1JIJA

Crystal structure of s. aureus tyrrs in complex with sb-239629
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
319
structure length
319
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords tyrosyl-tRNA synthetase
total genus 84
structure length 319
sequence length 319
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jijA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jijA01
1TYDE 3RK0A 1M8FA 3ISJA 4MUIA 1JEDA 3FG9A 3IUEA 5TGTA 5HUHA 4OUDA 1JEEA 2QTMA 1F7VA 2CT8A 4MWBA 2A1TS 2RE8A 4MWCA 1O95C 1UFVA 1KORA 1EJ2A 2O8VA 3DLAA 1JIJA 4GU5A 4ZT7A 4MVCA 1NUSA 1N2OA 3GMIA 1VBMA 3G59A 1M1ZA 5LFAA 3SYTA 3P0HA 2E21A 1WXFA 1NUQA 2A86A 3A2KA 3K9WA 2CUZA 1QNFA 2J5BA 1J70A 1LI7A 4PBSA 3LOQA 1IFXA 2A1TR 3KT3A 5IJXA 1JHDA 3ZJTA 1PFWA 4R2LA 5DK4A 1QRSA 1GTRA 4U7JA 5TS2A 4KPUA 1MJHA 3FIUA 4ZT3A 1R6XA 2XRZA 4MW7A 1M8GA 2JA2A 4P2BA 4A91A 1TQ8A 1IQUA 2EL7A 3AIIA 2CYAA 3FETA 1EXDA 4KR9A 3COWA 2YXNA 2I1LA 3AG6A 1WXGA 1RQGA 5KHAA 1G8HA 1NUTA 4I6JA 2DUMA 4L2IA 1K4KA 3RFFA 1OBHA 4MVXA 4QRDA 3VRHA 4ZCRA 5FNZA 2DLCX 1PFUA 1NUUA 3IOCA 2ZUEA 4DDHA 2NSYA 1QRTA 2OQ2A 2A84A 3UMVA 3ZJVA 4OJMX 3ZGZA 2HGZA 1TFUA 1OWPA 4MW4A 5AHWA 1MB2A 2PZ8A 4I6GA 3MLBA 4MW0A 3TZEA 3CVUA 1O0CA 4G6ZA 3ILVA 1JMVA 4CT0A 1M83A 5EKDA 2XRYA 1JGTA 1EFVB 1OWMA 3QE4A 3X1JA 4X0EA 4TS1A 4J76A 1ULHA 1YIDA 3IMGA 4YP6A 4MW9A 2WSIA 3IH5A 1KQPA 4G5FA 1O96B 1JZSA 3CR8A 3AG5A 1J1ZA 2QJTA 3INNA 2PFSA 4WNYA 2CV2A 1COZA 2GKSA 1KKUA 3MLAA 4CDMA 1MBZA 4R0NA 3IODA 3H05A 2J07A 3SP1A 4EG6A 2VTBB 4ZCSA 1OWOA 3H9BA 1XNJA 1T6XA 2YWCA 1U7DA 3FHJA 1U3DA 2Z3VA 3C8ZA 3H97A 3IMCA 1V47A 4MUJA 3H99A 4MUNA 2IELA 4MUGA 4ARCA 2OV4A 4MUKA 5H7XA 4RPIA 1M8JA 2O5RA 1KR2A 3MXTA 1O97C 5KWVA 2V0GA 1WKBA 1OBCA 2CV1A 1IRXA 1H3EA 3COYA 5F23A 1N78A 2AG6A 2QJFA 1U7XA 3Q10A 4Q93A 1G8GA 5K0SA 3CLTC 4MW6A 4GRIA 1FYDA 3G5AA 4MWDA 1O0BA 1MC1A 2D13A 4J75A 2YWBA 4ZCQA 4K03A 1M8PA 1MB9A 4XFJA 3TZLA 2IP1A 4ZCTA 2HMAA 3ND5A 3VGJA 2E89A 3Q12A 4JFAA 2PIDA 1Y42X 4AS1A 2QUHA 1XNHA 4L2IB 1U3CA 2DXIA 4NZPA 2DEUA 1O97D 3U1VA 4EG7A 5HG0A 3SEQA 2IJGX 2C5SA 1H3FA 2VTBA 4OUDB 3MMXA 1KQOA 1WXIA 3N8HA 3NBKA 5JBNA 2H2AA 3IUBA 3ZJUA 1X6VA 2QTNA 4MLPA 2A4MA 2JANA 4HPWA 3A05A 3IVXA 2X3FA 3L92A 4F4HA 1TEZA 3A04A 4XFDA 1KP3A 4MQ6A 2PZAA 3S3TA 3PXUA 1S4MA 3HL4A 3ZUGA 2G36A 1QU3A 2ZUFA 2DPLA 1LW7A 1GN8A 3IDFA 1WJGA 1U0BB 2D5BA 3CLSD 1QU2A 3M5WA 1KH2A 4HJRA 1O5TA 2QUJA 3FY4A 3ZXSA 1TYAE 4YP7A 5FO0A 2BYTA 1YUMA 2E0IA 4MWEA 2X1LA 2ZP1A 1N2HA 4MUFA 4R2MA 1H1TA 4PY2A 3IOBA 1KP2A 3CA8A 4BWVA 2NZ2A 3HFJA 5DEOA 3COVA 2DR2A 4MULA 3RJZA 1I6KA 1NUPA 4ND6A 4MVYA 4CDNA 4DDMA 3CLRC 1YULA 1N2JA 1T6YA 1VLHA 3RBAA 4MUEA 1KH1A 2DETA 1O96A 1PG2A 3FNRA 3IVGA 1GZUA 5LLTA 1QJCA 3KT8A 1WOYA 1QTQA 2HZ7A 3COZA 3X1KA 1MOPA 4QBTA 1Q11A 1OWLA 4MVWA 2PG3A 1EUQA 1WZ2A 1GLNA 3PNVA 3TQOA 2JAXA 4JXZA 1WY5A 5LM3A 4RUKA 3X1MA 3F3MA 4FZJA 1T9GS 1JIKA 3TQIA 1IQRA 1HYBA 3FWKA 2RD2A 2GM3A 3P0IA 1PFYA 1VL2A 3SDBA 1VBNA 1I6LA 4EGAA 3NBAA 3BL5A 3D6VA 1N2GA 2D54A 4ZT2A 1K97A 3G6KA 1D2RA 4MW5A 1O94D 3KT6A 1TYBE 2QTRA 2WQ7A 1EFPA 3OTWA 1WXHA 1EFPB 5BNZA 1WQ4A 1V8FA 1IVSA 3FI0A 3HZRA 3I05A 2V0CA 4KPUB 2CYCA 4CQNA 1NURA 1JECA 1A8HA 2B7LA 3DV2A 4KR7A 4ARIA 4DDKA 1MAWA 4JZYA 4S1OA 1JZQA 4HK4A 3IVCA 1BS2A 1ZH0A 3LCJA 3AL0C 4F3RA 1O6BA 1N3LA 4Q16A 3LE8A 3NV7A 4U8HA 3K32A 2PZBA 1JILA 1KAQA 4NAHA 1OD6A 5DB4A 1OWNA 3HGMA 3N2YA 4EG4A 1QRUA 5FO1A 1FFYA 2Z08A 3GLVA 1N2BA 1B6TA 1WXEA 3ND7A 3UY4A 2J08A 1IHOA 1T6ZA 1F7UA 1J09A 2EJCA 5TEVA 1O95D 4PBRA 1XJQA 4HJXA 1EE1A 3AFHA 1G8FA 3RHSA 1EUYA 2TS1A 3SZGA 3TNJA 1XNGA 3SZ3A 1X8XA 1H3NA 1NZJA 3FOCA 2CFOA 4DE5A 1N77A 1ZH6A 1J1UA 4MW2A 3N05A 3N9IA 4EF6A 4G5YA 1N2EA 2A88A 3H9CA 3UC5A 2QUIA 4I6EA 3ND6A 3FDXA 2X0KA 3KT0A 1EFVA 2J4DA 4YBRA 3E27A 1Q19A 1CT9A 4EG5A 3PNBA 3CLUD 1F9AA 4PBTA 1MAUA 3CLSC 1MRZA 1J20A 4H3SA 1KQNA 3RK1A 1Q77A 1T9GR 4ZT6A 1M8KA 1PG0A 4MW1A 3CLTD 4DNXA 3CVYA 2WQ6A 1SURA 1NSYA 3GUZA 4E1AA 4EFKA 1ILEA 1N1DA 3IMEA 1GPMA 1NYLA 3P0JA 1IQ0A 4MUHA 1R6UA 5J5AA 1GTSA 1O94C 1F4LA 3HMQA 5KCMA 4EG8A 3TS1A 3AKZA 2QUKA 3KFLA 4ZT4A 3ZXIA 2X1MA 4QREA 1ZUNA 1KH3A 1PFVA 2J09A 3VU8A 4DLPA 2DERA 4EG3A 4YMIA 2AZXA 3D6UA 1WQ3A 2H29A 4JXXA 1Q15A 1QQTA 1N75A 1I2DA 1R6TA 1VBKA 4NAUA 1G59A 1GAXA 2PXHA 3L93A 4ZT5A 3DO8A 2R5WA 3SEZA 2VXOA 3OP1A 3PRHA 1TYCA 1NI5A 4XSVA 5HUJA 5K0TA 4NX2A 4NATA 3UK2A 1DNPA 1YIAA 1JIIA 3DPIA 3CVVA 4UZEA 2E18A 2CV0A 4ZCPA 3ZIUA 5J58A 2CSXA 3PNYA 2Z09A 4MAFA 3Q4GA 4DJAA 2GOYA 2A1UA 3P52A 1K92A 5DASA 3CLUC 1ZJWA 3A4IA 3CVXA 4KKVA 1LI5A 5J59A 3FH0A 1YI8A 4EG1A 4WSOA 4YP5A 2BTEA 4KR6A 1J21A 5TEWA 1N2IA 2WB2A 2A7XA 2YY5A 2CYBA 3HV0A 3QTBA 3IOEA 3MUEA 3CLRD 3ELBA 1I6MA 3QTTA 4U63A 2AKEA 1K4MA 3CVWA 2QJOA 5IHXA 3UOWA 4JYZA 1IH8A 4AQ7A 2A1UB 4ND7A 1NP7A 4K0RA 1KAMA 1YUNA 3JXEA 4UZFA 4NDAA 5H16A 1P7PA
chains in the Genus database with same CATH superfamily
