1JICA

Solution nmr structure of recombinant sso7d with rnase activity, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SSO7D
publication title A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1998-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jicA00
1NAPA 3I91A 2B2TA 1HUMA 2FJ2A 2JP1A 2HDLA 4HSVA 1HUNA 2B2YA 1F9SA 2H1EA 2HUGA 2K01A 1IL8A 4U68A 1SSOA 2N88A 4QUFA 2Q8RE 2RVLA 1WVLA 1ICWA 1RODA 4R9WA 4X3TA 5D65A 4OIJA 5CBEE 2KUMA 1EIGA 3QO2A 4CJ0B 1EIHA 3G7LA 5EPKA 2RSNA 2B2WC 2BDNA 2J7ZA 1NR2A 1M8AA 2EOTA 1RTNA 2FINB 2KEDA 3F2UA 4MHEA 4XT3B 4DN4M 1O7ZA 2M2LA 3DEPA 4HEDA 3IL8A 4CJ2C 2KOLA 3R93A 1HHVA 2B2TC 1BNZA 1F2LA 2B2VA 2K04A 2KVMA 2R3ZA 3I8ZA 4UAIA 3UI2A 4CJ1B 1AZQA 1CA6A 4OIKA 1DONA 1F9PA 4ZLTF 5EKIA 1PLFA 1QNKA 1PFBA 1PFMA 3MWYW 4MN3A 3N52A 1LV9A 1BF4A 2KECA 1VMPA 1WTQA 2XIWA 1RTOA 4X3UA 1MSHA 1VMCA 4IUQA 1WD0A 2X69A 3I90A 5E4WC 2EE1A 5EPLA 5EQ0A 1WTRA 2L12A 3FDTA 2DY7A 1QG7A 3H91A 4HCSA 2MPMA 1X32A 1MI2A 2Q8TA 1HA6A 2X6GA 1O7YA 2MP1A 1NR4A 3P7JA 5CORA 5DNFA 1G2TA 1CM9A 3KBXA 5AFWA 5T1IA 1B4OA 4ZK9B 2HCIA 2B2UA 3DM1A 1WTXA 1PDQA 4NW2A 1RHPA 1QE6A 1NCVA 1U4MA 2B2YC 4IUPA 1EL0A 3DEOA 1B53A 1WTOA 2L9HA 3GV6A 4LMQD 4IUTA 3I3CA 1ILQA 1G6ZA 5EJWA 3HP3A 5CBAE 1WTPA 1ILPA 1J9OA 2HDMA 1HRJA 2RA4A 5D14A 5COYA 1U4PA 3D6WA 1U4LA 1X3QA 1E0BA 2K05A 4RA8A 1DZ1A 1GUWA 2L1BA 4HAEA 1C8CA 2B2VC 3LWEA 4ZKCB 1RJTA 4RWSC 3IFDA 2SDFA 1S4ZA 5EPJA 4R8IA 1MSGA 1ML0D 2JYOA 2HCCA 1G91A 2NYZD 4IURA 1JE4A 1G2SA 3Q6SA 1F9QA 5CMDA 2IL8A 1WTVA 2RSOA 4IUVA 2EPBA 2FFKB 2DY8A 4O42A 2D9UA 1BO0A 2K1BA 1B3AA 1DOKA 1X3PA 1AP0A 2KEEA 2K28A 3ONAB 3KUPA 1DOLA 2NZ1D 4IUUA 1Q3LA 3GV3A 2NWGA 1ESRA 2L11A 5JJZA 1MGSA 1HFGA 1KNEA 2X6LA 1SDFA 1F9RA 1DOMA 2B2UC 1IKLA 1ZXTA 2MGSA 1A15A 1J8IA 1B50A 4XDXA 4XT1B 1CA5A 3TN2A 1U4RA 3SVMA 1WTWA 1PFNA 1KNAA 4ZAIA 1EOTA 3FPUB 4X3SA 1B2TA 4X3KA 2N55A 2FHTA 1XX8A 2MJ8A 1EQTA 4ZKBB 1BBXC 1JICA 5T1GA 1IKMA 2CVRA 2FMMA 1AZPA 2L4NA 4QUCA 1HFNA 2K03A 4RAUC 2B2WA 5E4XA 1WD1A 1O80A 2VXWA 3TZDA 1TVXA 1XYIA 1SAPA 3MTSA
chains in the Genus database with same CATH superfamily
1STYA 2Z6BA 4QIWE 3J80i 1F9SA 3CRLC 1G291 2N88A 1HZAA 3UDFA 1IBKQ 4R9WA 4BWGB 1WFQA 3ULLA 1VQMA 4OO1G 2F0WA 1PH9A 5IGBA 5K5PA 2O5IC 4QQBX 3Q8DA 1HHVA 2O2LD 4U673 2YTYA 4R4CA 5FOBB 1OXVA 4DV2Q 3MWYW 1PFMA 4MN3A 2GA4B 4RMFA 2HD3A 3J7A5 4BXXH 3WOEA 3PO2G 1R9TH 3M4OB 4RH6A 1KL9A 2JXMB 2DJFC 5EPLA 4C3IB 2C9OA 1S5BD 1CZWA 1Z6HA 1KDAA 1GUTA 1ASZA 2BE5C 2MPMA 3B6YA 2ENBA 1ENCA 1ENAA 5T1IA 5IYBG 1HTPA 4KN4C 3D6CA 4K0KQ 2KCTA 4A76A 1U4MA 1EZ8A 1QJOA 3DEOA 3MXGA 1I6HH 3FRPB 4JI8Q 5C5MA 2BA1A 4IUTA 4BY1G 5TSSA 1ILQA 5FJ8G 3DWAA 1J9OA 2ID0A 1KTKA 1X6OA 4DR7L 1EY9A 3I72A 3J7YW 5M5WB 1C8CA 4LFAL 2Q2UA 1H9SB 4G4KA 4K6DA 1S3OA 4POGA 3BJUA 1DM0B 3SK8A 1C48A 2JYOA 4O0AA 3CF5A 3O13A 1EWHA 2F0JA 5I2YA 2KBNA 3KLSA 3S16H 2F0MA 3F2CA 2KEEA 2WB1E 3DWPA 2NWGA 4IFDG 2Q2TA 3HOYB 1I4PA 4J8QA 2ES2A 1UE6A 3DHQA 1H95A 5IYCG 4C3JH 4DK0A 1U0LA 3IKJA 1GUSA 3FPUB 5GADC 5CYUA 4JI3L 1XX8A 3G48A 3VR4A 4ZKBB 1YNNC 1OTCA 4XXEA 4IPHA 3SEBA 4JI5Q 5E4XA 4B3RQ 2VXWA 5LMUQ 2E76C 3PGZA 3CCEA 3X3NA 1SE2A 5ISRA 3S1RB 1YJ9A 1KD1C 3QO2A 3ERQA 2WB1G 2E2HB 4JBMA 4Y52H 5GROA 3J81i 4RCOA 3F2UA 5E1FA 2ZXOA 2JA8B 3DEPA 4L5QA 4X62Q 4E6IA 3PUWA 2B2TC 1IBMQ 1F2LA 1YHAA 4CJ1B 2DUDA 1IYVA 1C9OA 4H7BA 2IX1A 3GTQB 1CKNA 5IODA 2XWBB 1EY8A 2XIWA 3E9HA 4DAYA 3S2HH 1MSHA 4FYDA 4IUQA 4C2MB 2X69A 2H4OA 4FF3A 1SRUA 2K6AA 4QB4A 1D1KA 4ZRZA 1E24A 5CV4A 2E75C 5DNFA 1PZJD 1BR9A 3IAYA 4GNXB 2R61A 2HCIA 1YHQA 1PFSA 2HHHQ 2NZHA 5KGUA 1TWAB 4TQUS 3A54A 2JA5B 3BYTB 3TP7A 5IY0A 2PI2A 3HOUH 3CCLA 1T5XD 3D8GA 1GUWA 3I4MG 3GTKB 1LTSD 3VYUA 1XPOA 1PRTD 5CR3A 3RLFA 3TSSA 4ZYSA 5I4DA 3ND8A 4JI3Q 2LSSA 1FNWA 4XQNA 4DV0Q 5KNBA 1V43A 1PYWD 1WOCA 3QG1A 4A3EH 2R93H 4O1NA 3ZYYX 4DR4Q 4S3SA 3ONAB 1HCZA 2NN6G 2EYPA 4RKLA 2EJFC 1ET9A 5LMNL 1SDFA 1TY2A 1E7ZA 2D5DA 5C44G 2C5CA 4XT1B 4GNXC 4KY5A 4PZ7A 1H9JA 1R9TB 1N34Q 3E5SA 5CV7A 4A4IA 2AMCB 3NEMA 4F88A 5IP9H 4A3MG 3JAMc 4NP5A 2D0PA 3KF8A 1VQGA 2R92H 2ICEC 1DZ1A 4LF9L 2RHQB 2B2TA 5M5XB 1TS4A 4Q0FA 5EBCA 5G3LD 4U68A 1LTGD 5DM73 1RODA 4LFCL 2SEBD 4DKAC 2O4XA 1LUZA 1GJXA 2A68D 3M4QA 2Z4HA 2HIVA 2Z6KA 4Z9CB 1IBLL 1KIXA 1S40A 2A6ED 5GAEC 3VR2A 2PZUA 4FVMA 3J7AF 1Y14B 2F0KA 3NTIA 5CGKA 1BF4A 2GVBA 2D62A 4PV1C 5NUCA 1WTQA 3NBIA 1PH4A 1B1ZA 5JJLA 1PH3A 1LT6D 1QWYA 3BVMA 4DNIA 4I7AA 2XN9C 4OGQC 4NXML 2EJGC 2WP8J 4KK7A 2N49A 1K28A 4JI7Q 3KLSX 5FK9C 1ZEQX 3BVGA 4JI0L 3S16B 4BXXG 3KBXA 4UDUC 3H0GB 3K80C 1TWFH 3A56A 1C4QA 1CQFA 3DM1A 5KRUA 4IUPA 3GTOH 2GVAA 3GV6A 1Y8PB 1IW7C 1G6ZA 1E2WA 4PZ6A 2VZAA 4A3CG 2D0OA 2IX0A 5D14A 2CW0C 4IJHA 5COYA 4APVA 2C35B 4V190 1U4LA 3S1NB 2MFIA 1STNA 4L5RC 2BE5D 2KCMA 3S9WA 2RCNA 1ML0D 3AFPA 3R2IA 3PF5A 2R6GA 1JC7A 3PO3H 3TP6A 3EQLC 1L2FA 3CMEA 3GTGH 4QJFA 4BBSH 1CTMA 2UU9L 5IWAQ 2R7DA 4A3JB 2DGYA 2NZ1D 2VS1A 1HFGA 1M1KC 1OXSC 1KAWA 3UDGA 3A55A 2KENA 3K0XA 3P1HA 1EQTA 1WJJA 4P74A 2VUMH 5ELFA 3SE0A 1BUVT 1LABA 1O80A 4C3JG 3VR3A 4L5TA 4A93H 4KI0A 2B29A 2UXDL 4ZUIA 1PH7A 2RVLA 4X3TA 3M4PA 4LF5Q 4IFDJ 2HIXA 2F03A 4JI0Q 2QF7A 1MJCA 2FINB 4MHEA 2IJ0A 1KDBA 4IO9A 2ICIA 4H02A 1SNCA 2JA7H 1BNZA 2KVMA 2OQ0A 3HOZH 3E6ZX 1YNND 1JJCB 3OYYA 4A3GB 1H9KA 4LUVA 4GZYC 3BZKA 4HJAA 3KF6B 4OX9L 3K59A 3HOVH 2OWOA 2WKDA 1A3TA 1AEXA 1WTRA 3MXUA 3C46A 1RIPA 4PMWA 5FLXE 3H6MA 5C3EB 4JOIA 1Q86C 3L7ZC 3CD6A 2CHBD 3GTMH 4IFDI 1PH8A 1GO3E 4DR6L 4A3EB 2J0TD 2R93B 1UUPA 3NWSA 3CCSA 2WV6D 3PQIA 3SK6A 4ZK9B 3FKIB 4V0BA 1XNRQ 2B2YC 4P72A 1VQNA 4NB3A 3T1YQ 1C0AA 3PUXA 4J6HA 3D4RA 3D6WA 1E0BA 1N8RC 1MD2D 3IFTA 1TS2A 3HOUG 4DR3Q 4XYOA 1S4ZA 4RGOS 5I6WA 2R92B 2YV5A 2PO4A 2YTVA 4IURA 2K5HA 3Q22A 1F9QA 2Z1CA 4XTCS 1XPRA 1LTLA 2QA4A 2E2IH 1GKHA 1X3PA 1JORA 4Y7NH 2AQ2B 1B9NA 1TXYA 1TR5A 4UY8C 1MGSA 2CQOA 1KNEA 1PTOC 2B2UC 4C56C 2IPKD 1HZ9A 2K75A 4IJLA 4ZAIA 4A3EG 1SYBA 1K73C 3C2PA 4J15A 2R93G 1GHJA 3M4OH 1W6JA 1NJIC 3CMAA 4K5VA 1FGUA 1JICA 5JJKA 4P73A 3FVQA 2B8FA 2RDGA 2RHSB 4DK1A 1SN8A 4CDCC 4X65Q 1CI3M 3AU7A 2AKWB 1TWFB 2ALYB 3H15A 2R7FA 3I56A 1SYGA 5IP9G 2Q8RE 4XIGS 1ICWA 2EZVA 4DR6Q 5DLQE 2R92G 1UEBA 3J80L 4DN4M 1EY4A 3SK5A 3FMCA 2GN5A 2K04A 2L5TA 2XNAC 4DR5Q 1BQQT 2IT1A 4ZLTF 4G7ZC 2A69C 1KC8C 1I94Q 4LF8Q 3GP7A 3BG3A 2R7ZB 3K5NA 2Z0SA 4X3UA 1STGA 2IY5B 4I65A 3OWEB 3I90A 1DYQA 1RDPD 4DUZL 1HNZL 4KD4A 3GTGB 2F3IA 2B8GA 1O7YA 2PNRC 3HG9A 2VQEQ 5JPMC 2SOBA 4ALPA 3HOYH 3E3XA 2UUCL 1E22A 4KLKA 2OCEA 2I5MX 1F2MA 5GAGC 3I3CA 3HP3A 3OWFA 4KN7C 2Q2IA 1L0XB 3G6JB 3NK9A 3G4SA 4JI4Q 1LTBD 3AQQA 3VA7A 1IBKL 1D8LA 1NSNS 2VNUD 1YVCA 1STHA 3AB9A 3MFYA 4ABNA 4A93B 3K58A 2NYZD 5M5YB 2EXZA 4DV7Q 4A3FG 3S1RH 4ME3A 4DV2L 1XPUA 2RSOA 3LX0A 1SJHD 1VQIA 3TZUA 2K1BA 1B44D 1IW7D 2JA8H 4FF4A 2CW0D 3PO3G 4JV5Q 3AYHB 2X6LA 1EFID 1D6EC 1SR3A 2CQAA 3GTQH 1PH2A 3K0YA 4BBSG 1G51A 2PMZB 1EY7A 4K5XA 1MBYA 5J39A 3HOWB 3MHBA 4K0KL 4YWMA 2CVRA 4R1JA 2FMMA 1CSQA 1Y8NB 2UXCQ 5EGTA 1HXYD 4JI8L 2NVTB 2V4DA 2NUCA 1NMGA 4DAMA 2QKIC 1HJPA 1QVGA 5EKKA 5ELDA 3UDIA 5IT9E 1A3VA 4OHJA 4RG1A 1SSOA 1K0SA 2JEAI 4F7XA 4CJ0B 2VUMG 1TWAH 2L55A 1S5CD 3G7LA 2JA5H 1SBBB 1A2TA 3EIVA 4A93G 5FO9B 3IL8A 1PYBA 3D4DA 1CKNB 2KQ3A 4DAYB 1AZQA 1EEID 3J81L 2Z8LA 1EFWA 1A6XA 4HJ8A 1B3QA 1RTOA 1E2ZA 5GAHC 1WYDA 3HOZG 2KHIA 2JA7G 2L0CA 3KDFA 4HCEA 3HOVG 3F8TA 2E2IB 2F0GA 1NR4A 3P7JA 4A3DB 3S2DH 5AFWA 2NVXB 4GKKQ 1EUJA 2Z4IA 4Y7NB 5GQOA 4JI6Q 4PNYA 2LXJA 1UEAB 3FHWA 4JI5L 4B3RL 5LMUL 3CPFA 5A2QE 3E0JA 3MA2B 3EBEA 1Y1VH 1GUNA 2KHJA 1HR0W 2FXQA 3AMUA 1X3GA 1FVIA 1U5KA 3LWEA 2K32A 2PI2E 1PH1A 4CKEA 3HEJA 4R8IA 4JBJA 5M5XH 4X62L 1SYCA 1IBML 1SYEA 5C0XH 1K0RA 2LFNA 3TS2A 3PIO3 1T5EA 2FFKB 3PMFA 2D9UA 1B3AA 1JB7A 1N32L 4P75A 5JJZA 2ASBA 1ZYRC 1I4GA 1DGSA 4LWCA 1VS0A 4WJ3M 2UUBL 1ZXTA 1CA5A 2EXDA 3PF4A 5J3BA 1KNAA 5ELOA 4X66Q 2RQXA 3HGBA 4CHTB 4HIDA 2G9DA 1YNJC 3KF8B 5IP7H 4YY3Q 1D5ZC 2HHHL 4NMZA 4GLVB 3RUZA 1EOVA 4GKJQ 3TZDA 4LUZA 3MTSA 1NAPA 3EN2A 3H0GH 2QILA 5BR8L 2HDLA 1XTCD 4C3IG 5D3IB 4DK6C 1PTOD 4JPBW 2ZTEA 2I0QA 1V9PA 1Q12A 1K8AC 5JVH3 1NE3A 1AN8A 1PV4A 1EYDA 5EPKA 4C3HB 3U4ZA 1RF2D 1S72A 2QEJC 2IWHA 1HZCA 3DMUA 3GO5A 1QNUA 3RLNA 3D4WA 3UI2A 4DV0L 3S1NH 3MEHA 3GTPH 5EKIA 2FMCA 3HZXA 1EU4A 1PFBA 5I2XA 4HJ9A 1LV9A 3KK7A 4JBWA 4DR4L 1TWGH 1K8OA 2Z9HA 1CKMA 2UUAQ 1QG7A 3GD7A 3I2ZA 1X32A 2M00A 1BCPB 4LUOA 2F0UA 5DEHA 1HTLD 3M9BA 4NXNL 4JK1C 3OTOL 4A3JH 3JAME 1CM9A 2EYLA 3P75A 1N34L 1B4OA 2PQAA 5C4JH 3HFZB 1RHPA 4MTKA 4DV6Q 