1JICA

Solution nmr structure of recombinant sso7d with rnase activity, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
ATVKFKYKGEEKQVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single-point mutation in the extreme heat- and pressure-resistant sso7d protein from sulfolobus solfataricus leads to a major rearrangement of the hydrophobic core.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein
molecule keywords SSO7D
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1998-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jicA00
2B2TC 4U68A 2B2WA 2DY8A 4MN3A 1B50A 1G91A 1ESRA 1HFGA 2B2YA 2HCCA 1F2LA 3I91A 1O7YA 2KEEA 3Q6SA 4ZAIA 2MP1A 1X3QA 5T1GA 2L1BA 1BBXC 1HRJA 4LMQD 2RVLA 1BF4A 1IKLA 1PFMA 2N55A 2NZ1D 1WTPA 1EL0A 4QUCA 5CBAE 4X3SA 4XT1B 2NYZD 2KOLA 1F9PA 3DEOA 1O7ZA 2K28A 1IL8A 1U4PA 1HUNA 2Q8TA 1HUMA 1F9SA 1LV9A 4NW2A 3R93A 1AZQA 3I90A 2X6LA 1B3AA 1DZ1A 4XDXA 1EIGA 4IUPA 2RSNA 4R9WA 1KNAA 2K05A 1WD0A 3I8ZA 2NWGA 1MI2A 1WD1A 4X3KA 2MJ8A 3IFDA 1CA6A 5COYA 1B4OA 3I3CA 1BNZA 2Q8RE 2HCIA 4OIKA 5CMDA 1XX8A 2B2TA 2EOTA 3P7JA 5EJWA 2FFKB 3DEPA 3D6WA 2CVRA 2K04A 1MGSA 2XIWA 2R3ZA 1WTQA 1J8IA 3MWYW 1CA5A 1DONA 1Q3LA 1ICWA 1O80A 2B2WC 5EPJA 4CJ2C 1NAPA 4R8IA 3GV6A 5E4WC 1WTXA 1ZXTA 2MGSA 4OIJA 1F9RA 1XYIA 1ILPA 4HSVA 2JYOA 3N52A 1WTWA 1CM9A 1J9OA 5EQ0A 2H1EA 3TZDA 1HFNA 1QG7A 4HCSA 3UI2A 4UAIA 1E0BA 1G2TA 3QO2A 1DOKA 5JJZA 5D14A 3FPUB 3KBXA 5D65A 4ZKBB 1EIHA 4RA8A 2B2VC 4HAEA 4HEDA 4O42A 1B2TA 4IUVA 1PFBA 2B2YC 5CBEE 5EKIA 2X69A 2B2VA 4DN4M 1HHVA 2HDMA 2RA4A 3G7LA 2FMMA 1SSOA 2RSOA 4MHEA 5AFWA 3IL8A 4RWSC 1PDQA 1WTRA 5EPKA 1PFNA 1NR2A 1BO0A 1A15A 4RAUC 1M8AA 1NR4A 3TN2A 1TVXA 2JP1A 1VMCA 2DY7A 1S4ZA 2FJ2A 2HDLA 2M2LA 2L11A 1U4RA 4XT3B 2L12A 1KNEA 1G2SA 1NCVA 1DOLA 1MSGA 1PLFA 2B2UA 2EE1A 1RTOA 3HP3A 2FINB 3GV3A 5E4XA 1U4LA 3FDTA 1QNKA 2FHTA 1RJTA 1VMPA 1JICA 1X32A 1X3PA 2L9HA 3F2UA 2BDNA 1ILQA 4CJ0B 2J7ZA 1U4MA 2VXWA 4ZLTF 2K01A 1GUWA 2K03A 2L4NA 4X3UA 3KUPA 1RTNA 2B2UC 5CORA 2HUGA 2IL8A 1AZPA 1C8CA 2KECA 2K1BA 3LWEA 1RODA 1SDFA 3H91A 4IURA 5EPLA 1JE4A 2EPBA 4IUTA 4X3TA 2KEDA 3DM1A 1WVLA 1IKMA 4ZK9B 2MPMA 1RHPA 5DNFA 1EOTA 2KVMA 1B53A 4QUFA 2KUMA 3MTSA 3SVMA 1SAPA 1DOMA 1F9QA 2X6GA 1QE6A 4CJ1B 1ML0D 5T1IA 1EQTA 2N88A 1WTVA 2D9UA 1AP0A 1MSHA 2SDFA 3ONAB 4IUUA 4ZKCB 1G6ZA 1HA6A 4IUQA 1WTOA
chains in the Genus database with same CATH superfamily
2XSCA 4WJ3M 4DUYQ 5JEAJ 4A76A 4OXPA 2F0LA 2F3VA 3TS0A 4KK7A 4ZUIA 1O7YA 4A3EB 4LF5Q 2ZTDA 2B63B 4JI1L 3Q23A 1O7ZA 1LLRD 1HUMA 3JAMc 1KIXA 1EY9A 3ULJA 5FLXc 3H94A 1KNAA 2SOBA 3Q22A 3AMUA 1B4OA 1C4QA 1I4QA 3BG3A 4MNOA 4K5VA 2HCIA 2UUCL 4H7BA 2NBFA 3S16B 3C1FA 4OO1I 4A3JH 2YYZA 4IFDJ 4HJ5A 2XNAC 1GXDC 2ZM6Q 5C44G 3SK5A 1RIPA 3JAML 3S1RH 1XYIA 2CKZB 1GHKA 5DM63 3TZDA 4LWCA 4RKBA 4YHHL 5JJKA 2V1CC 5I2YA 2F0OA 2XVSA 4GNXA 3TP5A 1VQEA 1M4VA 5CV6A 1ENAA 4NDXA 2CW0D 5CV9A 3G6JB 3RNUA 3CCJA 2G9DA 3HG9A 1IW7D 1NR4A 4B9XA 2Q2TA 1HQRD 1EY8A 1K83B 1KNEA 1FL0A 2KA7A 3KFUA 1VQBA 4P74A 1VMPA 1STGA 2L9HA 2HHHQ 5CV7A 4X62Q 4G4KA 1P8LA 4R8NA 1CKNA 3K5MA 3HOYG 4IURA 3KBGA 4OWWB 3GD7A 3J7ZC 2MPMA 3PF4A 1GOZA 2EYMA 2E8GA 4ZYSA 2NTSA 5T1IA 1NNXA 1KTKA 1Z7TA 4DV1Q 3MFYA 3R2TA 2B3GA 4MN3A 1VDZA 2A69C 2UXBQ 4N8X1 4JK1C 4Q5VA 2LFNA 2L1BA 4XXEA 1X54A 4WJWA 3RZOB 1XXGA 3NE5B 5JOBA 4IN3A 2MNAA 3CC2A 2C35B 2P5ZX 4X3KA 2MJ8A 4ME3A 2K32A 2LXJA 1PH2A 2NUCA 4YCUA 3D31A 3CAMA 1QVFA 1UAPA 4BBSH 1HQMC 3DUZA 3FVQA 3BYYB 1PTOF 1TWFB 4DR4L 2H4OA 3PIP3 1B9MA 3SEBA 2KQ3A 1A6XA 3HEJA 2LXKA 4AYBE 1IXRA 5IYDG 2XWJB 2EJFC 3KK7A 4CDFC 2ICIA 1VQ8A 2SNMA 1KXLA 2R7ZH 4PMWA 4EX5A 3FPUB 4NXML 3S1NB 4O42A 5CV5A 1AN8A 1SSOA 5KIXA 2VUMH 1EIFA 2AQ2B 5IYBH 1VQGA 2O2LD 4B3RL 1QUQA 3FKIH 4OX9Q 3M7GA 2E2IH 4P2CB 4KKTA 2L11A 1RL2A 1XPUA 2R92G 5C3EG 2NN6G 3VR5A 1X3PA 2F0NA 4DV6Q 1JOOA 2RQXA 4K2KA 4DPGA 4R4CA 2Z8LA 2R6GA 3TMEA 2IL8A 2CWAA 2K1BA 2IY5B 5J3BA 3NENA 3VR6A 1MHWC 1EEID 5DNFA 2PW7A 4BBSB 1N33Q 3PIPA 2I07B 4AYBG 1QVCA 4CJ1B 2VQFQ 1JE5A 2HQLA 4PZ7A 3CF5A 4NB3A 1VQIA 2BOSA 3TQYA 2XRSD 3OIQA 4P73A 1X3EA 2B2WA 3PF5A 1GUNA 4OONA 3Q6SA 4H02A 1H9SA 4IQZA 4RGTA 3QB3A 1IKLA 4RGNA 1PRTF 3U4ZA 2NVQB 5ELFA 1Z6HA 4X65Q 2PZTA 5IYBG 2EYJA 4BY7B 3EA6A 4B3SL 1Q81C 2X6LA 4KI0A 2CQOA 1EIGA 3KLSX 4BY1H 2RSNA 2K05A 1WD1A 3IFDA 1YNND 2JEAI 2N8NA 3VR3A 5BN5A 3I3CA 1QB5D 5FLXE 1EIYB 3HGBA 1K0RA 4F88A 3P7JA 2E2HB 4GOPB 3AB9A 1ET9A 1EUJA 3OPOA 1IYUA 3MWYW 1SFOB 1TS3A 2AKWB 3J80c 1AE2A 1Q1BA 5IYCH 1XMQQ 2XGTA 3H6MA 2F0UA 2JA7B 1EQVA 3EQLC 3NEMA 1S72A 1BR9A 1PZKD 3V96A 4LAAA 2PYKA 4HIDA 3WWVA 1PH9A 5K36G 1MBYA 1VQLA 2OQ0A 3OOCA 2HT1A 1VQFA 2PW5A 1OXSC 2GVBA 1Q86C 3D3RA 4R4IA 2J4XA 4HJ8A 1ENCA 1D1KA 4HMIA 1D6EC 1ASZA 2HDMA 3E0EA 3S14H 2VUMG 4N9PA 4ILWA 2ZXRA 4P75A 1PMRA 5FLMG 1BCPD 2EY2A 4KTAA 2DNCA 5JJIA 1DJRD 2M9VA 1LTSD 1I5FA 4LJZC 1G6PA 3M4OB 4DV2Q 2UXDL 4A3MG 3HRZC 2DY7A 4J8QA 4CHTB 4CKCA 5IT9c 2LMCB 2BCOA 3GTQB 3DMUA 1ESFA 3PUXA 3GV3A 3T1YL 3QIAA 3FDTA 1HZBA 5M9OA 1SYDA 3S1QH 2V4DA 3A8JE 1GJXA 1EYDA 1IKMA 4BA2I 5JEAG 1SLJA 5ISRA 2KUMA 3MTSA 4KY6A 1E2WA 1TY0A 4DV5L 1XMOQ 3PUVA 4A93G 3I4MB 2N88A 2WB1E 3BVZA 3F2BA 4IJHA 4RGMA 3CCVA 1G6ZA 1Y1WB 1W6JA 1GD7A 4U673 2N49A 1LTID 4K0KL 2PQAA 2ZM6L 5J1ZA 4DR2L 1NMGA 4XYQA 1K9MC 1CK1A 1V9PA 3MFGA 2JA9A 2RVLA 5E7NA 2NZ1D 1WTPA 1E7ZA 2OQKA 3K7AB 3NBIA 2DUDA 3WDNA 2B63H 4B3TQ 2FMCA 3PUWA 5IE8A 2R93H 3A0JA 1YIJA 1HUNA 5M5WH 3CP0A 3I7FA 5HGQA 2RHSB 2NVYB 4HR7B 2A19A 4JOIA 4XYOA 2F0FA 3J80i 3M4PA 1UWVA 1GUOA 1HPCA 4UP9A 2K5VA 1STNA 2EXDA 4DK1A 2NB0A 4DV7Q 2VL6A 1BNZA 2TMPA 2K5WA 3TS2A 5JAVA 1LT4D 3I4NH 4GKJQ 2R7ZB 4B08A 2O4XA 2IHFA 3NTIA 5GROA 1LM0A 5M5XB 1J8IA 4BA1I 3HKZE 4A3EG 3NBHA 5EPJA 3PO3G 1PYSB 1NAPA 4KMUC 3J7A5 4IOAA 2JA8G 4NKLA 1CSPA 1VQ4A 2NN6H 1SYFA 4HSVA 3AFPA 4JI5Q 2AHOB 3G4SA 1SE2A 1HFNA 3MVVA 3K58A 4FP5D 5D14A 1EQQA 3DLLA 4UP8A 1B2TA 4DGZA 3P20A 1PYWD 3NTHA 4RCOA 3ZYYX 2L15A 5FLXL 4M8AA 4C3HB 1TWAB 1HZ9A 1NJIC 4RKLA 2VUMB 3PO2H 3TREA 1HR0W 1V1QA 1M8AA 4YY3L 2N78A 3FKIG 2M2LA 1S4ZA 1SMXA 1JB7A 1U4RA 1K83H 1DOLA 2F0WA 3QWNA 2JA7G 1TKWB 3W1BA 2EVBA 3A7LA 4R4TA 1UE5A 1ZEQX 1XTCD 2K03A 5K5PA 5CORA 3NELA 2PNRC 1AEXA 3C3LA 1KD1C 1E1TA 3J80L 1JJGA 1BVSA 4DKAC 1TT2A 2UUAL 4GLAC 4KY7A 1QE6A 2L55A 2F0IA 1Q1EA 3CCUA 4IUUA 3FHWA 4DV3L 1YBYA 4Y52H 2JA7H 2B2YA 4JC0A 1EQRA 3TRZA 3TZUA 4DV0L 2I0QA 2PQAB 3FRPB 4DV6L 1K8OA 5IT9L 4L5TA 1GVPA 1JC7A 1GHJA 3S2HB 4X66Q 4O2DA 2UUCQ 2K28A 1EWIA 1SJHD 5JPMC 3R93A 3ITPA 4A3DB 4B3RQ 2NTTA 4DUZL 2RKSA 3TEHB 4DNRB 2MHVA 1F2ZA 5J22A 5KNCA 5COYA 4C3IG 1B50A 2Z6KC 3T56B 3OW7A 1JQYD 4K6LA 3CPWA 2GVAA 1I50B 1TQOA 1IBKL 1TWCB 1L0XB 4JBKA 3GTGH 1PH4A 4A3EH 3GV6A 4Z9CB 2HIVA 4BS9A 4HIMA 1HR0Q 5C5MA 4KJOA 4DR3L 1WCMH 3OWEB 2F0EA 1DOKA 4OWTB 4DK3C 4PMBA 2NVQH 3SR1A 1U0LA 3UDFA 4HJ7A 5A2QL 1RCVD 2Z4HA 4LFAL 2UXCQ 1STEA 1HZAA 2F4VL 4TRDA 3K7UC 1F2YA 3A8KE 3EVQA 5FJ8G 4JI4L 2GN5A 3UDGA 3TN2A 4OGQC 4GN4B 4JYAQ 3RUZA 2E74C 1MKHA 2L12A 4I7ZC 3S2DB 2WFWA 3SHLA 4GZYC 5GADC 5E4XA 5IT9E 4C2MH 2IT1A 3QOJA 1GM5A 5HGTA 2BDNA 1VQ6A 5CV4A 1QZHA 4K14A 2Q8IB 1W3SA 2AWNA 1CI3M 3BVGA 2EPBA 5ELNA 1A3VA 3A55A 3UDIA 3ULPA 4EGVA 1K3RA 1TWHB 1D1IA 4L5SA 1M1KC 3DWPA 4V190 1ZKOA 5I2XA 1MJCA 3HOVB 3K80C 1U5KA 1S40A 2ZT9C 3S15B 3K81C 1E2ZA 3I2ZA 3CXCA 2B2TC 4ZRZA 1H9SB 5FO9B 4LUOA 2IW3A 5M3MH 5LMUL 3CW2C 1I6HB 2F0GA 3GTKH 4IFDG 4X3SA 3D4WA 4UPAA 4C1NI 4TVAB 1I3QB 2RDHA 1CKNB 4A3BH 2ZXPA 3SK4A 4IJLA 5HURA 5M5WB 3M4YA 1ENFA 2EDGA 3GO5A 2CHBD 4Y7NH 1JWMD 1JJ2A 4JCVE 3BS1A 2VQEL 4LF8Q 1HCZA 3CKIB 1LT5D 4N8FA 5FOBB 1ZYRD 4QJFA 4ZCKA 1EY4A 4MZ9A 1JJCB 2XN9C 1J6QA 4DAPA 2EJGC 4DU9A 5C0XJ 2F0DA 4BY1G 5M3MB 1DCZA 4K5WA 5CR3A 4C3JH 1HNXL 2F3WA 3VYUA 4XIGS 1F9RA 3HKZG 3L9AX 2JYOA 2B8FA 4A3LG 2JA5B 4RH6A 4F87A 4BXXH 4RFBA 2VQFL 2NVTB 3FEWX 2CQAA 2YTXA 4KY5A 3PUYA 1WOCA 3EFXD 2TSSA 2Y0SE 1PFBA 3RD4A 1ZYRC 4EQNA 1CZGA 1A3TA 2A73B 1DD2A 4J1MA 1A2TA 1S5DD 5C0XH 2Y0SG 5KYLA 1QVGA 1TIID 2WB1B 1UNSA 2R92H 5J39A 1VQOA 1H95A 4I7AA 4DV4Q 2A69D 4G7ZC 2E5LQ 3H3VH 2JSOA 2R93B 2K6AA 4BBRH 5M5YB 1LT3D 1KDAA 1HH2P 2D0PA 5A2QE 5C4JH 4PV1C 1GUWA 4X3UA 1RTNA 3L2PA 3UE1A 3S14B 5DM73 2JE6I 3W3AA 3NP8A 5KGUA 3EBEA 1T5EA 4C3IH 1DOMA 3RLFA 4CDDC 4J6HA 1ML0D 3S16H 2A1AA 3I4MH 1WTVA 2D9UA 1HA6A 4QGUA 3GTJH 2DY8A 1K8GA 2KEEA 3RZDH 4LMQD 2JA6H 2N55A 1PTOD 1XPRA 4DR5Q 1Q7YC 3TP7A 2C5CA 2VB2X 1I4XA 2I5MX 5EAYA 3VA5A 1HNZL 4DR1L 2WAQB 4OWXB 1LTLA 1EZ6A 1CSQA 1II3A 4C3HH 3SGIA 3PUZA 4A93B 3M85A 3O13A 1OXVA 4OIKA 3IKJA 3DEPA 