1JILA

Crystal structure of s. aureus tyrrs in complex with sb284485
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
323
structure length
323
Chain Sequence
TNVLIEDLKWRGLIYQQTDEQGIEDLLNKEQVTLYCGADPTADSLHIGHLLPFLTLRRFQEHGHRPIVLIGGGTGMIGDPSGKSEERVLQTEEQVDKNIEGISKQMHNIFEFGTDHGAVLVNNRDWLGQISLISFLRDYGKHVGVNYMLGKDSIQSRLEHGISYTEFTYTILQAIDFGHLNRELNCKIQVGGSDQWGNITSGIELMRRMYGQTDAYGLTIPLVTKSDGKKFGKSESGAVWLDAEKTSPYEFYQFWINQSDEDVIKFLKYFTFLGKEEIDRLEQSKNEAPHLREAQKTLAEEVTKFIHGEDALNDAIRISQALF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcus aureus tyrosyl-tRNA synthetase in complex with a class of potent and specific inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Ligase
molecule keywords tyrosyl-tRNA synthetase
total genus 117
structure length 323
sequence length 323
ec nomenclature ec 6.1.1.1: Tyrosine--tRNA ligase.
pdb deposition date 2001-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
A PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 1jilA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1jilA01
4ZT4A 5J58A 1OWMA 1A8HA 1OD6A 1MB9A 1H3FA 1X6VA 5KWVA 2CV0A 2NSYA 2X0KA 3KFLA 2QTNA 3PRHA 2D13A 3MMXA 1MAUA 2PXHA 1JZQA 4JFAA 5HG0A 4QRDA 3IVGA 3K32A 5KCMA 1EFPB 4MW5A 3NBAA 2PIDA 2A86A 4S1OA 1H3NA 3P0HA 1KR2A 1X8XA 1ZH0A 1F4LA 3KT3A 4MAFA 2DEUA 1KH3A 3FWKA 3MLAA 4GU5A 1WXHA 1PFVA 1NZJA 1O96A 4TS1A 3F3MA 1JEDA 4NATA 2OV4A 3DLAA 1QRTA 1XJQA 1GPMA 3BL5A 2ZUEA 4ZT7A 1F7VA 3DO8A 5F23A 1MAWA 3E27A 2J08A 1N78A 3TQIA 5FO0A 4A91A 3PNVA 1WKBA 3MXTA 2QUIA 4KR9A 1M8FA 4MVWA 4DJAA 2R5WA 3ZUGA 1OWOA 1KORA 3IOBA 1VBKA 1OWNA 4EG6A 4QREA 1KP2A 1TYDE 3RK1A 4PBTA 3FDXA 3ND6A 2AG6A 2VTBB 5LM3A 3ZXSA 3HMQA 4PBSA 4DDKA 2J5BA 3CA8A 2CSXA 4K0RA 1QJCA 3FH0A 5DEOA 1G8HA 1N2HA 2J07A 1I6KA 4YP5A 3CLSC 1WXFA 3IMGA 3COWA 4R2MA 1N2IA 1RQGA 5DB4A 2TS1A 1KH2A 4QBTA 3CVWA 3KT0A 1F7UA 2X3FA 3ZJUA 5IJXA 4I6GA 2X1MA 1EFVA 1YUNA 2YXNA 2J4DA 2RE8A 3AFHA 2D5BA 4EG5A 4NAUA 3ZXIA 4UZEA 2DR2A 3IUBA 1TFUA 4ARIA 3N9IA 1UFVA 1QRSA 3CLRC 3CR8A 1MOPA 1I6LA 5KHAA 1FFYA 3HFJA 4Q16A 1QU2A 3IDFA 2E0IA 2Z09A 4G6ZA 3CVUA 2DERA 2EJCA 1O95D 5H16A 1VBNA 2QJTA 4NZPA 1V8FA 3N8HA 3FETA 