1EIFA 5C3XA 5J1ZA 1D7QA 1VQFA 2A69D 4KJOA 2K4KA 5C5LA 1Q1EA 1N32Q 1IYJB 2A73B 4CKCA 1VQJA 1YEZA 1O7IA 1JOQA 3PUZA 3HOYG 2Z6KC 2UUBQ 1L0YB 2H5XA 3BZCA 1MJEA 3T53B 1JE5A 4OELB 1BKBA 3DUZA 2HCCA 1J6QA 2QCPX 2QEXA 4CDFC 1SYDA 2TMPA 5CMDA 4EQPA 2A6HC 4EQOA 4MTNA 4O42A 3K5OA 3KUPA 1TS3A 4K6LA 4AIMA 2F4VQ 5CV5A 4LFBL 3RD4A 5BR8Q 3DWQA 1BCPC 2TSSA 2CH4A 1IKLA 1FJGQ 4A3GH 4JI7L 1ENFA 2ZXRA 3U58A 3SVMA 5HY6A 2JA8G 5JJIA 3V2TA 3RN5A 1PH6A 3CCRA 3DLLA 2LMCB 5K36H 2OXPA 5AJ3L 1KDCA 5C3EH 3T16A 5LL6S 1PTOH 3CAMA 2MHVA 4BA1I 3S2DB 4L5SA 1N9WA 3FKIH 2AQ3B 1QUQA 1Q8IA 4DPGA 4NKLA 4QUFA 1XMQQ 1RCVD 4RHSA 4YCUA 3CXCA 2EOTA 3ITPA 4A3KH 4NXNQ 3OTOQ 1WCMH 3A8JE 4LW1A 1Y1VB 2F0FA 1QZHA 1GVPA 4HJ7A 5FO7B 3TBIB 3F2DA 2JA5G 1EY0A 5IWAL 1YI2A 5EQ0A 4UP7A 4KV6A 2DY7A 2JEBI 5D3DA 4B9WA 1VQDA 1P16A 1EY6A 4GOPA 1UE5A 5CORA 1G2TA 4BA2I 1A3UA 4PZ8A 5JAVA 1H9MA 4HMIA 1X54A 3MXNA 2HQEA 3CCUA 1K3BC 4CDEC 1QCBD 4QCLA 2RDHA 5IT9L 2IHEA 3TP5A 1NY4A 4LFBQ 4DNRB 4YIJA 3URYA 5ELNA 4LF5L 2WINB 5HURA 2I5LX 3EVQA 3SXHA 1LM0A 3S17H 3VYSA 1G2SA 2K7VA 3A8KE 5AJ3Q 3TS0A 3D3RA 1U9RA 4RGNA 4GN4B 4JOIC 4RGTA 2B63B 5M3MB 4IOAA 4DR2Q 2L11A 1Q8KA 3ICEA 3FP9A 5KYIA 3LGJA 3GTPB 4YHHQ 1B50A 4R4QA 4EGVA 2R7ZH 4KHVA 3DXJC 2IX3A 3HKZB 1EOTA 4KKUA 1TWGB 4IALA 2MJ8A 1IKMA 1XNRL 2B39A 3J80c 3CQZH 3IRBA 2F0IA 2UXBQ 3T1YL 4MNOA 4B3SQ 5C4XH 5IP7G 1ZYRD 1LT3D 2H1EA 3HKZE 5C4JB 4WRDA 1LTID 1TT2A 1L0WA 1EIHA 2KUMA 5JPNC 4CGYB 1VF7A 4DR3L 1KABA 1EQQA 3I4LA 4TVAB 5FLMH 1O7ZA 5I6YA 3H0GG 1YNJD 1KQSA 1PRTF 1IXRA 4DV4Q 4FF1A 4KY6A 2VY3A 1KRSA 4A3BB 4DV3Q 1TWHB 1PZID 4AYBB 4P2CB 1NNXA 4KD3A 2KECA 4DXFA 1HH2P 2JA6H 1YJWA 3S1QB 1W3SA 4B3MQ 4K2KA 5M5YH 1QOHA 1I4QA 2EYMA 1XXGA 3OW7A 4LF7Q 5IYDH 5KNDA 4YCVA 1A8VA 3NWTA 2Y0SB 1R4PB 3OMGA 1Q81C 4IQZA 3MXPA 4JG2A 5E7NA 4PQXA 1GOZA 4PMCA 3GDEA 3A8IE 2ZXPA 1QE6A 1TU2B 1PA6A 3PUVA 2ZJPA 1YIJA 2DJGC 1B53A 1WTOA 3KFUA 3EFXD 4K14A 5EKLA 4X65L 4FP5D 4A3JG 3HOWH 3OIPA 1I50B 1SLJA 1HNWQ 4OWXB 4DUYQ 1K83H 1FR3A 3V05A 1PTOB 2NVTH 3IFDA 5G3LF 3S15B 3A7AB 3PCOB 1HNXQ 1V8QA 5EPJA 1J5EL 2EYJA 3NENA 5IGEA 1VQOA 4R4OA 4DR5L 1YHBA 5JVG3 1D5MC 1I94L 1Q46A 4LF8L 4CKBA 1BO0A 1UE7A 2JA9A 4JW0A 1DOKA 1JWSD 3K57A 1LT5D 3H09A 4A3KB 2K14A 1WCMB 1TIID 4XQJA 3VR5A 1SROA 1PYSB 1XWEA 4KHPQ 4DGZA 2VQEL 4HMJA 4OWWB 4LF6Q 1N36L 1CK1A 1SNOA 3UE1A 1UAPA 3W2DA 2G5DA 4A3GG 2A6HD 1W6KA 1E2VA 2A1AA 4QL5A 3I4NH 4A3DH 4ZQ3A 3J81c 2NVXH 3H3VC 3CHBD 4JI4L 5K36G 1BCPD 1OXUA 1Q7YC 5LHY1 1Q82C 5C4HA 4OWTB 5C3EG 1EWIA 1F2ZA 4OEMB 2NVYH 3HKSA 4XT3B 2F0TA 2ZJRA 1L1OA 1V1OA 1OXXK 2OT2A 1SE8A 2B2VA 2EY5A 3FKIG 4UAIA 3MFGA 4DV7L 2DN8A 1ASYA 2JN4A 3RLOA 3OW2A 4BY7H 1EU3A 1KLGD 4EQ5A 4FNFA 4DV1Q 4A3KG 1EY5A 3KDFB 1WCMG 3MZ5A 5E4WC 5LL6X 4OXPA 1W2BA 3S17B 1HQMC 3K7UC 4JV5L 2MO0A 4DFAA 1DJRD 1HA6A 1XJVA 1G8ZD 1KHIA 1CSPA 1SNQA 4HR7B 4IPDA 1J5EQ 3I7FA 2CCZA 1WTXA 2K52A 4NW2A 1EQVA 3F1ZA 2UXCL 4FO2A 4YWKA 1YBYA 2ZM6Q 5EJWA 3K8AA 1JCKB 2CFMA 1CFMA 1VQ5A 2VW9A 1UWVA 3OIQA 3R2TA 1XNQQ 2N78A 2WAQB 4F8MA 3CQZB 4PMBA 2BDOA 3TEHB 2E5LQ 1MSGA 2N8NA 3V96A 1JMCA 1T9HA 2HT1A 1SEBD 2AWOA 2XRSD 5C4XB 2F0PA 1CHQD 1N36Q 1F77A 1ONLA 1JQYD 3NUCA 4HIMA 4C3HH 4H13C 5JEAH 2NTTA 4NPSA 4IUUA 4X64Q 4A3IH 4H0LC 2OTJA 2B3GA 2KJXA 5KIXA 3NQIA 2MGSA 3NP8A 1J8IA 1WTHA 4XDXA 3TDQA 2LXKA 2JA6B 5BN5A 4GKKL 2WKCA 1V1PA 4JI6L 5C6AA 1BBXC 5T1GA 1P8LA 1S5FD 3AEVA 4QUCA 3HOXB 3ULJA 4A3LH 4ZCKA 2R7ZG 1LTAD 4JI2Q 5M9OA 4R8NA 1GUOA 2PZTA 4RGMA 4DK3C 1HUMA 3JAMi 3D0FA 4HSVA 4MIUA 1I6VC 2NB0A 1KAAA 1D2BA 1JT8A 1Y8OB 2IW3A 1QVCA 5CBEE 1SFOB 1K8GA 1CT1D 1I4XA 4KMUC 2DNCA 2F0SA 1EQRA 5HGQA 4FXGC 1IL2A 5IGFA 1V1QA 5J22A 1JR0D 5C4XG 5EAYA 4XYQA 1AW7A 1LACA 5KYLA 1K83B 1GHKA 4TRDA 1VMPA 4AQYQ 2VQFQ 5FLMG 3OPOA 1SYFA 1LTRD 4KKSA 2PPBC 2PMZE 3WDNA 3RNUA 4AH6A 3NXWA 5DAUA 4G57A 4WORA 2Q8TA 2PQAB 3W1BA 1BBWA 4X66L 5C0XI 1GD7A 3VR6A 5ELBA 4EX5A 2HQLA 2KCCA 2OQKA 4YY3L 1BDOA 5C44H 4DR1Q 4X6AH 4N8X1 5IYDG 4GKJL 4HN7A 1JWUD 4OONA 5KEEA 1B8AA 3PO2B 3OHXC 1ILPA 5CC4A 3UDXA 3G6EA 1FL0A 3U50C 2ZT9C 1VQCA 4RA8A 4HAEA 5BN3A 3AFQA 3Q0AA 2QDBA 2A68C 2I07B 3I4NB 2XRQD 1N33Q 1G91A 4F87A 3HOWG 1O78A 4DV5L 2YU9B 2IL8A 5C4ZA 3SHLA 2EY6A 4JVZA 4BY1B 2VL6A 1LLRD 2NVYB 1SJED 1II3A 1C7YA 4HIKA 2F4IA 1DXMA 2UUAL 2RDFA 1IHZA 4ZUJA 3NE5B 5IOCA 2PCFB 4BY7B 1IZ6A 2K5DA 1PFNA 3M7GA 2ZTDA 2K5WA 2N3SA 3BYYB 3EA6A 2L4NA 4CDDC 4DV6L 3T1HL 5C3WA 1QUQB 1SE4A 1JJ2A 2WIIB 2LY7A 3A5UA 3I91A 4JYAQ 4UPAA 5CV8A 5FLXL 2OTLA 2I5HA 1WVLA 3K5LA 1HQRD 3Q24A 4M8AA 3I4NG 1Q90A 1RTNA 4IOCA 4A3DG 4A3CH 1B7YB 2AUKA 2A74C 2KOLA 2F0EA 1D5XC 3TRZA 3JC66 4ODGA 4ILWA 4N8FA 3QR8A 4C1NK 2EY1A 3N52A 1X65A 1VMCA 2F4VL 3NELA 4GOPB 1Q1BA 5LMNW 4RFBA 1F2YA 4A75A 2EJMA 1LYLA 4JI1Q 1A2UA 5IT9c 1FJGL 4UHVA 2WB1B 4HSPA 4BY7G 3NBHA 3MC0B 2MP1A 3CC2A 1CUKA 2F0HA 2B63H 5M3MH 1VQAA 3MXNB 3T56B 1ET6A 1JOKA 4A3IB 3QIAA 4DV5Q 2QW7A 2MNAA 1FNVA 1LT4D 2YTXA 3A0JA 3STBC 1SMYC 4GN5A 4LMQD 4R4TA 3K7AB 1LO5D 3OSOA 4G7OC 2HDMA 4K8IA 2NVQB 3LWUA 4KTAA 1X3QA 1HPCA 1UNSA 1XMQL 5M3FH 1QZGA 4ZKCB 1S5DD 4DXGA 1TQOA 3H3VI 1PVOA 4KHZA 4L8JA 2AQ1B 4HJ5A 4G7HC 1YITA 3A5ZB 4B08A 1PZKD 2DNEA 5IGCA 1SMXA 3T1HQ 3L3OC 2F52A 3ND9A 3RMHA 1TKWB 1I4HA 4GOPC 3I55A 4TKOB 3GV3A 4LK1C 3A74A 1HZBA 3I4MB 5DM63 4A3BH 5HGTA 2VB2X 1TWHH 3X3MA 5H1SE 3RZDH 2K5VA 2RKSA 3CCJA 2Q8IB 4C3HG 5JEAG 1H9RA 3S1QH 1VQPA 4GS3A 3Q23A 4A3IG 2ZJQA 1AZPA 3S14H 1FYCA 3HRZC 4JC0A 4L6TB 3L2PA 2NZOA 4IPCA 1WD1A 2YYZA 4MZ9A 3BU2A 1VQHA 3J7AV 4DR7Q 3OOCA 2K01A 3WOFA 3CPWA 1IL8A 1HR0L 5C44B 4LJZC 1X3FA 4LFAQ 1EIGA 1BVSA 2B2WC 4A3LG 4IUNA 1HFNA 4LF4L 2CH4W 1M90C 4A3MB 3C1EA 4KJNA 3QOLA 4DAVA 2WACA 3RZOH 1I50H 3H3VH 1F9PA 1YJNA 2SNMA 1SXTA 1X9NA 3S15H 4PG3A 3H94A 1OO9B 1CQVA 3P20A 2PQEA 4DR2L 2K33A 1I3QH 2EE1A 3FDTA 3GQBA 2K5QA 3R3OA 4YHHL 3A7LA 1TWCH 4OL7A 1MIUA 3J80E 4IPGA 4FXDA 4RCNA 3NQTA 1NCVA 2UXBL 4YWLA 1TS5A 2F0QA 3S1MH 1STBA 2D2CC 1WTPA 1G6PA 2KCNA 1HRJA 4B3SL 2RA4A 4ID6A 1ESFA 1GXDC 3L0OA 1FD7D 2BCOA 3EJIA 1PMRA 3TP8A 1A63A 1PTOF 4BBRH 1EYAA 1H9SA 2Q2HA 2KHSA 3NPPA 4DV4L 3L9AX 3K6OA 4CBVA 4DV3L 1WTVA 3GTJH 3BS1A 4IUVA 3CKIB 1UE1A 1R4QB 4EQNA 4B3ML 5FKAC 3RN2A 3E0EA 2M9VA 1HR0Q 4LF7L 1VQ4A 1I6HB 1WI5A 1VDZA 3W5OA 2PNHA 3W3AA 2WFWA 4LF4Q 3HS0C 1EYCA 1Y1VG 3M4YA 2A5HA 2F3VA 2K03A 2JE6I 2B2WA 2EYHA 3KBGA 3I73A 2VB3X 1XYIA 2RBMA 3T4AC 1SAPA 4M1UB 4K5WA 1QB5D 1X56A 2MUYA 2JP1A 2F0LA 3MVVA 1CHPD 5IGDA 2XWJB 2HUGA 2E2DC 1CZGA 4BS9A 1Y1WH 5FO8B 1HNWL 4OIJA 4DUYL 1L1OB 4K2LA 4C1NI 5C0XG 2XVSA 3C3LA 2RSNA 3NTKA 2BDNA 1HNXL 2KEDA 3VYRA 2JQOA 1MKHA 3NSWA 2M2LA 3PV0A 4UP8A 3TREA 2F0DA 3U4VA 4N9PA 1DONA 3BDOA 3KLRA 4QF4A 1VQLA 1PLFA 5M3FB 4C3JB 1NTGA 2K5NA 5A2QL 3RR5A 2E2JH 3U9SA 1MHWC 1BBUA 4A3FH 5LMNQ 2BA0A 1SNMA 2PW7A 2BH2A 2MQHA 4H44C 2QGQA 4KKTA 4B3TL 4RKBA 4KHPL 4TSSA 4QY7A 4YCWA 4OO1I 2A8VA 2F0VA 1AE3A 1D1IA 3I70A 5CV6A 4RHRA 3T51B 4LF6L 1YZ6A 3PIPA 3VA5A 4LNQA 3S24A 4GNXA 3J81E 1M4VA 1RL2A 2L9HA 3RZDB 2KA7A 4LF9Q 3NHHA 2B63G 1S5ED 5IGGA 5M3MG 3M7NA 1NBWA 1GM5A 1L1OC 3M3YH 2B2VC 3S14B 3HOXH 4LFCQ 2XSCA 4QGUA 2AWNA 3N6RA 3BVZA 2QDLA 1VQ9A 1IYUA 2LS01 3CW2C 3QOJA 3S2HB 3HKZG 4AYBE 2J4XA 3FPPA 1IBLQ 3Q6SA 4P71A 1FGBD 3KLWA 4KY7A 1SFOH 5M3FG 2DY8A 3STBD 1SMYD 3EROA 3CP0A 3SK4A 4DV1L 1GUGA 1BOSA 1Q3LA 3ULPA 1XTDA 2Y0SE 4I7ZC 1DCZA 1VQ8A 3RZOB 4NXMQ 1A15A 1PXUA 2G9HD 3ERSX 2BH8A 1V1PB 3HOUB 1U4RA 3GTLH 3M85A 4EVOA 4X3SA 1Z47A 2FHTA 3CC7A 4N9TA 1VQEA 1Z9FA 3C1FA 3VYTA 1I3QB 4LAAA 5IIFA 1NUCA 4A3BG 1XMOL 2XGTA 4OO1H 2ZTCA 3BZDB 4RAUC 4AYBG 5F2DA 3TN2A 2ZM6L 3J7ZC 2EVBA 2A19A 1TWCB 1HUNA 4DA2A 1A0IA 1XNQL 2PYKA 3U9OA 5D65A 3SDZA 4QMGA 1KLUD 2J7ZA 1NR2A 5BN4A 3JAML 4B3TQ 2V1CC 1RD9D 3PO2H 3S1MB 2Y0SG 5ELCA 2E5LL 4HEDA 4CJ2C 3DM3A 2NBFA 2AUJD 3QJYA 1CA6A 5JEAJ 2F0NA 4IZ8A 1A62A 2CWPA 2UU9Q 2PW5A 4DAPA 5IYBH 4BBRB 1DD2A 4X64L 1EEFD 1K3RA 2L12A 3ZJYC 4R4IA 2YU9H 3H91A 4HCSA 4FXKC 1CKOA 3GTJB 4BY1H 5FJ8H 2X6GA 3VDYA 3NTHA 3SGIA 4GLXA 3MAQA 3PUYA 1STAA 3E9IA 4FDBA 3K5MA 4HTHA 5I9OA 2EYFA 1EL0A 1VQBA 1OXTA 2I46A 1EYGA 4L63B 4JI2L 5CBAE 3BDLA 2UXDQ 2CKZB 2PZWA 3KYHC 2E8GA 3PIOA 5E3FA 1U4PA 4POFA 2K05A 3PSIA 1B70B 2SDFA 3CRKC 1KRTA 5CV9A 4IFDH 4C3IH 1JE4A 3D31A 2RF4A 1Y1WB 2EPBA 5IYCH 4GLAC 1XMOQ 4OX9Q 1JWMD 3QB3A 4WJ4A 3KOJA 1AP0A 4AQYL 1E3PA 1SE3A 2K28A 1O7LA 4BBRG 2VQFL 1DOLA 1VQKA 1BXTA 4JCVE 4Q5VA 1ESRA 1VQ6A 1F9RA 3T13A 1KXLA 3GTOB 1X55A 2F1MA 1TY0A 5FLXc 1B2TA 1PRTB 4X3KA 2E2JB 3TQYA 3R8BA 2OF1A 4A3FB 5M5WH 4DR1L 2BOSA 1PH5A 1AH9A 1NMFA 1E1OA 1VQ7A 2NTSA 2WAQE 5L37A 2EDGA 2FJ2A 3PO3B 1JJGA 2IHFA 2B2YA 2NN6I 4ULLA 2EIFA 4NDXA 2RCFA 1EIYB 1SNPA 4BBSB 1JOOA 1I5FA 2JK8A 3K7AH 1M8AA 1I4RA 1N33L 3R93A 2NVQH 1STEA 4HIOA 1ZKOA 2R3ZA 3I8ZA 4J1MA 4FF2A 5KNCA 1K8MA 4OIKA 4UP9A 1Y1WG 3M3YB 1QILA 3G71A 1QNKA 2LKVA 3WWVA 1JB3A 3J81j 3TMEA 1WD0A 3KF6A 1K9MC 3NBHB 2E74C 2VUMB 2WAQG 1MI2A 3LNNA 3PIP3 1PRTC 3CCVA 1EZ6A 1SNDA 5ELEA 5C0XJ 3ER0A 1LTTD 3W1GA 2O5JC 2B2UA 5JOBA 4JBKA 1QVFA 1PDQA 3SR1A 3I4MH 1EWCA 2F0OA 1HA5A 2E2HH 3F2BA 5IE8A 1ICFB 3GTLB 4ME5A 5A35A 2P5ZX 3FEWX 4GN3B 3KJOA 1RKNA 3BDCA 1Z7TA 4IN3A 3KJPA 1Y69U 3HOZB 4JYAL 2JA7B 3K81C 1E1TA 2L1BA 2ATWA 4WFN3 2L15A 4K8JA 1RJTA 4RWSC 3HOVB 4O2DA 1BCPF 3CCMA 2CWAA 2NN6H 3CU7A 4C2MH 2JA6G 1AFPA 2JJQA 2JSOA 3I4OA 4DU9A 3HOXG 3GTMB 2K50A 2SNSA 1VF5C 1VCIA 1AE2A 1X3EA 3UE0A 4A3MH 4DUZQ 5I9PA 1HNZQ 3CC4A 1DOMA 4JI1L 3MEFA 2EQSA 4B9XA 1WTWA 4QIWB 4XQQA 4DNTB 1FNUA 3CCQA 2AHOB 3OMCA 2F3WA 2N55A 2EY2A 2XTIA 2MO1A 1B9MA 3QWNA 1PHJA 2OEOA 2A6EC 2UUCQ 4WJWA 3GTKH 5EBDA 1YNXA 2EYOA 1TVXA 4DF7A