1OLUB 1F9EA 4OOFA 3HVKA 2HSGA 4FNOA 5CB4A 3KBOA 1JEDA 2JFFA 2PMFA 3DKVA 3RV4A 4D6PA 1DUSA 1Q7RA 2HFKA 3MYRA 3RE1A 1FSFA 2EU8A 5L40A 3UUGA 2QMYA 3VISA 3VPBA 4FGUA 1EAYA 4N82A 3L04A 3IXMA 3N2ZB 5D3MA 3SKVA 4ZT7A 1VYTA 4X20B 1ZOSA 4ZXFA 5AUOB 3EOZA 2XVZA 2ZSFA 3EEOA 1E1CA 3QY9A 2ID8A 4HZUB 3W6ZA 2VDWA 2VOJA 3BJRA 4XPZA 3K1AB 4TPKA 1LLUA 1R0RE 2OQRA 3P0HA 4NI5A 4RK4A 2V6FA 5EJEA 4KGVA 5HPYB 5AOAA 1PVOA 1B8NA 1OSNA 2BEVA 3CLVA 4BKOA 3IQZA 1I94B 5JZBA 7REQA 4XRRA 3ZNNA 3GNLA 5SY9A 5LQJA 1NVFA 4B7UA 3PJGA 3H2SA 1OLUA 2QM7A 4L78A 4QVIA 4PPNA 5MN5A 4B2LA 2GVDC 1E2KA 2PGXA 1ZITA 2GLXA 2OBYA 2FPIA 1SQGA 5HIKA 3DMRA 5CYFA 1X38A 1I8TA 2JGEA 2G4LA 1ZAYA 4AYXA 2KJQA 4I46A 3GP5A 1MQ9A 3KDAA 3IIEA 4MW7A 3TJMA 1GDDA 5K8JB 1Z4NA 4FGSA 3FVTA 4OL0A 5KVVA 1TQ8A 1E92A 2BGNA 1E98A 4PG7A 4ZO8A 4R68A 2EL7A 5EIFA 4EYQA 2J32A 5L7WA 3GPBA 3CFYA 4KQCA 1XU7A 4FSHA 3M6AA 3OQ6A 5E6RB 3AJAA 1XA0A 5KVSA 1TAGA 1P9NA 1YQUA 3L8GA 4ETNA 3T5DA 4C06A 1E2NA 3U3ZA 2J87A 3B2NA 1V2HE 3IPXA 1EX6A 1YU9A 2AMVA 4LHYA 4PGAA 3TW8B 2GEKA 2PX2A 1IM2A 1C4XA 4FB4A 1I3KA 3LUJA 3X0DA 1JEQA 1CLUA 4CV1A 1QGUB 2WVHA 5F3WB 1CS4C 5MDHA 4DNFA 1JP7A 1NN0A 4LRWA 1V43A 5JNRA 3ZJVA 4OJMX 2BR5A 4ZOEA 1M0TA 1JR3D 2TSYB 4BV9A 4HXYA 2YIJA 1R5NA 4BNZA 1A8PA 1RSZA 2C96A 2Q27A 3I83A 2YJNA 4AYWA 3D2CA 2EATA 2G8LA 2NU6B 4HDAA 5FI0B 2QMQA 1V9SA 2F1IA 3NORA 3RS5A 1PZGA 3NGXA 4Y7DA 2YFQA 3P20A 3PQ4A 1JEYB 4DTIA 3WTCA 3HJAA 3JYNA 1YFJA 5HF9A 2ISCA 1Z7YA 1TRKA 1Z6AA 5EJFA 1XTIA 4BV8A 4MUAA 1AN9A 4IG4A 4U6NA 4JJKA 3IA2A 1RCUA 4ILEA 2ODWA 2IXDA 3PQ5A 4QYXA 1Z6YA 3OOJA 4HQOA 4MPDA 4J76A 1K75A 4DCNA 2WWFA 2E4AA 1LLQA 3DXXA 4C07A 5CA1A 5HFJA 1IEWA 1HEUA 3DNPA 4AT1A 1X7ZA 1Z7WA 1T0PA 3F6PA 4XLLA 4LJ9A 4HWPA 2OPBA 4KDRA 5IJZA 4NY1A 1XI2A 1LPBB 5JDCC 1E9RA 3SF0A 3LIPA 1LC0A 2GJAA 3L0YA 4IDOA 3NBZC 1Y3IA 2OORC 3BZUA 3WGKA 4L57A 2BF4A 3CZ9A 3AQIA 3DV9A 1GNRA 4ICIA 4I4TB 5SZJA 3EJ6A 2R3SA 6ABPA 1OXSC 4HBGA 1Y81A 5JASA 4F6RA 5CCEA 3FTCA 3E22A 1O8CA 2FFRA 3O9ZA 3PUJA 3BERA 3WGQA 4DCVA 3OEED 4L1KA 1PU2A 2EQ5A 2VDWB 4B31A 4YV7A 3DLHA 3H97A 2QL9A 3E2IA 4N54A 2CBGA 1BW9A 3QWAA 3VTAA 5LQKA 4NBUA 2BEUB 2BEVB 2OGZA 1XQYA 4EA9A 1L5FA 2JF0A 4FFSA 3HY6A 3OG9A 5AUNB 3NC0C 1T3HA 1EGMB 2GNOA 3ROZA 1C30B 3GJ5A 4B3JA 1U6KA 4CKCA 5KDDA 3FNQA 3FPFA 3UQYS 5J2TF 1LPSA 2CJWA 1IRXA 1YRQA 3O8BA 3RQSA 1J23A 2QIPA 3MCTA 1U3UA 1AG9A 1PYDA 2QQFA 3LQFA 1AHIA 3PNKA 1E61A 3AR6A 1NHGA 1YR2A 1A8SA 3C8HA 3EXEB 3V4SA 5I7OA 1CZOA 4HYYA 5K5EA 2LTAA 4ZCQA 1E3LA 1TM4E 1L4FA 4ESOA 5IM4A 4D5GA 8OHMA 1NW5A 1XCBA 1NRWA 5JD3A 3GLIE 2L82A 4KE7A 1VJGA 1X7YA 4L9RA 5EC8A 2C5EA 2GCPA 3TL3A 2HMAA 1JXQA 3GOHA 2H1CA 1GL7A 1MFZA 3FUTA 4JFAA 3I2KA 3PQEA 5ALDA 2JHGA 1TX4B 3THOA 3UATA 3QXGA 3F7TA 3C1AA 1UKAA 5EMMA 1CIVA 3EGOA 4Y30A 3DDNA 3PF9A 1HNZB 3IT0A 3KQYA 4IDGA 1IZ7A 1WL8A 2ODBA 3C3XA 3ESRA 3N76A 3WGNA 4ANFA 3G02A 3W4KA 1VI2A 5I9TA 3WKDA 3C1OA 4KYTA 2XUZA 1C29B 4LIPD 4OQEA 4JNKA 1QHFA 2Q6OA 4UTPA 2C2GA 5F7OA 1WIWA 1ZQ9A 4HOYA 5E4YA 3UPUA 5DTJA 4OMUA 1PW5A 2N46A 3UBMA 1KQOA 3HXOA 3MJEA 3GW8A 3FOZA 4OLBA 3IFSA 4BYGA 1T5TA 3OKAA 5BPFA 4JQZA 2QTNA 3SSNA 1KJ9A 2GO7A 3IXQA 3K4PA 4KVGA 2A4MA 2AE1A 2WDPA 3O4IA 3EFHA 1KERA 3B1YA 5JFOA 5E9QA 3UT0A 3V4FA 2O8BB 1E0SA 1F2TA 5BYBA 3PX7A 2AMLA 2RHLA 3FZQA 4KO8A 4BE9A 1CEEA 2H1FA 4IEFB 1BN6A 3M6IA 2Z04A 3JQBA 4BTEA 5B1IA 3DVAA 3U3RA 3HNPA 2VAPA 2QPOA 2O8EA 2RGNA 1FVFA 4G97A 4F38A 7MHTA 2ZWMA 3LT4A 4FYHA 4TKVB 1ZEJA 2ZJ6A 3ZNOA 1PRYA 1XDWA 1XRLA 3OO0A 1WJGA 3Q8WA 3BDVA 5KNBD 4EO9A 3P8ZA 1CUCA 4LWZA 4RJTA 2FLWA 2DEUA 2DR3A 5F5NA 1ESZA 2XLBA 4HLUA 5DN6A 3H75A 3ZXSA 1UXKA 4MWEA 2XMCA 4E2YA 2IE0A 1N2HA 3DH0A 4LTDA 2ZS8A 2PT9A 4RFLA 1KEVA 3F74A 1HI9A 2WD7B 2BW0A 3O38A 1CQJA 4K88A 4LDRA 3RO7A 3HFJA 4I4CA 3TKLA 2ZAMA 1NI4B 2CL7X 2QD1A 4ACAA 3PTAA 4J1TA 4WXYB 1P5FA 4IY1A 4U7TB 2RHBA 1L5SA 1C3OB 4X97A 1WCWA 1LSUA 2BHLA 4LK2A 5L8VA 1D6JA 3BKXA 1YZQA 1L1FA 1V0JA 4IKEA 3WHIA 1R9NA 3OEHA 1EUCA 3K8ZA 4LRSB 1V8DA 3SNKA 1ULZA 2QVGA 3I9MA 4IZOA 3OSUA 4KP7A 1H6BA 5JR3A 3K70C 1VZ2A 3D7MA 4UAVA 4CM7A 1YL7A 3VH4A 5GADl 4JLMA 2M6LA 2BFDB 3B78A 4JGBA 4UEOA 2QXUA 4AK9A 4JKOA 5AUPB 2P2CA 1SKYE 3UMFA 2IZ5A 1GTVA 2QXYA 2VAWA 3ZXUB 3VJMA 2W7TA 4JLNA 3X1KA 3N0WA 4YCNA 1KBZA 3T52A 1I7NA 1AX9A 1KDOA 4J3JA 1ZK4A 2GBIA 2PG3A 1M3SA 4PLPA 1DTWA 2R751 4E5DA 3TVTA 1PTKA 3TOSA 2OLKA 4O4LA 3UWSA 4PN7A 3DHWC 2PGLA 2JGIA 3GLFE 5HGXA 4B7AA 1D04A 1IEQA 1PEKE 2G06A 1QRRA 5IDQA 3MTGA 3ZE7A 5JJBA 1KMNA 1P18A 2H18A 3PIIA 1C0KA 5BQOA 1KRXA 4MKHA 4QOIA 5A5GA 4DUYB 1DXQA 4BEWA 5HZHA 2CJXA 3F9CA 2AEMA 4MR8B 4Q3EA 3WO1A 4NMMA 1SO8A 1H1LA 2I4TA 3IBTA 1PWZA 3IVRA 5GMOA 1XZMA 4ND1A 3LY9A 1TYBE 2QAGB 2VDQB 4S0ZA 4UTXA 3NXSA 1ZA1A 5EJ9A 1PVVA 1ZONA 1Y1SA 4EABA 4RH3A 5AVKA 2UVQA 1NV8A 1PLLA 4QYIB 1U7UA 5JXJA 3QMMA 1ZJ6A 2WUGA 3QYFA 4ILKA 1W75A 2IS4A 1NE7A 4MWZA 3A6EA 5AHKA 5LYJB 2PLRA 2GHIA 1JECA 2LNDA 3DV2A 1NVVQ 3DT9A 5TLSA 2BR4A 1KI6B 4M55A 3QOFA 3UM9A 1TT5B 4OHPA 1DIOB 1XXLA 4J3NA 4UXJA 4QBGB 4JVNA 5I7FA 3OE1A 2ZXFA 3LQKA 1RYDA 3ICEA 4M9CA 3L4BC 2XITA 3VM6A 2YWDA 3K32A 4DBLE 3AO0B 1JSCA 3QLJA 4KIUA 1M76A 2W48A 1YA8A 1WCIA 1KBOA 3HGMA 4WEOA 2JIZD 4FSXA 3EWIA 4D80A 4LNAA 2D3TA 3GLVA 1SB8A 2JI4A 1F7UA 1BOFA 1K8XB 4DV0B 1WA5A 1MH9A 