1LYLA 3L3OC 2BE5D 4FF2A 4DFAA 1OXTA 1B9NA 4RMFA 1Q3LA 4DNTB 1O7LA 4C3JB 1PTOH 1PTOC 3K57A 2WAQE 1YJNA 1FJGQ 5C4XG 3BDLA 4A3CG 1N8RC 4KHZA 1H9JA 3J7AV 4BBSG 1JCKB 3DXJC 4JW0A 3GTMB 3BJUA 1AW7A 4QY7A 4HCEA 4RA8A 1FNWA 3T53B 1STBA 3J7AF 2K5HA 1Z9FA 2RA4A 3J80E 2WKDA 1GUGA 1I3QH 4R4OA 4FXGC 3OSOA 3EIVA 4RHRA 3M4QA 3PV0A 3H15A 2KENA 4DR7Q 1PYBA 1BO0A 4JG2A 3DWAA 2MFIA 2JA6B 1VQDA 2KJXA 4X64L 4JI6L 3NBHB 3MZ5A 2K4KA 2A74C 1TS4A 3CCSA 2IPKD 4JI1Q 2OEOA 1Y8OB 4JI8L 1OXUA 1X32A 3HKZB 4QIWB 5IP7H 1XNRQ 4CJ0B 1Y8PB 1ILQA 5C4XB 3LWEA 3H91A 4DAYB 4A93H 4LK1C 2KBNA 2EYHA 4ZK9B 2R7FA 5JEAH 1ASYA 1SAPA 2A68C 2L5TA 4E6IA 1IHZA 3BZDB 5NUCA 3D8GA 3E5SA 1QILA 2KCMA 5I9PA 2KCCA 4ZKCB 1VF7A 2PPBC 1SNCA 4K2LA 5C3XA 1ESRA 2HCCA 4H0LC 5BR8Q 3RZDB 1YJWA 3VDYA 4CGYB 3CHBD 3D4RA 1EY6A 1R4PB 2EYPA 2MO0A 3S2HH 2QEXA 1PH6A 3BYTB 3HOZG 1S5ED 3CC4A 4LF7L 3NHHA 3STBC 1IBKQ 1STHA 2ZXOA 3K5OA 1GUSA 1H9RA 4A3KG 2H5XA 3C2PA 1GUTA 1CA6A 1G51A 5ELEA 1BUVT 1HTLD 2Q2HA 2QW7A 4RHSA 3VYRA 2VW9A 4UDUC 4LF5L 1Y1VG 3CCQA 3W1GA 2CW0C 2JN4A 2O5IC 3MXPA 4A3GG 1DONA 4XTCS 5IGCA 1BOSA 3TSSA 1IZ6A 4CKEA 3RN2A 4C56C 4B3ML 5FKAC 5EQ0A 4A3FG 3IAYA 1Z47A 3QJYA 1QG7A 1SNMA 5IODA 4QB4A 2R92B 1EY5A 3RZOH 1IYJB 3M4OH 5D65A 4ME5A 4C3HG 4K8IA 3CQZB 4A3MH 5EKKA 1CT1D 2F0MA 4DN4M 1HHVA 4JI2L 4NXNQ 4LF6L 5G3LD 3U58A 3TP8A 5E3FA 3T1HL 1VCIA 3VA7A 1C9OA 2WB1G 3HS0C 1PFNA 1NR2A 2F52A 4X6AH 1V43A 2Z6BA 1GKHA 1IBML 2RCNA 1STYA 1FGUA 1RTOA 4HIKA 4OEMB 2ALYB 3CMEA 2QILA 3MXUA 4X64Q 5IYCG 2AUKA 2J7ZA 1JT8A 2PZWA 5BN3A 1AZPA 2HUGA 1I94L 5EGTA 4J15A 1QWYA 1RODA 1SDFA 3KDFB 4X3TA 2KEDA 3DM1A 5BN4A 1F77A 3T1HQ 2G9HD 1LTAD 1T5XD 4GN5A 1QNUA 4DA2A 1KDBA 3S1RB 2E2IB 3FMCA 4L5RC 5CC4A 1PTOB 2SDFA 5GAHC 2YU9B 2B39A 3HOZH 2A8VA 1BCPB 1SFOH 4JI5L 2QCPX 2F03A 3GTPB 2BE5C 1HA5A 5IGDA 4JI7Q 1L2FA 1IL8A 2E2JH 2JA8H 2Q8TA 4IPHA 4G7OC 2ATWA 1VQKA 3BZCA 3S24A 3F1ZA 1V8QA 2F0KA 5C6AA 2K5QA 5C0XI 4DV7L 2B63G 3STBD 4JPBW 2LKVA 4JI7L 3EN2A 4XQNA 3VYSA 1XX8A 1X3FA 4AQYL 4A3LH 1YITA 1XNQQ 1I4RA 1BQQT 4ULLA 2IWHA 3HOUH 2UUBL 3E0JA 3X3NA 1EYCA 1ILPA 1TS2A 4HIOA 1QJOA 1J9OA 1J5EL 4IPGA 4IO9A 1K8AC 2EZVA 2PMZB 1RF2D 4A3BG 5C5LA 1KRSA 1D2BA 4DAYA 1R9TB 3A54A 4HAEA 3BZKA 3NSWA 5CBEE 2B2VA 1NBWA 4OHJA 3NXWA 3ND9A 5FLMH 3G7LA 1RDPD 4WJ4A 3DWQA 2F0SA 1YEZA 3NTKA 2YU9H 5M3FH 4QF4A 4P72A 1PDQA 3EROA 4P71A 1PA6A 3A8IE 1KDCA 4O1NA 1TWGH 3MA2B 3PIO3 1VMCA 4PZ8A 5C3EB 3HOWH 4IFDH 1V1PB 2OCEA 2MUYA 4KN7C 4K6DA 2R61A 3SK8A 2JA8B 4KHPQ 1GO3E 1QNKA 1LTRD 1WJJA 3DHQA 4GN3B 5C44B 2KHSA 3F2UA 2E5LL 2D62A 5E1FA 2VXWA 5LL6S 4GNXB 2SNSA 5IP9G 3U9SA 4KN4C 3S1QB 3PMFA 3HOZB 1KABA 1TS5A 1N34L 1JB3A 1H9KA 2E2DC 3S17H 1SEBD 3CCRA 1SNOA 4FYDA 4KLKA 5C4ZA 1MD2D 1LT6D 4QL5A 3GTQH 5I6YA 1SJED 3GTOB 5F2DA 4U68A 3PQIA 1SR3A 1UE6A 3GTJB 4DXFA 1G91A 1UEAB 4IOCA 2M00A 1E1OA 1SXTA 5T1GA 1BBXC 1ONLA 4ZAIA 2QA4A 1HRJA 2CFMA 4L8JA 2NVXB 1YNJD 1G8ZD 1PFMA 5K36H 5IWAQ 2KOLA 1E3PA 2ES2A 1Q90A 4JBWA 4ODGA 4AYBB 1K73C 4LNQA 4YCWA 4R9WA 3I4MG 3KOJA 1IBLQ 2BA1A 2VS1A 3A5UA 3KF8A 1IBMQ 2WACA 3ERQA 3KJOA 3HOUG 4A3DG 1PRTD 2VQEQ 1MJEA 4LF8L 3CCLA 4B3SQ 2Z4IA 1TWAH 1HNWQ 4X65L 3V05A 2F0TA 3J81E 3U50C 1A0IA 1K8MA 5GAGC 5IWAL 4KD4A 4IFDI 4UAIA 1EEFD 1UEBA 5JJZA 4M1UB 5DAUA 3NPPA 4KKUA 4IZ8A 2B2VC 4FXDA 3KF8B 1E2VA 1TWHH 3CPFA 1HR0L 4LF9L 2BH8A 2FMMA 2RSOA 3I4OA 5C4XH 3HOYB 1RD9D 4KKSA 1QOHA 5IOCA 1XNRL 4LFBQ 5C44H 1VQ5A 1Q8IA 4CBVA 1AH9A 5EPKA 3I4NB 5KRUA 2EYLA 5FO8B 4GLVB 4POGA 1OTCA 4GS3A 1G2SA 3N6RA 2EE1A 1OXXK 4R1JA 1YHQA 2LY7A 3PGZA 4L6TB 4A3CH 2EIFA 1FVIA 2IX1A 1RJTA 1FNUA 1JICA 5I4DA 2Z1CA 1S3OA 4R4QA 1I4HA 2F4IA 4LF9Q 4BWGB 2B2UC 4TKOB 1Y14B 3P1HA 4RCNA 3PO2B 1CQFA 1WCMB 3M9BA 1O78A 4GOPC 2EY5A 4FF4A 3E6ZX 3OYYA 2IJ0A 1KRTA 1F9QA 3MXGA 1BKBA 5GAEC 2YTVA 4RGOS 4DV3Q 1AP0A 1Q82C 1FGBD 2QDBA 4NXMQ 4IPCA 2VZAA 1WTOA 1FJGL 1D5MC 3T16A 3EJIA 2K5NA 4BY7G 5IIFA 1WTHA 3NWSA 4QMGA 3QR8A 4H44C 1VQMA 1PFSA 1HNWL 1SNDA 4A3JB 1G291 2UU9Q 4XQJA 4UP7A 3HOXH 1RKNA 4HSPA 1YVCA 3CCMA 1N9WA 1I6VC 1VQ7A 1LV9A 1W2BA 4XDXA 2BH2A 4QIWE 4A3GH 5KYIA 1L1OC 5JJLA 1HNZQ 1C0AA 4LFCL 5KEEA 1YZ6A 2K14A 2Q8RE 2A6HC 2B2TA 2FFKB 3D6WA 2UU9L 2D2CC 2K04A 2NZOA 2XIWA 1WTQA 1BBWA 1EU3A 1K28A 4JI0Q 3U4VA 4LF4Q 1PHJA 3V2TA 4LF6Q 3PO2G 4L5QA 3A7AB 1IW7C 3N52A 5A35A 4GNXC 1LTTD 5C4JB 1BBUA 2DJFC 4OL7A 4DR3Q 3GP7A 4HCSA 1E0BA 2AUJD 2K50A 4QCLA 3OW2A 2LS01 1PH8A 1HXYD 5LHY1 3RMHA 1EIHA 4HEDA 1AE3A 2A5HA 4GKKQ 3QG1A 5EKIA 3UDXA 1JWSD 3VR2A 3T51B 1U9RA 4OO1G 2JQOA 4JI0L 4A4IA 4LF4L 3IL8A 4LUVA 2Q2UA 2G5DA 2HD3A 4IUNA 2KHJA 3GTLH 2DNEA 1KAWA 4DR6Q 4GKJL 3LX0A 1DM0B 3W5OA 4LW1A 3GQBA 1A2UA 1EYGA 2AWOA 1SN8A 4N9TA 3AU7A 5EBDA 2Z6KA 5FO7B 4OELB 3F2CA 2WV6D 4LF7Q 3H0GG 4A3GB 5L37A 4A3JG 3NQIA 2F0HA 1X56A 2O5JC 3OTOL 3A74A 5I9OA 2JA5H 2F4VQ 2ZJPA 2A6ED 4F8MA 4QUFA 4DR2Q 2YV5A 2A6HD 2RBMA 3ERSX 4NXNL 3SVMA 5AJ3L 4A3DH 2WAQG 4A3IB 2X6GA 5AJ3Q 4AH6A 3FP9A 1STAA 1YNNC 5IP9H 1E24A 1UUPA 3M7NA 3VYTA 4ZQ3A 1X3QA 5FK9C 4MTNA 2E76C 1NE3A 3K0XA 3I72A 4XT1B 1B44D 3GTPH 2RCFA 3SE0A 4NW2A 4DK6C 4PZ6A 4JOIC 4JI8Q 3D6CA 3RLNA 3I8ZA 3RR5A 1MI2A 1HTPA 5CV8A 1DGSA 3C46A 1X65A 1K0SA 1BXTA 2PCFB 4DR7L 3A5ZB 1B70B 2QKIC 2CVRA 4TSSA 4WORA 4FF3A 2XWBB 1E22A 4GKKL 4GLXA 4G57A 1ICWA 1A62A 3BDOA 2JEBI 4R8IA 5M3FG 1CHQD 2PO4A 1WTXA 1ZXTA 2MGSA 2RDGA 4FDBA 3CQZH 4A3MB 4APVA 1VQNA 4YCVA 1MIUA 4DV0Q 5JVG3 1Y1WH 1LUZA 2Z0SA 3DM3A 5LL6X 3OIPA 2JA6G 3HOWG 1D7QA 1I4GA 2F0QA 1N34Q 3NUCA 1CTMA 1EWHA 1B8AA 3IFTA 1NUCA 2X69A 1LO5D 1XMOL 4GOPA 4A3FB 5EKLA 3KF6A 4OO1H 1VQAA 1X3GA 3KLWA 3MHBA 3S2DH 2D0OA 3D0FA 3AFQA 2EJMA 2KCTA 2ZJRA 2HDLA 5GQOA 4BXXG 1V1PA 2IHEA 1JWUD 3NQTA 3Q24A 1MSGA 3HP3A 2PZUA 4WFN3 4A3BB 1PZJD 3PO3B 3K7AH 4ZUJA 1SMYC 1EFWA 2OT2A 1SRUA 1UE7A 1A63A 4IUTA 1YNXA 4IALA 1CUKA 3GTGB 2NVYH 3KYHC 2KVMA 3Q0AA 5IGFA 3GTMH 4BBRG 2RDFA 2K7VA 4Q0FA 3ULLA 5LMNW 4C1NK 3OTOQ 4EQ5A 1WFQA 4C3JG 1Y8NB 4B9WA 2WINB 3R8BA 1QUQB 1HFGA 4MIUA 3TBIB 1LTGD 2K33A 1N33L 2UUBQ 3J81L 1CQVA 2Z9HA 1BF4A 2J0TD 3AQQA 1EL0A 4QUCA 1XMQL 2A68D 5ELCA 1CKMA 2EY6A 5LMNL 1U4PA 2EY1A 5CGKA 2ZJQA 4BY7H 3I90A 1SYGA 2SEBD 3VR4A 4DR6L 3WOFA 1X55A 2B8GA 1BCPF 3J81j 3CC7A 4LFBL 1FNVA 1R4QB 1UE1A 3OMCA 1TWCH 1L0YB 1FD7D 2A6EC 4OX9L 2ZTEA 4NMZA 3J81c 5ELOA 3F8TA 1CFMA 1JMCA 4DR1Q 1W6KA 4AIMA 1YNJC 3W2DA 3PSIA 1Y1WG 3K5LA 2OXPA 5BR8L 2CCZA 5E4WC 2BDOA 3UE0A 2MO1A 2QDLA 4EQOA 5H1SE 3IRBA 4JBJA 3MXNA 1WTWA 1CM9A 2H1EA 2N3SA 4DNIA 2YTYA 1Y69U 1KQSA 4PNYA 2OTJA 4O0AA 2VY3A 3ER0A 3K0YA 3NK9A 3S1MB 3U9OA 4A75A 2B2YC 2F0PA 5M3MG 4BY1B 4L63B 2Y0SB 4A3FH 1C48A 5IGEA 1WI5A 4MHEA 4LFCQ 5AFWA 3PO3H 3GTKB 3I55A 4AQYQ 3OWFA 1A15A 3ZJYC 3RN5A 1PV4A 4JI6Q 3QOLA 4YY3Q 4XQQA 2NN6I 1SE3A 1PZID 1YHBA 4DXGA 2I46A 4JI3L 3L7ZC 4EVOA 4JV5Q 3HOYH 4DAMA 1VQHA 3PCOB 4KJNA 3G48A 1B53A 2JA5G 2UXBL 2AQ1B 3J7YW 1SE4A 2BA0A 2RHQB 2PQEA 3MXNB 1M90C 4CKBA 1JR0D 1MSHA 3CU7A 1QCBD 3SK6A 3R2IA 3P75A 3SDZA 1PRTB 4JBMA 4G7HC 1F2LA 1EWCA 3F2DA 3JAME 3D4DA 5CYUA 4KHPL 2L0CA 1T9HA 1AFPA 3DEOA 2HHHL 1F9SA 4EQPA 1SYEA 1JOKA 3I70A 1XJVA 3KLSA 3ND8A 2NWGA 2EQSA 1TY2A 4JYAL 1K3BC 1B7YB 1PH7A 2CH4A 3MEHA 3CMAA 3X3MA 1VF5C 4DR5L 4A3IH 4HJAA 1DYQA 1PXUA 1L1OA 4PQXA 1PH3A 1A8VA 1O80A 1TR5A 4CJ2C 4LFAQ 2UXCL 2DJGC 1SNPA 4IPDA 3S17B 3MEFA 1TWFH 1FYCA 4YWMA 3CD6A 1SYCA 4YIJA 5KNDA 3UI2A 2IX0A 1G2TA 1SROA 4ZKBB 3GDEA 1D8LA 2MQHA 1VQ9A 1SNQA 1WYDA 3HFZB 4CDEC 2CWPA 5M5XH 3S1NH 1KL9A 1N32L 1FR3A 5ELBA 4KD3A 1WTRA 1IBLL 3GTLB 3CRLC 3AEVA 3HOXG 2WP8J 4XT3B 2OF1A 2B2UA 1PLFA 3R3OA 5LMNQ 1F2MA 4DUZQ 4TQUS 3T13A 1TWGB 1YHAA 1NMFA 1SBBB 2JJQA 5LMUQ 5C4HA 4ZLTF 2CH4W 4S3SA 1S5BD 3TP6A 1C8CA 1Q12A 2OTLA 3JAMi 1JE4A 1N32Q 3BDCA 1PVOA 1X9NA 1RHPA 3LGJA 1EOTA 4PMCA 1DXMA 2K5DA 1KLGD 4K0KQ 4ABNA 1BDOA 2Q2IA 1EQTA 4A3KH 1CZWA 4DF7A 4NP5A 5JPNC 2C9OA 2I5HA 1CKOA 1X6OA 1OO9B 2QGQA 1Q46A 2ZTCA 3K5NA 2UUAQ 4KHVA 1EY7A 1Y1VH 2XTIA 1ET6A 1I50H 2KHIA 3T4AC 4MTKA 5CBAE 2NYZD 3OHXC 2HQEA 4DR4Q 1LABA 5IY0A 5IGBA 4IUPA 4KV6A 2K52A 2WKCA 1WD0A 4A3IG 3S15H 2R7DA 1O7IA 1R9TH 1SYBA 4ALPA 5CMDA 3CRKC 5EJWA 4FNFA 4JI2Q 2D5DA 3PIOA 3CCEA 3FPPA 2R3ZA 1CA5A 1V1OA 3H0GB 2JK8A 2RF4A 4UHVA 1H9MA 3E9IA 1EZ8A 1J5EQ 3HKSA 4ID6A 4Y7NB 3I4NG 2PNHA 1L0WA 1I6HH 5I6WA 1P16A 2R93G 4DUYL 2XRQD 3KBXA 3E9HA 5ELDA 5D3DA 4IUVA 3MC0B 1PH5A 1B1ZA 2E75C 2F0JA 2VB3X 1D5XC 3BU2A 3J81i 1S5CD 5C0XG 3G6EA 1JOQA 1L1OB 1EY0A 1EU4A 3B6YA 1VQPA 2GA4B 1YJ9A 4JV5L 1PRTC 4WRDA 3FKIB 2LSSA 1S5FD 3AYHB 3A56A 4JI3Q 4K5XA 5JVH3 1TVXA 3HOVH 1ICFB 4QQBX 1XWEA 1Q8KA 1NCVA 