chains in the Genus database with same CATH topology
1STYA 1F9SA 3CRLC 1G291 2N88A 4R9WA 4BWGB 4OO1G 2F0WA 5IGBA 5K5PA 2O5IC 1HHVA 2O2LD 4U673 5FOBB 1OXVA 3MWYW 1PFMA 4MN3A 2GA4B 3WOEA 3M4OB 4RH6A 2JXMB 5EPLA 4C3IB 2C9OA 1S5BD 1CZWA 1Z6HA 1KDAA 1GUTA 2BE5C 2MPMA 2ENBA 1ENCA 1ENAA 5T1IA 1HTPA 4KN4C 3D6CA 1U4MA 1EZ8A 1QJOA 3DEOA 3MXGA 3FRPB 5C5MA 2BA1A 4IUTA 5TSSA 1ILQA 3DWAA 1J9OA 2ID0A 1KTKA 1EY9A 3I72A 3J7YW 5M5WB 1C8CA 1H9SB 4G4KA 4K6DA 1DM0B 3SK8A 1C48A 2JYOA 3O13A 1EWHA 2F0JA 5I2YA 3KLSA 2F0MA 2KEEA 3DWPA 2NWGA 4IFDG 3HOYB 1I4PA 4J8QA 3DHQA 4DK0A 3IKJA 1GUSA 3FPUB 5CYUA 1XX8A 3VR4A 4ZKBB 1YNNC 4XXEA 3SEBA 5E4XA 2VXWA 2E76C 3X3NA 1SE2A 5ISRA 3S1RB 3QO2A 3ERQA 2E2HB 4RCOA 3F2UA 5E1FA 2ZXOA 2JA8B 3DEPA 4E6IA 3PUWA 2B2TC 1F2LA 4CJ1B 1IYVA 4H7BA 2IX1A 3GTQB 5IODA 2XWBB 1EY8A 2XIWA 4DAYA 1MSHA 4FYDA 4IUQA 4C2MB 2X69A 2H4OA 4FF3A 2K6AA 4QB4A 1D1KA 4ZRZA 5CV4A 2E75C 5DNFA 1PZJD 1BR9A 3IAYA 2R61A 2HCIA 5KGUA 1TWAB 4TQUS 3A54A 2JA5B 3BYTB 3TP7A 1T5XD 3D8GA 1GUWA 3GTKB 1LTSD 3VYUA 1PRTD 5CR3A 3RLFA 3TSSA 5I4DA 4ZYSA 3ND8A 1FNWA 4XQNA 5KNBA 1V43A 1PYWD 3QG1A 4O1NA 3ZYYX 4S3SA 3ONAB 1HCZA 2NN6G 2EYPA 4RKLA 2EJFC 1ET9A 1SDFA 1TY2A 2D5DA 2C5CA 4XT1B 4KY5A 1H9JA 1R9TB 3E5SA 5CV7A 4F88A 4NP5A 3KF8A 2ICEC 1DZ1A 2B2TA 5M5XB 1TS4A 4Q0FA 5EBCA 5G3LD 4U68A 1LTGD 5DM73 1RODA 2SEBD 2O4XA 1GJXA 2A68D 2Z4HA 4Z9CB 2A6ED 3J7AF 3VR2A 2PZUA 4FVMA 2F0KA 3NTIA 5CGKA 1BF4A 4PV1C 2D62A 5NUCA 1WTQA 3NBIA 1B1ZA 1LT6D 1QWYA 3BVMA 2XN9C 4OGQC 2EJGC 2WP8J 4KK7A 3KLSX 5FK9C 1ZEQX 3BVGA 3S16B 3KBXA 4UDUC 3H0GB 3A56A 1C4QA 1CQFA 3DM1A 5KRUA 4IUPA 3GV6A 1Y8PB 1IW7C 1G6ZA 1E2WA 5D14A 2IX0A 2CW0C 5COYA 4V190 1U4LA 3S1NB 1STNA 2BE5D 3S9WA 1ML0D 3R2IA 2R6GA 1JC7A 3TP6A 3EQLC 1CTMA 4A3JB 2NZ1D 1HFGA 1OXSC 3A55A 3P1HA 1EQTA 5ELFA 3SE0A 1BUVT 1LABA 1O80A 4C3JG 3VR3A 4KI0A 4ZUIA 2RVLA 4X3TA 4IFDJ 2F03A 4MHEA 2QF7A 2FINB 2IJ0A 1KDBA 2ICIA 1SNCA 1BNZA 2KVMA 3E6ZX 1YNND 4A3GB 1H9KA 4GZYC 3K59A 2WKDA 1A3TA 1AEXA 1WTRA 3MXUA 3C46A 5FLXE 4PMWA 3H6MA 5C3EB 3L7ZC 4IFDI 2CHBD 4A3EB 2J0TD 2R93B 1UUPA 3NWSA 2WV6D 3SK6A 4ZK9B 3FKIB 4V0BA 2B2YC 3PUXA 4J6HA 3D4RA 3D6WA 1E0BA 1MD2D 3IFTA 1TS2A 5I6WA 4XYOA 1S4ZA 4RGOS 2R92B 2PO4A 4IURA 3Q22A 1F9QA 2Z1CA 4XTCS 1X3PA 1JORA 2AQ2B 1B9NA 1TR5A 1MGSA 1KNEA 1PTOC 2B2UC 4C56C 2IPKD 4ZAIA 3C2PA 1SYBA 1GHJA 1W6JA 4K5VA 1JICA 3FVQA 2B8FA 2RDGA 4DK1A 1CI3M 3AU7A 1TWFB 1SYGA 2Q8RE 4XIGS 1ICWA 2EZVA 3J80L 4DN4M 1EY4A 3SK5A 3FMCA 2K04A 2L5TA 2XNAC 1BQQT 2IT1A 4ZLTF 4G7ZC 2A69C 3GP7A 3BG3A 2R7ZB 3K5NA 4X3UA 1STGA 4I65A 3OWEB 3I90A 1DYQA 1RDPD 4KD4A 3GTGB 2B8GA 1O7YA 2PNRC 3HG9A 5JPMC 2SOBA 1F2MA 3I3CA 3HP3A 3OWFA 4KN7C 1L0XB 3G6JB 3NK9A 1LTBD 3VA7A 1NSNS 2VNUD 1STHA 3AB9A 3MFYA 4ABNA 4A93B 3K58A 2NYZD 5M5YB 2EXZA 2RSOA 3LX0A 1SJHD 3TZUA 2K1BA 1B44D 1IW7D 4FF4A 2CW0D 2X6LA 1EFID 1D6EC 2CQAA 3K0YA 2PMZB 1EY7A 4K5XA 1MBYA 5J39A 3HOWB 3MHBA 2CVRA 2FMMA 1Y8NB 5EGTA 1HXYD 2NVTB 2V4DA 2NUCA 2QKIC 5EKKA 5ELDA 5IT9E 1A3VA 4OHJA 1SSOA 2JEAI 4F7XA 4CJ0B 2L55A 1S5CD 3G7LA 1SBBB 1A2TA 5FO9B 3IL8A 3D4DA 2KQ3A 1AZQA 1EEID 3J81L 2Z8LA 1A6XA 1RTOA 1E2ZA 2L0CA 4HCEA 2E2IB 2F0GA 1NR4A 3P7JA 4A3DB 5AFWA 2NVXB 2Z4IA 4Y7NB 4PNYA 1UEAB 5A2QE 3E0JA 3MA2B 1GUNA 3AMUA 3LWEA 2K32A 4CKEA 3HEJA 4R8IA 1SYCA 1SYEA 5C0XH 2LFNA 3PIO3 1T5EA 2FFKB 3PMFA 2D9UA 1B3AA 5JJZA 1ZYRC 1I4GA 1ZXTA 1CA5A 1KNAA 2RQXA 3HGBA 4CHTB 2G9DA 1YNJC 1D5ZC 4NMZA 3RUZA 3TZDA 3MTSA 1NAPA 2QILA 2HDLA 1XTCD 4C3IG 5D3IB 1PTOD 1Q12A 5JVH3 1AN8A 1EYDA 5EPKA 4C3HB 1RF2D 2QEJC 2IWHA 3DMUA 3GO5A 1QNUA 3D4WA 3UI2A 3MEHA 5EKIA 2FMCA 3HZXA 1EU4A 1PFBA 5I2XA 1LV9A 3KK7A 4JBWA 1K8OA 1QG7A 3GD7A 1X32A 2M00A 1BCPB 5DEHA 2F0UA 1HTLD 4JK1C 3JAME 1CM9A 2EYLA 3P75A 1B4OA 1RHPA 5C3XA 5J1ZA 2A69D 4KJOA 5C5LA 1Q1EA 2A73B 4CKCA 1JOQA 3PUZA 1L0YB 3T53B 3DUZA 2HCCA 2QCPX 1SYDA 2TMPA 5CMDA 4EQPA 2A6HC 4EQOA 4O42A 3K5OA 3KUPA 1TS3A 4K6LA 5CV5A 3RD4A 3DWQA 1BCPC 2TSSA 1IKLA 1ENFA 2ZXRA 3SVMA 3V2TA 2LMCB 5K36H 2OXPA 1KDCA 3T16A 5LL6S 1PTOH 2MHVA 4BA1I 3S2DB 2AQ3B 1Q8IA 4NKLA 4QUFA 1RCVD 4RHSA 2EOTA 3ITPA 3A8JE 1Y1VB 2F0FA 5FO7B 3TBIB 1EY0A 5EQ0A 4KV6A 2DY7A 2JEBI 5D3DA 4B9WA 1EY6A 5CORA 1G2TA 4BA2I 1A3UA 5JAVA 1H9MA 4HMIA 3MXNA 2HQEA 1QCBD 4QCLA 2RDHA 5IT9L 3TP5A 4DNRB 4YIJA 3URYA 2WINB 5HURA 3EVQA 3SXHA 3VYSA 1G2SA 2K7VA 3A8KE 3D3RA 1U9RA 4RGNA 4RGTA 2B63B 5M3MB 2L11A 5KYIA 3GTPB 1B50A 4EGVA 4KHVA 3DXJC 2IX3A 3HKZB 1EOTA 4KKUA 1TWGB 4IALA 2MJ8A 1IKMA 2B39A 2F0IA 1ZYRD 1LT3D 2H1EA 5C4JB 4WRDA 1LTID 1TT2A 1EIHA 2KUMA 5JPNC 4CGYB 1VF7A 1KABA 3I4LA 1O7ZA 5I6YA 1YNJD 1PRTF 4FF1A 4KY6A 4A3BB 1TWHB 1PZID 4AYBB 4P2CB 4KD3A 2KECA 4DXFA 3S1QB 4K2KA 1QOHA 1I4QA 2EYMA 1XXGA 3OW7A 5KNDA 3NWTA 2Y0SB 1R4PB 3OMGA 4IQZA 3MXPA 4PQXA 1GOZA 4PMCA 3A8IE 2ZXPA 1QE6A 1TU2B 3PUVA 1B53A 1WTOA 3EFXD 4K14A 5EKLA 4FP5D 3OIPA 1I50B 1FR3A 3V05A 1PTOB 3IFDA 5G3LF 3S15B 3A7AB 1V8QA 5EPJA 2EYJA 5IGEA 5JVG3 1D5MC 4CKBA 1BO0A 1DOKA 1JWSD 3K57A 1LT5D 3H09A 4A3KB 1WCMB 1TIID 4XQJA 3VR5A 1XWEA 4DGZA 4HMJA 1CK1A 1SNOA 1UAPA 3W2DA 2A6HD 1W6KA 1E2VA 4ZQ3A 3H3VC 3CHBD 5K36G 1BCPD 1OXUA 5LHY1 5C4HA 1F2ZA 4XT3B 2F0TA 1V1OA 1OXXK 2OT2A 2B2VA 2EY5A 4UAIA 3MFGA 2DN8A 1EU3A 1KLGD 4FNFA 1EY5A 5LL6X 3MZ5A 5E4WC 3S17B 1HQMC 4DFAA 1DJRD 1HA6A 1G8ZD 1SNQA 4HR7B 1WTXA 4NW2A 1EQVA 4FO2A 5EJWA 1JCKB 1CFMA 3OIQA 3R2TA 2WAQB 4F8MA 3CQZB 4PMBA 2BDOA 1MSGA 3V96A 1SEBD 2AWOA 2XRSD 5C4XB 2F0PA 1CHQD 1F77A 1ONLA 1JQYD 3NUCA 4H13C 5JEAH 2NTTA 4IUUA 4H0LC 2KJXA 5KIXA 3NQIA 2MGSA 3NP8A 1J8IA 4XDXA 3TDQA 2JA6B 5BN5A 2WKCA 1V1PA 5C6AA 1BBXC 5T1GA 1S5FD 4QUCA 3HOXB 1LTAD 5M9OA 4R8NA 1GUOA 2PZTA 4RGMA 1HUMA 4HSVA 4MIUA 1I6VC 2NB0A 1KAAA 1D2BA 1Y8OB 2IW3A 5CBEE 1SFOB 1CT1D 1I4XA 4KMUC 2DNCA 2F0SA 4FXGC 5IGFA 5J22A 1JR0D 4XYQA 1AW7A 1LACA 5KYLA 1K83B 1GHKA 4TRDA 1VMPA 3OPOA 1SYFA 1LTRD 4KKSA 2PPBC 3WDNA 3NXWA 5DAUA 4G57A 4WORA 2Q8TA 5C0XI 3VR6A 5ELBA 2KCCA 1BDOA 4HN7A 1JWUD 5KEEA 3PO2B 3OHXC 1ILPA 5CC4A 2ZT9C 4RA8A 4HAEA 5BN3A 3Q0AA 2QDBA 2A68C 2I07B 3I4NB 2XRQD 1G91A 4F87A 1O78A 2YU9B 2IL8A 5C4ZA 3SHLA 2EY6A 4BY1B 1LLRD 2NVYB 1SJED 1II3A 2F4IA 1DXMA 2RDFA 1IHZA 4ZUJA 3NE5B 5IOCA 2PCFB 4BY7B 2K5DA 1PFNA 3M7GA 2K5WA 3BYYB 3EA6A 2L4NA 5C3WA 1SE4A 2WIIB 2LY7A 3I91A 5CV8A 5FLXL 1WVLA 3K5LA 1HQRD 3Q24A 4M8AA 1Q90A 1RTNA 2AUKA 2A74C 2KOLA 2F0EA 1D5XC 4ODGA 4ILWA 4C1NK 2EY1A 3N52A 1VMCA 1Q1BA 4RFBA 1F2YA 2EJMA 1A2UA 2WB1B 4HSPA 3NBHA 3MC0B 2MP1A 2F0HA 3T56B 1ET6A 1JOKA 4A3IB 3QIAA 1FNVA 1LT4D 1SMYC 4LMQD 3K7AB 1LO5D 3OSOA 4G7OC 2HDMA 4K8IA 2NVQB 3LWUA 4KTAA 1X3QA 1HPCA 1UNSA 4ZKCB 1S5DD 4DXGA 1TQOA 4KHZA 4L8JA 2AQ1B 4G7HC 4B08A 1PZKD 2DNEA 5IGCA 3L3OC 3ND9A 3RMHA 1TKWB 1I4HA 4TKOB 3GV3A 4LK1C 3I4MB 5DM63 5HGTA 2VB2X 3X3MA 2RKSA 2Q8IB 4C3HG 5JEAG 1H9RA 3Q23A 1AZPA 1FYCA 3HRZC 4L6TB 1WD1A 2YYZA 3J7AV 3OOCA 2K01A 3WOFA 1IL8A 5C44B 4LJZC 1EIGA 2B2WC 4IUNA 1HFNA 4A3MB 3C1EA 4KJNA 3QOLA 4DAVA 2WACA 1F9PA 2SNMA 1SXTA 3H94A 1OO9B 1CQVA 3P20A 2PQEA 2K33A 2EE1A 3FDTA 3GQBA 2K5QA 3R3OA 3A7LA 4OL7A 3J80E 4FXDA 4RCNA 3NQTA 1NCVA 1TS5A 2F0QA 1STBA 2D2CC 1WTPA 2KCNA 1HRJA 2RA4A 4ID6A 1ESFA 1GXDC 1FD7D 2BCOA 3EJIA 1PMRA 3TP8A 1PTOF 1EYAA 1H9SA 2KHSA 3NPPA 3L9AX 3K6OA 4CBVA 1WTVA 3BS1A 4IUVA 3CKIB 1R4QB 4EQNA 5FKAC 2M9VA 1I6HB 1VDZA 3W3AA 3HS0C 1EYCA 3M4YA 2A5HA 2F3VA 2K03A 2JE6I 2B2WA 2EYHA 3KBGA 3I73A 2VB3X 1XYIA 2RBMA 3T4AC 1SAPA 4M1UB 4K5WA 1QB5D 2MUYA 2JP1A 