4JXKA 4AUMA 1NW6A 3ITNA 5ALFA 1QR6A 3TFQA 4HJXA 2FHSA 2J6IA 4FNAA 3ZV5A 4LZZA 2JA1A 2ZAYA 2BM1A 2ZU6A 3DWIA 5A6VA 4C7JA 1Z22A 5ALQA 3FCYA 1YMVA 4EWLA 2H00A 4MZDA 3VR3A 1Y3DE 1UPBA 1KDPA 4YECA 1MV8A 5B2EA 2WFZA 3DUWA 1NP6A 3QUBA 5ENDA 4Z3DA 2HDNB 4AICA 5JEEA 2W98A 1J99A 1JYSA 3EA5A 2AOVA 1PNRA 1CUZA 2FNAA 3FSGD 4LJAA 3C74A 2GTPA 3RC3A 2J4DA 1Q19A 2RK4A 2YDXA 1R0SA 4V0MA 5J43A 4J7XA 4ENRA 1XROA 1XVVA 2JFPA 2RMKA 3DV0A 3KXLA 4IDNA 3DEAA 4UM7A 2PX5A 3HBNA 1IZZA 1DAPA 4PCLA 2IYVA 3BDAA 1NXWA 1Y3CE 3NNDA 4HLDA 1XT6A 4GWGA 1OGJA 3LX6A 2ZSAA 1SURA 2Q46A 4XDZA 1CBUA 1ZNZA 3WGUA 2GF2A 1VJ0A 4EEXA 2GK3A 4L22A 2GJ8A 4A3SA 3KLPX 2R8ZA 3ANMA 3P0JA 1DJPA 2JL1A 1QR2A 2LCIA 1YJ5A 2WF9A 1OX4B 3PGLA 4MSUA 1DKPA 3FHCB 2C5LA 4B46A 3PTLA 3S81A 1X1BA 3AFIA 1QYRA 1C50A 2BFCB 5KDOA 1K8ZB 4LXGA 2AFVA 5ALZA 1D1QA 1U80A 2GZDA 1L5YA 1MDFA 4CU2A 5H5JA 2BMAA 4C7KA 1F2TB 3O74A 1HG1A 4IMJB 3FDJA 3ASZA 5L6MB 2H1WA 1XAGA 2YW2A 1OA1A 2YZMA 3IERA 1Y82A 3IO5A 4L7QA 1NVTA 4R41A 4YQEA 1UJNA 3H6HA 3I4CA 2A0KA 4FCTA 3RTDA 4PFJA 4WKCA 3L7LA 2Q4BA 4MMYB 1XXHB 3GLTA 4W8OA 4XD7D 4YTEA 3WDMA 2B4RO 2GHRA 2R9VA 3AL2A 3PSAA 3PGXA 3IAAA 3UMSA 3R7BA 2WIJA 1EXMA 1W2GA 2HXYA 5IHPA 4JJGA 3MJVA 4P31A 1NMQA 1G8PA 5FYDA 1XD2B 3AEKA 3ROPA 3RWOA 3K0FA 2FE4A 4JJ6A 4TWAA 2IU3A 3GEGA 5BRNA 4BNGA 4MDEA 3OP1A 3HWSA 4X7PA 1YB2A 4DWJA 1PSZA 2GYWA 5K8LA 3HABA 5B58T 3RRBA 4Q1FA 4ERNA 3NTXA 5CW1A 3UMRA 1EWTA 2JAPA 1TYCA 1MF7A 1QOZA 2YCBA 5T8KA 4PZCA 1OFUX 1C81A 4MUMA 3G17A 5DWDA 2FKAA 2Q9UA 4JUFA 3GMDA 1RRFA 2Y1XA 4RSGA 5AKXA 3RAFC 4GYJA 1XO1A 2Y4NA 1DDOA 1VKJA 4N47A 3SMVA 1F5SA 2M1XA 3DZJA 1MENA 3HUFA 3TNYA 1GG9A 4LQ4A 5FH9A 1E58A 1YA4A 3HXKA 2QTFA 2MSWA 3CR7A 1A76A 3EN0A 4J1SA 4QHSA 5TMDA 5D5HA 5EINA 4E4YA 3R7FA 2O1XA 2ETVA 1QFZA 3ZBTA 4YXWD 2II6A 4FINA 2PX0A 3JVEA 1LBEA 1WR8A 3DR5A 2H7CA 1VIVA 3EJWA 5DBEX 4CKWB 1YRHA 3M1AA 4AJPA 1YR3A 4BPRA 3I6QA 5DHQA 1PK9A 2FR1A 4FWBA 3V9AA 1VG1A 3HSKA 5LVAA 1GTL1 2JJYA 3BH0A 1F0KA 3FKSA 5IEBA 2XSZA 4EI7A 3NHUA 4QGAA 3QX8A 1NTOA 1E8NA 4DC9A 1DT5A 3ZI7A 3N58A 2AXEA 3A6LA 3LP5A 1B14A 3EC2A 2XEXA 1UDWA 1U28A 2N47A 3C85A 5EUMA 2HLNA 4IP0A 4RE6A 5BXQC 4JBXA 5JTTA 1XEWX 3K9HA 2PWPA 2RIRA 3LXMA 3NAGA 3WGYA 4MPJA 1MC8A 5ALSA 3VMFA 2H2GA 2QU7A 1KL7A 3EQ2A 3HB9A 4IX9A 5KPDA 1BHQ1 4UVDA 4P7KA 3C1UA 4PICA 2RHWA 2ZXEA 3QI7A 2R2GA 5TGTA 3BJZA 4N6OA 3VBCA 1TJ4A 2CT8A 1EA7A 3EULA 2Y0CA 3PC8A 5GAJA 2C7QA 5DHTA 1MVNA 2IZ0A 3PWKA 1HLFA 1AKEA 1BH2A 5JOQA 3VR4A 5JPIA 3LT5A 4L8LA 2R84A 1U0EA 2WLTA 2VH5R 1TK2A 4Q39A 4EI8A 3RIHA 5J4YA 5LFAA 2O5VA 3UJ8A 3R9XA 2IS1A 4YJGB 4W7SA 1CRQA 3M9LA 4LY6A 2G28A 3QHPA 1SOMA 2Z3WA 1XC7A 1EFCA 3KYCB 2SKCA 3QPWA 3UMCA 2QLBA 3MWKA 1IFXA 3BULA 3CZ5A 1SXQA 3TRDA 4LI0A 2IEZA 1F8FA 2OAGA 1GL3A 4TT8A 1DOAA 1MEEA 3U7QB 4HGPA 2CXPA 4JBGA 4Q4HB 2Z2ZA 2EG5A 4KBYA 5DT9A 2YICA 2IXAA 4P98A 2XT9A 1ZJ5A 1PEYA 4NEHB 1PJ3A 1THTA 1KY2A 1XXHA 1GPUA 4RKRA 4LMBA 3RAJA 2E5FA 5IXSA 5EWLB 1DELA 4ECAA 3PDIA 4ITRC 2O8DB 3FYTA 1QP0A 3SOZA 3FSJX 1Y5LA 5CRIA 4MB6A 2VLBA 3MD9A 2P90A 2P41A 1B15A 1JDBB 4CEHB 1FLAA 4GKAA 4G37A 2RHRA 1MHPA 4IRXA 4X94A 4DARA 1RQGA 1K6EA 3HL0A 4MGKR 1I1OA 2GUGA 3DWGA 4ID3A 4WLFA 4G1MB 4BASA 1G1MA 2PO7A 2XSZD 1VZ3A 4FDVA 1MB0A 2QW8A 5CCDA 5LZ2A 4MR9A 4MGIR 2UXCB 4PZDA 3NVMB 3NDPA 3PHCA 3PKJA 1U31A 2JVKA 4C3VA 2ZZKA 3A9RA 2ZUEA 4CMIA 2NSYA 3DWEX 3GA5A 1YZYA 5FBQB 1QRTA 1L7XA 2D4HA 2JK0A 4AY5A 4RL6A 3DV0B 1R5OA 3ITDA 3T38A 2FJPA 5DM2A 3U09A 3HYNA 5AHWA 4CG1A 1GT91 4GOJA 4WCDA 5EE1A 3EVTA 5EMJA 1J7KA 2YZ2A 2EJBA 1NVKA 3O3NB 3PD0A 4JB2A 4GR5A 4P4TA 2WAOA 1XQ9A 5GPBA 4RJKA 3RS9A 3TTXA 1O0CA 2IOHA 1MD9A 2LGJA 3ILVA 1EUDB 4ZZ1A 4JLWA 4CT0A 1OXXK 1JRLA 1C5KA 2B0CA 2QUZA 5DGCA 4PAGA 1A69A 1DFIA 2BEKA 2VCYA 4Y6SA 4FILA 3HY4A 1IXSB 1JIXA 4X8MA 1LLFA 2WDZA 2XOEA 4QVKA 3UV6A 2NU7B 1CIPA 4KQHA 4N7JA 4KHPB 3I37X 4KRFA 5BWBA 3ZU6A 1R4NA 1IC6A 2FKNA 3K15A 3MC1A 1IG3A 5JY6A 2BELA 4G4IA 3PYXA 3VNUA 2CXSA 1CUXA 1P9RA 1Z0SA 3EZGA 1X92A 3M5CA 3WWYA 2QTHA 1YJXA 4O8ZA 4L4RA 4OHBA 5BUSA 1O96B 4E12A 2I7DA 2EERA 2OZPA 5DGHA 2BP7A 4MJXA 5LBTA 5JHHB 3DZBA 4C0KA 3E8MA 1GGVA 3DC2A 1JW9B 1XU9A 1Y6ZA 3FR7A 1COZA 4WCFC 1VCNA 4PZZA 4A8JA 3HDTA 5AVXA 3KKPA 3AR7A 1RIFA 2XCQA 3MWEA 3MT0A 5JO9A 2IIBA 1XWIA 2HYDA 3IP1A 2RK3A 3K0FB 3V34A 2FGJA 3L8MA 2IYYA 3OJOA 1WU8A 2XQGA 1VDMA 2EGGA 3LUDA 5EJGA 3TBKA 4R1MA 1IJEA 2WIGA 3VJKA 3WGTA 1OH8A 4OFXA 5F51A 5L3RA 1PS8A 1CQZA 3IMCA 2WYWA 1R0ZA 4C5BA 1DL5A 4JQOA 4J2HA 3VNBA 3A1DA 4W5TA 3FMOB 3KKQA 4QXRA 5IKOA 3FTNA 4RPIA 5ILQA 2IYQA 2AI2A 3FDZB 1Z7GA 4QC2A 4CMGA 4DXDA 1US8A 2EP7A 2VQDA 1HLDA 1QFMA 3GFBA 4IGAA 4AC9A 1WKBA 1Q21A 5JT1A 3MB5A 1P7CA 3W5CA 3ZOZA 2JLRA 2IWHA 1EVJA 2P30A 1PQPA 4ZRNA 4JLDA 1G8GA 3VA7A 1FYDA 4JEMA 3HO6A 3RUEA 1TEXA 3QFFA 3Q72A 2NGRA 4TKZA 2X13A 1AF4A 1QUFA 2XD9A 3EG9B 2VP6A 4LF5B 1WQ1R 2HTEA 4LHSA 3ZV7A 2IP1A 4YDRA 3SG0A 4U02A 1DBPA 3KUXA 4H59A 5FA8A 5FR1A 3VR3D 1ZPDA 2X6QA 4RCVA 3TUIC 4XB2A 2BN4A 4MWTA 1P1FA 2K6GA 1INLA 4PG6A 1JR4A 2ZG6A 3ECSA 1SVLA 2I3AA 1JTFA 3QBVA 2AOTA 2I34A 2IT1A 3QXXA 4I4IA 3SYNA 4B6EA 