1D5ZC 1SMYD 3BVMA 3H09A 4DV4L 3NWTA 1U4LA 1KC8C 2E2JB 4A3KB 5IYDH 4I65A 3Q8DA 1U4MA 2AQ3B 2EYFA 3S9WA 4CDCC 3LWUA 2KECA 2PI2E 5EPLA 3I4LA 1WVLA 1Y1VB 5DEHA 3G71A 2WIIB 2ID0A 1XPOA 1A3UA 4FVMA 3M3YH 1XTDA 4IUQA 1NSNS 2JXMB 3H3VC 1NTGA 2OWOA 5EBCA 1HNXQ 2I5LX 1EOVA 3I91A 5TSSA 1QZGA 3L0OA 2MP1A 5IGGA 1XNQL 3KLRA 3ICEA 1TU2B 1F9PA 3URYA 2QF7A 3I56A 1I4PA 1NY4A 4BBRB 5M5YH 4DK0A 1AZQA 2PI2A 4F7XA 4C3IB 1B3AA 3H0GH 4HN7A 1DZ1A 1IYVA 1KHIA 3KDFA 3SXHA 1B3QA 3S1MH 2EYOA 4RG1A 3MAQA 3GTOH 2NZHA 1HJPA 3WOEA 2EOTA 5DLQE 4X66L 2F1MA 4H13C 4DV2L 1WCMG 4HTHA 5D3IB 3HOVG 3KF6B 1MGSA 2NVXH 3H3VI 2F3IA 4B3TL 2B2WC 4NPSA 3TDQA 2F0VA 4OIJA 5KNBA 5IP7G 5HY6A 5G3LF 1JORA 1VQJA 4B3MQ 2NVTH 2AMCB 3QO2A 4PG3A 4JVZA 2PMZE 2HIXA 2KCNA 5M3FB 5FJ8H 2E2HH 3K59A 1I94Q 2ASBA 3RLOA 2FXQA 1HZCA 2DGYA 2IX3A 1C7YA 1SE8A 1YI2A 4UY8C 4X62L 2K75A 4RWSC 1EFID 4K8JA 5C3EH 4V0BA 3HOWB 1KAAA 4HMJA 1N36L 2DN8A 4FF1A 4RAUC 1CHPD 4C2MB 1BCPC 2JP1A 2FJ2A 2ENBA 4HJ9A 2R7ZG 2B29A 3HOXB 1LACA 3T1YQ 4JI4Q 1VQCA 2FINB 2QEJC 2FHTA 4FO2A 2K01A 3E3XA 4POFA 2L4NA 3KUPA 2UXDQ 1TXYA 1N36Q 3JC66 4YWKA 5C3WA 4FXKC 1EYAA 4DAVA 3I73A 3K6OA 3HOUB 3OMGA 2VNUD 3KJPA 4LUZA 1VS0A 4DV5Q 4YWLA 4YHHQ 1LTBD 3C1EA 1IL2A 3M3YB 1KLUD 4DV1L 1PH1A 2EXZA 3ONAB 3HZXA 2ICEC 3K8AA 3LNNA
chains in the Genus database with same CATH topology
2XSCA 5JEAJ 2F0LA 2F3VA 4KK7A 4ZUIA 1O7YA 4A3EB 2B63B 3Q23A 1O7ZA 1LLRD 1HUMA 1EY9A 3H94A 1KNAA 2SOBA 3Q22A 3AMUA 1B4OA 1C4QA 1I4QA 3BG3A 4K5VA 2HCIA 4H7BA 2NBFA 3S16B 3C1FA 4OO1I 2YYZA 4IFDJ 2XNAC 1GXDC 3SK5A 3JAML 1XYIA 1GHKA 5DM63 3TZDA 4RKBA 5I2YA 2F0OA 2XVSA 3TP5A 1M4VA 5CV6A 1ENAA 4NDXA 2CW0D 5CV9A 3G6JB 2G9DA 3HG9A 1IW7D 1NR4A 4B9XA 1HQRD 1EY8A 1K83B 1KNEA 2KA7A 1VMPA 1STGA 2L9HA 5CV7A 4G4KA 4R8NA 3K5MA 4IURA 3KBGA 3GD7A 2MPMA 1GOZA 2EYMA 4ZYSA 2NTSA 5T1IA 1KTKA 1Z7TA 3MFYA 3R2TA 4MN3A 1VDZA 2A69C 4JK1C 4Q5VA 2LFNA 2L1BA 4XXEA 4WJWA 3RZOB 1XXGA 3NE5B 5JOBA 4IN3A 4X3KA 2MJ8A 2K32A 2NUCA 3D31A 1UAPA 1HQMC 3DUZA 3FVQA 3BYYB 1PTOF 1TWFB 2H4OA 3PIP3 1B9MA 3SEBA 2KQ3A 1A6XA 3HEJA 2XWJB 2EJFC 3KK7A 2ICIA 2SNMA 4PMWA 3FPUB 3S1NB 4O42A 5CV5A 1AN8A 1SSOA 5KIXA 2AQ2B 2O2LD 3M7GA 4P2CB 4KKTA 2L11A 2NN6G 3VR5A 1X3PA 2F0NA 1JOOA 2RQXA 4K2KA 2Z8LA 2R6GA 3TMEA 2IL8A 2K1BA 3VR6A 1EEID 5DNFA 2PW7A 4BBSB 2I07B 4CJ1B 2BOSA 2XRSD 3OIQA 2B2WA 1GUNA 3Q6SA 1H9SA 4IQZA 4RGTA 3QB3A 1IKLA 4RGNA 1PRTF 2NVQB 5ELFA 1Z6HA 2PZTA 2EYJA 4BY7B 3EA6A 2X6LA 4KI0A 1EIGA 3KLSX 2RSNA 2K05A 1WD1A 3IFDA 1YNND 2JEAI 3VR3A 5BN5A 3I3CA 1QB5D 5FLXE 3HGBA 2E2HB 4F88A 3P7JA 3AB9A 1ET9A 3OPOA 1IYUA 3MWYW 1SFOB 1TS3A 1Q1BA 3H6MA 2F0UA 2JA7B 1EQVA 3EQLC 1BR9A 1PZKD 3V96A 4LAAA 2PYKA 5K36G 1MBYA 3OOCA 2PW5A 1OXSC 3D3RA 2J4XA 1ENCA 1D1KA 4HMIA 1D6EC 2HDMA 4N9PA 4ILWA 2ZXRA 1PMRA 1BCPD 2EY2A 2DNCA 4KTAA 1DJRD 2M9VA 1LTSD 4LJZC 3M4OB 3HRZC 2DY7A 4J8QA 4CHTB 4CKCA 2LMCB 3GTQB 2BCOA 3DMUA 1ESFA 3PUXA 3GV3A 3QIAA 3FDTA 5M9OA 1SYDA 2V4DA 3A8JE 1GJXA 1EYDA 1IKMA 4BA2I 5JEAG 5ISRA 2KUMA 3MTSA 4KY6A 1E2WA 1TY0A 3PUVA 3I4MB 2N88A 3BVZA 4RGMA 1G6ZA 1Y1WB 1W6JA 4U673 1LTID 5J1ZA 4XYQA 1CK1A 3MFGA 2RVLA 2NZ1D 1WTPA 3K7AB 3NBIA 3WDNA 2FMCA 3PUWA 1HUNA 2NVYB 4HR7B 4XYOA 2F0FA 1GUOA 1HPCA 1STNA 4DK1A 2NB0A 1BNZA 2TMPA 2K5WA 5JAVA 1LT4D 2R7ZB 4B08A 2O4XA 3NTIA 1J8IA 5M5XB 4BA1I 3NBHA 5EPJA 1NAPA 4KMUC 4NKLA 2NN6H 1SYFA 4HSVA 1SE2A 1HFNA 3MVVA 3K58A 4FP5D 5D14A 1B2TA 4DGZA 3P20A 1PYWD 3NTHA 4RCOA 3ZYYX 5FLXL 4M8AA 4C3HB 1TWAB 2VUMB 4RKLA 1M8AA 2M2LA 1S4ZA 1U4RA 1DOLA 2F0WA 3QWNA 1TKWB 2EVBA 3A7LA 1ZEQX 1XTCD 2K03A 5K5PA 5CORA 2PNRC 1AEXA 3C3LA 3J80L 1TT2A 4KY7A 1QE6A 2L55A 2F0IA 1Q1EA 4IUUA 2B2YA 3TZUA 3FRPB 1K8OA 5IT9L 1JC7A 1GHJA 3S2HB 2K28A 1SJHD 5JPMC 3R93A 3ITPA 4A3DB 2NTTA 2RKSA 4DNRB 2MHVA 1F2ZA 5J22A 5KNCA 5COYA 4C3IG 1B50A 3T56B 3OW7A 1JQYD 4K6LA 1I50B 1TQOA 1TWCB 1L0XB 3GV6A 4Z9CB 4BS9A 5C5MA 4KJOA 3OWEB 2F0EA 1DOKA 4PMBA 3SR1A 5A2QL 1RCVD 2Z4HA 1STEA 4TRDA 1F2YA 3A8KE 3EVQA 3TN2A 4OGQC 3S2DB 3RUZA 2E74C 4I7ZC 2L12A 3SHLA 4GZYC 5E4XA 5IT9E 2IT1A 3QOJA 5HGTA 2BDNA 5CV4A 4K14A 2Q8IB 2AWNA 1CI3M 3BVGA 2EPBA 1A3VA 3A55A 4EGVA 1TWHB 1D1IA 3DWPA 4V190 1ZKOA 5I2XA 3HOVB 2ZT9C 3S15B 1E2ZA 2B2TC 4ZRZA 1H9SB 5FO9B 2IW3A 1I6HB 2F0GA 4IFDG 4X3SA 3D4WA 4C1NI 1I3QB 2RDHA 2ZXPA 3SK4A 5HURA 5M5WB 3M4YA 1ENFA 2EDGA 3GO5A 2CHBD 1JWMD 3BS1A 1HCZA 3CKIB 1LT5D 5FOBB 1ZYRD 1EY4A 2XN9C 4DAPA 2EJGC 4DU9A 5C0XJ 2F0DA 5M3MB 1DCZA 4K5WA 5CR3A 2F3WA 3VYUA 4XIGS 1F9RA 3L9AX 2JYOA 2B8FA 2JA5B 4RH6A 4F87A 4RFBA 2NVTB 3FEWX 2CQAA 4KY5A 3PUYA 3EFXD 2TSSA 1PFBA 3RD4A 1ZYRC 4EQNA 1CZGA 1A3TA 2A73B 1DD2A 4J1MA 1A2TA 1S5DD 5C0XH 5KYLA 1TIID 2WB1B 1UNSA 5J39A 2A69D 4G7ZC 2JSOA 2R93B 2K6AA 5M5YB 1LT3D 1KDAA 5A2QE 4PV1C 1GUWA 4X3UA 1RTNA 3S14B 5DM73 2JE6I 3W3AA 3NP8A 5KGUA 1T5EA 1DOMA 3RLFA 4J6HA 1ML0D 1WTVA 2D9UA 1HA6A 2DY8A 2KEEA 4LMQD 2N55A 1PTOD 3TP7A 2C5CA 2VB2X 1I4XA 3VA5A 2WAQB 1EZ6A 1II3A 3PUZA 4A93B 3M85A 3O13A 1OXVA 4OIKA 3IKJA 3DEPA 3L3OC 2BE5D 4FF2A 4DFAA 1OXTA 1B9NA 1Q3LA 4DNTB 1O7LA 4C3JB 1PTOH 1PTOC 3K57A 3BDLA 4KHZA 1H9JA 3J7AV 1JCKB 3DXJC 3GTMB 1AW7A 4HCEA 4RA8A 1FNWA 3T53B 1STBA 3J7AF 3J80E 2RA4A 2WKDA 1GUGA 4FXGC 3OSOA 4RHRA 3PV0A 1BO0A 3DWAA 2JA6B 2KJXA 3MZ5A 2A74C 1TS4A 2IPKD 2OEOA 1Y8OB 1OXUA 1X32A 3HKZB 4QIWB 4CJ0B 1Y8PB 1ILQA 5C4XB 3LWEA 3H91A 4LK1C 2EYHA 4ZK9B 5JEAH 1SAPA 2A68C 2L5TA 4E6IA 1IHZA 3BZDB 5NUCA 3D8GA 3E5SA 1QILA 5I9PA 2KCCA 4ZKCB 1VF7A 2PPBC 1SNCA 4K2LA 5C3XA 1ESRA 2HCCA 4H0LC 3RZDB 4CGYB 3CHBD 3D4RA 1EY6A 1R4PB 2EYPA 3BYTB 1S5ED 3NHHA 1STHA 2ZXOA 3K5OA 1GUSA 1H9RA 3C2PA 1GUTA 1CA6A 5ELEA 1BUVT 1HTLD 4RHSA 3VYRA 4UDUC 2CW0C 2O5IC 3MXPA 1DONA 4XTCS 5IGCA 1BOSA 3TSSA 4CKEA 4C56C 5FKAC 5EQ0A 3IAYA 1Z47A 3QJYA 1QG7A 1SNMA 5IODA 4QB4A 2R92B 1EY5A 5D65A 4ME5A 4C3HG 4K8IA 3CQZB 5EKKA 1CT1D 2F0MA 4DN4M 1HHVA 5G3LD 3TP8A 5E3FA 1VCIA 3VA7A 3HS0C 1PFNA 1NR2A 1V43A 1STYA 1RTOA 2QILA 3MXUA 2AUKA 2J7ZA 2PZWA 5BN3A 1AZPA 2HUGA 5EGTA 1QWYA 1RODA 1SDFA 4X3TA 2KEDA 3DM1A 5BN4A 1F77A 2G9HD 1T5XD 1LTAD 1QNUA 4DA2A 1KDBA 3S1RB 2E2IB 3FMCA 5CC4A 1PTOB 2SDFA 2YU9B 2B39A 1BCPB 2QCPX 2F03A 3GTPB 2BE5C 1HA5A 5IGDA 1IL8A 2Q8TA 4G7OC 1V8QA 2F0KA 5C6AA 2K5QA 5C0XI 2LKVA 4XQNA 3VYSA 1XX8A 1I4RA 1BQQT 4ULLA 2IWHA 3E0JA 3X3NA 1EYCA 1ILPA 1TS2A 1QJOA 1J9OA 2EZVA 2PMZB 1RF2D 5C5LA 1D2BA 4DAYA 1R9TB 3A54A 4HAEA 3NSWA 5CBEE 2B2VA 4OHJA 3NXWA 3ND9A 3G7LA 1RDPD 3DWQA 2F0SA 3NTKA 4QF4A 1PDQA 3EROA 3A8IE 1KDCA 4O1NA 3MA2B 3PIO3 1VMCA 5C3EB 4IFDH 1V1PB 2MUYA 4KN7C 4K6DA 2R61A 3SK8A 2JA8B 1QNKA 1LTRD 3DHQA 5C44B 2KHSA 3F2UA 2D62A 5E1FA 2VXWA 5LL6S 2SNSA 3U9SA 4KN4C 3S1QB 3PMFA 3HOZB 1KABA 1TS5A 1JB3A 1H9KA 2E2DC 1SEBD 1SNOA 4FYDA 5C4ZA 1MD2D 1LT6D 5I6YA 1SJED 3GTOB 5F2DA 4U68A 3GTJB 4DXFA 1G91A 1UEAB 2M00A 1SXTA 5T1GA 1BBXC 1ONLA 4ZAIA 1HRJA 4L8JA 2NVXB 1YNJD 1G8ZD 1PFMA 5K36H 2KOLA 1Q90A 4JBWA 4ODGA 4AYBB 4R9WA 2BA1A 3KF8A 2WACA 3ERQA 1PRTD 2Z4IA 3V05A 2F0TA 3J81E 1K8MA 4KD4A 4IFDI 4UAIA 1EEFD 5JJZA 4M1UB 5DAUA 3NPPA 4KKUA 4IZ8A 2B2VC 4FXDA 1E2VA 3HOYB 2FMMA 2RSOA 1RD9D 4KKSA 1QOHA 5IOCA 1Q8IA 4CBVA 5EPKA 3I4NB 5KRUA 2EYLA 5FO8B 1G2SA 3N6RA 2EE1A 1OXXK 2LY7A 4L6TB 2IX1A 1RJTA 1FNUA 1JICA 5I4DA 2Z1CA 1I4HA 2F4IA 4BWGB 2B2UC 4TKOB 3P1HA 4RCNA 3PO2B 1CQFA 1WCMB 1O78A 4FF4A 2EY5A 3E6ZX 2IJ0A 1F9QA 3MXGA 4RGOS 1AP0A 1FGBD 2QDBA 1WTOA 1D5MC 3T16A 3EJIA 5IIFA 3NWSA 4QMGA 4H44C 1SNDA 4A3JB 1G291 4XQJA 1RKNA 4HSPA 1I6VC 1LV9A 4XDXA 5KYIA 5KEEA 2Q8RE 2A6HC 2B2TA 2FFKB 3D6WA 2D2CC 2K04A 1WTQA 2XIWA 1EU3A 3V2TA 3A7AB 1IW7C 3N52A 5A35A 1LTTD 5C4JB 4OL7A 3GP7A 4HCSA 1E0BA 2AUJD 4QCLA 2LS01 1HXYD 5LHY1 3RMHA 1EIHA 4HEDA 2A5HA 3QG1A 5EKIA 1JWSD 3VR2A 3T51B 1U9RA 4OO1G 3IL8A 4IUNA 2DNEA 3LX0A 1DM0B 3GQBA 1A2UA 2AWOA 4N9TA 3AU7A 5EBDA 5FO7B 2WV6D 4A3GB 3NQIA 2F0HA 2O5JC 5I9OA 2A6ED 4F8MA 4QUFA 2A6HD 2RBMA 3SVMA 4A3IB 2X6GA 1STAA 1YNNC 1UUPA 3M7NA 3VYTA 4ZQ3A 1X3QA 5FK9C 2E76C 3I72A 4XT1B 1B44D 3SE0A 4NW2A 3D6CA 3I8ZA 1MI2A 1HTPA 5CV8A 3C46A 1BXTA 2PCFB 4WORA 2QKIC 2CVRA 4TSSA 4FF3A 2XWBB 4G57A 1ICWA 3BDOA 2JEBI 4R8IA 1CHQD 2PO4A 1WTXA 1ZXTA 2MGSA 2RDGA 4A3MB 5JVG3 5LL6X 3OIPA 1I4GA 2F0QA 3NUCA 1CTMA 1EWHA 3IFTA 1NUCA 2X69A 1LO5D 4A3FB 5EKLA 4OO1H 3MHBA 2EJMA 2HDLA 1V1PA 1JWUD 3NQTA 3Q24A 1MSGA 3HP3A 2PZUA 4WFN3 4A3BB 1PZJD 3PO3B 4ZUJA 1SMYC 2OT2A 4IUTA 3GTGB 4IALA 3Q0AA 2KVMA 5IGFA 2RDFA 2K7VA 4Q0FA 4C1NK 4C3JG 1Y8NB 4B9WA 2WINB 3R8BA 1HFGA 4MIUA 3TBIB 1LTGD 2K33A 3J81L 1CQVA 1BF4A 2J0TD 1EL0A 4QUCA 2A68D 5ELCA 2EY6A 1U4PA 2EY1A 5CGKA 3I90A 