2F0LA 3MVVA 1CHPD 5IGDA 2XWJB 2HUGA 2E2DC 1CZGA 4BS9A 5FO8B 4OIJA 4K2LA 4C1NI 5C0XG 2XVSA 3C3LA 2RSNA 3NTKA 2BDNA 2KEDA 3VYRA 3PV0A 3NSWA 2M2LA 2F0DA 4N9PA 1DONA 3BDOA 3KLRA 4QF4A 1PLFA 5M3FB 4C3JB 5A2QL 3U9SA 2BA0A 1SNMA 2PW7A 4H44C 4KKTA 4RKBA 4TSSA 4OO1I 2F0VA 1D1IA 3I70A 5CV6A 4RHRA 3T51B 3VA5A 3J81E 1M4VA 2L9HA 3RZDB 2KA7A 3NHHA 1S5ED 5IGGA 3M7NA 2B2VC 3S14B 2XSCA 2AWNA 3N6RA 3BVZA 3S2HB 1IYUA 2LS01 3QOJA 2J4XA 3FPPA 3Q6SA 1FGBD 4KY7A 2DY8A 1SMYD 3EROA 3SK4A 1GUGA 1BOSA 1Q3LA 4I7ZC 1DCZA 3RZOB 1A15A 1PXUA 2G9HD 1V1PB 3HOUB 1U4RA 3M85A 4EVOA 4X3SA 1Z47A 2FHTA 4N9TA 3VYTA 3C1FA 1I3QB 4LAAA 5IIFA 1NUCA 4OO1H 3BZDB 4RAUC 5F2DA 3TN2A 2EVBA 1TWCB 1HUNA 4DA2A 2PYKA 3U9OA 5D65A 3SDZA 4QMGA 1KLUD 2J7ZA 1NR2A 5BN4A 3JAML 1RD9D 3S1MB 5ELCA 4HEDA 4CJ2C 2NBFA 2AUJD 3QJYA 1CA6A 5JEAJ 2F0NA 4IZ8A 2PW5A 4DAPA 4BBRB 1DD2A 1EEFD 2L12A 3H91A 4HCSA 4FXKC 3GTJB 2X6GA 3NTHA 3MAQA 3PUYA 1STAA 3K5MA 4HTHA 5I9OA 2EYFA 1EL0A 1OXTA 2I46A 4L63B 5CBAE 3BDLA 2PZWA 5E3FA 1U4PA 2K05A 2SDFA 3CRKC 5CV9A 4IFDH 1JE4A 3D31A 1Y1WB 2EPBA 1JWMD 3QB3A 1AP0A 1SE3A 2K28A 1O7LA 1DOLA 1BXTA 4Q5VA 1ESRA 1F9RA 3T13A 3GTOB 2F1MA 1TY0A 1B2TA 1PRTB 4X3KA 2E2JB 3R8BA 2OF1A 4A3FB 2BOSA 2NTSA 2EDGA 2FJ2A 3PO3B 2B2YA 2NN6I 4ULLA 4NDXA 1SNPA 4BBSB 1JOOA 1M8AA 1I4RA 3R93A 1STEA 1ZKOA 2R3ZA 3I8ZA 4J1MA 4FF2A 5KNCA 1K8MA 4OIKA 3M3YB 1QILA 1QNKA 2LKVA 1JB3A 3TMEA 1WD0A 2E74C 2VUMB 1MI2A 3LNNA 3PIP3 1PRTC 1EZ6A 1SNDA 5ELEA 5C0XJ 1LTTD 2O5JC 2B2UA 5JOBA 1PDQA 3SR1A 1EWCA 2F0OA 1HA5A 3GTLB 4ME5A 5A35A 3FEWX 3HOZB 1RKNA 3BDCA 1Z7TA 4IN3A 1Y69U 2JA7B 2L1BA 4WFN3 3HOVB 4K8JA 1RJTA 4RWSC 1BCPF 2NN6H 3CU7A 1AFPA 2JSOA 4DU9A 3GTMB 2SNSA 1VF5C 1VCIA 5I9PA 1DOMA 4B9XA 1WTWA 4QIWB 4XQQA 4DNTB 1FNUA 3OMCA 2F3WA 2N55A 2EY2A 1B9MA 3QWNA 2OEOA 2A6EC 4WJWA 5EBDA 2EYOA 1TVXA 4DF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAP A;  3I91 A;  2B2T A;  1HUM A;  2FJ2 A;  2JP1 A;  2HDL A;  4HSV A;  1HUN A;  2B2Y A;  1F9S A;  2H1E A;  2HUG A;  2K01 A;  1IL8 A;  4U68 A;  1SSO A;  2N88 A;  4QUF A;  2Q8R E;  2RVL A;  1WVL A;  1ICW A;  1ROD A;  4R9W A;  4X3T A;  5D65 A;  4OIJ A;  5CBE E;  2KUM A;  1EIG A;  3QO2 A;  4CJ0 B;  1EIH A;  3G7L A;  5EPK A;  2RSN A;  2B2W C;  2BDN A;  2J7Z A;  1NR2 A;  1M8A A;  2EOT A;  1RTN A;  2FIN B;  2KED A;  3F2U A;  4MHE A;  4XT3 B;  4DN4 M;  1O7Z A;  2M2L A;  3DEP A;  4HED A;  3IL8 A;  4CJ2 C;  2KOL A;  3R93 A;  1HHV A;  2B2T C;  1BNZ A;  1F2L A;  2B2V A;  2K04 A;  2KVM A;  2R3Z A;  3I8Z A;  4UAI A;  3UI2 A;  4CJ1 B;  1AZQ A;  1CA6 A;  4OIK A;  1DON A;  1F9P A;  4ZLT F;  5EKI A;  1PLF A;  1QNK A;  1PFB A;  1PFM A;  3MWY W;  4MN3 A;  3N52 A;  1LV9 A;  1BF4 A;  2KEC A;  1VMP A;  1WTQ A;  2XIW A;  1RTO A;  4X3U A;  1MSH A;  1VMC A;  4IUQ A;  1WD0 A;  2X69 A;  3I90 A;  5E4W C;  2EE1 A;  5EPL A;  5EQ0 A;  1WTR A;  2L12 A;  3FDT A;  2DY7 A;  1QG7 A;  3H91 A;  4HCS A;  2MPM A;  1X32 A;  1MI2 A;  2Q8T A;  1HA6 A;  2X6G A;  1O7Y A;  2MP1 A;  1NR4 A;  3P7J A;  5COR A;  5DNF A;  1G2T A;  1CM9 A;  3KBX A;  5AFW A;  5T1I A;  1B4O A;  4ZK9 B;  2HCI A;  2B2U A;  3DM1 A;  1WTX A;  1PDQ A;  4NW2 A;  1RHP A;  1QE6 A;  1NCV A;  1U4M A;  2B2Y C;  4IUP A;  1EL0 A;  3DEO A;  1B53 A;  1WTO A;  2L9H A;  3GV6 A;  4LMQ D;  4IUT A;  3I3C A;  1ILQ A;  1G6Z A;  5EJW A;  3HP3 A;  5CBA E;  1WTP A;  1ILP A;  1J9O A;  2HDM A;  1HRJ A;  2RA4 A;  5D14 A;  5COY A;  1U4P A;  3D6W A;  1U4L A;  1X3Q A;  1E0B A;  2K05 A;  4RA8 A;  1DZ1 A;  1GUW A;  2L1B A;  4HAE A;  1C8C A;  2B2V C;  3LWE A;  4ZKC B;  1RJT A;  4RWS C;  3IFD A;  2SDF A;  1S4Z A;  5EPJ A;  4R8I A;  1MSG A;  1ML0 D;  2JYO A;  2HCC A;  1G91 A;  2NYZ D;  4IUR A;  1JE4 A;  1G2S A;  3Q6S A;  1F9Q A;  5CMD A;  2IL8 A;  1WTV A;  2RSO A;  4IUV A;  2EPB A;  2FFK B;  2DY8 A;  4O42 A;  2D9U A;  1BO0 A;  2K1B A;  1B3A A;  1DOK A;  1X3P A;  1AP0 A;  2KEE A;  2K28 A;  3ONA B;  3KUP A;  1DOL A;  2NZ1 D;  4IUU A;  1Q3L A;  3GV3 A;  2NWG A;  1ESR A;  2L11 A;  5JJZ A;  1MGS A;  1HFG A;  1KNE A;  2X6L A;  1SDF A;  1F9R A;  1DOM A;  2B2U C;  1IKL A;  1ZXT A;  2MGS A;  1A15 A;  1J8I A;  1B50 A;  4XDX A;  4XT1 B;  1CA5 A;  3TN2 A;  1U4R A;  3SVM A;  1WTW A;  1PFN A;  1KNA A;  4ZAI A;  1EOT A;  3FPU B;  4X3S A;  1B2T A;  4X3K A;  2N55 A;  2FHT A;  1XX8 A;  2MJ8 A;  1EQT A;  4ZKB B;  1BBX C;  1JIC A;  5T1G A;  1IKM A;  2CVR A;  2FMM A;  1AZP A;  2L4N A;  4QUC A;  1HFN A;  2K03 A;  4RAU C;  2B2W A;  5E4X A;  1WD1 A;  1O80 A;  2VXW A;  3TZD A;  1TVX A;  1XYI A;  1SAP A;  3MTS A; 
#chains in the Genus database with same CATH topology
 1STY A;  2Z6B A;  4QIW E;  3J80 i;  1F9S A;  3CRL C;  1G29 1;  2N88 A;  1HZA A;  3UDF A;  1IBK Q;  4R9W A;  4BWG B;  1WFQ A;  3ULL A;  1VQM A;  4OO1 G;  2F0W A;  1PH9 A;  5IGB A;  5K5P A;  2O5I C;  4QQB X;  3Q8D A;  1HHV A;  2O2L D;  4U67 3;  2YTY A;  4R4C A;  5FOB B;  1OXV A;  4DV2 Q;  3MWY W;  1PFM A;  4MN3 A;  2GA4 B;  4RMF A;  2HD3 A;  3J7A 5;  4BXX H;  3WOE A;  3PO2 G;  1R9T H;  3M4O B;  4RH6 A;  1KL9 A;  2JXM B;  2DJF C;  5EPL A;  4C3I B;  2C9O A;  1S5B D;  1CZW A;  1Z6H A;  1KDA A;  1GUT A;  1ASZ A;  2BE5 C;  2MPM A;  3B6Y A;  2ENB A;  1ENC A;  1ENA A;  5T1I A;  5IYB G;  1HTP A;  4KN4 C;  3D6C A;  4K0K Q;  2KCT A;  4A76 A;  1U4M A;  1EZ8 A;  1QJO A;  3DEO A;  3MXG A;  1I6H H;  3FRP B;  4JI8 Q;  5C5M A;  2BA1 A;  4IUT A;  4BY1 G;  5TSS A;  1ILQ A;  5FJ8 G;  3DWA A;  1J9O A;  2ID0 A;  1KTK A;  1X6O A;  4DR7 L;  1EY9 A;  3I72 A;  3J7Y W;  5M5W B;  1C8C A;  4LFA L;  2Q2U A;  1H9S B;  4G4K A;  4K6D A;  1S3O A;  4POG A;  3BJU A;  1DM0 B;  3SK8 A;  1C48 A;  2JYO A;  4O0A A;  3CF5 A;  3O13 A;  1EWH A;  2F0J A;  5I2Y A;  2KBN A;  3KLS A;  3S16 H;  2F0M A;  3F2C A;  2KEE A;  2WB1 E;  3DWP A;  2NWG A;  4IFD G;  2Q2T A;  3HOY B;  1I4P A;  4J8Q A;  2ES2 A;  1UE6 A;  3DHQ A;  1H95 A;  5IYC G;  4C3J H;  4DK0 A;  1U0L A;  3IKJ A;  1GUS A;  3FPU B;  5GAD C;  5CYU A;  4JI3 L;  1XX8 A;  3G48 A;  3VR4 A;  4ZKB B;  1YNN C;  1OTC A;  4XXE A;  4IPH A;  3SEB A;  4JI5 Q;  5E4X A;  4B3R Q;  2VXW A;  5LMU Q;  2E76 C;  3PGZ A;  3CCE A;  3X3N A;  1SE2 A;  5ISR A;  3S1R B;  1YJ9 A;  1KD1 C;  3QO2 A;  3ERQ A;  2WB1 G;  2E2H B;  4JBM A;  4Y52 H;  5GRO A;  3J81 i;  4RCO A;  3F2U A;  5E1F A;  2ZXO A;  2JA8 B;  3DEP A;  4L5Q A;  4X62 Q;  4E6I A;  3PUW A;  2B2T C;  1IBM Q;  1F2L A;  1YHA A;  4CJ1 B;  2DUD A;  1IYV A;  1C9O A;  4H7B A;  2IX1 A;  3GTQ B;  1CKN A;  5IOD A;  2XWB B;  1EY8 A;  2XIW A;  3E9H A;  4DAY A;  3S2H H;  1MSH A;  4FYD A;  4IUQ A;  4C2M B;  2X69 A;  2H4O A;  4FF3 A;  1SRU A;  2K6A A;  4QB4 A;  1D1K A;  4ZRZ A;  1E24 A;  5CV4 A;  2E75 C;  5DNF A;  1PZJ D;  1BR9 A;  3IAY A;  4GNX B;  2R61 A;  2HCI A;  1YHQ A;  1PFS A;  2HHH Q;  2NZH A;  5KGU A;  1TWA B;  4TQU S;  3A54 A;  2JA5 B;  3BYT B;  3TP7 A;  5IY0 A;  2PI2 A;  3HOU H;  3CCL A;  1T5X D;  3D8G A;  1GUW A;  3I4M G;  3GTK B;  1LTS D;  3VYU A;  1XPO A;  1PRT D;  5CR3 A;  3RLF A;  3TSS A;  4ZYS A;  5I4D A;  3ND8 A;  4JI3 Q;  2LSS A;  1FNW A;  4XQN A;  4DV0 Q;  5KNB A;  1V43 A;  1PYW D;  1WOC A;  3QG1 A;  4A3E H;  2R93 H;  4O1N A;  3ZYY X;  4DR4 Q;  4S3S A;  3ONA B;  1HCZ A;  2NN6 G;  2EYP A;  4RKL A;  2EJF C;  1ET9 A;  5LMN L;  1SDF A;  1TY2 A;  1E7Z A;  2D5D A;  5C44 G;  2C5C A;  4XT1 B;  4GNX C;  4KY5 A;  4PZ7 A;  1H9J A;  1R9T B;  1N34 Q;  3E5S A;  5CV7 A;  4A4I A;  2AMC B;  3NEM A;  4F88 A;  5IP9 H;  4A3M G;  3JAM c;  4NP5 A;  2D0P A;  3KF8 A;  1VQG A;  2R92 H;  2ICE C;  1DZ1 A;  4LF9 L;  2RHQ B;  2B2T A;  5M5X B;  1TS4 A;  4Q0F A;  5EBC A;  5G3L D;  4U68 A;  1LTG D;  5DM7 3;  1ROD A;  4LFC L;  2SEB D;  4DKA C;  2O4X A;  1LUZ A;  1GJX A;  2A68 D;  3M4Q A;  2Z4H A;  2HIV A;  2Z6K A;  4Z9C B;  1IBL L;  1KIX A;  1S40 A;  2A6E D;  5GAE C;  3VR2 A;  2PZU A;  4FVM A;  3J7A F;  1Y14 B;  2F0K A;  3NTI A;  5CGK A;  1BF4 A;  2GVB A;  2D62 A;  4PV1 C;  5NUC A;  1WTQ A;  3NBI A;  1PH4 A;  1B1Z A;  5JJL A;  1PH3 A;  1LT6 D;  1QWY A;  3BVM A;  4DNI A;  4I7A A;  2XN9 C;  4OGQ C;  4NXM L;  2EJG C;  2WP8 J;  4KK7 A;  2N49 A;  1K28 A;  4JI7 Q;  3KLS X;  5FK9 C;  1ZEQ X;  3BVG A;  4JI0 L;  3S16 B;  4BXX G;  3KBX A;  4UDU C;  3H0G B;  3K80 C;  1TWF H;  3A56 A;  1C4Q A;  1CQF A;  3DM1 A;  5KRU A;  4IUP A;  3GTO H;  2GVA A;  3GV6 A;  1Y8P B;  1IW7 C;  1G6Z A;  1E2W A;  4PZ6 A;  2VZA A;  4A3C G;  2D0O A;  2IX0 A;  5D14 A;  2CW0 C;  4IJH A;  