2FWBA 4R3WA 1C0IA 1P5RA 1V39A 2IJGX 3KSZO 1JDSA 5CHEA 3T5MA 3VVBA 2ATEA 4M1TA 2BFBB 3VXKA 2PJRA 1O2DA 2A5DA 3DKKA 4AX8A 2ZJ2A 3KZMA 5ITSA 2YWRA 4C43A 4P0QB 5HTKA 5TT0A 4DIFA 1A3CA 1USUA 3RFCA 4NXNB 5CXSA 1DKQA 3R4VA 2GPAA 3I2JA 2VCEA 3KLOA 3L92A 4LE0A 2FU5C 1KIMA 4PYNA 1OUMA 1ZIOA 3F8WA 3BTVA 1U04A 2V74B 3K3PA 2ENWA 4QYWA 4G84A 3W3AH 3X2SA 3THYB 5L3ZA 2ZYTX 1FFCA 2KSQA 1DTSA 1NATA 1VKZA 3TMAA 1XG5A 2ATCA 2PWAA 5ER9A 3FF1A 3GGOA 3EGEA 4XJSA 3KYCA 1BEUB 4OMDA 2G9VA 5D8DA 2LWIA 4AP9A 4FBLA 3V1KA 3SZRA 2HMUA 4HUJA 4IGIA 4MA5A 1FK8A 3C7TA 3CT4A 4GOMD 4MR8A 3VZSA 1P91A 3JALB 4Z7JA 3ZI0A 1F38A 2BM9A 1JI0A 4IVPA 1JJIA 3PA6A 3DDWA 5AM1A 3JPWA 4J0KA 4HDQB 4K6HA 3GROA 5CXQA 4RXMA 4BNIA 1TXGA 3F9IA 5DCWA 3TPFA 2ZP1A 2LDBA 4KE9A 1ZUHA 4DHWA 4JIGA 1YOVB 3K1AA 4MDYA 1KP2A 5AXAA 2DOKA 3QPVA 3SZLA 4DIOA 4IIHA 3COVA 1RXSA 2B5VA 3MJ4A 2UYHA 4UHFA 1XAHA 4PLWA 4U7FA 2E4ZA 3GH3A 4B5KA 1BH6A 2F8MA 2VQSA 5FBRB 3A6DA 5HE8A 3OHPA 4BKUA 3DOEA 2UZ1B 4BNKA 1YS7A 4LHVA 1WMFA 4DCGA 4D4JA 1G5TA 1GQSA 3V7YA 2FPIB 3ZY6A 2ZUUA 2FPGB 1CF2O 3WG9A 3N8NA 3P1JA 5EP2A 2IXGA 3R3VA 3ZV6A 3L8HA 4WERA 3SS8A 1LSJA 3AP3A 1OLSA 1C3EA 2Y9MB 1QIKA 1FCJA 1YTLA 2C5GA 1U0HC 2HZ7A 1K1EA 2YNMC 3O83A 2QNRA 4Q3CA 2FRXA 3ZY4A 1JAHA 5HW0A 2L69A 4RF2A 4NFYA 3KM0A 2DH5A 4D8XA 2FUNB 3OICA 4G4SO 3GCWA 1J22A 4QAJA 4PQFA 2AEEA 3S1AB 2YWGA 4X7RA 2PDAA 2XBUA 4BB5A 5J2UA 4MJLA 2J6CA 3KJGA 4QBKA 4D6YA 1HYBA 3UJCA 1BZYA 1F2UB 1PFYA 2P6UA 4FPXA 4RF5A 2QI9F 2ONCA 1RRKA 2AI3A 4PAOA 5KU1A 2BKXA 1FPMA 1YH3A 4C6TA 3W1EA 4PIPA 4IYJA 1U4NA 1A9XB 1XMSA 1K97A 2P69A 2QEQA 3F78A 3NVKI 1BMTA 3WRXC 4CNBA 2IBSA 3LA6A 1LNQA 4OP3A 4HFJA 5DBHX 3AUAA 5HCNA 4C7VA 3KSBC 1IXKA 1JG6A 3C6BA 2ILVA 3LPCA 2W42A 4BN5A 3TF5A 1WF6A 1X87A 1RRPA 1W36D 4BC1A 2W2LA 1XVTA 2GM4A 4EO4A 1KZYC 4GOKA 1XZLA 4HAUA 3HJNA 4PX3A 2VI5A 2G1PA 5LYJA 4BVEA 3NKLA 2ZUTA 5AKZA 3FGZA 3SXUB 1MAWA 1EKXA 3RRJA 5BNIA 1GTJ1 3BGDA 1FJGB 1RABA 1NVMB 1C9NA 1VLZA 2Z2IA 1FDRA 2VRNA 1V8PA 4CPDA 1MC5A 1SUWA 2HNAA 2ZR0A 4AULA 4EF5A 5IH7A 3K92A 1E2DA 3OZFA 3MAJA 1KI7A 2FPSA 3DBOB 5DB4A 4JJAA 3ZQUA 2P0EA 3AHIA 2I1VB 3A6HA 5LMZA 4UU0A 1NFQA 2I6XA 1RWVA 3CRW1 2Z08A 4OU5A 4P80A 2BR3A 3TINA 2J3QA 3R6TA 4QXAA 1Z6GA 1KJWA 4H15A 4RSHA 3UCEA 3WX0A 1HRDA 4DAEA 4EG0A 3KFVA 2O2IA 1JTEA 4XUEA 2VPWA 1Y7HA 2PSDA 2B99A 3IRVA 1OXMA 1ACJA 3D2LA 4G56A 4MQMA 1AKRA 1U6JA 1T43A 3BHJA 3CNLA 1WZCA 4PGMA 3LFHA 5HSGA 3H5RA 5IZCC 4LF9B 4X61A 3UK1A 1ZESA 4WXHA 5GV7A 1VGVA 3U1BA 1QV9A 1T5OA 2DT5A 5JISA 3JQQA 1VJTA 3VVCA 3Q7EA 3L1HA 2MJLA 5C5EA 3T1YB 3N5CA 1GD1O 5DDIP 2H1HA 3IQDB 4QDZA 3I0MA 2XY4A 2VJLA 4U7GA 3RSOA 4CL3A 1GQFA 2VNSA 2ZUDA 4RAQA 2GRUA 4B3SB 4LOJA 3LJKA 5A0VA 5KQPA 3ND6A 4YJ3F 5DI3A 2GZAA 4S12A 4TL9A 5GZ3A 4JOCA 1AQUA 4G0NA 2D1QA 4KQKA 1XRRA 4OL9A 5KREA 3QU7A 3QSYA 3K5HA 5JAUA 3DONA 8LDHA 1EDBA 3F5MA 4IIUA 2QRVB 3QX9A 5EIAA 2V4MA 1Z88A 2AOTB 4L5JA 1PG0A 5AVYA 2W2NA 1K0UA 3K94A 1GGKA 1S8AA 1RNLA 1Z7EA 5CUQA 2O8FA 2COUA 1N4DA 1Z29A 2I2AA 1P2UA 3GJZA 3N8DA 4DBVO 2XWSA 2E5LB 1CHNA 4I08A 5CPFA 1N8TA 1Y33E 1MU0A 1QC5A 3FVWA 2R11A 4MVJH 3H1PA 2Z5FA 3ZCQA 1BRMA 3GNSA 3D6HA 5GONB 3LGAA 2C3UA 4RY9A 4CL2A 1TOAA 5A6SA 4FZ3A 5DNYB 1W44A 4DDWA 3RU9A 4Y9DA 3HEMA 3R74A 1W4AA 5E7MA 3HCAA 3Q6MA 4FZ5A 3RIXA 3HMQA 2NYAA 5CVTA 1OT5A 2W4MA 1O8BA 3FM9A 4J2TA 5I9LA 1X94A 2J09A 1A97A 2VF4X 3FLAA 1OXKB 1XDSA 4G4JA 3GCZA 4I36A 3SQNA 3G85A 3LX5A 4WW0A 4DV4B 2IU4A 1OV6A 1UOEA 2R25B 3ORQA 1XHEA 4RULA 4WI1A 4QBIA 4CM3A 4X5OA 1THZA 2QSJA 3WLAA 3H1AA 4KUGA 2A0UA 2A9VA 2CDCA 1ENYA 2YC2C 3IAM6 1U2GC 2FW0A 2ZCUA 4LY3A 5LQRA 1OB2A 1ZUIA 2DAPA 5FFFA 1KTVA 5AM5A 1TC1A 5E6SB 1KSGA 4Q15A 3G0DA 2VA8A 4KQEA 1LQTA 3A1VA 4DIEA 2JFNA 2HJ9A 2P2GA 3GAZA 3THXA 3PRHA 3IR6A 4YVFA 4LXIA 5DYWA 5HOEA 1FU7A 2R6DA 2JI8A 1BROA 4NX2A 4OLFA 3DGEC 5CIQA 4ZQGA 3W79A 1H69A 3WMEA 4ER3A 3EPHA 3DAYA 4BMZA 3FWPA 4XA8A 3IEIA 1BC5A 4YK7A 2OL4A 4ND5A 1E1QA 2XYQA 3A3PA 3EEQA 5KNDA 4KUHA 1XL1A 1F14A 3GNQA 1CUAA 1Z56C 3GVPA 1M5RA 3MWGA 4PSVA 1MQAA 2Z30A 1N3IA 4PYQA 5BN3A 4MWSA 3OQIB 4OATA 2FW7A 1JR3A 3Q0TA 1ZJWA 2QMEA 1P44A 2WD8A 5EVJA 2OBMA 1RYZA 2GILA 1NU8A 2X22A 5PNTA 4B8YA 4FYVA 2WTBA 2D62A 4EG1A 4WSOA 3J81k 4BVHA 1J21A 5TEWA 3M2PA 2FTKE 4HSEA 4KJZA 2NZ8A 2AH5A 3B3QA 2NV6A 4DCMA 4ETMA 1AKMA 1FS4A 3JYQA 2ZB2A 2OAQ1 3LO5A 3JASB 3PFNA 4NENB 1HWYA 4X91A 3CM0A 2VTKA 5IANA 4L3WA 1M5TA 2GO1A 3QTTA 4U63A 3VO8A 1TQ2A 1K4MA 5G0WA 3T7EA 1VIAA 3FFWA 3PSHA 4Z4GA 5JXHA 5KKCA 4QE3A 4YRTA 1MXFA 3OWOA 1ONPA 2HIHA 3QI2A 1T8PA 4H7HA 3ABQB 4IXTA 3V1UA 1LVUA 1KAMA 2WKSA 1YUNA 4TN5A 4DHEA 2J9YB 3P7MA 1Z8NA 2A9QA 1HFEL 4Y1FA 5AHRA 2APJA 4C9BA 3PNPA 4N49A 4JJEA 2IIPA 2GCOA 1W5SA 2H52A 2QRGA 2XB2A 5DF1A 4MUIA 1E2PA 1K68A 1MX5A 4ASUD 4KR3A 1D2MA 4HMOA 3NPAA 4JBHA 3UH1A 2EWVA 2CXUA 2H4XA 4BP8A 2RE8A 1NXOA 2VXCA 4NWIA 5T4FA 1WLYA 5C8ZA 4UJ3A 3Q15C 1KORA 4LSMA 5CT6A 1UT8A 5DXFA 1HZZA 1SKMA 4DRZA 4TYNA 3MF4A 1U9CA 1N2OA 3GMIA 1VBMA 5DP2A 3IX7A 1BTOA 3IPCA 4X41A 3UKDA 1R7RA 3IEUA 5CVCA 1Z2DA 1FYEA 3JSXA 1N2CE 1ZHHA 2I65A 1JG7A 4G9GA 1QNFA 4JP8A 5H80A 