;  4FVM A;  1V1P A;  2HDL A;  2FIN B;  4CJ0 B;  2MP1 A;  1PTO F;  1JCK B;  4DXF A;  1PLF A;  3DWP A;  4IUP A;  2G9H D;  2QIL A;  3A54 A;  3QWN A;  4H13 C;  2F0F A;  5JOB A;  1SFO B;  3NHH A;  4BY1 B;  3VR3 A;  4LJZ C;  4X3U A;  1KDC A;  2WIN B;  1JQY D;  4RH6 A;  2B2W A;  4XYQ A;  3MZ5 A;  3FPU B;  1TS2 A;  1CQF A;  4DXG A;  1FGB D;  3OWF A;  2K5D A;  1F9P A;  4NDX A;  1JWM D;  3TP5 A;  3PO2 B;  4CKB A;  3K59 A;  2K03 A;  4RGM A;  1CM9 A;  1SYE A;  3T51 B;  3FDT A;  1SNC A;  5I6W A;  2RA4 A;  5COY A;  1SJE D;  2HUG A;  3NWT A;  1QIL A;  2V4D A;  1WTR A;  1Z7T A;  4OO1 I;  1JWU D;  2E2J B;  2PZT A;  2IX1 A;  4JBW A;  3ND9 A;  4PQX A;  5IGF A;  3GTP B;  2EYP A;  1D1I A;  2F0H A;  1JC7 A;  5IIF A;  3I72 A;  5KYI A;  1AN8 A;  1T5X D;  1V43 A;  3Q0A A;  1STA A;  2DN8 A;  5C0X J;  5IGD A;  3SHL A;  1LTA D;  5ISR A;  1QNK A;  1KNE A;  4TQU S;  1D5X C;  2B2Y A;  4LAA A;  1EU3 A;  1ILP A;  3PUY A;  1B1Z A;  1G29 1;  2DY7 A;  1RF2 D;  2Q8T A;  1K8O A;  1S5E D;  2PW5 A;  4FP5 D;  1PFB A;  3BZD B;  2Z4H A;  1Q90 A;  1R4P B;  2NN6 H;  4FXK C;  3H0G B;  1RKN A;  2BE5 C;  5EPK A;  3H3V C;  2R7Z B;  4DNT B;  3OHX C;  1I4G A;  1DXM A;  3A8J E;  3SK4 A;  2B2T C;  5JPN C;  2OT2 A;  2KQ3 A;  2B8F A;  3VR4 A;  5BN3 A;  3SDZ A;  1EQT A;  2NZ1 D;  2DY8 A;  4OGQ C;  3S16 B;  1A2U A;  1OXT A;  3C1F A;  2HCC A;  1V1P B;  3E5S A;  5C3W A;  4O1N A;  3BDO A;  3DXJ C;  1TWH B;  5KYL A;  3L3O C;  4A3M B;  4KTA A;  5E4X A;  2I07 B;  1STY A;  1CZW A;  2SNS A;  1B4O A;  3P1H A;  3NQI A;  2I46 A;  1WD0 A;  5FK9 C;  4DA2 A;  1Z6H A;  2K5W A;  3C3L A;  3QB3 A;  1HHV A;  3EQL C;  5LL6 X;  4QMG A;  4Y7N B;  1L0X B;  5C0X I;  1TWA B;  2ICI A;  4G4K A;  1TQO A;  3WOF A;  4IUV A;  2RDF A;  4R9W A;  2YYZ A;  4WRD A;  1DJR D;  1F2M A;  4ZK9 B;  2O2L D;  4C3J G;  1UUP A;  1UAP A;  2F0O A;  2MUY A;  1JIC A;  1BOS A;  5TSS A;  1KLG D;  2F0M A;  1PTO B;  4OIK A;  1HUN A;  3T4A C;  2YU9 B;  3D31 A;  1VMC A;  1GXD C;  4BBS B;  1F9S A;  2IWH A;  1PRT C;  2NUC A;  4ZYS A;  4RKB A;  3K6O A;  1RHP A;  4FO2 A;  3NK9 A;  1JB3 A;  3VA7 A;  3NWS A;  4XTC S;  4ILW A;  1CFM A;  1A3V A;  1EL0 A;  4OIJ A;  1RCV D;  1W6K A;  4XQJ A;  1CQV A;  1NR2 A;  3NTK A;  3BDL A;  2D2C C;  4B08 A;  1SNP A;  3T56 B;  4L8J A;  4MN3 A;  2EYL A;  3Q6S A;  3C1E A;  2B2U A;  3C2P A;  3GTM B;  1HQM