5COY A;  4APV A;  2C35 B;  4V19 0;  1U4L A;  3S1N B;  2MFI A;  1STN A;  4L5R C;  2BE5 D;  2KCM A;  3S9W A;  2RCN A;  1ML0 D;  3AFP A;  3R2I A;  3PF5 A;  2R6G A;  1JC7 A;  3PO3 H;  3TP6 A;  3EQL C;  1L2F A;  3CME A;  3GTG H;  4QJF A;  4BBS H;  1CTM A;  2UU9 L;  5IWA Q;  2R7D A;  4A3J B;  2DGY A;  2NZ1 D;  2VS1 A;  1HFG A;  1M1K C;  1OXS C;  1KAW A;  3UDG A;  3A55 A;  2KEN A;  3K0X A;  3P1H A;  1EQT A;  1WJJ A;  4P74 A;  2VUM H;  5ELF A;  3SE0 A;  1BUV T;  1LAB A;  1O80 A;  4C3J G;  3VR3 A;  4L5T A;  4A93 H;  4KI0 A;  2B29 A;  2UXD L;  4ZUI A;  1PH7 A;  2RVL A;  4X3T A;  3M4P A;  4LF5 Q;  4IFD J;  2HIX A;  2F03 A;  4JI0 Q;  2QF7 A;  1MJC A;  2FIN B;  4MHE A;  2IJ0 A;  1KDB A;  4IO9 A;  2ICI A;  4H02 A;  1SNC A;  2JA7 H;  1BNZ A;  2KVM A;  2OQ0 A;  3HOZ H;  3E6Z X;  1YNN D;  1JJC B;  3OYY A;  4A3G B;  1H9K A;  4LUV A;  4GZY C;  3BZK A;  4HJA A;  3KF6 B;  4OX9 L;  3K59 A;  3HOV H;  2OWO A;  2WKD A;  1A3T A;  1AEX A;  1WTR A;  3MXU A;  3C46 A;  1RIP A;  4PMW A;  5FLX E;  3H6M A;  5C3E B;  4JOI A;  1Q86 C;  3L7Z C;  3CD6 A;  2CHB D;  3GTM H;  4IFD I;  1PH8 A;  1GO3 E;  4DR6 L;  4A3E B;  2J0T D;  2R93 B;  1UUP A;  3NWS A;  3CCS A;  2WV6 D;  3PQI A;  3SK6 A;  4ZK9 B;  3FKI B;  4V0B A;  1XNR Q;  2B2Y C;  4P72 A;  1VQN A;  4NB3 A;  3T1Y Q;  1C0A A;  3PUX A;  4J6H A;  3D4R A;  3D6W A;  1E0B A;  1N8R C;  1MD2 D;  3IFT A;  1TS2 A;  3HOU G;  4DR3 Q;  4XYO A;  1S4Z A;  4RGO S;  5I6W A;  2R92 B;  2YV5 A;  2PO4 A;  2YTV A;  4IUR A;  2K5H A;  3Q22 A;  1F9Q A;  2Z1C A;  4XTC S;  1XPR A;  1LTL A;  2QA4 A;  2E2I H;  1GKH A;  1X3P A;  1JOR A;  4Y7N H;  2AQ2 B;  1B9N A;  1TXY A;  1TR5 A;  4UY8 C;  1MGS A;  2CQO A;  1KNE A;  1PTO C;  2B2U C;  4C56 C;  2IPK D;  1HZ9 A;  2K75 A;  4IJL A;  4ZAI A;  4A3E G;  1SYB A;  1K73 C;  3C2P A;  4J15 A;  2R93 G;  1GHJ A;  3M4O H;  1W6J A;  1NJI C;  3CMA A;  4K5V A;  1FGU A;  1JIC A;  5JJK A;  4P73 A;  3FVQ A;  2B8F A;  2RDG A;  2RHS B;  4DK1 A;  1SN8 A;  4CDC C;  4X65 Q;  1CI3 M;  3AU7 A;  2AKW B;  1TWF B;  2ALY B;  3H15 A;  2R7F A;  3I56 A;  1SYG A;  5IP9 G;  2Q8R E;  4XIG S;  1ICW A;  2EZV A;  4DR6 Q;  5DLQ E;  2R92 G;  1UEB A;  3J80 L;  4DN4 M;  1EY4 A;  3SK5 A;  3FMC A;  2GN5 A;  2K04 A;  2L5T A;  2XNA C;  4DR5 Q;  1BQQ T;  2IT1 A;  4ZLT F;  4G7Z C;  2A69 C;  1KC8 C;  1I94 Q;  4LF8 Q;  3GP7 A;  3BG3 A;  2R7Z B;  3K5N A;  2Z0S A;  4X3U A;  1STG A;  2IY5 B;  4I65 A;  3OWE B;  3I90 A;  1DYQ A;  1RDP D;  4DUZ L;  1HNZ L;  4KD4 A;  3GTG B;  2F3I A;  2B8G A;  1O7Y A;  2PNR C;  3HG9 A;  2VQE Q;  5JPM C;  2SOB A;  4ALP A;  3HOY H;  3E3X A;  2UUC L;  1E22 A;  4KLK A;  2OCE A;  2I5M X;  1F2M A;  5GAG C;  3I3C A;  3HP3 A;  3OWF A;  4KN7 C;  2Q2I A;  1L0X B;  3G6J B;  3NK9 A;  3G4S A;  4JI4 Q;  1LTB D;  3AQQ A;  3VA7 A;  1IBK L;  1D8L A;  1NSN S;  2VNU D;  1YVC A;  1STH A;  3AB9 A;  3MFY A;  4ABN A;  4A93 B;  3K58 A;  2NYZ D;  5M5Y B;  2EXZ A;  4DV7 Q;  4A3F G;  3S1R H;  4ME3 A;  4DV2 L;  1XPU A;  2RSO A;  3LX0 A;  1SJH D;  1VQI A;  3TZU A;  2K1B A;  1B44 D;  1IW7 D;  2JA8 H;  4FF4 A;  2CW0 D;  3PO3 G;  4JV5 Q;  3AYH B;  2X6L A;  1EFI D;  1D6E C;  1SR3 A;  2CQA A;  3GTQ H;  1PH2 A;  3K0Y A;  4BBS G;  1G51 A;  2PMZ B;  1EY7 A;  4K5X A;  1MBY A;  5J39 A;  3HOW B;  3MHB A;  4K0K L;  4YWM A;  2CVR A;  4R1J A;  2FMM A;  1CSQ A;  1Y8N B;  2UXC Q;  5EGT A;  1HXY D;  4JI8 L;  2NVT B;  2V4D A;  2NUC A;  1NMG A;  4DAM A;  2QKI C;  1HJP A;  1QVG A;  5EKK A;  5ELD A;  3UDI A;  5IT9 E;  1A3V A;  4OHJ A;  4RG1 A;  1SSO A;  1K0S A;  2JEA I;  4F7X A;  4CJ0 B;  2VUM G;  1TWA H;  2L55 A;  1S5C D;  3G7L A;  2JA5 H;  1SBB B;  1A2T A;  3EIV A;  4A93 G;  5FO9 B;  3IL8 A;  1PYB A;  3D4D A;  1CKN B;  2KQ3 A;  4DAY B;  1AZQ A;  1EEI D;  3J81 L;  2Z8L A;  1EFW A;  1A6X A;  4HJ8 A;  1B3Q A;  1RTO A;  1E2Z A;  5GAH C;  1WYD A;  3HOZ G;  2KHI A;  2JA7 G;  2L0C A;  3KDF A;  4HCE A;  3HOV G;  3F8T A;  2E2I B;  2F0G A;  1NR4 A;  3P7J A;  4A3D B;  3S2D H;  5AFW A;  2NVX B;  4GKK Q;  1EUJ A;  2Z4I A;  4Y7N B;  5GQO A;  4JI6 Q;  4PNY A;  2LXJ A;  1UEA B;  3FHW A;  4JI5 L;  4B3R L;  5LMU L;  3CPF A;  5A2Q E;  3E0J A;  3MA2 B;  3EBE A;  1Y1V H;  1GUN A;  2KHJ A;  1HR0 W;  2FXQ A;  3AMU A;  1X3G A;  1FVI A;  1U5K A;  3LWE A;  2K32 A;  2PI2 E;  1PH1 A;  4CKE A;  3HEJ A;  4R8I A;  4JBJ A;  5M5X H;  4X62 L;  1SYC A;  1IBM L;  1SYE A;  5C0X H;  1K0R A;  2LFN A;  3TS2 A;  3PIO 3;  1T5E A;  2FFK B;  3PMF A;  2D9U A;  1B3A A;  1JB7 A;  1N32 L;  4P75 A;  5JJZ A;  2ASB A;  1ZYR C;  1I4G A;  1DGS A;  4LWC A;  1VS0 A;  4WJ3 M;  2UUB L;  1ZXT A;  1CA5 A;  2EXD A;  3PF4 A;  5J3B A;  1KNA A;  5ELO A;  4X66 Q;  2RQX A;  3HGB A;  4CHT B;  4HID A;  2G9D A;  1YNJ C;  3KF8 B;  5IP7 H;  4YY3 Q;  1D5Z C;  2HHH L;  4NMZ A;  4GLV B;  3RUZ A;  1EOV A;  4GKJ Q;  3TZD A;  4LUZ A;  3MTS A;  1NAP A;  3EN2 A;  3H0G H;  2QIL A;  5BR8 L;  2HDL A;  1XTC D;  4C3I G;  5D3I B;  4DK6 C;  1PTO D;  4JPB W;  2ZTE A;  2I0Q A;  1V9P A;  1Q12 A;  1K8A C;  5JVH 3;  1NE3 A;  1AN8 A;  1PV4 A;  1EYD A;  5EPK A;  4C3H B;  3U4Z A;  1RF2 D;  1S72 A;  2QEJ C;  2IWH A;  1HZC A;  3DMU A;  3GO5 A;  1QNU A;  3RLN A;  3D4W A;  3UI2 A;  4DV0 L;  3S1N H;  3MEH A;  3GTP H;  5EKI A;  2FMC A;  3HZX A;  1EU4 A;  1PFB A;  5I2X A;  4HJ9 A;  1LV9 A;  3KK7 A;  4JBW A;  4DR4 L;  1TWG H;  1K8O A;  2Z9H A;  1CKM A;  2UUA Q;  1QG7 A;  3GD7 A;  3I2Z A;  1X32 A;  2M00 A;  1BCP B;  4LUO A;  2F0U A;  5DEH A;  1HTL D;  3M9B A;  4NXN L;  4JK1 C;  3OTO L;  4A3J H;  3JAM E;  1CM9 A;  2EYL A;  3P75 A;  1N34 L;  1B4O A;  2PQA A;  5C4J H;  3HFZ B;  1RHP A;  4MTK A;  4DV6 Q;  1EIF A;  5C3X A;  5J1Z A;  1D7Q A;  1VQF A;  2A69 D;  4KJO A;  2K4K A;  5C5L A;  1Q1E A;  1N32 Q;  1IYJ B;  2A73 B;  4CKC A;  1VQJ A;  1YEZ A;  1O7I A;  1JOQ A;  3PUZ A;  3HOY G;  2Z6K C;  2UUB Q;  1L0Y B;  2H5X A;  3BZC A;  1MJE A;  3T53 B;  1JE5 A;  4OEL B;  1BKB A;  3DUZ A;  2HCC A;  1J6Q A;  2QCP X;  2QEX A;  4CDF C;  1SYD A;  2TMP A;  5CMD A;  4EQP A;  2A6H C;  4EQO A;  4MTN A;  4O42 A;  3K5O A;  3KUP A;  1TS3 A;  4K6L A;  4AIM A;  2F4V Q;  5CV5 A;  4LFB L;  3RD4 A;  5BR8 Q;  3DWQ A;  1BCP C;  2TSS A;  2CH4 A;  1IKL A;  1FJG Q;  4A3G H;  4JI7 L;  1ENF A;  2ZXR A;  3U58 A;  3SVM A;  5HY6 A;  2JA8 G;  5JJI A;  3V2T A;  3RN5 A;  1PH6 A;  3CCR A;  3DLL A;  2LMC B;  5K36 H;  2OXP A;  5AJ3 L;  1KDC A;  5C3E H;  3T16 A;  5LL6 S;  1PTO H;  3CAM A;  2MHV A;  4BA1 I;  3S2D B;  4L5S A;  1N9W A;  3FKI H;  2AQ3 B;  1QUQ A;  1Q8I A;  4DPG A;  4NKL A;  4QUF A;  1XMQ Q;  1RCV D;  4RHS A;  4YCU A;  3CXC A;  2EOT A;  3ITP A;  4A3K H;  4NXN Q;  3OTO Q;  1WCM H;  3A8J E;  4LW1 A;  1Y1V B;  2F0F A;  1QZH A;  1GVP A;  4HJ7 A;  5FO7 B;  3TBI B;  3F2D A;  2JA5 G;  1EY0 A;  5IWA L;  1YI2 A;  5EQ0 A;  4UP7 A;  4KV6 A;  2DY7 A;  2JEB I;  5D3D A;  4B9W A;  1VQD A;  1P16 A;  1EY6 A;  4GOP A;  1UE5 A;  5COR A;  1G2T A;  4BA2 I;  1A3U A;  4PZ8 A;  5JAV A;  1H9M A;  4HMI A;  1X54 A;  3MXN A;  2HQE A;  3CCU A;  1K3B C;  4CDE C;  1QCB D;  4QCL A;  2RDH A;  5IT9 L;  2IHE A;  3TP5 A;  1NY4 A;  4LFB Q;  4DNR B;  4YIJ A;  3URY A;  5ELN A;  4LF5 L;  2WIN B;  5HUR A;  2I5L X;  3EVQ A;  3SXH A;  1LM0 A;  3S17 H;  3VYS A;  1G2S A;  2K7V A;  3A8K E;  5AJ3 Q;  3TS0 A;  3D3R A;  1U9R A;  4RGN A;  4GN4 B;  4JOI C;  4RGT A;  2B63 B;  5M3M B;  4IOA A;  4DR2 Q;  2L11 A;  1Q8K A;  3ICE A;  3FP9 A;  5KYI A;  3LGJ A;  3GTP B;  4YHH Q;  1B50 A;  4R4Q A;  4EGV A;  2R7Z H;  4KHV A;  3DXJ C;  2IX3 A;  3HKZ B;  1EOT A;  4KKU A;  1TWG B;  4IAL A;  2MJ8 A;  1IKM A;  1XNR L;  2B39 A;  3J80 c;  3CQZ H;  3IRB A;  2F0I A;  2UXB Q;  3T1Y L;  4MNO A;  4B3S Q;  5C4X H;  5IP7 G;  1ZYR D;  1LT3 D;  2H1E A;  3HKZ E;  5C4J B;  4WRD A;  1LTI D;  1TT2 A;  1L0W A;  1EIH A;  2KUM A;  5JPN C;  4CGY B;  1VF7 A;  4DR3 L;  1KAB A;  1EQQ A;  3I4L A;  4TVA B;  5FLM H;  1O7Z A;  5I6Y A;  3H0G G;  1YNJ D;  1KQS A;  1PRT F;  1IXR A;  4DV4 Q;  4FF1 A;  4KY6 A;  2VY3 A;  1KRS A;  4A3B B;  4DV3 Q;  1TWH B;  1PZI D;  4AYB B;  4P2C B;  1NNX A;  4KD3 A;  2KEC A;  4DXF A;  1HH2 P;  2JA6 H;  1YJW A;  3S1Q B;  1W3S A;  4B3M Q;  4K2K A;  5M5Y H;  1QOH A;  1I4Q A;  2EYM A;  1XXG A;  3OW7 A;  4LF7 Q;  5IYD H;  5KND A;  4YCV A;  1A8V A;  3NWT A;  2Y0S B;  1R4P B;  3OMG A;  1Q81 C;  4IQZ A;  3MXP A;  4JG2 A;  5E7N A;  4PQX A;  1GOZ A;  4PMC A;  3GDE A;  3A8I E;  2ZXP A;  1QE6 A;  