5DRYA 1YNSA 3TOVA 4KB5A 4D43A 1FFXA 4HGZA 4DY4A 2WILA 4G8BA 4GFDA 3HU5A 1CZKA 5DIFA 1JF8A 1JKMA 2P9GA 3UB2A 1RPAA 3NEAA 4P93A 2HWKA 2JIDA 1W47A 3AUFA 3BRCA 3N2LA 1L7NA 2Y2VA 2UDPA 2Y6UA 1IQPA 1O6ZA 2XNDA 2ACWA 4K9SA 4YEDA 5K0LA 2X19A 1MIHA 4H6VA 5HCUA 1X7HA 1AD2A 2QRLA 3C5HA 5EWLA 4KLCA 3VZCA 4JXJA 1E2IA 2FN3A 3A6KA 1S8NA 4YCAA 1C1DB 1TMKA 4WZBE 5FUYA 4DA6A 4MX8A 1V95A 4Y0AA 1QE3A 2WIKA 5A5EA 3FHTA 4QUJA 5BSKA 1D6SA 3DZCA 1RFLA 1FF9A 2XIJA 1G8HA 3R6WA 4TYPA 4RTMA 5B4VA 4QELA 1A7UA 5K8CA 4PPYA 4JJ4A 4HTAA 2FSVA 1CU1A 2PUTA 4HGNA 3VRHA 1ODSA 4YRPA 4CODB 2FQWA 4R2XA 3IILA 4C4RA 3MFYA 4LPKA 3T3OA 1VA5A 3C48A 2OQ2A 3WQSB 5ITZA 2A84A 1RC8A 4LC1A 2BJWA 4UBMA 4OGGA 4UAGA 5BQPA 5IP5A 1Z5ZA 4UM9D 4Y1RA 3PQ8A 1CUFA 2HH9A 4M1SA 3U4AA 2ZTMA 2MU1A 1WXQA 4JP2A 5TPZA 3ENQA 2WAAA 4I6GA 1PQWA 3EIHA 3IIKA 5CFMA 4O3MA 1XZJA 3MPUA 4G6ZA 4JGIA 4BB6A 2XMDA 3NM4A 4MQLA 3PBKA 4DLLA 3PDUA 4DJ5X 1MAAA 1N2CA 3AJ8A 4GL4A 1UBJS 3PDHA 5LDDC 4Q4CA 2A3RA 3BXGA 4BFVA 4R5HA 2ZUWA 2PUBA 2W11A 4I4NA 2IYTA 1P5HA 2ZR8A 3UUEA 4HGQA 1LQ2A 3KQUA 1ISRA 1GKLA 2C31A 2H4FA 3JD4A 4Q1BA 1Q7BA 4B82A 4DA9A 3KD2A 2XUGA 4TWRA 1W8IA 2NYRA 3H5LA 4ONEA 4X00A 3ZZUA 1O9GA 3NALA 3GLFA 4GLJA 1SXHA 3F1KA 5EWJA 5GZ6A 2H51A 4Z53A 4Q3KA 221PA 3H1FA 5JW6A 2HO4A 5LP6B 5M29A 3F47A 4LJYA 5TJHA 3VR4D 5CJ2A 1ZJJA 2BP7B 4NYIQ 5T3YA 2RJ3A 4XVHA 1X3LA 1OZ0A 2R7AA 3LLVA 3WE7A 2CNNA 1KKUA 421PA 2HJHA 4CDMA 1MIOA 3ML1A 5BYKA 3RQIA 2WSBA 3U17A 1WW3A 5IS2A 2G0TA 4KFTA 4CN9A 1I10A 3JQDA 1QS0B 1XZAA 1EHCA 3PUXA 4RGVA 4YPFA 5G3YA 2AOUB 4NKRA 1VLJA 3QKIA 1LH0A 1TEHA 4M86A 2R4QA 4TQ9A 3KD3A 3LRXA 2R6FA 4KXXA 1P0PA 3KKLA 4YX9A 1NOKA 4XARA 5JRDS 5C18A 3U0VA 5ESDA 4YMTA 2D2XA 5K7SA 2G1UA 2ASVA 3F6YA 3FFXA 4QJ3A 2ZR9A 2IELA 1E3SA 1CX9B 3BL6A 3LUPA 2CEAA 4DEYA 4DR1B 2YMQA 4IYRA 2IH4A 2WVJA 3FKSD 3GBPA 4N8SA 1KR2A 4YBZA 3S8YA 3NBYC 1KVTA 2RAUA 3PHJA 1QUEA 5KVQA 4IMRA 3HLYA 1MIOB 5L95A 4M0KA 4HI0E 4RV5A 1GCOA 4DZZA 1MV5A 1VJ5A 4LBVA 4C87A 3FX2A 3A25A 4EJFA 3IQFA 5H59A 3PUHA 2OB1A 3EF3A 4RKFA 2Q0HA 1MC1A 4K6FA 1XF1A 4AWAA 3PXCX 1ZY2A 5KNCD 3MGCA 1GNVA 4HNGA 3I3OA 2A6PA 5HQTA 2W6ZA 1V9LA 1ZMXA 2ZYUX 5A3VA 1J9GA 2CWWA 4MS1A 3ES9A 4YCDA 1CSEE 2CCGA 3LAWA 4AZWA 1PFKA 2VTEA 2ZRMA 4BBAA 5JXIA 4FB5A 1CJSA 2C4HA 4F7WA 4LZWA 1SUCA 3F5FA 5C31A 1SELA 1XNHA 1WXXA 2J7KA 4QTTB 4S35A 4ZN6A 1ODTC 1NLYA 2J6HA 1RZRA 3A1WA 3D9QX 2Q62A 2K4MA 1PEAA 2OOKA 3CLHA 3C7KA 3EISA 4RD0A 4XVUA 1F0PA 4WIAA 1C80A 2HK8A 4EG7A 5LPNA 4OXXA 3SJ7A 5BXYA 2GHQA 3HDGA 3LCUA 3WDLA 3IV9A 3KR1A 4UNNA 3U3OA 4FIDA 2Q5JA 3CSSA 4K9PA 5T57A 3F6RA 3AEQA 4ZHSA 16PKA 2NAFA 3GV0A 3MT8A 4I8XA 3SNHA 4OD0A 2QSZA 3T3PB 4EKDA 4NARA 1YONA 2B34A 4RH0A 2LBPA 4HKTA 4K9DA 4UHBA 5AOBA 3PPIA 3UGJA 2P75A 3ZJUA 2EEPA 1VRVA 1V6SA 3G5UA 2ZB8A 2JBHA 3FYUA 3EIWA 2CL6X 1YRAA 2AMJA 2YXDA 4QJBA 4WJKB 1H0HA 1MAHA 4PLZA 5HMLA 2B69A 2ZIUB 5E7JA 3NIGB 3H8WA 5AKYA 1ZI9A 4UPVA 2HHHB 3ZUGA 3C3JA 1QU3A 5C8DA 1ICEA 4R51A 2WAXA 5BV2P 3PF8A 3RD5A 4YDQA 3SHVA 1K86A 3QJ5A 4LYFA 5E9JA 4HNVA 5EJ6A 4D4HA 2HWWA 3VZPA 1JFVA 4YN3A 5IC6A 2BFPA 3OP4A 4E31A 5F2OA 4EQ6A 5FOVA 2BYTA 4YP7A 1W7AA 5B7PA 2OD2A 3KWJA 3RNLA 1H1TA 4BHTA 2XQVA 5DXAA 4MYRA 1TLLA 4JUBA 3PRJA 2H63A 4GDMA 2IV3A 4F2GA 4ZEVA 1U7ZA 1IY2A 1ZOLA 2DWOA 2ZBVA 3OETA 3WGOA 4I4TF 2JJ1A 2GWRA 2HPZA 4PANA 5AJHA 5FOTA 3DBHB 4TV9A 1YFKA 2UXDB 3AW9A 1L7OA 3AEZA 3GEBA 5LBUA 4GI5A 4GI2A 1NX6A 2L0XA 3H7IA 3ZCUA 3FYUC 1U5BA 3M9XA 4PYLA 3VR2A 2GBGA 3TECE 1H2BA 1TQHA 1F6BA 3BL8A 2RGXA 4J0JA 5I9BA 4Y2VA 1KH1A 2QORA 1N25A 4BMXA 4O1HA 1P81A 3ZWKA 1FXWF 5H1YA 3KXDA 2FUEA 4C7MA 1M1YB 1PG2A 3BIFA 1IUOA 3MOGA 4NICA 3TRKA 3KAJA 3TTYA 3QVVA 3ND9A 5AVZA 3FJOA 2MR6A 4NMWA 3AR3A 1GZUA 2CLMB 4XB6B 9LDTA 1U2DC 1V6CA 3QUQA 5EHGA 3QA3E 3X43A 4H31A 2MT9A 4FCVA 3RBZA 3K2EA 2PVCA 2FYTA 4JNCA 4FDUA 4MP6A 1XLVA 3KALA 3UMBA 2KMLA 4F4FA 4RVNA 2WF7A 1VA4A 1SKBA 3PEFA 2BPOA 2YZGA 4KC0A 4EW6A 1MMFB 3HA5A 1BE8A 4GO1A 4Q7EA 1BCSB 3DT6A 4HWGA 4W63A 5E8RA 1GQOA 5TJ9A 3BCUA 1Z25A 1ECCA 1PWHA 2OO5A 4G9BA 4LZNA 4BFWA 3KBBA 4IWNA 1Z0UA 1LVGA 2RBEA 2XUOA 2ZDQA 4NCIA 4Q5IA 4M7WA 1KEUA 4M0CA 5CK4A 2B37A 4QGSA 2FR0A 1NY6A 2CXRA 1UDCA 3PRKE 3CIOA 4P9NA 4WUVA 1LV7A 2Y1EA 1UADA 4I3GA 2D54A 4R9RA 4V0LA 1HFJA 2P6PA 3IPYA 2E37A 4AG3A 2ORVA 4GRAA 1MOSA 3EDOA 2ZSIA 3AKYA 3KOOA 5CLLA 3UJ3X 1JKJA 2WQ7A 5TQJA 1EQUA 1SCAA 3JATB 1OHHD 2JGDB 3RUCA 3LPDA 4YRKA 2OGSA 4L8GA 2WW8A 4GBJA 1M6HA 1XLWA 4REQB 4DBLC 1QPGA 2CYCA 3WADA 5KHOC 3PE6A 2ZSJA 2JHFA 4QOSA 1A2BA 3QFHA 1YE8A 3OIWA 1G9XA 2QTLA 1JWBB 3K9NA 2FA9A 5AVTA 3NIDB 2H8GA 1O6BA 3BRQA 5ENVA 3BSWA 3SCZA 3LVBA 1YBAA 4U8HA 4A2CA 4ARSA 4BXOA 5JU6A 2SBTA 5GM1A 4YUXA 1L5NA 4NAHA 1RM0A 3PR3A 4HL6A 3TD6A 3GGCA 1VL0A 3DVRX 5JAIA 3N2YA 1XJCA 1F1BA 4LN1A 5AKJA 3T3EA 3ND7A 4M1KA 4REQA 1TZKA 4HS9A 1OTXA 5LA6A 3UG7A 4BNYA 4U7DA 3ADOA 3KPYA 3WL5A 3CRQA 4K9QA 1QX4A 4C1BA 1VIMA 5G1OA 4UFNA 2YYSA 1JHOA 1ZU5A 1DEKA 3ACDA 4FD2A 1XZ8A 4MVJF 4URYR 5C4MA 4NNJA 4WKOA 1WVMA 3GLGB 4CIBA 1NQUA 3I8OA 1ZRMA 3G23A 4B87A 5JYBA 5KIAA 1BWQA 5TF4A 2WJJA 3K73O 3DB1A 1WCIB 4LPSA 