C;  2X6L A;  1QG7 A;  2TSS A;  2WAQ B;  2F0U A;  5K5P A;  1KLU D;  3BYY B;  1RDP D;  1G2T A;  1SE4 A;  3MTS A;  1O80 A;  1U4P A;  5DM7 3;  3S14 B;  5D3D A;  1W6J A;  4WJW A;  3CRL C;  3KK7 A;  4IFD I;  3DWA A;  2WII B;  4PMC A;  2B2T A;  2IJ0 A;  3CU7 A;  4XXE A;  4KD3 A;  3PUV A;  3AU7 A;  1SDF A;  5F2D A;  4A3D B;  2XWB B;  4HSP A;  5HUR A;  2CW0 D;  2PZW A;  4C3J B;  2AQ2 B;  4OHJ A;  1DYQ A;  4IUN A;  4C1N K;  4EQN A;  1D2B A;  1PZK D;  1BXT A;  4RCO A;  4HN7 A;  3KUP A;  2NVX B;  4KJN A;  3GO5 A;  5M9O A;  3N6R A;  5KND A;  1CT1 D;  1TS4 A;  3J7A F;  3OMC A;  1SYG A;  3K5N A;  4K5X A;  1I4P A;  2EJM A;  4EQO A;  4QF4 A;  1ENC A;  1VF5 C;  1ENA A;  5EPL A;  1CZG A;  1H9R A;  3SK6 A;  5EKL A;  1E2V A;  4IN3 A;  5CC4 A;  2WKD A;  1OXU A;  3QO2 A;  2PYK A;  1MI2 A;  5ELC A;  4NMZ A;  4BY7 B;  1F9Q A;  2XSC A;  4DU9 A;  1X32 A;  3HS0 C;  3R2T A;  3GTK B;  4ID6 A;  2RVL A;  3SR1 A;  1PFM A;  4CBV A;  1PMR A;  1STE A;  1PTO C;  2IT1 A;  4H7B A;  3S1R B;  2JA8 B;  1GHK A;  1ET9 A;  4RKL A;  5E1F A;  4IUR A;  1CTM A;  2XWJ B;  4X3K A;  5D14 A;  1R9T B;  3FEW X;  5IOD A;  3S1M B;  1J8I A;  1FNV A;  3TBI B;  3PUX A;  4KN7 C;  4KKU A;  1PTO H;  3GV6 A;  2E2I B;  1SE3 A;  5M5W B;  2CHB D;  3OIQ A;  3GTO B;  2C9O A;  3TME A;  1A2T A;  2L11 A;  2D62 A;  3AB9 A;  2AWO A;  1IKM A;  2H1E A;  4CKC A;  2LY7 A;  5DEH A;  2F0I A;  1LTS D;  4A93 B;  2EYH A;  4DGZ A;  2FFK B;  1XXG A;  3X3N A;  5FO7 B;  4A3K B;  2L12 A;  3CKI B;  4YIJ A;  3H09 A;  5K36 H;  1E0B A;  2L0C A;  3LWU A;  4ZLT F;  1Y8N B;  4KKS A;  1YNN C;  3L7Z C;  4BA2 I;  2A74 C;  4KHZ A;  2E2D C;  1M8A A;  2A69 D;  4OL7 A;  2B63 B;  1Q12 A;  3BYT B;  3NUC A;  3GTQ B;  2IPK D;  1WD1 A;  2EY6 A;  3OIP A;  1LTB D;  4BS9 A;  1STG A;  1TY0 A;  2SNM A;  2N55 A;  1EY4 A;  3A56 A;  2R6G A;  2EE1 A;  1FYC A;  1U4M A;  5FLX E;  4IFD G;  2OEO A;  3MWY W;  4ZUI A;  3EFX D;  1TS3 A;  3K5O A;  2RQX A;  4OO1 G;  1SSO A;  4K6L A;  3GTL B;  3E0J A;  4TRD A;  5C4Z A;  4I65 A;  3Q22 A;  1JWS D;  1F77 A;  2MJ8 A;  3Q23 A;  2R93 B;  1EY0 A;  3I73 A;  1YNJ D;  4X3T A;  2PNR C;  2F0J A;  1IKL A;  3HOY B;  4Q0F A;  3T53 B;  4KK7 A;  4ZQ3 A;  4C3H G;  2EYJ A;  5KNB A;  2HCI A;  2SOB A;  2BOS A;  3OSO A;  3O13 A;  1UNS A;  1ONL A;  3AMU A;  5JVG 3;  2A73 B;  1EFI D;  3EA6 A;  1PDQ A;  3W2D A;  