1SYGA 2SEBD 3VR4A 3WOFA 2B8GA 1BCPF 1FNVA 1R4QB 3OMCA 1L0YB 1FD7D 2A6EC 4NMZA 1CFMA 1W6KA 1YNJC 3W2DA 3K5LA 2OXPA 5E4WC 2BDOA 4EQOA 3MXNA 1WTWA 1CM9A 2H1EA 1Y69U 4PNYA 3K0YA 3NK9A 3S1MB 3U9OA 2B2YC 2F0PA 4BY1B 4L63B 2Y0SB 1C48A 5IGEA 4MHEA 5AFWA 3GTKB 3OWFA 1A15A 3QOLA 4XQQA 2NN6I 1SE3A 1PZID 4DXGA 2I46A 3L7ZC 4EVOA 4KJNA 1B53A 2AQ1B 3J7YW 1SE4A 2BA0A 2PQEA 4CKBA 1JR0D 1MSHA 3CU7A 1QCBD 3SK6A 3R2IA 3P75A 3SDZA 1PRTB 4G7HC 1F2LA 1EWCA 3JAME 3D4DA 5CYUA 2L0CA 1AFPA 3DEOA 1F9SA 4EQPA 1SYEA 1JOKA 3I70A 3KLSA 3ND8A 2NWGA 1TY2A 3MEHA 3X3MA 1VF5C 1DYQA 1PXUA 4PQXA 1O80A 1TR5A 4CJ2C 1SNPA 3S17B 1FYCA 1SYCA 4YIJA 5KNDA 3UI2A 2IX0A 1G2TA 4ZKBB 1SNQA 1FR3A 5ELBA 4KD3A 1WTRA 3GTLB 3CRLC 2WP8J 4XT3B 2OF1A 2B2UA 1PLFA 3R3OA 1F2MA 4TQUS 3T13A 1TWGB 1SBBB 5C4HA 4ZLTF 4S3SA 1S5BD 3TP6A 1C8CA 1Q12A 1JE4A 3BDCA 1RHPA 4PMCA 1EOTA 1DXMA 2K5DA 1KLGD 4ABNA 1BDOA 1EQTA 1CZWA 4DF7A 4NP5A 5JPNC 2C9OA 1OO9B 3K5NA 4KHVA 1EY7A 1ET6A 3T4AC 5CBAE 2NYZD 3OHXC 2HQEA 1LABA 5IGBA 4IUPA 4KV6A 2WKCA 1WD0A 1SYBA 5CMDA 3CRKC 5EJWA 4FNFA 2D5DA 3FPPA 2R3ZA 1CA5A 1V1OA 3H0GB 1H9MA 1EZ8A 4ID6A 4Y7NB 5I6WA 2XRQD 3KBXA 5ELDA 5D3DA 4IUVA 3MC0B 1B1ZA 2E75C 2F0JA 2VB3X 1D5XC 1S5CD 5C0XG 1JOQA 1EY0A 1EU4A 2GA4B 1PRTC 4WRDA 3FKIB 1S5FD 3A56A 4K5XA 5JVH3 1TVXA 1XWEA 1NCVA 1D5ZC 1SMYD 3BVMA 3H09A 3NWTA 1U4LA 2E2JB 4A3KB 4I65A 1U4MA 2AQ3B 2EYFA 3S9WA 3LWUA 2KECA 5EPLA 3I4LA 1WVLA 1Y1VB 5DEHA 2WIIB 2ID0A 1A3UA 4FVMA 4IUQA 1NSNS 2JXMB 3H3VC 5EBCA 3I91A 5TSSA 2MP1A 5IGGA 3KLRA 1TU2B 1F9PA 3URYA 2QF7A 1I4PA 4BBRB 4DK0A 1AZQA 4F7XA 4C3IB 1B3AA 4HN7A 1DZ1A 1IYVA 3SXHA 2EYOA 3MAQA 3WOEA 2EOTA 2F1MA 4H13C 4HTHA 5D3IB 1MGSA 2B2WC 3TDQA 2F0VA 4OIJA 5KNBA 5G3LF 1JORA 3QO2A 2KCNA 5M3FB 3K59A 2IX3A 4RWSC 1EFID 4K8JA 3HOWB 4V0BA 1KAAA 4HMJA 2DN8A 4FF1A 4RAUC 1CHPD 4C2MB 1BCPC 2JP1A 2FJ2A 2ENBA 3HOXB 1LACA 2FINB 2QEJC 2FHTA 4FO2A 2K01A 2L4NA 3KUPA 5C3WA 4FXKC 1EYAA 4DAVA 3HOUB 3I73A 3K6OA 3OMGA 2VNUD 1LTBD 3C1EA 3M3YB 1KLUD 2EXZA 3ONAB 3HZXA 2ICEC 3LNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2T C;  4U68 A;  2B2W A;  2DY8 A;  4MN3 A;  1B50 A;  1G91 A;  1ESR A;  1HFG A;  2B2Y A;  2HCC A;  1F2L A;  3I91 A;  1O7Y A;  2KEE A;  3Q6S A;  4ZAI A;  2MP1 A;  1X3Q A;  5T1G A;  2L1B A;  1BBX C;  1HRJ A;  4LMQ D;  2RVL A;  1BF4 A;  1IKL A;  1PFM A;  2N55 A;  2NZ1 D;  1WTP A;  1EL0 A;  4QUC A;  5CBA E;  4X3S A;  4XT1 B;  2NYZ D;  2KOL A;  1F9P A;  3DEO A;  1O7Z A;  2K28 A;  1IL8 A;  1U4P A;  1HUN A;  2Q8T A;  1HUM A;  1F9S A;  1LV9 A;  4NW2 A;  3R93 A;  1AZQ A;  3I90 A;  2X6L A;  1B3A A;  1DZ1 A;  4XDX A;  1EIG A;  4IUP A;  2RSN A;  4R9W A;  1KNA A;  2K05 A;  1WD0 A;  3I8Z A;  2NWG A;  1MI2 A;  1WD1 A;  4X3K A;  2MJ8 A;  3IFD A;  1CA6 A;  5COY A;  1B4O A;  3I3C A;  1BNZ A;  2Q8R E;  2HCI A;  4OIK A;  5CMD A;  1XX8 A;  2B2T A;  2EOT A;  3P7J A;  5EJW A;  2FFK B;  3DEP A;  3D6W A;  2CVR A;  2K04 A;  1MGS A;  2XIW A;  2R3Z A;  1WTQ A;  1J8I A;  3MWY W;  1CA5 A;  1DON A;  1Q3L A;  1ICW A;  1O80 A;  2B2W C;  5EPJ A;  4CJ2 C;  1NAP A;  4R8I A;  3GV6 A;  5E4W C;  1WTX A;  1ZXT A;  2MGS A;  4OIJ A;  1F9R A;  1XYI A;  1ILP A;  4HSV A;  2JYO A;  3N52 A;  1WTW A;  1CM9 A;  1J9O A;  5EQ0 A;  2H1E A;  3TZD A;  1HFN A;  1QG7 A;  4HCS A;  3UI2 A;  4UAI A;  1E0B A;  1G2T A;  3QO2 A;  1DOK A;  5JJZ A;  5D14 A;  3FPU B;  3KBX A;  5D65 A;  4ZKB B;  1EIH A;  4RA8 A;  2B2V C;  4HAE A;  4HED A;  4O42 A;  1B2T A;  4IUV A;  1PFB A;  2B2Y C;  5CBE E;  5EKI A;  2X69 A;  2B2V A;  4DN4 M;  1HHV A;  2HDM A;  2RA4 A;  3G7L A;  2FMM A;  1SSO A;  2RSO A;  4MHE A;  5AFW A;  3IL8 A;  4RWS C;  1PDQ A;  1WTR A;  5EPK A;  1PFN A;  1NR2 A;  1BO0 A;  1A15 A;  4RAU C;  1M8A A;  1NR4 A;  3TN2 A;  1TVX A;  2JP1 A;  1VMC A;  2DY7 A;  1S4Z A;  2FJ2 A;  2HDL A;  2M2L A;  2L11 A;  1U4R A;  4XT3 B;  2L12 A;  1KNE A;  1G2S A;  1NCV A;  1DOL A;  1MSG A;  1PLF A;  2B2U A;  2EE1 A;  1RTO A;  3HP3 A;  2FIN B;  3GV3 A;  5E4X A;  1U4L A;  3FDT A;  1QNK A;  2FHT A;  1RJT A;  1VMP A;  1JIC A;  1X32 A;  1X3P A;  2L9H A;  3F2U A;  2BDN A;  1ILQ A;  4CJ0 B;  2J7Z A;  1U4M A;  2VXW A;  4ZLT F;  2K01 A;  1GUW A;  2K03 A;  2L4N A;  4X3U A;  3KUP A;  1RTN A;  2B2U C;  5COR A;  2HUG A;  2IL8 A;  1AZP A;  1C8C A;  2KEC A;  2K1B A;  3LWE A;  1ROD A;  1SDF A;  3H91 A;  4IUR A;  5EPL A;  1JE4 A;  2EPB A;  4IUT A;  4X3T A;  2KED A;  3DM1 A;  1WVL A;  1IKM A;  4ZK9 B;  2MPM A;  1RHP A;  5DNF A;  1EOT A;  2KVM A;  1B53 A;  4QUF A;  2KUM A;  3MTS A;  3SVM A;  1SAP A;  1DOM A;  1F9Q A;  2X6G A;  1QE6 A;  4CJ1 B;  1ML0 D;  5T1I A;  1EQT A;  2N88 A;  1WTV A;  2D9U A;  1AP0 A;  1MSH A;  2SDF A;  3ONA B;  4IUU A;  4ZKC B;  1G6Z A;  1HA6 A;  4IUQ A;  1WTO A; 
#chains in the Genus database with same CATH topology
 2XSC A;  4WJ3 M;  4DUY Q;  5JEA J;  4A76 A;  4OXP A;  2F0L A;  2F3V A;  3TS0 A;  4KK7 A;  4ZUI A;  1O7Y A;  4A3E B;  4LF5 Q;  2ZTD A;  2B63 B;  4JI1 L;  3Q23 A;  1O7Z A;  1LLR D;  1HUM A;  3JAM c;  1KIX A;  1EY9 A;  3ULJ A;  5FLX c;  3H94 A;  1KNA A;  2SOB A;  3Q22 A;  3AMU A;  1B4O A;  1C4Q A;  1I4Q A;  3BG3 A;  4MNO A;  4K5V A;  2HCI A;  2UUC L;  4H7B A;  2NBF A;  3S16 B;  3C1F A;  4OO1 I;  4A3J H;  2YYZ A;  4IFD J;  4HJ5 A;  2XNA C;  1GXD C;  2ZM6 Q;  5C44 G;  3SK5 A;  1RIP A;  3JAM L;  3S1R H;  1XYI A;  2CKZ B;  1GHK A;  5DM6 3;  3TZD A;  4LWC A;  4RKB A;  4YHH L;  5JJK A;  2V1C C;  5I2Y A;  2F0O A;  2XVS A;  4GNX A;  3TP5 A;  1VQE A;  1M4V A;  5CV6 A;  1ENA A;  4NDX A;  2CW0 D;  5CV9 A;  3G6J B;  3RNU A;  3CCJ A;  2G9D A;  3HG9 A;  1IW7 D;  1NR4 A;  4B9X A;  2Q2T A;  1HQR D;  1EY8 A;  1K83 B;  1KNE A;  1FL0 A;  2KA7 A;  3KFU A;  1VQB A;  4P74 A;  1VMP A;  1STG A;  2L9H A;  2HHH Q;  5CV7 A;  4X62 Q;  4G4K A;  1P8L A;  4R8N A;  1CKN A;  3K5M A;  3HOY G;  4IUR A;  3KBG A;  4OWW B;  3GD7 A;  3J7Z C;  2MPM A;  3PF4 A;  1GOZ A;  2EYM A;  2E8G A;  4ZYS A;  2NTS A;  5T1I A;  1NNX A;  1KTK A;  1Z7T A;  4DV1 Q;  3MFY A;  3R2T A;  2B3G A;  4MN3 A;  1VDZ A;  2A69 C;  2UXB Q;  4N8X 1;  4JK1 C;  4Q5V A;  2LFN A;  2L1B A;  4XXE A;  1X54 A;  4WJW A;  3RZO B;  1XXG A;  3NE5 B;  5JOB A;  4IN3 A;  2MNA A;  3CC2 A;  2C35 B;  2P5Z X;  4X3K A;  2MJ8 A;  4ME3 A;  2K32 A;  2LXJ A;  1PH2 A;  2NUC A;  4YCU A;  3D31 A;  3CAM A;  1QVF A;  1UAP A;  4BBS H;  1HQM C;  3DUZ A;  3FVQ A;  3BYY B;  1PTO F;  1TWF B;  4DR4 L;  2H4O A;  3PIP 3;  1B9M A;  3SEB A;  2KQ3 A;  1A6X A;  3HEJ A;  2LXK A;  4AYB E;  1IXR A;  5IYD G;  2XWJ B;  2EJF C;  3KK7 A;  4CDF C;  2ICI A;  1VQ8 A;  2SNM A;  1KXL A;  2R7Z H;  4PMW A;  4EX5 A;  3FPU B;  4NXM L;  3S1N B;  4O42 A;  5CV5 A;  1AN8 A;  1SSO A;  5KIX A;  2VUM H;  1EIF A;  2AQ2 B;  5IYB H;  1VQG A;  2O2L D;  4B3R L;  1QUQ A;  3FKI H;  4OX9 Q;  3M7G A;  2E2I H;  4P2C B;  4KKT A;  2L11 A;  1RL2 A;  1XPU A;  2R92 G;  5C3E G;  2NN6 G;  3VR5 A;  1X3P A;  2F0N A;  4DV6 Q;  1JOO A;  2RQX A;  4K2K A;  4DPG A;  4R4C A;  2Z8L A;  2R6G A;  3TME A;  2IL8 A;  2CWA A;  2K1B A;  2IY5 B;  5J3B A;  3NEN A;  3VR6 A;  1MHW C;  1EEI D;  5DNF A;  2PW7 A;  4BBS B;  1N33 Q;  3PIP A;  2I07 B;  4AYB G;  1QVC A;  4CJ1 B;  2VQF Q;  1JE5 A;  2HQL A;  4PZ7 A;  3CF5 A;  4NB3 A;  1VQI A;  2BOS A;  3TQY A;  2XRS D;  3OIQ A;  4P73 A;  1X3E A;  2B2W A;  3PF5 A;  1GUN A;  4OON A;  3Q6S A;  4H02 A;  1H9S A;  4IQZ A;  4RGT A;  3QB3 A;  1IKL A;  4RGN A;  1PRT F;  3U4Z A;  2NVQ B;  5ELF A;  1Z6H A;  4X65 Q;  2PZT A;  5IYB G;  2EYJ A;  4BY7 B;  3EA6 A;  4B3S L;  1Q81 C;  2X6L A;  4KI0 A;  2CQO A;  1EIG A;  3KLS X;  4BY1 H;  2RSN A;  2K05 A;  1WD1 A;  3IFD A;  1YNN D;  2JEA I;  2N8N A;  3VR3 A;  5BN5 A;  3I3C A;  1QB5 D;  5FLX E;  1EIY B;  3HGB A;  1K0R A;  4F88 A;  3P7J A;  2E2H B;  4GOP B;  3AB9 A;  1ET9 A;  1EUJ A;  3OPO A;  1IYU A;  3MWY W;  1SFO B;  1TS3 A;  2AKW B;  3J80 c;  1AE2 A;  1Q1B A;  5IYC H;  1XMQ Q;  2XGT A;  3H6M A;  2F0U A;  2JA7 B;  1EQV A;  3EQL C;  3NEM A;  1S72 A;  1BR9 A;  1PZK D;  3V96 A;  4LAA A;  2PYK A;  4HID A;  3WWV A;  1PH9 A;  5K36 G;  1MBY A;  1VQL A;  2OQ0 A;  3OOC A;  2HT1 A;  1VQF A;  2PW5 A;  1OXS C;  2GVB A;  1Q86 C;  3D3R A;  4R4I A;  2J4X A;  4HJ8 A;  1ENC A;  1D1K A;  4HMI A;  1D6E C;  1ASZ A;  2HDM A;  3E0E A;  3S14 H;  2VUM G;  4N9P A;  4ILW A;  2ZXR A;  4P75 A;  1PMR A;  5FLM G;  1BCP D;  2EY2 A;  4KTA A;  2DNC A;  5JJI A;  1DJR D;  2M9V A;  1LTS D;  1I5F A;  4LJZ C;  1G6P A;  3M4O B;  4DV2 Q;  2UXD L;  4A3M G;  