5AK0A 5E4JA 4DS3A 1JR2A 3GEDA 4F6CA 3CH5A 2W4QA 3DBHA 4XWGA 3LLCA 3W9UA 2QZPA 3TCXB 3TZCA 1E4YA 5CFPA 1PG5A 1P72A 2ECQA 3GQBA 3L7JA 2ZBFA 7YASA 5ICFA 1QVRA 1HQKA 2GN2A 3LHKA 4LK3A 4BATA 4NOMA 4IINA 3VYTB 1L4EA 1QF7A 3IV7A 2GM9A 3HZHA 3KJZA 1JFSA 4FWIB 3NWJA 4O0LA 1RCTE 1UT6A 4P08A 3E5MA 4E1AA 4DR2B 4NMLA 1S1MA 3O1HB 2KYRA 2VHJA 3U3JA 3ABSB 3RS0A 2AGVA 2B1JA 1Q20A 1E3IA 1I1HA 2AOXA 3H2JA 3EZFA 1Y7PA 2DULA 1T1IA 1JJBA 1GL9B 3CKYA 1ZCFA 3QEKA 4FUTA 3Q87B 2LKCA 3JYOA 2W2OA 4HH0A 2AEJA 3RSLA 5KCMA 4GQIA 1E6EA 4A0HA 5ADWA 3I04M 4NNPA 3REFA 3WLJA 4ZT4A 3DOHA 3PICA 5KTTA 4YI3A 1XDUA 1Z8DA 2VRBA 2H4JA 1HNXB 1KQGA 2GNPA 1B23P 4BNHA 1M67A 2H2DA 2OKGA 1TTTA 4HGRA 4JL6A 2I80A 2HBQA 4ZIRB 1ZK3A 2A5GA 3R0IA 5FUQA 4KIGA 2K87A 1H6DA 3I45A 4BX8A 2R47A 3RFXA 1UP6A 4QIHA 1QYVA 2Q8NA 1ESMA 1MPXA 2Q3JA 3VDRA 2Q0XA 3RDPA 3OQHA 3DO5A 3EXG2 3NXKA 1IBRA 1KYQA 1OR8A 1RI4A 5DEIA 1JEYA 1NI4A 1Q0UA 4PE5B 1AGNA 3IOYA 1NI5A 4H77A 1GTMA 3UNXA 4F96A 4JV5B 3RTGA 1NSFA 5IK2D 1KS9A 2H06A 3P4UA 3R8FA 1PDWA 3S2IA 3UJDA 2PYDA 1ORIA 5BSTA 3RG2A 2QV0A 1HZZC 1JIUA 1Z2PX 1WAMA 3G79A 2YHSA 1S2OA 2VYCA 3SC6A 1EFTA 1PJBA 2BOVA 5CIWA 5D85A 1IK4A 1NR5A 3KFXA 5F5XA 1XCPA 5A5DA 2ECKA 5LUBA 2CLIB 4MVJP 3PKZA 1JPUA 1Y3AA 3DEYX 1ZGJA 4YACA 1UJBA 4AJ9A 1T9HA 4LZOA 4J1TC 4Z1MD 5EE0A 2ODEA 2DSNA 1Z28A 1SBHA 3NJRA 3O75A 5BSEA 1I7SB 1T5HX 3D3NA 7MDHA 4PPFA 4WFIA 4AAYA 2EZTA 4QQ8A 3F2IA 3MRVA 1NBHA 4X8OA 5C51B 2VPTA 4RWEA 3ULKA 3GLGA 2L19A 5KC9A 1WUIS 5AKLA 4LRYA 3PITA 4N5IX 5IHXA 2OECA 3U37A 1SD5A 1U02A 1R88A 1R0BA 3GRCA 5FULA 4CQMD 5K9ZA 4JVOA 4AQ7A 2JFQA 4EJ2A 2ADMA 4OLHA 2V9CA 4R1LA 3RCBA 4MAMA 5IDVA 4XIIA 4MV3A 3BDIA 3GUVA 3WKBA 3DVAB 4BU0A 5FPQA 2Q9BA 4AY2A 3OUUA 2V9PA 1OY1A 4ZRMA 4ARZA 3DVLA 4ROSA 3E48A 4RD1A 4JD5A 2XNCA 3D4OA 1MEJA 3I28A 3S70A 4BX9A 1A4UA 2QTMA 3KZOA 5ALWA 3ETGA 4L73A 3O8RA 2P9ZA 1HL7A 1H42A 1U1IA 5JNTA 2UUAB 4YUAA 1UFVA 1NP3A 4BMNA 4CMBA 4PPGA 2AQKA 4D2IA 4C1NA 1RU3A 2QPLA 2PX8A 2OBBA 3E7FA 3S7ZA 2O8CA 2C84A 1F2UA 1NOIA 4QNNA 1BWRA 1TZCA 4U2FA 1ST3A 3OLXA 1DDIA 1IM8A 1ESDA 2HPVA 3IQEA 2J5BA 5FOUA 2IYSA 5IKMA 1V1MA 4E5MA 3ECCA 1LF0A 1UPCA 2J9ZB 4YP1A 3R4CA 3EQ9A 1BOOA 3CF4A 4YB8A 3IO3A 3LNTA 2GQ0A 4QPCA 3EEIA 1TLTA 1XVUA 5DYGA 4CM8A 5JCPA 3LQQA 3AEUA 2FZGA 4U7JA 3PHHA 2VUTA 2O5CA 1RMYA 3QYJA 5TQVA 1EXVA 5U9CA 1JALA 4BECA 2REXB 1M8GA 1Q12A 2JA2A 1Q7EA 1RZ3A 2QSUA 4UDYX 5EGSA 1AGRA 2JNWA 2GDZA 2XB8A 4NRDA 4WVLA 3TL6A 4AUEA 3H5WA 2RAFA 5ALKA 1PP4A 3COWA 2YXNA 1YKGA 2WWIA 2BI8A 3W9BA 2I1LA 2UZAA 1QONA 4WK6A 2IY7A 1Q95A 2O2SA 2O2YA 4PX9A 2OY0A 3TW4A 1JU3A 5KQMA 3A36A 5HQ3B 4KE8A 3MELA 1UM8A 3UAYA 5CM9C 1G8YA 3AUTA 3GGGA 2UYGA 3NWOA 1E2BA 1KI8A 1WE2A 2JD2A 4RIEA 2WFLA 4A0QA 4B83A 4FFMA 3WSVA 3IB3A 2ZRAA 5H68A 4EB3A 4RY2A 3H8SA 3U4GA 3G5LA 3SSAA 3U13A 1FP4A 3HCEA 2ES4A 3KHSA 3OZSA 3UMVA 3GFRA 1SZPA 2ZIFA 3S29A 3MHPA 4Q1VA 2I6GA 2IITA 1JHPA 1DQZA 2AN9A 3WWOA 4C4XA 4EW2A 3DAPA 4ZMSA 2QAGA 2H92A 4AJJA 4DIUA 5JAMA 1TK9A 1YAJA 4B3IA 3ITKA 3ZDDA 3HVUA 3N2NA 4RV9A 4BX2A 1E9AA 5I4CA 3IRUA 3ZWOA 2Q9CA 2TMKA 2XTJA 3E7PA 4X1IB 5E6SA 3RADC 3PJRA 3GUUA 4KXNA 1JHAA 4YAWA 2E2WA 2JDID 4C4SA 1HLGA 1OLXB 1QK5A 3ESBA 1J0BA 3L6RA 4RA9A 3STYA 1JVBA 4Z7QB 2E48A 1YJBA 1GNSA 3H4VA 4M9XA 4MS3B 4INAA 1FFEA 2WNSA 4FBGA 3OZBA 5EZYF 1GP2A 4QU9A 2I29A 1BGWA 1U8CB 3N86A 4WCFA 4JI6B 5JXGA 1G5FA 1PO7A 1W8DA 3IH5A 1KQPA 4A8HA 2FPKA 3D81A 4GBMA 4MWGA 3TYXA 1E6WA 4OJTA 3JYPA 4LRTB 1XP5A 5E1OA 5ICSA 4QFCA 1E3JA 2TRSB 3T7DA 1C41A 2Y71A 4IFBA 1ONBA 2YIMA 4UTZA 3IEMA 1WUJS 3BWXA 4DGSA 5IVKA 2FUCA 5BOSB 2BKEA 4X45A 5IJWA 3B89A 2QZZA 1E1YA 1QIDA 2P65A 2WVGA 3E0XA 3ONEA 1C3VA 1TA9A 4Q82A 4NCXA 1YB6A 3ZE9A 3ZWDA 1T6XA 3G9TA 2NP6A 3V55A 2YWCA 5C52B 3KLNA 1E64A 5ERYA 1XCJA 1I3NA 1SKAA 1U3DA 2ZB7A 2XODA 4HXGA 1YOBA 2H11A 2P3SA 4HWTA 1V47A 1LVHA 1A5TA 1XALA 1GRQA 4MUJA 4BP3A 5JNVA 2QM8A 4S0XA 2W8ZA 4LDAA 5CDSA 4N41A 2XUFA 3OEYA 4OHMA 2OM2A 5IW8A 4PYMA 4TS3A 3UJBA 7ABPA 1ZIDA 5CBPB 5FOQA 5KYXB 1IRIA 3BICA 2C4WA 5J4VA 2QLJA 1DRUA 4HWRA 2V0GA 2GJKA 2FX3A 2UVPA 2XDWA 3D1VA 4HNRA 3RSFA 5CA0B 4DNPA 3K7EA 4AO8A 3GT7A 1O4WA 3M2TA 5F23A 2FSHA 3DBLA 3K2BA 3PS9A 1QPZA 3BIWA 5G4LA 3TX6A 2YR0A 5FWXA 2MYUA 2BONA 1URPA 5BN4A 3QXCA 3JQAB 3THXB 5JMWA 2GAIA 3OO1A 3UPTA 4UEQA 2J41A 4P2GA 4L50A 3PDIB 1OYWA 2VT7A 2YWBA 1V5EA 5CTJA 1C4WA 1RM5A 3I8XA 4XFJA 3W1WA 5LR6A 4RXUA 3N74A 1BJKA 1WX1A 1E5DA 1H2AS 3BZWA 3RW9A 3TZLA 5HDQA 2NADA 4YFYA 4MGZR 2E6KA 2RHDA 4HEQA 1LEHA 2JJ2D 1N6NA 3CH7A 3FB1A 4F4IA 3DCYA 4ROTA 2FF5A 5TB5A 2OD7A 1E79D 2Q0SA 4KH0A 3GGSA 2ZBGA 1RHMA 3QZUA 4YXFA 2YH2A 4V38A 4JT8A 3W6NA 1J8YF 3NHWA 1EG7A 3EXFA 3UTDA 1QF9A 3L41A 2YN2A 2JGJA 1Z5PA 1PDVA 1YBVA 3I9FA 5A7FA 1GRNA 4L5BA 3T95A 4K2AA 3S2SA 2W90A 1IY8A 1SBYA 1CW2B 5IAJA 2H7XA 2JKZA 3N87A 3H18A 1UPTA 2ID7A 5H83A 3WQRA 4RZ3A 5DLEA 5HJ7A 4MKXA 1TLFA 4L9AA 3HO8A 5F1KA 1HEYA 2OCAA 2PV0A 3MWFA 1X6VA 2PKEA 2AA3A 5AM3A 1QHXA 6REQB 1S3GA 4QPPA 2FP3A 2Q7OE 1G3IA 2XKJE 3G7UA 4WAUA 1K27A 1RJ9A 4AW9A 4JOSA 4RIIA 4ESHA 1TO2E 2J48A 2VJPA 2AOWA 3DL4A 2GEVA 2RH5A 