2L1B A;  3NBH A;  4U67 3;  3TP7 A;  2VB2 X;  2JE6 I;  3HOX B;  3LWE A;  5C6A A;  4GZY C;  2L9H A;  4CHT B;  3E6Z X;  2QF7 A;  1SE2 A;  3OMG A;  3J81 E;  1WTO A;  5EPJ A;  1QJO A;  2ZXR A;  1WTW A;  1BUV T;  3I8Z A;  5I2Y A;  1A6X A;  3MFY A;  3P7J A;  3RMH A;  3R3O A;  3VR6 A;  1PFN A;  2LMC B;  4TKO B;  4FF2 A;  2KJX A;  1TY2 A;  1HA5 A;  1LTI D;  5J22 A;  1AW7 A;  1B9N A;  3NQT A;  3A7L A;  2QEJ C;  4HAE A;  1SYD A;  3K7A B;  2OF1 A;  2NN6 G;  1BCP D;  5C3E B;  2K7V A;  1TWF B;  1Q1E A;  2G9D A;  3MEH A;  1A3U A;  1F2L A;  3G6J B;  1HFN A;  5J1Z A;  5KRU A;  2ZT9 C;  3DMU A;  4EVO A;  3BVG A;  3TN2 A;  2NVY B;  1QNU A;  1Z47 A;  3NTI A;  3PMF A;  2DNE A;  2A6E D;  4PMW A;  2KCC A;  4KJO A;  1WCM B;  3KLR A;  4KV6 A;  5M3M B;  1PRT B;  5IGC A;  1DZ1 A;  3ITP A;  1H9M A;  1SYC A;  4ODG A;  2F3V A;  3FKI B;  3WOE A;  4B9X A;  3SVM A;  1G91 A;  1LLR D;  3D6C A;  5FLX L;  2ICE C;  5CV9 A;  1FNU A;  2L4N A;  4IUT A;  1ZKO A;  1EYC A;  1ICW A;  2A6H C;  1HQR D;  3DEP A;  1R4Q B;  3QOJ A;  5ELE A;  3NSW A;  1DCZ A;  1UEA B;  4G7Z C;  4QCL A;  3I4M B;  1I4R A;  3HP3 A;  4HMJ A;  3TZU A;  1H9K A;  5M5X B;  1TWC B;  2XRQ D;  1GOZ A;  2IL8 A;  4C1N I;  2B39 A;  2PMZ B;  4HR7 B;  5M5Y B;  4RAU C;  1ET6 A;  4PNY A;  1TS5 A;  1CHQ D;  4BA1 I;  4FF3 A;  1X3Q A;  3M85 A;  1PRT D;  3TZD A;  4G7H C;  1STB A;  3K5M A;  1VCI A;  5ELF A;  4RA8 A;  2KVM A;  5D65 A;  1H9S B;  3NXW A;  1PZJ D;  5CR3 A;  4A3G B;  2F3W A;  1NUC A;  1CA6 A;  4DAY A;  2RBM A;  2EY5 A;  1ZYR D;  2Z8L A;  3V96 A;  4S3S A;  3BS1 A;  5CBA E;  3OPO A;  4IUU A;  2FMC A;  5FKA C;  2LFN A;  3MXU A;  2CVR A;  2D5D A;  1OXV A;  1A3T A;  3OW7 A;  4DN4 M;  5JPM C;  4ZRZ A;  3J7Y W;  1JOQ A;  4UDU C;  1HRJ A;  3BVZ A;  3ND8 A;  3A55 A;  2WV6 D;  1TWG B;  1O7Z A;  1GHJ A;  4H0L C;  1XX8 A;  1EY8 A;  5JJZ A;  2E74 C;  3U9O A;  3S1N B;  3LNN A;  1AEX A;  5JVH 3;  2B2W C;  3HG9 A;  2KCN A;  1JOO A;  5C0X G;  4I7Z C;  4XDX A;  1GUT A;  1KDB A;  4A3F B;  3M4O B;  5DAU A;  3ERO A;  1DOM A;  5J39 A;  3RD4 A;  4P2C B;  2B8G A;  4V19 0;  3NPP A;  2RDG A;  3D4W A;  1CK1 A;  4ZKB B;  2A68 D;  4LMQ D;  4C3H B;  3GTG B;  4N9T A;  4FF1 A;  1AFP A;  1HUM A;  3HGB A;  3N52 A;  3NE5 B;  3I3C A;  2JEB I;  4BWG B;  5KGU A;  1II3 A;  3I91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...