3HRZ C;  2DY7 A;  4J8Q A;  4CHT B;  4CKC A;  5IT9 c;  2LMC B;  2BCO A;  3GTQ B;  3DMU A;  1ESF A;  3PUX A;  3GV3 A;  3T1Y L;  3QIA A;  3FDT A;  1HZB A;  5M9O A;  1SYD A;  3S1Q H;  2V4D A;  3A8J E;  1GJX A;  1EYD A;  1IKM A;  4BA2 I;  5JEA G;  1SLJ A;  5ISR A;  2KUM A;  3MTS A;  4KY6 A;  1E2W A;  1TY0 A;  4DV5 L;  1XMO Q;  3PUV A;  4A93 G;  3I4M B;  2N88 A;  2WB1 E;  3BVZ A;  3F2B A;  4IJH A;  4RGM A;  3CCV A;  1G6Z A;  1Y1W B;  1W6J A;  1GD7 A;  4U67 3;  2N49 A;  1LTI D;  4K0K L;  2PQA A;  2ZM6 L;  5J1Z A;  4DR2 L;  1NMG A;  4XYQ A;  1K9M C;  1CK1 A;  1V9P A;  3MFG A;  2JA9 A;  2RVL A;  5E7N A;  2NZ1 D;  1WTP A;  1E7Z A;  2OQK A;  3K7A B;  3NBI A;  2DUD A;  3WDN A;  2B63 H;  4B3T Q;  2FMC A;  3PUW A;  5IE8 A;  2R93 H;  3A0J A;  1YIJ A;  1HUN A;  5M5W H;  3CP0 A;  3I7F A;  5HGQ A;  2RHS B;  2NVY B;  4HR7 B;  2A19 A;  4JOI A;  4XYO A;  2F0F A;  3J80 i;  3M4P A;  1UWV A;  1GUO A;  1HPC A;  4UP9 A;  2K5V A;  1STN A;  2EXD A;  4DK1 A;  2NB0 A;  4DV7 Q;  2VL6 A;  1BNZ A;  2TMP A;  2K5W A;  3TS2 A;  5JAV A;  1LT4 D;  3I4N H;  4GKJ Q;  2R7Z B;  4B08 A;  2O4X A;  2IHF A;  3NTI A;  5GRO A;  1LM0 A;  5M5X B;  1J8I A;  4BA1 I;  3HKZ E;  4A3E G;  3NBH A;  5EPJ A;  3PO3 G;  1PYS B;  1NAP A;  4KMU C;  3J7A 5;  4IOA A;  2JA8 G;  4NKL A;  1CSP A;  1VQ4 A;  2NN6 H;  1SYF A;  4HSV A;  3AFP A;  4JI5 Q;  2AHO B;  3G4S A;  1SE2 A;  1HFN A;  3MVV A;  3K58 A;  4FP5 D;  5D14 A;  1EQQ A;  3DLL A;  4UP8 A;  1B2T A;  4DGZ A;  3P20 A;  1PYW D;  3NTH A;  4RCO A;  3ZYY X;  2L15 A;  5FLX L;  4M8A A;  4C3H B;  1TWA B;  1HZ9 A;  1NJI C;  4RKL A;  2VUM B;  3PO2 H;  3TRE A;  1HR0 W;  1V1Q A;  1M8A A;  4YY3 L;  2N78 A;  3FKI G;  2M2L A;  1S4Z A;  1SMX A;  1JB7 A;  1U4R A;  1K83 H;  1DOL A;  2F0W A;  3QWN A;  2JA7 G;  1TKW B;  3W1B A;  2EVB A;  3A7L A;  4R4T A;  1UE5 A;  1ZEQ X;  1XTC D;  2K03 A;  5K5P A;  5COR A;  3NEL A;  2PNR C;  1AEX A;  3C3L A;  1KD1 C;  1E1T A;  3J80 L;  1JJG A;  1BVS A;  4DKA C;  1TT2 A;  2UUA L;  4GLA C;  4KY7 A;  1QE6 A;  2L55 A;  2F0I A;  1Q1E A;  3CCU A;  4IUU A;  3FHW A;  4DV3 L;  1YBY A;  4Y52 H;  2JA7 H;  2B2Y A;  4JC0 A;  1EQR A;  3TRZ A;  3TZU A;  4DV0 L;  2I0Q A;  2PQA B;  3FRP B;  4DV6 L;  1K8O A;  5IT9 L;  4L5T A;  1GVP A;  1JC7 A;  1GHJ A;  3S2H B;  4X66 Q;  4O2D A;  2UUC Q;  2K28 A;  1EWI A;  1SJH D;  5JPM C;  3R93 A;  3ITP A;  4A3D B;  4B3R Q;  2NTT A;  4DUZ L;  2RKS A;  3TEH B;  4DNR B;  2MHV A;  1F2Z A;  5J22 A;  5KNC A;  5COY A;  4C3I G;  1B50 A;  2Z6K C;  3T56 B;  3OW7 A;  1JQY D;  4K6L A;  3CPW A;  2GVA A;  1I50 B;  1TQO A;  1IBK L;  1TWC B;  1L0X B;  4JBK A;  3GTG H;  1PH4 A;  4A3E H;  3GV6 A;  4Z9C B;  2HIV A;  4BS9 A;  4HIM A;  1HR0 Q;  5C5M A;  4KJO A;  4DR3 L;  1WCM H;  3OWE B;  2F0E A;  1DOK A;  4OWT B;  4DK3 C;  4PMB A;  2NVQ H;  3SR1 A;  1U0L A;  3UDF A;  4HJ7 A;  5A2Q L;  1RCV D;  2Z4H A;  4LFA L;  2UXC Q;  1STE A;  1HZA A;  2F4V L;  4TRD A;  3K7U C;  1F2Y A;  3A8K E;  3EVQ A;  5FJ8 G;  4JI4 L;  2GN5 A;  3UDG A;  3TN2 A;  4OGQ C;  4GN4 B;  4JYA Q;  3RUZ A;  2E74 C;  1MKH A;  2L12 A;  4I7Z C;  3S2D B;  2WFW A;  3SHL A;  4GZY C;  5GAD C;  5E4X A;  5IT9 E;  4C2M H;  2IT1 A;  3QOJ A;  1GM5 A;  5HGT A;  2BDN A;  1VQ6 A;  5CV4 A;  1QZH A;  4K14 A;  2Q8I B;  1W3S A;  2AWN A;  1CI3 M;  3BVG A;  2EPB A;  5ELN A;  1A3V A;  3A55 A;  3UDI A;  3ULP A;  4EGV A;  1K3R A;  1TWH B;  1D1I A;  4L5S A;  1M1K C;  3DWP A;  4V19 0;  1ZKO A;  5I2X A;  1MJC A;  3HOV B;  3K80 C;  1U5K A;  1S40 A;  2ZT9 C;  3S15 B;  3K81 C;  1E2Z A;  3I2Z A;  3CXC A;  2B2T C;  4ZRZ A;  1H9S B;  5FO9 B;  4LUO A;  2IW3 A;  5M3M H;  5LMU L;  3CW2 C;  1I6H B;  2F0G A;  3GTK H;  4IFD G;  4X3S A;  3D4W A;  4UPA A;  4C1N I;  4TVA B;  1I3Q B;  2RDH A;  1CKN B;  4A3B H;  2ZXP A;  3SK4 A;  4IJL A;  5HUR A;  5M5W B;  3M4Y A;  1ENF A;  2EDG A;  3GO5 A;  2CHB D;  4Y7N H;  1JWM D;  1JJ2 A;  4JCV E;  3BS1 A;  2VQE L;  4LF8 Q;  1HCZ A;  3CKI B;  1LT5 D;  4N8F A;  5FOB B;  1ZYR D;  4QJF A;  4ZCK A;  1EY4 A;  4MZ9 A;  1JJC B;  2XN9 C;  1J6Q A;  4DAP A;  2EJG C;  4DU9 A;  5C0X J;  2F0D A;  4BY1 G;  5M3M B;  1DCZ A;  4K5W A;  5CR3 A;  4C3J H;  1HNX L;  2F3W A;  3VYU A;  4XIG S;  1F9R A;  3HKZ G;  3L9A X;  2JYO A;  2B8F A;  4A3L G;  2JA5 B;  4RH6 A;  4F87 A;  4BXX H;  4RFB A;  2VQF L;  2NVT B;  3FEW X;  2CQA A;  2YTX A;  4KY5 A;  3PUY A;  1WOC A;  3EFX D;  2TSS A;  2Y0S E;  1PFB A;  3RD4 A;  1ZYR C;  4EQN A;  1CZG A;  1A3T A;  2A73 B;  1DD2 A;  4J1M A;  1A2T A;  1S5D D;  5C0X H;  2Y0S G;  5KYL A;  1QVG A;  1TII D;  2WB1 B;  1UNS A;  2R92 H;  5J39 A;  1VQO A;  1H95 A;  4I7A A;  4DV4 Q;  2A69 D;  4G7Z C;  2E5L Q;  3H3V H;  2JSO A;  2R93 B;  2K6A A;  4BBR H;  5M5Y B;  1LT3 D;  1KDA A;  1HH2 P;  2D0P A;  5A2Q E;  5C4J H;  4PV1 C;  1GUW A;  4X3U A;  1RTN A;  3L2P A;  3UE1 A;  3S14 B;  5DM7 3;  2JE6 I;  3W3A A;  3NP8 A;  5KGU A;  3EBE A;  1T5E A;  4C3I H;  1DOM A;  3RLF A;  4CDD C;  4J6H A;  1ML0 D;  3S16 H;  2A1A A;  3I4M H;  1WTV A;  2D9U A;  1HA6 A;  4QGU A;  3GTJ H;  2DY8 A;  1K8G A;  2KEE A;  3RZD H;  4LMQ D;  2JA6 H;  2N55 A;  1PTO D;  1XPR A;  4DR5 Q;  1Q7Y C;  3TP7 A;  2C5C A;  2VB2 X;  1I4X A;  2I5M X;  5EAY A;  3VA5 A;  1HNZ L;  4DR1 L;  2WAQ B;  4OWX B;  1LTL A;  1EZ6 A;  1CSQ A;  1II3 A;  4C3H H;  3SGI A;  3PUZ A;  4A93 B;  3M85 A;  3O13 A;  1OXV A;  4OIK A;  3IKJ A;  3DEP A;  1LYL A;  3L3O C;  2BE5 D;  4FF2 A;  4DFA A;  1OXT A;  1B9N A;  4RMF A;  1Q3L A;  4DNT B;  1O7L A;  4C3J B;  1PTO H;  1PTO C;  3K57 A;  2WAQ E;  1YJN A;  1FJG Q;  5C4X G;  3BDL A;  4A3C G;  1N8R C;  4KHZ A;  1H9J A;  3J7A V;  4BBS G;  1JCK B;  3DXJ C;  4JW0 A;  3GTM B;  3BJU A;  1AW7 A;  4QY7 A;  4HCE A;  4RA8 A;  1FNW A;  3T53 B;  1STB A;  3J7A F;  2K5H A;  1Z9F A;  2RA4 A;  3J80 E;  2WKD A;  1GUG A;  1I3Q H;  4R4O A;  4FXG C;  3OSO A;  3EIV A;  4RHR A;  3M4Q A;  3PV0 A;  3H15 A;  2KEN A;  4DR7 Q;  1PYB A;  1BO0 A;  4JG2 A;  3DWA A;  2MFI A;  2JA6 B;  1VQD A;  2KJX A;  4X64 L;  4JI6 L;  3NBH B;  3MZ5 A;  2K4K A;  2A74 C;  1TS4 A;  3CCS A;  2IPK D;  4JI1 Q;  2OEO A;  1Y8O B;  4JI8 L;  1OXU A;  1X32 A;  3HKZ B;  4QIW B;  5IP7 H;  1XNR Q;  4CJ0 B;  1Y8P B;  1ILQ A;  5C4X B;  3LWE A;  3H91 A;  4DAY B;  4A93 H;  4LK1 C;  2KBN A;  2EYH A;  4ZK9 B;  2R7F A;  5JEA H;  1ASY A;  1SAP A;  2A68 C;  2L5T A;  4E6I A;  1IHZ A;  3BZD B;  5NUC A;  3D8G A;  3E5S A;  1QIL A;  2KCM A;  5I9P A;  2KCC A;  4ZKC B;  1VF7 A;  2PPB C;  1SNC A;  4K2L A;  5C3X A;  1ESR A;  2HCC A;  4H0L C;  5BR8 Q;  3RZD B;  1YJW A;  3VDY A;  4CGY B;  3CHB D;  3D4R A;  1EY6 A;  1R4P B;  2EYP A;  2MO0 A;  3S2H H;  2QEX A;  1PH6 A;  3BYT B;  3HOZ G;  1S5E D;  3CC4 A;  4LF7 L;  3NHH A;  3STB C;  1IBK Q;  1STH A;  2ZXO A;  3K5O A;  1GUS A;  1H9R A;  4A3K G;  2H5X A;  3C2P A;  1GUT A;  1CA6 A;  1G51 A;  5ELE A;  1BUV T;  1HTL D;  2Q2H A;  2QW7 A;  4RHS A;  3VYR A;  2VW9 A;  4UDU C;  4LF5 L;  1Y1V G;  3CCQ A;  3W1G A;  2CW0 C;  2JN4 A;  2O5I C;  3MXP A;  4A3G G;  1DON A;  4XTC S;  5IGC A;  1BOS A;  3TSS A;  1IZ6 A;  4CKE A;  3RN2 A;  4C56 C;  4B3M L;  5FKA C;  5EQ0 A;  4A3F G;  3IAY A;  1Z47 A;  3QJY A;  1QG7 A;  1SNM A;  5IOD A;  4QB4 A;  2R92 B;  1EY5 A;  3RZO H;  1IYJ B;  3M4O H;  5D65 A;  4ME5 A;  4C3H G;  4K8I A;  3CQZ B;  4A3M H;  5EKK A;  1CT1 D;  2F0M A;  4DN4 M;  1HHV A;  4JI2 L;  4NXN Q;  4LF6 L;  5G3L D;  3U58 A;  3TP8 A;  5E3F A;  3T1H L;  1VCI A;  3VA7 A;  1C9O A;  2WB1 G;  3HS0 C;  1PFN A;  1NR2 A;  2F52 A;  4X6A H;  1V43 A;  2Z6B A;  1GKH A;  1IBM L;  2RCN A;  1STY A;  1FGU A;  1RTO A;  4HIK A;  4OEM B;  2ALY B;  3CME A;  2QIL A;  3MXU A;  4X64 Q;  5IYC G;  2AUK A;  2J7Z A;  1JT8 A;  2PZW A;  5BN3 A;  1AZP A;  2HUG A;  1I94 L;  5EGT A;  4J15 A;  1QWY A;  1ROD A;  1SDF A;  3KDF B;  4X3T A;  2KED A;  3DM1 A;  5BN4 A;  1F77 A;  3T1H Q;  2G9H D;  1LTA D;  1T5X D;  4GN5 A;  1QNU A;  4DA2 A;  1KDB A;  3S1R B;  2E2I B;  3FMC A;  4L5R C;  5CC4 A;  1PTO B;  2SDF A;  5GAH C;  2YU9 B;  2B39 A;  3HOZ H;  2A8V A;  1BCP B;  1SFO H;  4JI5 L;  2QCP X;  2F03 A;  3GTP B;  2BE5 C;  1HA5 A;  5IGD A;  4JI7 Q;  1L2F A;  1IL8 A;  2E2J H;  2JA8 H;  2Q8T A;  4IPH A;  4G7O C;  2ATW A;  1VQK A;  3BZC A;  3S24 A;  3F1Z A;  1V8Q A;  2F0K A;  5C6A A;  2K5Q A;  5C0X I;  4DV7 L;  2B63 G;  3STB D;  4JPB W;  2LKV A;  4JI7 L;  3EN2 A;  4XQN A;  3VYS A;  1XX8 A;  1X3F A;  4AQY L;  4A3L H;  1YIT A;  1XNQ Q;  1I4R A;  1BQQ T;  