3HUDA 1IXRC 3PXUA 2DM6A 3G2IA 4ITVA 4BO0A 4KXWA 3RH0A 4D6XA 1H1DA 3P5SA 3Q8XB 2PRIA 2ID9A 2MSDB 5MGNA 4BQPA 2FFJA 1V1MB 4UM5A 3SE0A 1ST2A 2CF6A 4II7A 5C32A 2R8XA 3HBAA 5F9HA 1UK9A 4XTRA 1QGED 4X84A 3N2KB 3HYTA 3IVAA 5B55A 2A67A 3M5WA 4NHEA 5A71A 2PO5A 1FP2A 4AF6A 1A4XA 1PT5A 4GQBA 5JPCA 2BZ1A 3QM1A 4CTNA 3HKCB 1T29A 2B1GA 4XR9A 1GA1A 1YU6A 1LPAB 1J5XA 4QDUA 2EFYA 2WT8A 4OO3A 4HDRA 4OQ4A 3FSEA 4QDOA 3PFWO 4WPGA 5FHRA 4EL0A 5KSOA 1Q7CA 3EIQA 3SQXA 3OCXA 5LLSA 2X4LA 4JQYA 1I0ZA 4EEKA 4JL5A 5B4TA 1YAHA 3BIOA 4K05A 1T2EA 3EZ6A 4PXSA 5FDFA 4MI9A 1Z0IA 3QVSA 4RY0A 3I58A 1B0ZA 2NTJA 2C8JA 4HTFB 4CGYA 1OCEA 3QXHA 2XB6A 1H8HA 2WWHA 4O4JB 4FX5A 4EKEA 3ZE8A 5FPYA 1E32A 2B61A 5K3BA 4D0LB 5CA1B 4POAA 4CCWA 1ML4A 2H5EA 3B6IA 3CKLA 3ZPXA 2E55A 2X8BA 3EGCA 4WK0B 4EMSA 2EX4A 5KYWB 2I1QA 4MJ3A 1QTQA 1M2GA 2FEOA 3W8DA 3WYBA 4LXTA 4PHFA 1UBFA 4Y98A 3TSZA 3LQYA 1JG2A 4IG9A 1WVGA 1Y6JA 2I8LA 2Z9CA 3AI2A 5EMLA 3LHIA 1PD0A 2M6RA 3SR3A 5FF9A 2G1JA 2QQ5A 4XM2A 1K6MA 3VSCA 3T1OA 1IVYA 4ZCIA 3D2AA 4Z1OA 2DF8A 2JK1A 4D9KA 5TQ2B 5BWCA 3DG9A 5A05A 1D9ZA 5CDFE 3M5DA 4GC9A 4WN9B 4YLGA 1H9CA 4Q3BA 1H65A 4LV8B 1UPUA 4JB8A 3VYRB 2JB9A 3JQ6A 3KPWA 2G9UA 2RGGA 5THKA 4BWYA 1GKKA 1ENOA 2X14A 3P9ZA 5DYIA 1I3MA 2P3OA 4I8DA 2IEAA 2NXCA 2P5YA 3AF3A 1FTWA 3OFVA 5HFNA 3RJ5A 4AXBA 3UMYA 5FKJA 1VIYA 1QLJA 3PQCA 4A27A 3ZOKA 4GSLA 1SVOA 1R8XA 1YACA 1AF7A 1KIFA 1T3ZA 5EXDA 5FL7D 3D8UA 3NEYA 2F3UA 2WJ6A 4JCCA 3NT5A 2XA9A 1IVSA 1T0HB 1NGSA 5E7QA 3I05A 1PX0A 1KR5A 2DUUA 4G8DA 4TL8A 4UW9A 2HK7A 4ZO9A 3W5VA 3NCHA 4KQIA 4E6PA 2EZUA 4JLAA 4HRVA 2YWXA 4FOSA 4RHEA 1SKYB 4ID9A 2OZLA 2QN1A 4QUBA 4RWZA 1RAFA 4UM8B 4ZQHA 4CKEB 1B74A 3VHRA 1UPFA 4F3RA 2FEKA 2LPMA 5EJ4A 1WD5A 3TH5A 2X86A 3V8RA 3EVFA 1M72A 3IQWA 4HNQA 4LJ4A 4JYMA 3W90A 3H11A 1XZPA 1PTJC 1VC2A 3DP7A 3OD5A 4TRMA 4RZIA 2FMHA 4NVRA 3TXYA 4RS4A 4CIWA 1NDQA 5B1HA 3UY4A 1ZGCA 1LXCA 1Z68A 3NBQA 3TSWA 1AMNA 5LMUB 1RTKA 2BEWA 1XTZA 3MLEA 3NU1A 3PE3A 3UW1A 1XMXA 1YO6A 5B5SA 2HLPA 3P97A 1O95D 4JLVA 2R7LA 4RLHA 4EAAA 1G8FA 3ZTWA 4M0MA 3QKUA 3V7WA 4YCMA 3RSZA 5LIRA 1HM5A 2FX2A 1GCGA 3SZ3A 3TR0A 4DPLA 4GS5A 1MJNA 3IAEA 1QIJA 4KSCA 4TTSA 4EVRA 4EVIA 2X2FA 4DE5A 1NZDA 4FFWA 3S2EA 1Z2EA 2WT9A 1ZUD1 5BN4B 2G6TA 3WO0A 2XGJA 1MOQA 1B0UA 4KPGA 3DDOA 1BVUA 4PZ9A 4XQGA 1O03A 1PHRA 2P78A 2V58A 1G8KA 3P0FA 1OZAA 4L75A 1CZRA 4BGIA 5C35A 3DEIA 4QOEA 3EIUA 3SMQA 3TW8A 2P40A 1S2IA 3RT1A 3S8MA 4YT2A 4PSCA 2OLJA 4BX0A 5IRCD 1E77A 4UDNA 5ALHA 1UKYA 1G7SA 3WIVA 2ZJAA 3WGZA 2RGUA 2XI4A 1EFRA 1ECJA 1Q0TA 1H2FA 1C9JA 3H8JA 4JEHA 4LOHA 2XE8A 3CEHA 1I7DA 1OILA 4GMXA 5AP9A 1EQ2A 1ZMRA 4LJ7A 5DM4A 3E18A 3F96A 4CT5A 4JBWA 1VLQA 4OI4A 5AKKA 3Q3JB 1KO4A 3AKEA 2ZYHA 1NFFA 4PLTA 4HZGA 3AVPA 1QGAA 4EQZA 4AIRA 5F76A 2RGWA 1RRGA 1NBIA 4GM4A 2B1RA 1YDHA 1BS9A 1AE1A 3D6FA 2Q2VA 3DLCA 3LY7A 4XW2A 4MV9A 1BFUA 2PKXA 5J5AA 4CHTA 1KF0A 4HAXA 3NT2A 4J6EA 2QKYA 3OTQA 4TXMA 1JQLB 1K6IA 2ZUSA 2CHFA 3FTDA 4YRCA 3UT6A 1MHTA 1H05A 2HMYB 5FIUA 3LTEA 4NBVA 4CLDA 3H9UA 4GT1A 4WGFA 1BS1A 1FL9A 4MOWA 4IZIA 1FUEA 1JBEA 3ZVLA 4I1PA 3U44B 2Z9DA 4DV2B 1PQ4A 3COSA 1XYGA 2OQVA 3OQBA 2PQ0A 5DN9A 1GZ4A 3RYIB 3D8RA 1G17A 1NONA 1MFPA 3VPSA 1M2FA 3AEQB 3GUCA 5C46F 1ZK2A 3IB6A 4UDXX 2DB3A 5HKLA 2O3UA 2QX6A 4MV1A 1N75A 2BMWA 2FJ0A 1FW6A 1Y6GA 1QGOA 2AX4A 4B71A 4CV0A 1E4EA 4IDCA 2CFCA 4WVFA 3ZDYB 2RGBA 6PFKA 3KZKA 1QIGA 3DO8A 4KNVA 4XUCA 7GPBA 1NF3A 4JI0B 4PHTA 1OZFA 1EUDA 3FVVA 5I48A 3LSYA 2C9DA 1JH9A 1IZ8A 4W9NA 2X5KO 4HBZA 3N6XA 4KXYA 3DMDA 4Z9FA 4PTYA 1RCFA 2HPHA 3GFVA 4B40A 1AU9A 1W88B 2QRMA 1MP0A 4UBOA 1HDCA 4BFYA 3OPNA 1RHJA 3L77A 1MO6A 3K72B 4EGSA 2PK3A 3AUKA 4YRMA 4BMOB 1NBWB 2FJUA 3LP8A 3F7MA 4MB0A 3L43A 4QXPA 2OXFA 2IU6A 4X6YA 3NAMA 4OLAA 1N4AA 1H2HA 1L6RA 1DMSA 2NAPA 3TW6A 4J4TA 4P6VF 4KDCA 1LF5A 4B0OA 4ZYLA 3RVPA 1LQUA 3NVAA 1FUIA 1VCIA 2D2IA 2QP9X 4ALMA 4ME6A 5A5FA 1S89A 2NXNA 4ES6A 1EZZA 2VQ6A 1JT9A 3S2UA 3U7JA 3FH0A 3WOVA 4UEJA 1UEJA 2PLWA 2Q8QA 2QLMA 5GJWC 1R4ZA 3E4CA 1SY7A 4N3AA 3EVCA 4I3HA 1Q2XA 3TG2A 5JO0A 4G4SP 1RAAA 2HHLA 1RP7A 2J0VA 2OQIA 3TLXA 4EY6A 4EHFA 1RAHA 3MUEA 1NIPA 1QZXA 2ZE7A 5AI6A 3ELBA 3JWIA 3MCUA 5LOVA 3D3EA 1S9HA 3N8KA 1XN1A 1A8QA 4DR5B 1LNSA 3W34A 3KV1A 4V2UA 2OV3A 1T26A 2CXHA 1QM5A 2VHCA 3P19A 1IH8A 4W5RA 2C61A 1VE3A 1R8YA 1TZBA 3AU9A 1WCYA 4HC4A 2ZYDA 4RKYA 5IJAA 5MFZA 2EFHB 4K6MA 3J7AC 1GPJA 1ZK1A 2KM1A 1RJFA 1CQPA 4TKUB 5I01A 1EBFA 1ZO8A 2QDXA 1KYYA 2QX4A 2N3ZA 3MSCA 5ESRA 3FYDA 2AZDA 1YZNA 3C3WA 4IHJA 4LYGA 2EKLA 4YT4A 5F21A 3GOQA 4HVAA 3ED5A 1NJ1A 1R6DA 1ULTA 3UCFA 4EHAA 1O5OA 5KTSA 4OI1A 5GM2A 5CT5A 3EIXA 4UXHA 2O8VA 3O9VA 1JIJA 3IR7A 4M38A 3A2NA 4OI2A 4PHHA 1AUPA 2QUAA 3ZK7A 4IJVA 3G59A 4KIWA 4Q21A 3VKVA 4LQLA 1DKOA 2BGLA 3BWMA 3ETDA 4DLNA 4G63A 2J5RA 1JQ5A 5B6JA 4IIBA 1NC1A 2Q5IA 4HH4A 1SUSA 4M89A 3ZD7A 1DTEA 1VSTA 1OAOC 5DTEA 3A1TA 1NMYA 2GK6A 4R81A 4Y6RA 2WZBA 3DZFA 4POOA 4PG4A 1EB8A 1XD8A 4UE3S 1AGXA 3KE8A 3SSMA 5DBFA 4ZYWA 5DK4A 3RB8A 2EYUA 2LDXA 4CCAA 3ET4A 2BGMA 2CLKB 2PUVA 3ABOB 3BXEA 2W8BA 1BX3A 3L7OA 4M8KA 4ZFNA 4OQLA 3BXXA 3QBTA 