1TU2 B;  1PA6 A;  3PUV A;  2ZJP A;  1YIJ A;  2DJG C;  1B53 A;  1WTO A;  3KFU A;  3EFX D;  4K14 A;  5EKL A;  4X65 L;  4FP5 D;  4A3J G;  3HOW H;  3OIP A;  1I50 B;  1SLJ A;  1HNW Q;  4OWX B;  4DUY Q;  1K83 H;  1FR3 A;  3V05 A;  1PTO B;  2NVT H;  3IFD A;  5G3L F;  3S15 B;  3A7A B;  3PCO B;  1HNX Q;  1V8Q A;  5EPJ A;  1J5E L;  2EYJ A;  3NEN A;  5IGE A;  1VQO A;  4R4O A;  4DR5 L;  1YHB A;  5JVG 3;  1D5M C;  1I94 L;  1Q46 A;  4LF8 L;  4CKB A;  1BO0 A;  1UE7 A;  2JA9 A;  4JW0 A;  1DOK A;  1JWS D;  3K57 A;  1LT5 D;  3H09 A;  4A3K B;  2K14 A;  1WCM B;  1TII D;  4XQJ A;  3VR5 A;  1SRO A;  1PYS B;  1XWE A;  4KHP Q;  4DGZ A;  2VQE L;  4HMJ A;  4OWW B;  4LF6 Q;  1N36 L;  1CK1 A;  1SNO A;  3UE1 A;  1UAP A;  3W2D A;  2G5D A;  4A3G G;  2A6H D;  1W6K A;  1E2V A;  2A1A A;  4QL5 A;  3I4N H;  4A3D H;  4ZQ3 A;  3J81 c;  2NVX H;  3H3V C;  3CHB D;  4JI4 L;  5K36 G;  1BCP D;  1OXU A;  1Q7Y C;  5LHY 1;  1Q82 C;  5C4H A;  4OWT B;  5C3E G;  1EWI A;  1F2Z A;  4OEM B;  2NVY H;  3HKS A;  4XT3 B;  2F0T A;  2ZJR A;  1L1O A;  1V1O A;  1OXX K;  2OT2 A;  1SE8 A;  2B2V A;  2EY5 A;  3FKI G;  4UAI A;  3MFG A;  4DV7 L;  2DN8 A;  1ASY A;  2JN4 A;  3RLO A;  3OW2 A;  4BY7 H;  1EU3 A;  1KLG D;  4EQ5 A;  4FNF A;  4DV1 Q;  4A3K G;  1EY5 A;  3KDF B;  1WCM G;  3MZ5 A;  5E4W C;  5LL6 X;  4OXP A;  1W2B A;  3S17 B;  1HQM C;  3K7U C;  4JV5 L;  2MO0 A;  4DFA A;  1DJR D;  1HA6 A;  1XJV A;  1G8Z D;  1KHI A;  1CSP A;  1SNQ A;  4HR7 B;  4IPD A;  1J5E Q;  3I7F A;  2CCZ A;  1WTX A;  2K52 A;  4NW2 A;  1EQV A;  3F1Z A;  2UXC L;  4FO2 A;  4YWK A;  1YBY A;  2ZM6 Q;  5EJW A;  3K8A A;  1JCK B;  2CFM A;  1CFM A;  1VQ5 A;  2VW9 A;  1UWV A;  3OIQ A;  3R2T A;  1XNQ Q;  2N78 A;  2WAQ B;  4F8M A;  3CQZ B;  4PMB A;  2BDO A;  3TEH B;  2E5L Q;  1MSG A;  2N8N A;  3V96 A;  1JMC A;  1T9H A;  2HT1 A;  1SEB D;  2AWO A;  2XRS D;  5C4X B;  2F0P A;  1CHQ D;  1N36 Q;  1F77 A;  1ONL A;  1JQY D;  3NUC A;  4HIM A;  4C3H H;  4H13 C;  5JEA H;  2NTT A;  4NPS A;  4IUU A;  4X64 Q;  4A3I H;  4H0L C;  2OTJ A;  2B3G A;  2KJX A;  5KIX A;  3NQI A;  2MGS A;  3NP8 A;  1J8I A;  1WTH A;  4XDX A;  3TDQ A;  2LXK A;  2JA6 B;  5BN5 A;  4GKK L;  2WKC A;  1V1P A;  4JI6 L;  5C6A A;  1BBX C;  5T1G A;  1P8L A;  1S5F D;  3AEV A;  4QUC A;  3HOX B;  3ULJ A;  4A3L H;  4ZCK A;  2R7Z G;  1LTA D;  4JI2 Q;  5M9O A;  4R8N A;  1GUO A;  2PZT A;  4RGM A;  4DK3 C;  1HUM A;  3JAM i;  3D0F A;  4HSV A;  4MIU A;  1I6V C;  2NB0 A;  1KAA A;  1D2B A;  1JT8 A;  1Y8O B;  2IW3 A;  1QVC A;  5CBE E;  1SFO B;  1K8G A;  1CT1 D;  1I4X A;  4KMU C;  2DNC A;  2F0S A;  1EQR A;  5HGQ A;  4FXG C;  1IL2 A;  5IGF A;  1V1Q A;  5J22 A;  1JR0 D;  5C4X G;  5EAY A;  4XYQ A;  1AW7 A;  1LAC A;  5KYL A;  1K83 B;  1GHK A;  4TRD A;  1VMP A;  4AQY Q;  2VQF Q;  5FLM G;  3OPO A;  1SYF A;  1LTR D;  4KKS A;  2PPB C;  2PMZ E;  3WDN A;  3RNU A;  4AH6 A;  3NXW A;  5DAU A;  4G57 A;  4WOR A;  2Q8T A;  2PQA B;  3W1B A;  1BBW A;  4X66 L;  5C0X I;  1GD7 A;  3VR6 A;  5ELB A;  4EX5 A;  2HQL A;  2KCC A;  2OQK A;  4YY3 L;  1BDO A;  5C44 H;  4DR1 Q;  4X6A H;  4N8X 1;  5IYD G;  4GKJ L;  4HN7 A;  1JWU D;  4OON A;  5KEE A;  1B8A A;  3PO2 B;  3OHX C;  1ILP A;  5CC4 A;  3UDX A;  3G6E A;  1FL0 A;  3U50 C;  2ZT9 C;  1VQC A;  4RA8 A;  4HAE A;  5BN3 A;  3AFQ A;  3Q0A A;  2QDB A;  2A68 C;  2I07 B;  3I4N B;  2XRQ D;  1N33 Q;  1G91 A;  4F87 A;  3HOW G;  1O78 A;  4DV5 L;  2YU9 B;  2IL8 A;  5C4Z A;  3SHL A;  2EY6 A;  4JVZ A;  4BY1 B;  2VL6 A;  1LLR D;  2NVY B;  1SJE D;  1II3 A;  1C7Y A;  4HIK A;  2F4I A;  1DXM A;  2UUA L;  2RDF A;  1IHZ A;  4ZUJ A;  3NE5 B;  5IOC A;  2PCF B;  4BY7 B;  1IZ6 A;  2K5D A;  1PFN A;  3M7G A;  2ZTD A;  2K5W A;  2N3S A;  3BYY B;  3EA6 A;  2L4N A;  4CDD C;  4DV6 L;  3T1H L;  5C3W A;  1QUQ B;  1SE4 A;  1JJ2 A;  2WII B;  2LY7 A;  3A5U A;  3I91 A;  4JYA Q;  4UPA A;  5CV8 A;  5FLX L;  2OTL A;  2I5H A;  1WVL A;  3K5L A;  1HQR D;  3Q24 A;  4M8A A;  3I4N G;  1Q90 A;  1RTN A;  4IOC A;  4A3D G;  4A3C H;  1B7Y B;  2AUK A;  2A74 C;  2KOL A;  2F0E A;  1D5X C;  3TRZ A;  3JC6 6;  4ODG A;  4ILW A;  4N8F A;  3QR8 A;  4C1N K;  2EY1 A;  3N52 A;  1X65 A;  1VMC A;  2F4V L;  3NEL A;  4GOP B;  1Q1B A;  5LMN W;  4RFB A;  1F2Y A;  4A75 A;  2EJM A;  1LYL A;  4JI1 Q;  1A2U A;  5IT9 c;  1FJG L;  4UHV A;  2WB1 B;  4HSP A;  4BY7 G;  3NBH A;  3MC0 B;  2MP1 A;  3CC2 A;  1CUK A;  2F0H A;  2B63 H;  5M3M H;  1VQA A;  3MXN B;  3T56 B;  1ET6 A;  1JOK A;  4A3I B;  3QIA A;  4DV5 Q;  2QW7 A;  2MNA A;  1FNV A;  1LT4 D;  2YTX A;  3A0J A;  3STB C;  1SMY C;  4GN5 A;  4LMQ D;  4R4T A;  3K7A B;  1LO5 D;  3OSO A;  4G7O C;  2HDM A;  4K8I A;  2NVQ B;  3LWU A;  4KTA A;  1X3Q A;  1HPC A;  1UNS A;  1XMQ L;  5M3F H;  1QZG A;  4ZKC B;  1S5D D;  4DXG A;  1TQO A;  3H3V I;  1PVO A;  4KHZ A;  4L8J A;  2AQ1 B;  4HJ5 A;  4G7H C;  1YIT A;  3A5Z B;  4B08 A;  1PZK D;  2DNE A;  5IGC A;  1SMX A;  3T1H Q;  3L3O C;  2F52 A;  3ND9 A;  3RMH A;  1TKW B;  1I4H A;  4GOP C;  3I55 A;  4TKO B;  3GV3 A;  4LK1 C;  3A74 A;  1HZB A;  3I4M B;  5DM6 3;  4A3B H;  5HGT A;  2VB2 X;  1TWH H;  3X3M A;  5H1S E;  3RZD H;  2K5V A;  2RKS A;  3CCJ A;  2Q8I B;  4C3H G;  5JEA G;  1H9R A;  3S1Q H;  1VQP A;  4GS3 A;  3Q23 A;  4A3I G;  2ZJQ A;  1AZP A;  3S14 H;  1FYC A;  3HRZ C;  4JC0 A;  4L6T B;  3L2P A;  2NZO A;  4IPC A;  1WD1 A;  2YYZ A;  4MZ9 A;  3BU2 A;  1VQH A;  3J7A V;  4DR7 Q;  3OOC A;  2K01 A;  3WOF A;  3CPW A;  1IL8 A;  1HR0 L;  5C44 B;  4LJZ C;  1X3F A;  4LFA Q;  1EIG A;  1BVS A;  2B2W C;  4A3L G;  4IUN A;  1HFN A;  4LF4 L;  2CH4 W;  1M90 C;  4A3M B;  3C1E A;  4KJN A;  3QOL A;  4DAV A;  2WAC A;  3RZO H;  1I50 H;  3H3V H;  1F9P A;  1YJN A;  2SNM A;  1SXT A;  1X9N A;  3S15 H;  4PG3 A;  3H94 A;  1OO9 B;  1CQV A;  3P20 A;  2PQE A;  4DR2 L;  2K33 A;  1I3Q H;  2EE1 A;  3FDT A;  3GQB A;  2K5Q A;  3R3O A;  4YHH L;  3A7L A;  1TWC H;  4OL7 A;  1MIU A;  3J80 E;  4IPG A;  4FXD A;  4RCN A;  3NQT A;  1NCV A;  2UXB L;  4YWL A;  1TS5 A;  2F0Q A;  3S1M H;  1STB A;  2D2C C;  1WTP A;  1G6P A;  2KCN A;  1HRJ A;  4B3S L;  2RA4 A;  4ID6 A;  1ESF A;  1GXD C;  3L0O A;  1FD7 D;  2BCO A;  3EJI A;  1PMR A;  3TP8 A;  1A63 A;  1PTO F;  4BBR H;  1EYA A;  1H9S A;  2Q2H A;  2KHS A;  3NPP A;  4DV4 L;  3L9A X;  3K6O A;  4CBV A;  4DV3 L;  1WTV A;  3GTJ H;  3BS1 A;  4IUV A;  3CKI B;  1UE1 A;  1R4Q B;  4EQN A;  4B3M L;  5FKA C;  3RN2 A;  3E0E A;  2M9V A;  1HR0 Q;  4LF7 L;  1VQ4 A;  1I6H B;  1WI5 A;  1VDZ A;  3W5O A;  2PNH A;  3W3A A;  2WFW A;  4LF4 Q;  3HS0 C;  1EYC A;  1Y1V G;  3M4Y A;  2A5H A;  2F3V A;  2K03 A;  2JE6 I;  2B2W A;  2EYH A;  3KBG A;  3I73 A;  2VB3 X;  1XYI A;  2RBM A;  3T4A C;  1SAP A;  4M1U B;  4K5W A;  1QB5 D;  1X56 A;  2MUY A;  2JP1 A;  2F0L A;  3MVV A;  1CHP D;  5IGD A;  2XWJ B;  2HUG A;  2E2D C;  1CZG A;  4BS9 A;  1Y1W H;  5FO8 B;  1HNW L;  4OIJ A;  4DUY L;  1L1O B;  4K2L A;  4C1N I;  5C0X G;  2XVS A;  3C3L A;  2RSN A;  3NTK A;  2BDN A;  1HNX L;  2KED A;  3VYR A;  2JQO A;  1MKH A;  3NSW A;  2M2L A;  3PV0 A;  4UP8 A;  3TRE A;  2F0D A;  3U4V A;  4N9P A;  1DON A;  3BDO A;  3KLR A;  4QF4 A;  1VQL A;  1PLF A;  5M3F B;  4C3J B;  1NTG A;  2K5N A;  5A2Q L;  3RR5 A;  2E2J H;  3U9S A;  1MHW C;  1BBU A;  4A3F H;  5LMN Q;  2BA0 A;  1SNM A;  2PW7 A;  2BH2 A;  2MQH A;  4H44 C;  2QGQ A;  4KKT A;  4B3T L;  4RKB A;  4KHP L;  4TSS A;  4QY7 A;  4YCW A;  4OO1 I;  2A8V A;  2F0V A;  1AE3 A;  1D1I A;  3I70 A;  5CV6 A;  4RHR A;  3T51 B;  4LF6 L;  1YZ6 A;  3PIP A;  3VA5 A;  4LNQ A;  3S24 A;  4GNX A;  3J81 E;  1M4V A;  1RL2 A;  2L9H A;  3RZD B;  2KA7 A;  4LF9 Q;  3NHH A;  2B63 G;  1S5E D;  5IGG A;  5M3M G;  3M7N A;  1NBW A;  1GM5 A;  1L1O C;  3M3Y H;  2B2V C;  3S14 B;  3HOX H;  4LFC Q;  2XSC A;  4QGU A;  2AWN A;  3N6R A;  3BVZ A;  2QDL A;  1VQ9 A;  1IYU A;  2LS0 1;  3CW2 C;  3QOJ A;  3S2H B;  3HKZ G;  4AYB E;  2J4X A;  3FPP A;  1IBL Q;  3Q6S A;  4P71 A;  1FGB D;  3KLW A;  4KY7 A;  1SFO H;  5M3F G;  2DY8 A;  3STB D;  1SMY D;  3ERO A;  3CP0 A;  3SK4 A;  4DV1 L;  1GUG A;  1BOS A;  1Q3L A;  3ULP A;  1XTD A;  2Y0S E;  4I7Z C;  1DCZ A;  1VQ8 A;  3RZO B;  4NXM Q;  1A15 A;  1PXU A;  2G9H D;  3ERS X;  2BH8 A;  1V1P B;  3HOU B;  1U4R A;  3GTL H;  3M85 A;  4EVO A;  4X3S A;  1Z47 A;  2FHT A;  3CC7 A;  4N9T A;  1VQE A;  1Z9F A;  3C1F A;  3VYT A;  1I3Q B;  4LAA A;  5IIF A;  1NUC A;  4A3B G;  1XMO L;  2XGT A;  4OO1 H;  2ZTC A;  3BZD B;  4RAU