4ULL A;  2IWH A;  3HOU H;  2UUB L;  3E0J A;  3X3N A;  1EYC A;  1ILP A;  1TS2 A;  4HIO A;  1QJO A;  1J9O A;  1J5E L;  4IPG A;  4IO9 A;  1K8A C;  2EZV A;  2PMZ B;  1RF2 D;  4A3B G;  5C5L A;  1KRS A;  1D2B A;  4DAY A;  1R9T B;  3A54 A;  4HAE A;  3BZK A;  3NSW A;  5CBE E;  2B2V A;  1NBW A;  4OHJ A;  3NXW A;  3ND9 A;  5FLM H;  3G7L A;  1RDP D;  4WJ4 A;  3DWQ A;  2F0S A;  1YEZ A;  3NTK A;  2YU9 H;  5M3F H;  4QF4 A;  4P72 A;  1PDQ A;  3ERO A;  4P71 A;  1PA6 A;  3A8I E;  1KDC A;  4O1N A;  1TWG H;  3MA2 B;  3PIO 3;  1VMC A;  4PZ8 A;  5C3E B;  3HOW H;  4IFD H;  1V1P B;  2OCE A;  2MUY A;  4KN7 C;  4K6D A;  2R61 A;  3SK8 A;  2JA8 B;  4KHP Q;  1GO3 E;  1QNK A;  1LTR D;  1WJJ A;  3DHQ A;  4GN3 B;  5C44 B;  2KHS A;  3F2U A;  2E5L L;  2D62 A;  5E1F A;  2VXW A;  5LL6 S;  4GNX B;  2SNS A;  5IP9 G;  3U9S A;  4KN4 C;  3S1Q B;  3PMF A;  3HOZ B;  1KAB A;  1TS5 A;  1N34 L;  1JB3 A;  1H9K A;  2E2D C;  3S17 H;  1SEB D;  3CCR A;  1SNO A;  4FYD A;  4KLK A;  5C4Z A;  1MD2 D;  1LT6 D;  4QL5 A;  3GTQ H;  5I6Y A;  1SJE D;  3GTO B;  5F2D A;  4U68 A;  3PQI A;  1SR3 A;  1UE6 A;  3GTJ B;  4DXF A;  1G91 A;  1UEA B;  4IOC A;  2M00 A;  1E1O A;  1SXT A;  5T1G A;  1BBX C;  1ONL A;  4ZAI A;  2QA4 A;  1HRJ A;  2CFM A;  4L8J A;  2NVX B;  1YNJ D;  1G8Z D;  1PFM A;  5K36 H;  5IWA Q;  2KOL A;  1E3P A;  2ES2 A;  1Q90 A;  4JBW A;  4ODG A;  4AYB B;  1K73 C;  4LNQ A;  4YCW A;  4R9W A;  3I4M G;  3KOJ A;  1IBL Q;  2BA1 A;  2VS1 A;  3A5U A;  3KF8 A;  1IBM Q;  2WAC A;  3ERQ A;  3KJO A;  3HOU G;  4A3D G;  1PRT D;  2VQE Q;  1MJE A;  4LF8 L;  3CCL A;  4B3S Q;  2Z4I A;  1TWA H;  1HNW Q;  4X65 L;  3V05 A;  2F0T A;  3J81 E;  3U50 C;  1A0I A;  1K8M A;  5GAG C;  5IWA L;  4KD4 A;  4IFD I;  4UAI A;  1EEF D;  1UEB A;  5JJZ A;  4M1U B;  5DAU A;  3NPP A;  4KKU A;  4IZ8 A;  2B2V C;  4FXD A;  3KF8 B;  1E2V A;  1TWH H;  3CPF A;  1HR0 L;  4LF9 L;  2BH8 A;  2FMM A;  2RSO A;  3I4O A;  5C4X H;  3HOY B;  1RD9 D;  4KKS A;  1QOH A;  5IOC A;  1XNR L;  4LFB Q;  5C44 H;  1VQ5 A;  1Q8I A;  4CBV A;  1AH9 A;  5EPK A;  3I4N B;  5KRU A;  2EYL A;  5FO8 B;  4GLV B;  4POG A;  1OTC A;  4GS3 A;  1G2S A;  3N6R A;  2EE1 A;  1OXX K;  4R1J A;  1YHQ A;  2LY7 A;  3PGZ A;  4L6T B;  4A3C H;  2EIF A;  1FVI A;  2IX1 A;  1RJT A;  1FNU A;  1JIC A;  5I4D A;  2Z1C A;  1S3O A;  4R4Q A;  1I4H A;  2F4I A;  4LF9 Q;  4BWG B;  2B2U C;  4TKO B;  1Y14 B;  3P1H A;  4RCN A;  3PO2 B;  1CQF A;  1WCM B;  3M9B A;  1O78 A;  4GOP C;  2EY5 A;  4FF4 A;  3E6Z X;  3OYY A;  2IJ0 A;  1KRT A;  1F9Q A;  3MXG A;  1BKB A;  5GAE C;  2YTV A;  4RGO S;  4DV3 Q;  1AP0 A;  1Q82 C;  1FGB D;  2QDB A;  4NXM Q;  4IPC A;  2VZA A;  1WTO A;  1FJG L;  1D5M C;  3T16 A;  3EJI A;  2K5N A;  4BY7 G;  5IIF A;  1WTH A;  3NWS A;  4QMG A;  3QR8 A;  4H44 C;  1VQM A;  1PFS A;  1HNW L;  1SND A;  4A3J B;  1G29 1;  2UU9 Q;  4XQJ A;  4UP7 A;  3HOX H;  1RKN A;  4HSP A;  1YVC A;  3CCM A;  1N9W A;  1I6V C;  1VQ7 A;  1LV9 A;  1W2B A;  4XDX A;  2BH2 A;  4QIW E;  4A3G H;  5KYI A;  1L1O C;  5JJL A;  1HNZ Q;  1C0A A;  4LFC L;  5KEE A;  1YZ6 A;  2K14 A;  2Q8R E;  2A6H C;  2B2T A;  2FFK B;  3D6W A;  2UU9 L;  2D2C C;  2K04 A;  2NZO A;  2XIW A;  1WTQ A;  1BBW A;  1EU3 A;  1K28 A;  4JI0 Q;  3U4V A;  4LF4 Q;  1PHJ A;  3V2T A;  4LF6 Q;  3PO2 G;  4L5Q A;  3A7A B;  1IW7 C;  3N52 A;  5A35 A;  4GNX C;  1LTT D;  5C4J B;  1BBU A;  2DJF C;  4OL7 A;  4DR3 Q;  3GP7 A;  4HCS A;  1E0B A;  2AUJ D;  2K50 A;  4QCL A;  3OW2 A;  2LS0 1;  1PH8 A;  1HXY D;  5LHY 1;  3RMH A;  1EIH A;  4HED A;  1AE3 A;  2A5H A;  4GKK Q;  3QG1 A;  5EKI A;  3UDX A;  1JWS D;  3VR2 A;  3T51 B;  1U9R A;  4OO1 G;  2JQO A;  4JI0 L;  4A4I A;  4LF4 L;  3IL8 A;  4LUV A;  2Q2U A;  2G5D A;  2HD3 A;  4IUN A;  2KHJ A;  3GTL H;  2DNE A;  1KAW A;  4DR6 Q;  4GKJ L;  3LX0 A;  1DM0 B;  3W5O A;  4LW1 A;  3GQB A;  1A2U A;  1EYG A;  2AWO A;  1SN8 A;  4N9T A;  3AU7 A;  5EBD A;  2Z6K A;  5FO7 B;  4OEL B;  3F2C A;  2WV6 D;  4LF7 Q;  3H0G G;  4A3G B;  5L37 A;  4A3J G;  3NQI A;  2F0H A;  1X56 A;  2O5J C;  3OTO L;  3A74 A;  5I9O A;  2JA5 H;  2F4V Q;  2ZJP A;  2A6E D;  4F8M A;  4QUF A;  4DR2 Q;  2YV5 A;  2A6H D;  2RBM A;  3ERS X;  4NXN L;  3SVM A;  5AJ3 L;  4A3D H;  2WAQ G;  4A3I B;  2X6G A;  5AJ3 Q;  4AH6 A;  3FP9 A;  1STA A;  1YNN C;  5IP9 H;  1E24 A;  1UUP A;  3M7N A;  3VYT A;  4ZQ3 A;  1X3Q A;  5FK9 C;  4MTN A;  2E76 C;  1NE3 A;  3K0X A;  3I72 A;  4XT1 B;  1B44 D;  3GTP H;  2RCF A;  3SE0 A;  4NW2 A;  4DK6 C;  4PZ6 A;  4JOI C;  4JI8 Q;  3D6C A;  3RLN A;  3I8Z A;  3RR5 A;  1MI2 A;  1HTP A;  5CV8 A;  1DGS A;  3C46 A;  1X65 A;  1K0S A;  1BXT A;  2PCF B;  4DR7 L;  3A5Z B;  1B70 B;  2QKI C;  2CVR A;  4TSS A;  4WOR A;  4FF3 A;  2XWB B;  1E22 A;  4GKK L;  4GLX A;  4G57 A;  1ICW A;  1A62 A;  3BDO A;  2JEB I;  4R8I A;  5M3F G;  1CHQ D;  2PO4 A;  1WTX A;  1ZXT A;  2MGS A;  2RDG A;  4FDB A;  3CQZ H;  4A3M B;  4APV A;  1VQN A;  4YCV A;  1MIU A;  4DV0 Q;  5JVG 3;  1Y1W H;  1LUZ A;  2Z0S A;  3DM3 A;  5LL6 X;  3OIP A;  2JA6 G;  3HOW G;  1D7Q A;  1I4G A;  2F0Q A;  1N34 Q;  3NUC A;  1CTM A;  1EWH A;  1B8A A;  3IFT A;  1NUC A;  2X69 A;  1LO5 D;  1XMO L;  4GOP A;  4A3F B;  5EKL A;  3KF6 A;  4OO1 H;  1VQA A;  1X3G A;  3KLW A;  3MHB A;  3S2D H;  2D0O A;  3D0F A;  3AFQ A;  2EJM A;  2KCT A;  2ZJR A;  2HDL A;  5GQO A;  4BXX G;  1V1P A;  2IHE A;  1JWU D;  3NQT A;  3Q24 A;  1MSG A;  3HP3 A;  2PZU A;  4WFN 3;  4A3B B;  1PZJ D;  3PO3 B;  3K7A H;  4ZUJ A;  1SMY C;  1EFW A;  2OT2 A;  1SRU A;  1UE7 A;  1A63 A;  4IUT A;  1YNX A;  4IAL A;  1CUK A;  3GTG B;  2NVY H;  3KYH C;  2KVM A;  3Q0A A;  5IGF A;  3GTM H;  4BBR G;  2RDF A;  2K7V A;  4Q0F A;  3ULL A;  5LMN W;  4C1N K;  3OTO Q;  4EQ5 A;  1WFQ A;  4C3J G;  1Y8N B;  4B9W A;  2WIN B;  3R8B A;  1QUQ B;  1HFG A;  4MIU A;  3TBI B;  1LTG D;  2K33 A;  1N33 L;  2UUB Q;  3J81 L;  1CQV A;  2Z9H A;  1BF4 A;  2J0T D;  3AQQ A;  1EL0 A;  4QUC A;  1XMQ L;  2A68 D;  5ELC A;  1CKM A;  2EY6 A;  5LMN L;  1U4P A;  2EY1 A;  5CGK A;  2ZJQ A;  4BY7 H;  3I90 A;  1SYG A;  2SEB D;  3VR4 A;  4DR6 L;  3WOF A;  1X55 A;  2B8G A;  1BCP F;  3J81 j;  3CC7 A;  4LFB L;  1FNV A;  1R4Q B;  1UE1 A;  3OMC A;  1TWC H;  1L0Y B;  1FD7 D;  2A6E C;  4OX9 L;  2ZTE A;  4NMZ A;  3J81 c;  5ELO A;  3F8T A;  1CFM A;  1JMC A;  4DR1 Q;  1W6K A;  4AIM A;  1YNJ C;  3W2D A;  3PSI A;  1Y1W G;  3K5L A;  2OXP A;  5BR8 L;  2CCZ A;  5E4W C;  2BDO A;  3UE0 A;  2MO1 A;  2QDL A;  4EQO A;  5H1S E;  3IRB A;  4JBJ A;  3MXN A;  1WTW A;  1CM9 A;  2H1E A;  2N3S A;  4DNI A;  2YTY A;  1Y69 U;  1KQS A;  4PNY A;  2OTJ A;  4O0A A;  2VY3 A;  3ER0 A;  3K0Y A;  3NK9 A;  3S1M B;  3U9O A;  4A75 A;  2B2Y C;  2F0P A;  5M3M G;  4BY1 B;  4L63 B;  2Y0S B;  4A3F H;  1C48 A;  5IGE A;  1WI5 A;  4MHE A;  4LFC Q;  5AFW A;  3PO3 H;  3GTK B;  3I55 A;  4AQY Q;  3OWF A;  1A15 A;  3ZJY C;  3RN5 A;  1PV4 A;  4JI6 Q;  3QOL A;  4YY3 Q;  4XQQ A;  2NN6 I;  1SE3 A;  1PZI D;  1YHB A;  4DXG A;  2I46 A;  4JI3 L;  3L7Z C;  4EVO A;  4JV5 Q;  3HOY H;  4DAM A;  1VQH A;  3PCO B;  4KJN A;  3G48 A;  1B53 A;  2JA5 G;  2UXB L;  2AQ1 B;  3J7Y W;  1SE4 A;  2BA0 A;  2RHQ B;  2PQE A;  3MXN B;  1M90 C;  4CKB A;  1JR0 D;  1MSH A;  3CU7 A;  1QCB D;  3SK6 A;  3R2I A;  3P75 A;  3SDZ A;  1PRT B;  4JBM A;  4G7H C;  1F2L A;  1EWC A;  3F2D A;  3JAM E;  3D4D A;  5CYU A;  4KHP L;  2L0C A;  1T9H A;  1AFP A;  3DEO A;  2HHH L;  1F9S A;  4EQP A;  1SYE A;  1JOK A;  3I70 A;  1XJV A;  3KLS A;  3ND8 A;  2NWG A;  2EQS A;  1TY2 A;  4JYA L;  1K3B C;  1B7Y B;  1PH7 A;  2CH4 A;  3MEH A;  3CMA A;  3X3M A;  1VF5 C;  4DR5 L;  4A3I H;  4HJA A;  1DYQ A;  1PXU A;  1L1O A;  4PQX A;  1PH3 A;  1A8V A;  1O80 A;  1TR5 A;  4CJ2 C;  4LFA Q;  2UXC L;  2DJG C;  1SNP A;  4IPD A;  3S17 B;  3MEF A;  1TWF H;  1FYC A;  4YWM A;  3CD6 A;  1SYC A;  4YIJ A;  5KND A;  3UI2 A;  2IX0 A;  1G2T A;  1SRO A;  4ZKB B;  3GDE A;  1D8L A;  2MQH A;  1VQ9 A;  1SNQ A;  1WYD A;  3HFZ B;  4CDE C;  2CWP A;  5M5X H;  3S1N H;  1KL9 A;  1N32 L;  1FR3 A;  5ELB A;  4KD3 A;  1WTR A;  1IBL L;  3GTL B;  3CRL C;  3AEV A;  3HOX G;  2WP8 J;  4XT3 B;  2OF1 A;  2B2U A;  1PLF A;  3R3O A;  5LMN Q;  1F2M A;  4DUZ Q;  4TQU S;  3T13 A;  1TWG B;  1YHA A;  1NMF A;  1SBB B;  2JJQ A;  5LMU Q;  5C4H A;  4ZLT F;  2CH4 W;  4S3S A;  1S5B D;  3TP6 A;  1C8C A;  1Q12 A;  2OTL A;  3JAM i;  1JE4 A;  1N32 Q;  3BDC A;  1PVO A;  1X9N A;  1RHP A;  3LGJ A;  1EOT A;  4PMC A;  1DXM A;  2K5D A;  1KLG D;  4K0K