3WLRA 4DLTA 1MOZA 1M74A 3M0EA 3AZQA 1K3UB 4PLCA 2Q2QA 3FAZA 1OLSB 4LE2A 1NMEA 1Z2OX 1I2AA 2QNIA 4GUDA 4ZT3A 2H4YA 3BB4A 1P4SA 1QYCA 3FNGA 1I30A 1ZNQO 4IJUA 4M1MA 4BE4A 3QQPA 3O03A 2R87A 1T9CA 1E94E 1EYZA 1TEVA 1BMDA 3JZAA 4KR9A 4C03A 4QTYA 1LDNA 1MTOA 4F4CA 2X8JA 3FZEA 3OT5A 4N3CA 4PSDA 2YJTD 3TAHA 3PT9A 1Y3HA 3MUNA 2P0AA 5F33A 3OJ0A 4OSPA 1AHHA 4L2IA 1KFBB 1NT2A 5J3JA 1OBHA 1SXGA 4ND3A 4Z8XA 5C4IA 5D3ZA 5DYNA 2OFWA 3G2NA 2O3JA 1VPLA 3V48A 4OHWA 1EZ4A 5BQ3A 3RS8A 1XA4A 1II8A 1QO9A 3IDZA 5AVJA 4MVJG 1C1HA 1OWPA 4D5EA 3ZGXA 4XWYA 4JWKA 4HX2A 2PZ8A 1QQ6A 2C9CA 2VDMB 3NFRA 4IUCS 4PLHA 4MW0A 4PCAA 3V4LA 2YOFA 4JVLA 2P4HX 3O1JC 1JMVA 3F8SA 2PUEA 1DG9A 3WHKA 3E5RA 3KQSA 3FPCA 4ISBA 5FRDA 4ZVQA 4BEBA 2OZKA 3OQPA 2R8YA 5L4SA 3PFIA 3ACCA 3AFGA 5DM70 3A3KA 2BE9A 3DXZA 3R44A 3RR2A 1GGJA 2IEBA 4KNYA 1FXSA 2FG5A 3K30A 2RGYA 2D3WA 2QT0A 2W37A 3WRWA 2EBUA 4HO1X 4LOKA 4Q47A 1YZFA 3V4PB 1IL0A 2G67A 2H54A 2Z1MA 1DJLA 2PUWA 1GQQA 3EZ7A 1OH7A 3K0CA 4XWOA 5EMKA 2MSKA 4EUSA 3BF8A 3HRHA 3AG5A 5CU7A 1N92A 5K3CA 3OIUA 1HX7A 1TU0A 1TYEB 3MTIA 4LEIA 4MVJI 5T4HA 4DUGA 1N7HA 2RHMA 2PUJA 3WIDA 4AJOA 2VK8A 3HB0A 4BVLA 4E3WA 1T3TA 1EJ0A 2ZRIA 4HLCA 3C8MA 1JQJC 2D0IA 5BSHA 5FX2A 4DM4A 5HJ2A 1QHIA 2Q2WA 2QAIA 2DFDA 4EG6A 5JSHA 4JBNA 1DSSG 1Q0RA 2JFYA 1OWOA 2WPDD 1CR6A 4ZCSA 3ZWYA 1WDWB 2WHYA 1OYOA 4FQ7A 3O3CA 5G0TA 1DU4A 3L4BA 1TKAA 4Y0VA 3GYGA 2XTMA 2PZGA 5HK9A 1JN0A 3CW9A 4FDTA 1NF9A 2Z3VA 4R1TA 2F9FA 3K4QA 4NBWA 3E1GA 2NU8B 4BU1A 2QE6A 4ZI5A 5CD9A 5C1DA 1RJ9B 4U0JA 3OKFA 3H99A 4K81B 2VUSA 2XKBA 1T4MA 3ILHA 4D0NA 3BWCA 4EPTA 1QV6A 1VMKA 5BR1A 4H17A 3K5IA 3ZZTA 2BFFA 2VQFB 1ITZA 4M8LA 1RMQA 5EIEA 5KWVA 5DV9A 3AKDA 2MHCA 3CB2A 4DA8A 1ZVMA 3NHLA 3SVZA 1LK7A 3WB0A 2CMHA 1TL7C 2XRFA 2CV1A 1ZMBA 2H5LA 3F6SA 3PDCA 4CMEA 3V2UA 2QRJA 1NUAA 5LA6F 3FXAA 1U7XA 2XRMA 4GRIA 3H9EO 3G5AA 4FR5A 3GWGA 4Q0MA 4Z8YA 5AW6A 1OH5A 3HB1A 5DULA 3E9NA 4C5AA 1QHYA 2HRRA 3NANA 3DOIA 4S3MA 4CUJA 2I2XB 5AHXA 4ARAA 1S2MA 3M6VA 1QZZA 3V1NA 2CNWA 3DVSX 1NMZA 2HF7A 5FNVF 1FLNA 1O77A 1VE6A 1DX4A 2ON6A 4LBZA 2HUNA 1K5GA 2CXOA 3VSEA 1Y42X 1NWCA 1J7JA 1DBVO 1TJ3A 3WZMA 2A14A 3R7WB 1G4HA 3AMVA 4ON9A 2CFSA 4W82A 2R68A 1HSOA 2WTEA 2PYZA 4C0JA 4QA9A 4B6JA 1KZ6A 2D74A 1CR0A 3ME5A 4G0WA 5HG0A 3W9YA 3UAXA 4LNUA 1JHXA 2GFHA 4ZVTA 5SZKB 4A1OA 4E2WA 621PA 1AXGA 4D9BA 3U5ZB 1CY1A 5FBLB 2X9VA 4TTIA 2I71A 2OO3A 2ZRQA 3JQ9C 4BRWA 3IAXA 1UJ5A 4YUVA 5BUQA 1B8VA 1U94A 1KOLA 4E5YA 4ZGBA 4FYIA 1RJDA 4P3PA 4EI2A 2IYXA 4R8SA 4XFDA 1NNLA 1OFHA 1LA2A 2CNOA 2KW5A 2WJIA 1C2TA 1J49A 1POXA 3B9RA 3D3QA 3I23A 3K0AB 1T2VA 5H3HA 2AF3C 2I4MA 2IKSA 3D6TB 2J9FB 3PJFA 4NJMA 4INPA 2PWYA 3L8CA 4BMCA 1TVKA 4K5QA 2F67A 4RCYA 3BQNB 4R1OA 1T0JB 1VCMA 2RC6A 3KQLA 2XNSA 3BB3A 1P62B 1W46A 2QHXA 3AV3A 3B9QA 4BZXA 4BWVA 1VHJA 3CLSD 3EHEA 4B4KA 4DSUA 1JDBC 1QU2A 3A8TA 4C0WA 1HXHA 2DC1A 4PXAA 4GMKA 3PEVA 3N8GA 3UANA 2I6FA 2H31A 1Y9ZA 2D00A 1XKXA 4P4LA 3KYBA 2A8YA 1ZN9A 4R7ZA 1T1JA 4IDQA 4J03A 3NHYA 3OI7A 1N5KA 5G53C 2PL5A 1W30A 2V7WA 4XIJA 2Q0QA 4TL7A 3CUWA 1RZVA 2IWRA 5HX7A 3SJCA 3ZDXB 1D1SA 5KC8A 2WUVA 2IRWA 3SS7X 3D6AA 3ZHYA 1BXRB 2X9GA 3RFVA 2HWUA 1NXVA 2EBWA 3IAS6 2C4VA 3GMTA 4GPBA 4RANA 4WKNA 4UUBA 1IOVA 5HKKA 5CMLA 3KZ1E 4D99A 3EF0A 1T6YA 3F71A 2ZBRA 5HMMA 4MUEA 2UZ3A 5AM0A 5AJYA 3QWHA 3QEBZ 3O7WA 3P71T 2EZ9A 3OC0A 2HMWA 1BKDR 2CDNA 3CUTA 3NJ4A 4N9QA 3IS3A 1P0CA 3FFAA 4QPJC 4WFKA 1JG3A 1J2UA 2X15A 4TMTA 1YR7A 3LC1O 2X0FA 4FHDA 3M3PA 2HV9A 3VSAA 1Z2NX 1KA9H 2B21A 2J0QA 1Q7GA 3KUDA 3ZDAA 1NQAO 2EIXA 2V96A 3G0CA 1CUDA 4JDUA 1AKTA 3GFQA 5LB2A 3TTSA 5ICEA 5KOHA 4L5AA 2IU0A 1GU0A 4GDFA 2C2WA 4J4HA 1H0KA 1W0KA 1FP1D 3NDIA 5EKXA 2RD2A 4E11A 3OIFA 4WJLA 5AIAA 3C6QA 5G3ZA 5SZHB 4MS4A 3FBTA 4HQ0A 5DCLA 1VBNA 1T8WA 1U2QA 4E46A 3T12A 1PCXA 4FGKA 3V33A 2ACVA 2J3KA 4D9CA 4G3XA 2WV7A 4JK3A 4MMZB 5CG2A 4HLNA 2CGEA 4YMSA 2V55B 1A04A 1OTYA 3NWEA 1HH4A 1HE8B 3KT6A 4XX1A 3UAWA 1YB1A 3HVIA 4YT5A 2D6FA 2R86A 3AFNA 1GCUA 1GEEA 3W06A 5JJ5A 2IGBA 1NDHA 4Q7JB 2PGDA 2Q1UA 5BNZA 1Z4JA 2QJWA 1V8FA 2AUTA 5B30A 1T1SA 1KFEB 2V0CA 4OREX 4LKRA 4E13A 1WPQA 3DDUA 1G0NA 4WDQA 1U9JA 4FYMA 2ARKA 4LJKA 4WH0A 2AW3A 3IYLW 4N5HX 3N7TA 4YJKA 1QCZA 1TI7A 3HNOA 3OT1A 2QRHA 4MCHA 3RPEA 4LZPA 3FOAA 1U1FA 3FA2A 4OH7A 4EZIA 2Z1NA 3TCKA 3UWKA 4F1WA 1GKIA 2UV8A 2DU8A 5I3ZA 5JJIA 1PLJA 3S27A 4OHZA 2QPAA 2XT6A 2IF0A 3ZCVA 2V7XA 5D7NA 2AV6A 4Z6KA 3BVPA 3NV7A 4F1JA 3C6KA 1KAQA 1DEXA 2PTGA 2B5WA 3C1TA 4TLEA 5F4BA 2GF0A 3OQJA 4W6ZA 1XCGB 4C01A 5GIOE 2GRAA 3A3NA 4LVCA 1UL1X 4QATA 5JARA 1GG2A 4CM4B 3IVMA 1S7CA 3OLZA 3B85A 4GI1A 5HYVA 2CFRA 1KGSA 4NYIR 3OF5A 4CM9A 1L3CA 2REOA 3GELA 3I6MA 3OCJA 5I8WA 1H0RA 2JAQA 2D2VA 2JBWA 2RB4A 4QARA 5A2QA 3BA6A 4YRQA 3ZCPA 2OGWA 2H2IA 3WMGA 4AECA 5FUVA 3KYIB 3T06B 2QX9A 4K1XA 1GUYA 3KP1A 3RUIA 1KJJA 2XB9A 2PCLA 4M1WA 2C92A 1T4CB 2FK8A 4O5AA 5DHPA 4PC1A 1SHUX 4BCBA 4ZI3A 4P0PB 3I39X 3GJ3A 2O8NA 4RPHA 4MUYA 2XVYA 1RDFA 4WE3A 2EGUA 5C1BA 2QUIA 2RJNA 1UBHS 5EE5B 1WMBA 3FDXA 3BGWA 3S5JA 4KR2A 4KMOA 3R41A 3PNBA 4JT9A 4MVJD 4X6LA 3CG0A 3KOYA 2A59A 4K1LA