C;  4AYB G;  5F2D A;  3TN2 A;  2ZM6 L;  3J7Z C;  2EVB A;  2A19 A;  1TWC B;  1HUN A;  4DA2 A;  1A0I A;  1XNQ L;  2PYK A;  3U9O A;  5D65 A;  3SDZ A;  4QMG A;  1KLU D;  2J7Z A;  1NR2 A;  5BN4 A;  3JAM L;  4B3T Q;  2V1C C;  1RD9 D;  3PO2 H;  3S1M B;  2Y0S G;  5ELC A;  2E5L L;  4HED A;  4CJ2 C;  3DM3 A;  2NBF A;  2AUJ D;  3QJY A;  1CA6 A;  5JEA J;  2F0N A;  4IZ8 A;  1A62 A;  2CWP A;  2UU9 Q;  2PW5 A;  4DAP A;  5IYB H;  4BBR B;  1DD2 A;  4X64 L;  1EEF D;  1K3R A;  2L12 A;  3ZJY C;  4R4I A;  2YU9 H;  3H91 A;  4HCS A;  4FXK C;  1CKO A;  3GTJ B;  4BY1 H;  5FJ8 H;  2X6G A;  3VDY A;  3NTH A;  3SGI A;  4GLX A;  3MAQ A;  3PUY A;  1STA A;  3E9I A;  4FDB A;  3K5M A;  4HTH A;  5I9O A;  2EYF A;  1EL0 A;  1VQB A;  1OXT A;  2I46 A;  1EYG A;  4L63 B;  4JI2 L;  5CBA E;  3BDL A;  2UXD Q;  2CKZ B;  2PZW A;  3KYH C;  2E8G A;  3PIO A;  5E3F A;  1U4P A;  4POF A;  2K05 A;  3PSI A;  1B70 B;  2SDF A;  3CRK C;  1KRT A;  5CV9 A;  4IFD H;  4C3I H;  1JE4 A;  3D31 A;  2RF4 A;  1Y1W B;  2EPB A;  5IYC H;  4GLA C;  1XMO Q;  4OX9 Q;  1JWM D;  3QB3 A;  4WJ4 A;  3KOJ A;  1AP0 A;  4AQY L;  1E3P A;  1SE3 A;  2K28 A;  1O7L A;  4BBR G;  2VQF L;  1DOL A;  1VQK A;  1BXT A;  4JCV E;  4Q5V A;  1ESR A;  1VQ6 A;  1F9R A;  3T13 A;  1KXL A;  3GTO B;  1X55 A;  2F1M A;  1TY0 A;  5FLX c;  1B2T A;  1PRT B;  4X3K A;  2E2J B;  3TQY A;  3R8B A;  2OF1 A;  4A3F B;  5M5W H;  4DR1 L;  2BOS A;  1PH5 A;  1AH9 A;  1NMF A;  1E1O A;  1VQ7 A;  2NTS A;  2WAQ E;  5L37 A;  2EDG A;  2FJ2 A;  3PO3 B;  1JJG A;  2IHF A;  2B2Y A;  2NN6 I;  4ULL A;  2EIF A;  4NDX A;  2RCF A;  1EIY B;  1SNP A;  4BBS B;  1JOO A;  1I5F A;  2JK8 A;  3K7A H;  1M8A A;  1I4R A;  1N33 L;  3R93 A;  2NVQ H;  1STE A;  4HIO A;  1ZKO A;  2R3Z A;  3I8Z A;  4J1M A;  4FF2 A;  5KNC A;  1K8M A;  4OIK A;  4UP9 A;  1Y1W G;  3M3Y B;  1QIL A;  3G71 A;  1QNK A;  2LKV A;  3WWV A;  1JB3 A;  3J81 j;  3TME A;  1WD0 A;  3KF6 A;  1K9M C;  3NBH B;  2E74 C;  2VUM B;  2WAQ G;  1MI2 A;  3LNN A;  3PIP 3;  1PRT C;  3CCV A;  1EZ6 A;  1SND A;  5ELE A;  5C0X J;  3ER0 A;  1LTT D;  3W1G A;  2O5J C;  2B2U A;  5JOB A;  4JBK A;  1QVF A;  1PDQ A;  3SR1 A;  3I4M H;  1EWC A;  2F0O A;  1HA5 A;  2E2H H;  3F2B A;  5IE8 A;  1ICF B;  3GTL B;  4ME5 A;  5A35 A;  2P5Z X;  3FEW X;  4GN3 B;  3KJO A;  1RKN A;  3BDC A;  1Z7T A;  4IN3 A;  3KJP A;  1Y69 U;  3HOZ B;  4JYA L;  2JA7 B;  3K81 C;  1E1T A;  2L1B A;  2ATW A;  4WFN 3;  2L15 A;  4K8J A;  1RJT A;  4RWS C;  3HOV B;  4O2D A;  1BCP F;  3CCM A;  2CWA A;  2NN6 H;  3CU7 A;  4C2M H;  2JA6 G;  1AFP A;  2JJQ A;  2JSO A;  3I4O A;  4DU9 A;  3HOX G;  3GTM B;  2K50 A;  2SNS A;  1VF5 C;  1VCI A;  1AE2 A;  1X3E A;  3UE0 A;  4A3M H;  4DUZ Q;  5I9P A;  1HNZ Q;  3CC4 A;  1DOM A;  4JI1 L;  3MEF A;  2EQS A;  4B9X A;  1WTW A;  4QIW B;  4XQQ A;  4DNT B;  1FNU A;  3CCQ A;  2AHO B;  3OMC A;  2F3W A;  2N55 A;  2EY2 A;  2XTI A;  2MO1 A;  1B9M A;  3QWN A;  1PHJ A;  2OEO A;  2A6E C;  2UUC Q;  4WJW A;  3GTK H;  5EBD A;  1YNX A;  2EYO A;  1TVX A;  4DF7 A; 
#chains in the Genus database with same CATH homology
 1STY A;  1F9S A;  3CRL C;  1G29 1;  2N88 A;  4R9W A;  4BWG B;  4OO1 G;  2F0W A;  5IGB A;  5K5P A;  2O5I C;  1HHV A;  2O2L D;  4U67 3;  5FOB B;  1OXV A;  3MWY W;  1PFM A;  4MN3 A;  2GA4 B;  3WOE A;  3M4O B;  4RH6 A;  2JXM B;  5EPL A;  4C3I B;  2C9O A;  1S5B D;  1CZW A;  1Z6H A;  1KDA A;  1GUT A;  2BE5 C;  2MPM A;  2ENB A;  1ENC A;  1ENA A;  5T1I A;  1HTP A;  4KN4 C;  3D6C A;  1U4M A;  1EZ8 A;  1QJO A;  3DEO A;  3MXG A;  3FRP B;  5C5M A;  2BA1 A;  4IUT A;  5TSS A;  1ILQ A;  3DWA A;  1J9O A;  2ID0 A;  1KTK A;  1EY9 A;  3I72 A;  3J7Y W;  5M5W B;  1C8C A;  1H9S B;  4G4K A;  4K6D A;  1DM0 B;  3SK8 A;  1C48 A;  2JYO A;  3O13 A;  1EWH A;  2F0J A;  5I2Y A;  3KLS A;  2F0M A;  2KEE A;  3DWP A;  2NWG A;  4IFD G;  3HOY B;  1I4P A;  4J8Q A;  3DHQ A;  4DK0 A;  3IKJ A;  1GUS A;  3FPU B;  5CYU A;  1XX8 A;  3VR4 A;  4ZKB B;  1YNN C;  4XXE A;  3SEB A;  5E4X A;  2VXW A;  2E76 C;  3X3N A;  1SE2 A;  5ISR A;  3S1R B;  3QO2 A;  3ERQ A;  2E2H B;  4RCO A;  3F2U A;  5E1F A;  2ZXO A;  2JA8 B;  3DEP A;  4E6I A;  3PUW A;  2B2T C;  1F2L A;  4CJ1 B;  1IYV A;  4H7B A;  2IX1 A;  3GTQ B;  5IOD A;  2XWB B;  1EY8 A;  2XIW A;  4DAY A;  1MSH A;  4FYD A;  4IUQ A;  4C2M B;  2X69 A;  2H4O A;  4FF3 A;  2K6A A;  4QB4 A;  1D1K A;  4ZRZ A;  5CV4 A;  2E75 C;  5DNF A;  1PZJ D;  1BR9 A;  3IAY A;  2R61 A;  2HCI A;  5KGU A;  1TWA B;  4TQU S;  3A54 A;  2JA5 B;  3BYT B;  3TP7 A;  1T5X D;  3D8G A;  1GUW A;  3GTK B;  1LTS D;  3VYU A;  1PRT D;  5CR3 A;  3RLF A;  3TSS A;  5I4D A;  4ZYS A;  3ND8 A;  1FNW A;  4XQN A;  5KNB A;  1V43 A;  1PYW D;  3QG1 A;  4O1N A;  3ZYY X;  4S3S A;  3ONA B;  1HCZ A;  2NN6 G;  2EYP A;  4RKL A;  2EJF C;  1ET9 A;  1SDF A;  1TY2 A;  2D5D A;  2C5C A;  4XT1 B;  4KY5 A;  1H9J A;  1R9T B;  3E5S A;  5CV7 A;  4F88 A;  4NP5 A;  3KF8 A;  2ICE C;  1DZ1 A;  2B2T A;  5M5X B;  1TS4 A;  4Q0F A;  5EBC A;  5G3L D;  4U68 A;  1LTG D;  5DM7 3;  1ROD A;  2SEB D;  2O4X A;  1GJX A;  2A68 D;  2Z4H A;  4Z9C B;  2A6E D;  3J7A F;  3VR2 A;  2PZU A;  4FVM A;  2F0K A;  3NTI A;  5CGK A;  1BF4 A;  4PV1 C;  2D62 A;  5NUC A;  1WTQ A;  3NBI A;  1B1Z A;  1LT6 D;  1QWY A;  3BVM A;  2XN9 C;  4OGQ C;  2EJG C;  2WP8 J;  4KK7 A;  3KLS X;  5FK9 C;  1ZEQ X;  3BVG A;  3S16 B;  3KBX A;  4UDU C;  3H0G B;  3A56 A;  1C4Q A;  1CQF A;  3DM1 A;  5KRU A;  4IUP A;  3GV6 A;  1Y8P B;  1IW7 C;  1G6Z A;  1E2W A;  5D14 A;  2IX0 A;  2CW0 C;  5COY A;  4V19 0;  1U4L A;  3S1N B;  1STN A;  2BE5 D;  3S9W A;  1ML0 D;  3R2I A;  2R6G A;  1JC7 A;  3TP6 A;  3EQL C;  1CTM A;  4A3J B;  2NZ1 D;  1HFG A;  1OXS C;  3A55 A;  3P1H A;  1EQT A;  5ELF A;  3SE0 A;  1BUV T;  1LAB A;  1O80 A;  4C3J G;  3VR3 A;  4KI0 A;  4ZUI A;  2RVL A;  4X3T A;  4IFD J;  2F03 A;  4MHE A;  2QF7 A;  2FIN B;  2IJ0 A;  1KDB A;  2ICI A;  1SNC A;  1BNZ A;  2KVM A;  3E6Z X;  1YNN D;  4A3G B;  1H9K A;  4GZY C;  3K59 A;  2WKD A;  1A3T A;  1AEX A;  1WTR A;  3MXU A;  3C46 A;  5FLX E;  4PMW A;  3H6M A;  5C3E B;  3L7Z C;  4IFD I;  2CHB D;  4A3E B;  2J0T D;  2R93 B;  1UUP A;  3NWS A;  2WV6 D;  3SK6 A;  4ZK9 B;  3FKI B;  4V0B A;  2B2Y C;  3PUX A;  4J6H A;  3D4R A;  3D6W A;  1E0B A;  1MD2 D;  3IFT A;  1TS2 A;  5I6W A;  4XYO A;  1S4Z A;  4RGO S;  2R92 B;  2PO4 A;  4IUR A;  3Q22 A;  1F9Q A;  2Z1C A;  4XTC S;  1X3P A;  1JOR A;  2AQ2 B;  1B9N A;  1TR5 A;  1MGS A;  1KNE A;  1PTO C;  2B2U C;  4C56 C;  2IPK D;  4ZAI A;  3C2P A;  1SYB A;  1GHJ A;  1W6J A;  4K5V A;  1JIC A;  3FVQ A;  2B8F A;  2RDG A;  4DK1 A;  1CI3 M;  3AU7 A;  1TWF B;  1SYG A;  2Q8R E;  4XIG S;  1ICW A;  2EZV A;  3J80 L;  4DN4 M;  1EY4 A;  3SK5 A;  3FMC A;  2K04 A;  2L5T A;  2XNA C;  1BQQ T;  2IT1 A;  4ZLT F;  4G7Z C;  2A69 C;  3GP7 A;  3BG3 A;  2R7Z B;  3K5N A;  4X3U A;  1STG A;  4I65 A;  3OWE B;  3I90 A;  1DYQ A;  1RDP D;  4KD4 A;  3GTG B;  2B8G A;  1O7Y A;  2PNR C;  3HG9 A;  5JPM C;  2SOB A;  1F2M A;  3I3C A;  3HP3 A;  3OWF A;  4KN7 C;  1L0X B;  3G6J B;  3NK9 A;  1LTB D;  3VA7 A;  1NSN S;  2VNU D;  1STH A;  3AB9 A;  3MFY A;  4ABN A;  4A93 B;  3K58 A;  2NYZ D;  5M5Y B;  2EXZ A;  2RSO A;  3LX0 A;  1SJH D;  3TZU A;  2K1B A;  1B44 D;  1IW7 D;  4FF4 A;  2CW0 D;  2X6L A;  1EFI D;  1D6E C;  2CQA A;  3K0Y A;  2PMZ B;  1EY7 A;  4K5X A;  1MBY A;  5J39 A;  3HOW B;  3MHB A;  2CVR A;  2FMM A;  1Y8N B;  5EGT A;  1HXY D;  2NVT B;  2V4D A;  2NUC A;  2QKI C;  5EKK A;  5ELD A;  5IT9 E;  1A3V A;  4OHJ A;  1SSO A;  2JEA I;  4F7X A;  4CJ0 B;  2L55 A;  1S5C D;  3G7L A;  1SBB B;  1A2T A;  5FO9 B;  3IL8 A;  3D4D A;  2KQ3 A;  1AZQ A;  1EEI D;  3J81 L;  2Z8L A;  1A6X A;  1RTO A;  1E2Z A;  2L0C A;  4HCE A;  2E2I B;  2F0G A;  1NR4 A;  3P7J A;  4A3D B;  5AFW A;  2NVX B;  2Z4I A;  4Y7N B;  4PNY A;  1UEA B;  5A2Q E;  3E0J A;  3MA2 B;  1GUN A;  3AMU A;  3LWE A;  2K32 A;  4CKE A;  3HEJ A;  4R8I A;  1SYC A;  1SYE A;  5C0X H;  2LFN A;  3PIO 3;  1T5E A;  2FFK B;  3PMF A;  2D9U A;  1B3A A;  5JJZ A;  1ZYR C;  1I4G A;  1ZXT A;  1CA5 A;  1KNA A;  2RQX A;  3HGB A;  4CHT B;  2G9D A;  1YNJ C;  1D5Z C;  4NMZ A;  3RUZ A;  3TZD A;  3MTS A;  1NAP A;  2QIL A;  2HDL A;  1XTC D;  4C3I G;  5D3I B;  1PTO D;  1Q12 A;  5JVH 3;  1AN8 A;  1EYD A;  5EPK A;  4C3H B;  1RF2 D;  2QEJ C;  2IWH A;  3DMU A;  3GO5 A;  1QNU A;  3D4W A;  3UI2 A;  3MEH A;  5EKI A;  2FMC A;  3HZX A;  1EU4 A;  1PFB A;  5I2X A;  1LV9 A;  3KK7 A;  4JBW A;  1K8O A;  1QG7 A;  3GD7 A;  1X32 A;  2M00 A;  1BCP B;  5DEH A;  2F0U A;  1HTL D;  4JK1 C;  3JAM E;  1CM9 A;  2EYL A;  3P75 A;  1B4O A;  1RHP A;  5C3X A;  5J1Z A;  2A69 D;  4KJO A;  5C5L A;  1Q1E A;  2A73 B;  4CKC A;  1JOQ A;  3PUZ A;  1L0Y B;  3T53 B;  3DUZ A;  2HCC A;  2QCP X;  1SYD A;  2TMP A;  5CMD A;  4EQP A;  2A6H C;  4EQO A;  4O42 A;  3K5O A;  3KUP A;  1TS3 A;  4K6L A;  5CV5 A;  3RD4 A;  3DWQ A;  1BCP C;  2TSS A;  1IKL A;  1ENF A;  2ZXR A;  3SVM A;  3V2T A;  2LMC B;  5K36 H;  2OXP A;  1KDC A;  3T16 A;  5LL6 S;  1PTO H;  2MHV A;  4BA1 I;  3S2D B;  2AQ3 B;  1Q8I A;  4NKL A;  4QUF A;  1RCV D;  4RHS A;  2EOT A;  3ITP A;  3A8J E;  1Y1V B;  2F0F A;  5FO7 B;  3TBI B;  1EY0 A;  5EQ0 A;  4KV6 A;  2DY7 A;  2JEB I;  5D3D A;  4B9W A;  1EY6 A;  5COR A;  1G2T A;  4BA2 I;  1A3U A;  5JAV A;  1H9M A;  4HMI A;  3MXN A;  2HQE A;  1QCB D;  4QCL A;  2RDH A;  5IT9 L;  3TP5 A;  4DNR B;  4YIJ A;  3URY A;  2WIN B;  5HUR A;  3EVQ A;  3SXH A;  3VYS A;  1G2S A;  2K7V A;  3A8K E;  3D3R A;  1U9R A;  4RGN A;  4RGT A;  2B63 B;  5M3M B;  2L11 A;  5KYI A;  3GTP B;  1B50 A;  4EGV A;  4KHV A;  3DXJ C;  2IX3 A;  3HKZ B;  1EOT A;  4KKU A;  1TWG B;  4IAL A;  2MJ8 A;  1IKM A;  2B39 A;  2F0I A;  1ZYR D;  1LT3 D;  2H1E A;  5C4J B;  4WRD A;  1LTI D;  1TT2 A;  1EIH A;  2KUM A;  5JPN C;  4CGY B;  1VF7 A;  1KAB A;  3I4L A;  1O7Z A;  5I6Y A;  1YNJ D;  1PRT F;  4FF1 A;  4KY6 A;  4A3B B;  1TWH B;  1PZI D;  4AYB B;  4P2C B;  4KD3 A;  2KEC A;  4DXF A;  3S1Q B;  4K2K A;  1QOH A;  1I4Q A;  2EYM A;  1XXG A;  3OW7 A;  5KND A;  3NWT A;  2Y0S B;  1R4P B;  3OMG A;  4IQZ A;  3MXP A;  4PQX A;  1GOZ A;  4PMC A;  3A8I E;  2ZXP A;  1QE6 A;  1TU2 B;  3PUV A;  1B53 A;  1WTO A;  3EFX D;  4K14 A;  5EKL A;  4FP5 D;  3OIP A;  1I50 B;  1FR3 A;  3V05 A;  1PTO B;  3IFD A;  5G3L F;  3S15 B;  3A7A B;  1V8Q A;  5EPJ A;  2EYJ A;  5IGE A;  5JVG 3;  1D5M C;  4CKB A;  1BO0 A;  1DOK A;  1JWS D;  3K57 A;  1LT5 D;  3H09 A;  4A3K B;  1WCM B;  1TII D;  4XQJ A;  3VR5 A;  1XWE A;  4DGZ A;  4HMJ A;  1CK1 A;  1SNO A;  1UAP A;  3W2D A;  2A6H D;  1W6K A;  1E2V A;  4ZQ3 A;  3H3V C;  3CHB D;  5K36 G;  1BCP D;  1OXU A;  5LHY 1;  5C4H A;  1F2Z A;  4XT3 B;  2F0T A;  1V1O A;  1OXX K;  2OT2 A;  2B2V A;  2EY5 A;  4UAI A;  3MFG A;  2DN8 A;  1EU3 A;  1KLG D;  4FNF A;  1EY5 A;  5LL6 X;  3MZ5 A;  5E4W C;  3S17 B;  1HQM C;  4DFA A;  1DJR D;  1HA6 A;  1G8Z D;  1SNQ A;  4HR7 B;  1WTX A;  4NW2 A;  1EQV A;  4FO2 A;  5EJW A;  1JCK B;  1CFM A;  3OIQ A;  3R2T A;  2WAQ B;  4F8M A;  3CQZ B;  4PMB A;  2BDO A;  1MSG A;  3V96 A;  1SEB D;  2AWO A;  2XRS D;  5C4X B;  2F0P A;  1CHQ D;  1F77 A;  1ONL A;  1JQY D;  3NUC A;  4H13 C;  5JEA H;  2NTT A;  4IUU A;  4H0L C;  2KJX A;  5KIX A;  3NQI A;  2MGS A;  3NP8 A;  1J8I A;  4XDX A;  3TDQ A;  2JA6 B;  5BN5 A;  2WKC A;  1V1P A;  5C6A A;  1BBX C;  5T1G A;  1S5F D;  4QUC A;  3HOX B;  1LTA D;  5M9O A;  4R8N A;  1GUO A;  2PZT A;  4RGM A;  1HUM A;  4HSV A;  4MIU A;  1I6V C;  2NB0 A;  1KAA A;  1D2B A;  1Y8O B;  2IW3 A;  5CBE E;  1SFO B;  1CT1 D;  1I4X A;  4KMU C;  2DNC A;  2F0S A;  4FXG C;  5IGF A;  5J22 A;  1JR0 D;  4XYQ A;  1AW7 A;  1LAC A;  5KYL A;  1K83 B;  1GHK A;  4TRD A;  1VMP A;  3OPO A;  1SYF A;  1LTR D;  4KKS A;  2PPB C;  3WDN A;  3NXW A;  5DAU A;  4G57 A;  4WOR A;  2Q8T A;  5C0X I;  3VR6 A;  5ELB A;  2KCC A;  1BDO A;  4HN7 A;  1JWU D;  5KEE A;  3PO2 B;  3OHX C;  1ILP A;  5CC4 A;  2ZT9 C;  4RA8 A;  4HAE A;  5BN3 A;  3Q0A A;  2QDB A;  2A68 C;  2I07 B;  3I4N B;  2XRQ D;  1G91 A;  4F87 A;  1O78 A;  2YU9 B;  2IL8 A;  5C4Z A;  3SHL A;  2EY6 A;  4BY1 B;  1LLR D;  2NVY B;  1SJE D;  1II3 A;  2F4I A;  1DXM A;  2RDF A;  1IHZ A;  4ZUJ A;  3NE5 B;  5IOC A;  2PCF B;  4BY7 B;  2K5D A;  1PFN A;  3M7G A;  2K5W A;  3BYY B;  3EA6 A;  2L4N A;  5C3W A;  1SE4 A;  2WII B;  2LY7 A;  3I91 A;  5CV8 A;  5FLX L;  1WVL A;  3K5L A;  1HQR D;  3Q24 A;  4M8A A;  1Q90 A;  1RTN A;  2AUK A;  2A74 C;  2KOL A;  2F0E A;  1D5X C;  4ODG A;  4ILW A;  4C1N K;  2EY1 A;  3N52 A;  1VMC A;  1Q1B A;  4RFB A;  1F2Y A;  2EJM A;  1A2U A;  2WB1 B;  4HSP A;  3NBH A;  3MC0 B;  2MP1 A;  2F0H A;  3T56 B;  1ET6 A;  1JOK A;  4A3I B;  3QIA A;  1FNV A;  1LT4 D;  1SMY C;  4LMQ D;  3K7A B;  1LO5 D;  3OSO A;  4G7O C;  2HDM A;  4K8I A;  2NVQ B;  3LWU A;  4KTA A;  1X3Q A;  1HPC A;  1UNS A;  4ZKC B;  1S5D D;  4DXG A;  1TQO A;  4KHZ A;  4L8J A;  2AQ1 B;  4G7H C;  4B08 A;  1PZK D;  2DNE A;  5IGC A;  3L3O C;  3ND9 A;  3RMH A;  1TKW B;  1I4H A;  4TKO B;  3GV3 A;  4LK1 C;  3I4M B;  5DM6 3;  5HGT A;  2VB2 X;  3X3M A;  2RKS A;  2Q8I B;  4C3H G;  5JEA G;  1H9R A;  3Q23 A;  1AZP A;  1FYC A;  3HRZ C;  4L6T B;  1WD1 A;  2YYZ A;  3J7A V;  3OOC A;  2K01 A;  3WOF A;  1IL8 A;  5C44 B;  4LJZ C;  1EIG A;  2B2W C;  4IUN A;  1HFN A;  4A3M B;  3C1E A;  4KJN A;  3QOL A;  4DAV A;  2WAC A;  1F9P A;  2SNM A;  1SXT A;  3H94 A;  1OO9 B;  1CQV A;  3P20 A;  2PQE A;  2K33 A;  2EE1 A;  3FDT A;  3GQB A;  2K5Q A;  3R3O A;  3A7L A;  4OL7 A;  3J80 E;  4FXD A;  4RCN A;  3NQT A;  1NCV A;  1TS5 A;  2F0Q A;  1STB A;  2D2C C;  1WTP A;  2KCN A;  1HRJ A;  2RA4 A;  4ID6 A;  1ESF A;  1GXD C;  1FD7 D;  2BCO A;  3EJI A;  1PMR A;  3TP8 A;  1PTO F;  1EYA A;  1H9S A;  2KHS A;  3NPP A;  3L9A X;  3K6O A;  4CBV A;  1WTV A;  3BS1 A;  4IUV A;  3CKI B;  1R4Q B;  4EQN A;  5FKA C;  2M9V A;  1I6H B;  1VDZ A;  3W3A A;  3HS0 C;  1EYC A;  3M4Y A;  2A5H A;  2F3V A;  2K03 A;  2JE6 I;  2B2W A;  2EYH A;  3KBG A;  3I73 A;  2VB3 X;  1XYI A;  2RBM A;  3T4A C;  1SAP A;  4M1U B;  4K5W A;  1QB5 D;  2MUY A;  2JP1 A;  2F0L A;  3MVV A;  1CHP D;  5IGD A;  2XWJ B;  2HUG A;  2E2D C;  1CZG A;  4BS9 A;  5FO8 B;  4OIJ A;  4K2L A;  4C1N I;  5C0X G;  2XVS A;  3C3L A;  2RSN A;  3NTK A;  2BDN A;  2KED A;  3VYR A;  3PV0 A;  3NSW A;  2M2L A;  2F0D A;  4N9P A;  1DON A;  3BDO A;  3KLR A;  4QF4 A;  1PLF A;  5M3F B;  4C3J B;  5A2Q L;  3U9S A;  2BA0 A;  1SNM A;  2PW7 A;  4H44 C;  4KKT A;  4RKB A;  4TSS A;  4OO1 I;  2F0V A;  1D1I A;  3I70 A;  5CV6 A;  4RHR A;  3T51 B;  3VA5 A;  3J81 E;  1M4V A;  2L9H A;  3RZD B;  2KA7 A;  3NHH A;  1S5E D;  5IGG A;  3M7N A;  2B2V C;  3S14 B;  2XSC A;  2AWN A;  3N6R A;  3BVZ A;  3S2H B;  1IYU A;  2LS0 1;  3QOJ A;  2J4X A;  3FPP A;  3Q6S A;  1FGB D;  4KY7 A;  2DY8 A;  1SMY D;  3ERO A;  3SK4 A;  1GUG A;  1BOS A;  1Q3L A;  4I7Z C;  1DCZ A;  3RZO B;  1A15 A;  1PXU A;  2G9H D;  1V1P B;  3HOU B;  1U4R A;  3M85 A;  4EVO A;  4X3S A;  1Z47 A;  2FHT A;  4N9T A;  3VYT A;  3C1F A;  1I3Q B;  4LAA A;  5IIF A;  1NUC A;  4OO1 H;  3BZD B;  4RAU C;  5F2D A;  3TN2 A;  2EVB A;  1TWC B;  1HUN A;  4DA2 A;  2PYK A;  3U9O A;  5D65 A;  3SDZ A;  4QMG A;  1KLU D;  2J7Z A;  1NR2 A;  5BN4 A;  3JAM L;  1RD9 D;  3S1M B;  5ELC A;  4HED A;  4CJ2 C;  2NBF A;  2AUJ D;  3QJY A;  1CA6 A;  5JEA J;  2F0N A;  4IZ8 A;  2PW5 A;  4DAP A;  4BBR B;  1DD2 A;  1EEF D;  2L12 A;  3H91 A;  4HCS A;  4FXK C;  3GTJ B;  2X6G A;  3NTH A;  3MAQ A;  3PUY A;  1STA A;  3K5M A;  4HTH A;  5I9O A;  2EYF A;  1EL0 A;  1OXT A;  2I46 A;  4L63 B;  5CBA E;  3BDL A;  2PZW A;  5E3F A;  1U4P A;  2K05 A;  2SDF A;  3CRK C;  5CV9 A;  4IFD H;  1JE4 A;  3D31 A;  1Y1W B;  2EPB A;  1JWM D;  3QB3 A;  1AP0 A;  1SE3 A;  2K28 A;  1O7L A;  1DOL A;  1BXT A;  4Q5V A;  1ESR A;  1F9R A;  3T13 A;  3GTO B;  2F1M A;  1TY0 A;  1B2T A;  1PRT B;  4X3K A;  2E2J B;  3R8B A;  2OF1 A;  4A3F B;  2BOS A;  2NTS A;  2EDG A;  2FJ2 A;  3PO3 B;  2B2Y A;  2NN6 I;  4ULL A;  4NDX A;  1SNP A;  4BBS B;  1JOO A;  1M8A A;  1I4R A;  3R93 A;  1STE A;  1ZKO A;  2R3Z A;  3I8Z A;  4J1M A;  4FF2 A;  5KNC A;  1K8M A;  4OIK A;  3M3Y B;  1QIL A;  1QNK A;  2LKV A;  1JB3 A;  3TME A;  1WD0 A;  2E74 C;  2VUM B;  1MI2 A;  3LNN A;  3PIP 3;  1PRT C;  1EZ6 A;  1SND A;  5ELE A;  5C0X J;  1LTT D;  2O5J C;  2B2U A;  5JOB A;  1PDQ A;  3SR1 A;  1EWC A;  2F0O A;  1HA5 A;  3GTL B;  4ME5 A;  5A35 A;  3FEW X;  3HOZ B;  1RKN A;  3BDC A;  1Z7T A;  4IN3 A;  1Y69 U;  2JA7 B;  2L1B A;  4WFN 3;  3HOV B;  4K8J A;  1RJT A;  4RWS C;  1BCP F;  2NN6 H;  3CU7 A;  1AFP A;  2JSO A;  4DU9 A;  3GTM B;  2SNS A;  1VF5 C;  1VCI A;  5I9P A;  1DOM A;  4B9X A;  1WTW A;  4QIW B;  4XQQ A;  4DNT B;  1FNU A;  3OMC A;  2F3W A;  2N55 A;  2EY2 A;  1B9M A;  3QWN A;  2OEO A;  2A6E C;  4WJW A;  5EBD A;  2EYO A;  1TVX A;  4DF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...