Q;  4ABN A;  1BDO A;  2Q2I A;  1EQT A;  4A3K H;  1CZW A;  4DF7 A;  4NP5 A;  5JPN C;  2C9O A;  2I5H A;  1CKO A;  1X6O A;  1OO9 B;  2QGQ A;  1Q46 A;  2ZTC A;  3K5N A;  2UUA Q;  4KHV A;  1EY7 A;  1Y1V H;  2XTI A;  1ET6 A;  1I50 H;  2KHI A;  3T4A C;  4MTK A;  5CBA E;  2NYZ D;  3OHX C;  2HQE A;  4DR4 Q;  1LAB A;  5IY0 A;  5IGB A;  4IUP A;  4KV6 A;  2K52 A;  2WKC A;  1WD0 A;  4A3I G;  3S15 H;  2R7D A;  1O7I A;  1R9T H;  1SYB A;  4ALP A;  5CMD A;  3CRK C;  5EJW A;  4FNF A;  4JI2 Q;  2D5D A;  3PIO A;  3CCE A;  3FPP A;  2R3Z A;  1CA5 A;  1V1O A;  3H0G B;  2JK8 A;  2RF4 A;  4UHV A;  1H9M A;  3E9I A;  1EZ8 A;  1J5E Q;  3HKS A;  4ID6 A;  4Y7N B;  3I4N G;  2PNH A;  1L0W A;  1I6H H;  5I6W A;  1P16 A;  2R93 G;  4DUY L;  2XRQ D;  3KBX A;  3E9H A;  5ELD A;  5D3D A;  4IUV A;  3MC0 B;  1PH5 A;  1B1Z A;  2E75 C;  2F0J A;  2VB3 X;  1D5X C;  3BU2 A;  3J81 i;  1S5C D;  5C0X G;  3G6E A;  1JOQ A;  1L1O B;  1EY0 A;  1EU4 A;  3B6Y A;  1VQP A;  2GA4 B;  1YJ9 A;  4JV5 L;  1PRT C;  4WRD A;  3FKI B;  2LSS A;  1S5F D;  3AYH B;  3A56 A;  4JI3 Q;  4K5X A;  5JVH 3;  1TVX A;  3HOV H;  1ICF B;  4QQB X;  1XWE A;  1Q8K A;  1NCV A;  1D5Z C;  1SMY D;  3BVM A;  3H09 A;  4DV4 L;  3NWT A;  1U4L A;  1KC8 C;  2E2J B;  4A3K B;  5IYD H;  4I65 A;  3Q8D A;  1U4M A;  2AQ3 B;  2EYF A;  3S9W A;  4CDC C;  3LWU A;  2KEC A;  2PI2 E;  5EPL A;  3I4L A;  1WVL A;  1Y1V B;  5DEH A;  3G71 A;  2WII B;  2ID0 A;  1XPO A;  1A3U A;  4FVM A;  3M3Y H;  1XTD A;  4IUQ A;  1NSN S;  2JXM B;  3H3V C;  1NTG A;  2OWO A;  5EBC A;  1HNX Q;  2I5L X;  1EOV A;  3I91 A;  5TSS A;  1QZG A;  3L0O A;  2MP1 A;  5IGG A;  1XNQ L;  3KLR A;  3ICE A;  1TU2 B;  1F9P A;  3URY A;  2QF7 A;  3I56 A;  1I4P A;  1NY4 A;  4BBR B;  5M5Y H;  4DK0 A;  1AZQ A;  2PI2 A;  4F7X A;  4C3I B;  1B3A A;  3H0G H;  4HN7 A;  1DZ1 A;  1IYV A;  1KHI A;  3KDF A;  3SXH A;  1B3Q A;  3S1M H;  2EYO A;  4RG1 A;  3MAQ A;  3GTO H;  2NZH A;  1HJP A;  3WOE A;  2EOT A;  5DLQ E;  4X66 L;  2F1M A;  4H13 C;  4DV2 L;  1WCM G;  4HTH A;  5D3I B;  3HOV G;  3KF6 B;  1MGS A;  2NVX H;  3H3V I;  2F3I A;  4B3T L;  2B2W C;  4NPS A;  3TDQ A;  2F0V A;  4OIJ A;  5KNB A;  5IP7 G;  5HY6 A;  5G3L F;  1JOR A;  1VQJ A;  4B3M Q;  2NVT H;  2AMC B;  3QO2 A;  4PG3 A;  4JVZ A;  2PMZ E;  2HIX A;  2KCN A;  5M3F B;  5FJ8 H;  2E2H H;  3K59 A;  1I94 Q;  2ASB A;  3RLO A;  2FXQ A;  1HZC A;  2DGY A;  2IX3 A;  1C7Y A;  1SE8 A;  1YI2 A;  4UY8 C;  4X62 L;  2K75 A;  4RWS C;  1EFI D;  4K8J A;  5C3E H;  4V0B A;  3HOW B;  1KAA A;  4HMJ A;  1N36 L;  2DN8 A;  4FF1 A;  4RAU C;  1CHP D;  4C2M B;  1BCP C;  2JP1 A;  2FJ2 A;  2ENB A;  4HJ9 A;  2R7Z G;  2B29 A;  3HOX B;  1LAC A;  3T1Y Q;  4JI4 Q;  1VQC A;  2FIN B;  2QEJ C;  2FHT A;  4FO2 A;  2K01 A;  3E3X A;  4POF A;  2L4N A;  3KUP A;  2UXD Q;  1TXY A;  1N36 Q;  3JC6 6;  4YWK A;  5C3W A;  4FXK C;  1EYA A;  4DAV A;  3I73 A;  3K6O A;  3HOU B;  3OMG A;  2VNU D;  3KJP A;  4LUZ A;  1VS0 A;  4DV5 Q;  4YWL A;  4YHH Q;  1LTB D;  3C1E A;  1IL2 A;  3M3Y B;  1KLU D;  4DV1 L;  1PH1 A;  2EXZ A;  3ONA B;  3HZX A;  2ICE C;  3K8A A;  3LNN A; 
#chains in the Genus database with same CATH homology
 2XSC A;  5JEA J;  2F0L A;  2F3V A;  4KK7 A;  4ZUI A;  1O7Y A;  4A3E B;  2B63 B;  3Q23 A;  1O7Z A;  1LLR D;  1HUM A;  1EY9 A;  3H94 A;  1KNA A;  2SOB A;  3Q22 A;  3AMU A;  1B4O A;  1C4Q A;  1I4Q A;  3BG3 A;  4K5V A;  2HCI A;  4H7B A;  2NBF A;  3S16 B;  3C1F A;  4OO1 I;  2YYZ A;  4IFD J;  2XNA C;  1GXD C;  3SK5 A;  3JAM L;  1XYI A;  1GHK A;  5DM6 3;  3TZD A;  4RKB A;  5I2Y A;  2F0O A;  2XVS A;  3TP5 A;  1M4V A;  5CV6 A;  1ENA A;  4NDX A;  2CW0 D;  5CV9 A;  3G6J B;  2G9D A;  3HG9 A;  1IW7 D;  1NR4 A;  4B9X A;  1HQR D;  1EY8 A;  1K83 B;  1KNE A;  2KA7 A;  1VMP A;  1STG A;  2L9H A;  5CV7 A;  4G4K A;  4R8N A;  3K5M A;  4IUR A;  3KBG A;  3GD7 A;  2MPM A;  1GOZ A;  2EYM A;  4ZYS A;  2NTS A;  5T1I A;  1KTK A;  1Z7T A;  3MFY A;  3R2T A;  4MN3 A;  1VDZ A;  2A69 C;  4JK1 C;  4Q5V A;  2LFN A;  2L1B A;  4XXE A;  4WJW A;  3RZO B;  1XXG A;  3NE5 B;  5JOB A;  4IN3 A;  4X3K A;  2MJ8 A;  2K32 A;  2NUC A;  3D31 A;  1UAP A;  1HQM C;  3DUZ A;  3FVQ A;  3BYY B;  1PTO F;  1TWF B;  2H4O A;  3PIP 3;  1B9M A;  3SEB A;  2KQ3 A;  1A6X A;  3HEJ A;  2XWJ B;  2EJF C;  3KK7 A;  2ICI A;  2SNM A;  4PMW A;  3FPU B;  3S1N B;  4O42 A;  5CV5 A;  1AN8 A;  1SSO A;  5KIX A;  2AQ2 B;  2O2L D;  3M7G A;  4P2C B;  4KKT A;  2L11 A;  2NN6 G;  3VR5 A;  1X3P A;  2F0N A;  1JOO A;  2RQX A;  4K2K A;  2Z8L A;  2R6G A;  3TME A;  2IL8 A;  2K1B A;  3VR6 A;  1EEI D;  5DNF A;  2PW7 A;  4BBS B;  2I07 B;  4CJ1 B;  2BOS A;  2XRS D;  3OIQ A;  2B2W A;  1GUN A;  3Q6S A;  1H9S A;  4IQZ A;  4RGT A;  3QB3 A;  1IKL A;  4RGN A;  1PRT F;  2NVQ B;  5ELF A;  1Z6H A;  2PZT A;  2EYJ A;  4BY7 B;  3EA6 A;  2X6L A;  4KI0 A;  1EIG A;  3KLS X;  2RSN A;  2K05 A;  1WD1 A;  3IFD A;  1YNN D;  2JEA I;  3VR3 A;  5BN5 A;  3I3C A;  1QB5 D;  5FLX E;  3HGB A;  2E2H B;  4F88 A;  3P7J A;  3AB9 A;  1ET9 A;  3OPO A;  1IYU A;  3MWY W;  1SFO B;  1TS3 A;  1Q1B A;  3H6M A;  2F0U A;  2JA7 B;  1EQV A;  3EQL C;  1BR9 A;  1PZK D;  3V96 A;  4LAA A;  2PYK A;  5K36 G;  1MBY A;  3OOC A;  2PW5 A;  1OXS C;  3D3R A;  2J4X A;  1ENC A;  1D1K A;  4HMI A;  1D6E C;  2HDM A;  4N9P A;  4ILW A;  2ZXR A;  1PMR A;  1BCP D;  2EY2 A;  2DNC A;  4KTA A;  1DJR D;  2M9V A;  1LTS D;  4LJZ C;  3M4O B;  3HRZ C;  2DY7 A;  4J8Q A;  4CHT B;  4CKC A;  2LMC B;  3GTQ B;  2BCO A;  3DMU A;  1ESF A;  3PUX A;  3GV3 A;  3QIA A;  3FDT A;  5M9O A;  1SYD A;  2V4D A;  3A8J E;  1GJX A;  1EYD A;  1IKM A;  4BA2 I;  5JEA G;  5ISR A;  2KUM A;  3MTS A;  4KY6 A;  1E2W A;  1TY0 A;  3PUV A;  3I4M B;  2N88 A;  3BVZ A;  4RGM A;  1G6Z A;  1Y1W B;  1W6J A;  4U67 3;  1LTI D;  5J1Z A;  4XYQ A;  1CK1 A;  3MFG A;  2RVL A;  2NZ1 D;  1WTP A;  3K7A B;  3NBI A;  3WDN A;  2FMC A;  3PUW A;  1HUN A;  2NVY B;  4HR7 B;  4XYO A;  2F0F A;  1GUO A;  1HPC A;  1STN A;  4DK1 A;  2NB0 A;  1BNZ A;  2TMP A;  2K5W A;  5JAV A;  1LT4 D;  2R7Z B;  4B08 A;  2O4X A;  3NTI A;  1J8I A;  5M5X B;  4BA1 I;  3NBH A;  5EPJ A;  1NAP A;  4KMU C;  4NKL A;  2NN6 H;  1SYF A;  4HSV A;  1SE2 A;  1HFN A;  3MVV A;  3K58 A;  4FP5 D;  5D14 A;  1B2T A;  4DGZ A;  3P20 A;  1PYW D;  3NTH A;  4RCO A;  3ZYY X;  5FLX L;  4M8A A;  4C3H B;  1TWA B;  2VUM B;  4RKL A;  1M8A A;  2M2L A;  1S4Z A;  1U4R A;  1DOL A;  2F0W A;  3QWN A;  1TKW B;  2EVB A;  3A7L A;  1ZEQ X;  1XTC D;  2K03 A;  5K5P A;  5COR A;  2PNR C;  1AEX A;  3C3L A;  3J80 L;  1TT2 A;  4KY7 A;  1QE6 A;  2L55 A;  2F0I A;  1Q1E A;  4IUU A;  2B2Y A;  3TZU A;  3FRP B;  1K8O A;  5IT9 L;  1JC7 A;  1GHJ A;  3S2H B;  2K28 A;  1SJH D;  5JPM C;  3R93 A;  3ITP A;  4A3D B;  2NTT A;  2RKS A;  4DNR B;  2MHV A;  1F2Z A;  5J22 A;  5KNC A;  5COY A;  4C3I G;  1B50 A;  3T56 B;  3OW7 A;  1JQY D;  4K6L A;  1I50 B;  1TQO A;  1TWC B;  1L0X B;  3GV6 A;  4Z9C B;  4BS9 A;  5C5M A;  4KJO A;  3OWE B;  2F0E A;  1DOK A;  4PMB A;  3SR1 A;  5A2Q L;  1RCV D;  2Z4H A;  1STE A;  4TRD A;  1F2Y A;  3A8K E;  3EVQ A;  3TN2 A;  4OGQ C;  3S2D B;  3RUZ A;  2E74 C;  4I7Z C;  2L12 A;  3SHL A;  4GZY C;  5E4X A;  5IT9 E;  2IT1 A;  3QOJ A;  5HGT A;  2BDN A;  5CV4 A;  4K14 A;  2Q8I B;  2AWN A;  1CI3 M;  3BVG A;  2EPB A;  1A3V A;  3A55 A;  4EGV A;  1TWH B;  1D1I A;  3DWP A;  4V19 0;  1ZKO A;  5I2X A;  3HOV B;  2ZT9 C;  3S15 B;  1E2Z A;  2B2T C;  4ZRZ A;  1H9S B;  5FO9 B;  2IW3 A;  1I6H B;  2F0G A;  4IFD G;  4X3S A;  3D4W A;  4C1N I;  1I3Q B;  2RDH A;  2ZXP A;  3SK4 A;  5HUR A;  5M5W B;  3M4Y A;  1ENF A;  2EDG A;  3GO5 A;  2CHB D;  1JWM D;  3BS1 A;  1HCZ A;  3CKI B;  1LT5 D;  5FOB B;  1ZYR D;  1EY4 A;  2XN9 C;  4DAP A;  2EJG C;  4DU9 A;  5C0X J;  2F0D A;  5M3M B;  1DCZ A;  4K5W A;  5CR3 A;  2F3W A;  3VYU A;  4XIG S;  1F9R A;  3L9A X;  2JYO A;  2B8F A;  2JA5 B;  4RH6 A;  4F87 A;  4RFB A;  2NVT B;  3FEW X;  2CQA A;  4KY5 A;  3PUY A;  3EFX D;  2TSS A;  1PFB A;  3RD4 A;  1ZYR C;  4EQN A;  1CZG A;  1A3T A;  2A73 B;  1DD2 A;  4J1M A;  1A2T A;  1S5D D;  5C0X H;  5KYL A;  1TII D;  2WB1 B;  1UNS A;  5J39 A;  2A69 D;  4G7Z C;  2JSO A;  2R93 B;  2K6A A;  5M5Y B;  1LT3 D;  1KDA A;  5A2Q E;  4PV1 C;  1GUW A;  4X3U A;  1RTN A;  3S14 B;  5DM7 3;  2JE6 I;  3W3A A;  3NP8 A;  5KGU A;  1T5E A;  1DOM A;  3RLF A;  4J6H A;  1ML0 D;  1WTV A;  2D9U A;  1HA6 A;  2DY8 A;  2KEE A;  4LMQ D;  2N55 A;  1PTO D;  3TP7 A;  2C5C A;  2VB2 X;  1I4X A;  3VA5 A;  2WAQ B;  1EZ6 A;  1II3 A;  3PUZ A;  4A93 B;  3M85 A;  3O13 A;  1OXV A;  4OIK A;  3IKJ A;  3DEP A;  3L3O C;  2BE5 D;  4FF2 A;  4DFA A;  1OXT A;  1B9N A;  1Q3L A;  4DNT B;  1O7L A;  4C3J B;  1PTO H;  1PTO C;  3K57 A;  3BDL A;  4KHZ A;  1H9J A;  3J7A V;  1JCK B;  3DXJ C;  3GTM B;  1AW7 A;  4HCE A;  4RA8 A;  1FNW A;  3T53 B;  1STB A;  3J7A F;  3J80 E;  2RA4 A;  2WKD A;  1GUG A;  4FXG C;  3OSO A;  4RHR A;  3PV0 A;  1BO0 A;  3DWA A;  2JA6 B;  2KJX A;  3MZ5 A;  2A74 C;  1TS4 A;  2IPK D;  2OEO A;  1Y8O B;  1OXU A;  1X32 A;  3HKZ B;  4QIW B;  4CJ0 B;  1Y8P B;  1ILQ A;  5C4X B;  3LWE A;  3H91 A;  4LK1 C;  2EYH A;  4ZK9 B;  5JEA H;  1SAP A;  2A68 C;  2L5T A;  4E6I A;  1IHZ A;  3BZD B;  5NUC A;  3D8G A;  3E5S A;  1QIL A;  5I9P A;  2KCC A;  4ZKC B;  1VF7 A;  2PPB C;  1SNC A;  4K2L A;  5C3X A;  1ESR A;  2HCC A;  4H0L C;  3RZD B;  4CGY B;  3CHB D;  3D4R A;  1EY6 A;  1R4P B;  2EYP A;  3BYT B;  1S5E D;  3NHH A;  1STH A;  2ZXO A;  3K5O A;  1GUS A;  1H9R A;  3C2P A;  1GUT A;  1CA6 A;  5ELE A;  1BUV T;  1HTL D;  4RHS A;  3VYR A;  4UDU C;  2CW0 C;  2O5I C;  3MXP A;  1DON A;  4XTC S;  5IGC A;  1BOS A;  3TSS A;  4CKE A;  4C56 C;  5FKA C;  5EQ0 A;  3IAY A;  1Z47 A;  3QJY A;  1QG7 A;  1SNM A;  5IOD A;  4QB4 A;  2R92 B;  1EY5 A;  5D65 A;  4ME5 A;  4C3H G;  4K8I A;  3CQZ B;  5EKK A;  1CT1 D;  2F0M A;  4DN4 M;  1HHV A;  5G3L D;  3TP8 A;  5E3F A;  1VCI A;  3VA7 A;  3HS0 C;  1PFN A;  1NR2 A;  1V43 A;  1STY A;  1RTO A;  2QIL A;  3MXU A;  2AUK A;  2J7Z A;  2PZW A;  5BN3 A;  1AZP A;  2HUG A;  5EGT A;  1QWY A;  1ROD A;  1SDF A;  4X3T A;  2KED A;  3DM1 A;  5BN4 A;  1F77 A;  2G9H D;  1T5X D;  1LTA D;  1QNU A;  4DA2 A;  1KDB A;  3S1R B;  2E2I B;  3FMC A;  5CC4 A;  1PTO B;  2SDF A;  2YU9 B;  2B39 A;  1BCP B;  2QCP X;  2F03 A;  3GTP B;  2BE5 C;  1HA5 A;  5IGD A;  1IL8 A;  2Q8T A;  4G7O C;  1V8Q A;  2F0K A;  5C6A A;  2K5Q A;  5C0X I;  2LKV A;  4XQN A;  3VYS A;  1XX8 A;  1I4R A;  1BQQ T;  4ULL A;  2IWH A;  3E0J A;  3X3N A;  1EYC A;  1ILP A;  1TS2 A;  1QJO A;  1J9O A;  2EZV A;  2PMZ B;  1RF2 D;  5C5L A;  1D2B A;  4DAY A;  1R9T B;  3A54 A;  4HAE A;  3NSW A;  5CBE E;  2B2V A;  4OHJ A;  3NXW A;  3ND9 A;  3G7L A;  1RDP D;  3DWQ A;  2F0S A;  3NTK A;  4QF4 A;  1PDQ A;  3ERO A;  3A8I E;  1KDC A;  4O1N A;  3MA2 B;  3PIO 3;  1VMC A;  5C3E B;  4IFD H;  1V1P B;  2MUY A;  4KN7 C;  4K6D A;  2R61 A;  3SK8 A;  2JA8 B;  1QNK A;  1LTR D;  3DHQ A;  5C44 B;  2KHS A;  3F2U A;  2D62 A;  5E1F A;  2VXW A;  5LL6 S;  2SNS A;  3U9S A;  4KN4 C;  3S1Q B;  3PMF A;  3HOZ B;  1KAB A;  1TS5 A;  1JB3 A;  1H9K A;  2E2D C;  1SEB D;  1SNO A;  4FYD A;  5C4Z A;  1MD2 D;  1LT6 D;  5I6Y A;  1SJE D;  3GTO B;  5F2D A;  4U68 A;  3GTJ B;  4DXF A;  1G91 A;  1UEA B;  2M00 A;  1SXT A;  5T1G A;  1BBX C;  1ONL A;  4ZAI A;  1HRJ A;  4L8J A;  2NVX B;  1YNJ D;  1G8Z D;  1PFM A;  5K36 H;  2KOL A;  1Q90 A;  4JBW A;  4ODG A;  4AYB B;  4R9W A;  2BA1 A;  3KF8 A;  2WAC A;  3ERQ A;  1PRT D;  2Z4I A;  3V05 A;  2F0T A;  3J81 E;  1K8M A;  4KD4 A;  4IFD I;  4UAI A;  1EEF D;  5JJZ A;  4M1U B;  5DAU A;  3NPP A;  4KKU A;  4IZ8 A;  2B2V C;  4FXD A;  1E2V A;  3HOY B;  2FMM A;  2RSO A;  1RD9 D;  4KKS A;  1QOH A;  5IOC A;  1Q8I A;  4CBV A;  5EPK A;  3I4N B;  5KRU A;  2EYL A;  5FO8 B;  1G2S A;  3N6R A;  2EE1 A;  1OXX K;  2LY7 A;  4L6T B;  2IX1 A;  1RJT A;  1FNU A;  1JIC A;  5I4D A;  2Z1C A;  1I4H A;  2F4I A;  4BWG B;  2B2U C;  4TKO B;  3P1H A;  4RCN A;  3PO2 B;  1CQF A;  1WCM B;  1O78 A;  4FF4 A;  2EY5 A;  3E6Z X;  2IJ0 A;  1F9Q A;  3MXG A;  4RGO S;  1AP0 A;  1FGB D;  2QDB A;  1WTO A;  1D5M C;  3T16 A;  3EJI A;  5IIF A;  3NWS A;  4QMG A;  4H44 C;  1SND A;  4A3J B;  1G29 1;  4XQJ A;  1RKN A;  4HSP A;  1I6V C;  1LV9 A;  4XDX A;  5KYI A;  5KEE A;  2Q8R E;  2A6H C;  2B2T A;  2FFK B;  3D6W A;  2D2C C;  2K04 A;  1WTQ A;  2XIW A;  1EU3 A;  3V2T A;  3A7A B;  1IW7 C;  3N52 A;  5A35 A;  1LTT D;  5C4J B;  4OL7 A;  3GP7 A;  4HCS A;  1E0B A;  2AUJ D;  4QCL A;  2LS0 1;  1HXY D;  5LHY 1;  3RMH A;  1EIH A;  4HED A;  2A5H A;  3QG1 A;  5EKI A;  1JWS D;  3VR2 A;  3T51 B;  1U9R A;  4OO1 G;  3IL8 A;  4IUN A;  2DNE A;  3LX0 A;  1DM0 B;  3GQB A;  1A2U A;  2AWO A;  4N9T A;  3AU7 A;  5EBD A;  5FO7 B;  2WV6 D;  4A3G B;  3NQI A;  2F0H A;  2O5J C;  5I9O A;  2A6E D;  4F8M A;  4QUF A;  2A6H D;  2RBM A;  3SVM A;  4A3I B;  2X6G A;  1STA A;  1YNN C;  1UUP A;  3M7N A;  3VYT A;  4ZQ3 A;  1X3Q A;  5FK9 C;  2E76 C;  3I72 A;  4XT1 B;  1B44 D;  3SE0 A;  4NW2 A;  3D6C A;  3I8Z A;  1MI2 A;  1HTP A;  5CV8 A;  3C46 A;  1BXT A;  2PCF B;  4WOR A;  2QKI C;  2CVR A;  4TSS A;  4FF3 A;  2XWB B;  4G57 A;  1ICW A;  3BDO A;  2JEB I;  4R8I A;  1CHQ D;  2PO4 A;  1WTX A;  1ZXT A;  2MGS A;  2RDG A;  4A3M B;  5JVG 3;  5LL6 X;  3OIP A;  1I4G A;  2F0Q A;  3NUC A;  1CTM A;  1EWH A;  3IFT A;  1NUC A;  2X69 A;  1LO5 D;  4A3F B;  5EKL A;  4OO1 H;  3MHB A;  2EJM A;  2HDL A;  1V1P A;  1JWU D;  3NQT A;  3Q24 A;  1MSG A;  3HP3 A;  2PZU A;  4WFN 3;  4A3B B;  1PZJ D;  3PO3 B;  4ZUJ A;  1SMY C;  2OT2 A;  4IUT A;  3GTG B;  4IAL A;  3Q0A A;  2KVM A;  5IGF A;  2RDF A;  2K7V A;  4Q0F A;  4C1N K;  4C3J G;  1Y8N B;  4B9W A;  2WIN B;  3R8B A;  1HFG A;  4MIU A;  3TBI B;  1LTG D;  2K33 A;  3J81 L;  1CQV A;  1BF4 A;  2J0T D;  1EL0 A;  4QUC A;  2A68 D;  5ELC A;  2EY6 A;  1U4P A;  2EY1 A;  5CGK A;  3I90 A;  1SYG A;  2SEB D;  3VR4 A;  3WOF A;  2B8G A;  1BCP F;  1FNV A;  1R4Q B;  3OMC A;  1L0Y B;  1FD7 D;  2A6E C;  4NMZ A;  1CFM A;  1W6K A;  1YNJ C;  3W2D A;  3K5L A;  2OXP A;  5E4W C;  2BDO A;  4EQO A;  3MXN A;  1WTW A;  1CM9 A;  2H1E A;  1Y69 U;  4PNY A;  3K0Y A;  3NK9 A;  3S1M B;  3U9O A;  2B2Y C;  2F0P A;  4BY1 B;  4L63 B;  2Y0S B;  1C48 A;  5IGE A;  4MHE A;  5AFW A;  3GTK B;  3OWF A;  1A15 A;  3QOL A;  4XQQ A;  2NN6 I;  1SE3 A;  1PZI D;  4DXG A;  2I46 A;  3L7Z C;  4EVO A;  4KJN A;  1B53 A;  2AQ1 B;  3J7Y W;  1SE4 A;  2BA0 A;  2PQE A;  4CKB A;  1JR0 D;  1MSH A;  3CU7 A;  1QCB D;  3SK6 A;  3R2I A;  3P75 A;  3SDZ A;  1PRT B;  4G7H C;  1F2L A;  1EWC A;  3JAM E;  3D4D A;  5CYU A;  2L0C A;  1AFP A;  3DEO A;  1F9S A;  4EQP A;  1SYE A;  1JOK A;  3I70 A;  3KLS A;  3ND8 A;  2NWG A;  1TY2 A;  3MEH A;  3X3M A;  1VF5 C;  1DYQ A;  1PXU A;  4PQX A;  1O80 A;  1TR5 A;  4CJ2 C;  1SNP A;  3S17 B;  1FYC A;  1SYC A;  4YIJ A;  5KND A;  3UI2 A;  2IX0 A;  1G2T A;  4ZKB B;  1SNQ A;  1FR3 A;  5ELB A;  4KD3 A;  1WTR A;  3GTL B;  3CRL C;  2WP8 J;  4XT3 B;  2OF1 A;  2B2U A;  1PLF A;  3R3O A;  1F2M A;  4TQU S;  3T13 A;  1TWG B;  1SBB B;  5C4H A;  4ZLT F;  4S3S A;  1S5B D;  3TP6 A;  1C8C A;  1Q12 A;  1JE4 A;  3BDC A;  1RHP A;  4PMC A;  1EOT A;  1DXM A;  2K5D A;  1KLG D;  4ABN A;  1BDO A;  1EQT A;  1CZW A;  4DF7 A;  4NP5 A;  5JPN C;  2C9O A;  1OO9 B;  3K5N A;  4KHV A;  1EY7 A;  1ET6 A;  3T4A C;  5CBA E;  2NYZ D;  3OHX C;  2HQE A;  1LAB A;  5IGB A;  4IUP A;  4KV6 A;  2WKC A;  1WD0 A;  1SYB A;  5CMD A;  3CRK C;  5EJW A;  4FNF A;  2D5D A;  3FPP A;  2R3Z A;  1CA5 A;  1V1O A;  3H0G B;  1H9M A;  1EZ8 A;  4ID6 A;  4Y7N B;  5I6W A;  2XRQ D;  3KBX A;  5ELD A;  5D3D A;  4IUV A;  3MC0 B;  1B1Z A;  2E75 C;  2F0J A;  2VB3 X;  1D5X C;  1S5C D;  5C0X G;  1JOQ A;  1EY0 A;  1EU4 A;  2GA4 B;  1PRT C;  4WRD A;  3FKI B;  1S5F D;  3A56 A;  4K5X A;  5JVH 3;  1TVX A;  1XWE A;  1NCV A;  1D5Z C;  1SMY D;  3BVM A;  3H09 A;  3NWT A;  1U4L A;  2E2J B;  4A3K B;  4I65 A;  1U4M A;  2AQ3 B;  2EYF A;  3S9W A;  3LWU A;  2KEC A;  5EPL A;  3I4L A;  1WVL A;  1Y1V B;  5DEH A;  2WII B;  2ID0 A;  1A3U A;  4FVM A;  4IUQ A;  1NSN S;  2JXM B;  3H3V C;  5EBC A;  3I91 A;  5TSS A;  2MP1 A;  5IGG A;  3KLR A;  1TU2 B;  1F9P A;  3URY A;  2QF7 A;  1I4P A;  4BBR B;  4DK0 A;  1AZQ A;  4F7X A;  4C3I B;  1B3A A;  4HN7 A;  1DZ1 A;  1IYV A;  3SXH A;  2EYO A;  3MAQ A;  3WOE A;  2EOT A;  2F1M A;  4H13 C;  4HTH A;  5D3I B;  1MGS A;  2B2W C;  3TDQ A;  2F0V A;  4OIJ A;  5KNB A;  5G3L F;  1JOR A;  3QO2 A;  2KCN A;  5M3F B;  3K59 A;  2IX3 A;  4RWS C;  1EFI D;  4K8J A;  3HOW B;  4V0B A;  1KAA A;  4HMJ A;  2DN8 A;  4FF1 A;  4RAU C;  1CHP D;  4C2M B;  1BCP C;  2JP1 A;  2FJ2 A;  2ENB A;  3HOX B;  1LAC A;  2FIN B;  2QEJ C;  2FHT A;  4FO2 A;  2K01 A;  2L4N A;  3KUP A;  5C3W A;  4FXK C;  1EYA A;  4DAV A;  3HOU B;  3I73 A;  3K6O A;  3OMG A;  2VNU D;  1LTB D;  3C1E A;  3M3Y B;  1KLU D;  2EXZ A;  3ONA B;  3HZX A;  2ICE C;  3LNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...