1SURA 1T6YA 5TEWA 5K0TA 2JAXA 1PG2A 2Z3VA 1B6TA 4L2IB 3QTTA 4MWDA 1O0CA 3MLBA 5EKDA 2NZ2A 3D6UA 2QTMA 1QNFA 2GOYA 3IVXA 3FG9A 1LI5A 3G6KA 2J09A 4UZFA 1P7PA 3H9BA 1NUPA 2AKEA 3L93A 4KKVA 1N75A 1U7DA 1MB2A 4HPWA 3X1JA 1VLHA 2CYCA 1R6TA 1KH1A 1NSYA 1S4MA 3SEQA 1T9GR 1YI8A 4F3RA 1EUYA 1J1ZA 4K03A 4KR7A 3NV7A 3JXEA 1NURA 2QUKA 1IRXA 1JIKA 3IUEA 4ZCRA 1LI7A 3M5WA 1K4KA 3CLRD 2PZBA 4MWCA 4JZYA 1M8KA 4R0NA 2WB2A 1BS2A 5TGTA 3D6VA 3A04A 3ZIUA 4WNYA 1R6XA 1I6MA 1O0BA 3RK0A 5FNZA 4L2IA 1G8FA 3LOQA 3HV0A 1ZUNA 3Q12A 2V0CA 3VU8A 1XNGA 5HUJA 4YP7A 3A2KA 4E1AA 1EFPA 3N2YA 2I1LA 2QUHA 5K0SA 4CDMA 5AHWA 1J20A 4ZT5A 4HK4A 3MUEA 2IJGX 3IH5A 1I2DA 4AQ7A 3P0IA 4PBRA 3UK2A 2HMAA 3H97A 4FZJA 4NDAA 1WXGA 3ELBA 4U7JA 1IHOA 4I6JA 1MBZA 2A84A 3X1MA 4CDNA 3QE4A 2DLCX 2DUMA 4RPIA 4MVCA 1VBMA 1XNJA 1JILA 3CLTD 1PFYA 4U63A 4XSVA 1OBHA 1D2RA 4EFKA 4OUDB 4ZT2A 3COVA 1MJHA 3AG5A 1YIAA 1N2GA 3G5AA 1NUUA 3IMEA 3GMIA 1JZSA 1OWPA 1JIIA 4MUJA 2E18A 3Q4GA 4MUKA 4JXXA 1WZ2A 1QQTA 3LCJA 3PNBA 4EG1A 2RD2A 2JA2A 1WQ3A 2YWBA 4MW6A 3ZJTA 4AS1A 4DLPA 2B7LA 2CT8A 2IELA 4NX2A 3GLVA 4DDHA 2Z08A 4ND7A 1XNHA 2H2AA 1FYDA 3FHJA 1GN8A 3ILVA 1OBCA 3N05A 1J09A 2E21A 3FOCA 1IQUA 3RJZA 4EF6A 1KAQA 3TS1A 1GLNA 3HL4A 4ND6A 3SDBA 2IP1A 5TS2A 4MUHA 2O5RA 1O94D 2YWCA 1R6UA 4ZT6A 1EJ2A 1OWLA 1KQNA 1T6ZA 2C5SA 4YP6A 2QJOA 4ZCTA 3CVXA 2HGZA 3VRHA 1J21A 3IOCA 4MW2A 1G8GA 2WQ6A 1M8GA 4J75A 1ZJWA 1DNPA 2O8VA 4DNXA 3RBAA 1Y42X 4J76A 3FNRA 2H29A 1YULA 2DETA 4MW1A 2BYTA 1TYCA 4MW7A 3VGJA 1IFXA 3QTBA 1COZA 4EG8A 1ZH6A 3H99A 1NYLA 3P52A 2A1TR 3DV2A 1NP7A 1O97D 3INNA 3UOWA 2A1TS 4G5YA 4MUGA 1O5TA 2YY5A 1KQOA 1M1ZA 1O97C 2PZ8A 1CT9A 4JYZA 2EL7A 3CLSD 3AG6A 2VXOA 4MULA 4H3SA 1T6XA 3SP1A 1PFUA 5JBNA 2HZ7A 1K92A 1EFVB 1TYBE 3A05A 4MWEA 4XFJA 3ISJA 4MUNA 3ZJVA 3OTWA 1M8JA 1N2EA 1M8PA 4P2BA 5TEVA 2G36A 2QJFA 3P0JA 1LW7A 4WSOA 1N2JA 2CYBA 3H9CA 1IQ0A 3UC5A 3HGMA 1EE1A 4HJRA 3U1VA 3CVVA 1JMVA 1O96B 4YBRA 4YMIA 4PY2A 4CQNA 3TZEA 3G59A 4KPUA 3Q10A 3SZGA 1KAMA 3I05A 5H7XA 4F4HA 1QU3A 1JIJA 4MVYA 1EUQA 4JXZA 4CT0A 3IODA 3RFFA 3IOEA 4GRIA 1WJGA 1O6BA 5J5AA 1U3DA 1N2OA 2QUJA 4KR6A 1U7XA 5FO1A 2GM3A 2XRYA 4MWBA 4MW4A 4ZT3A 1ILEA 1KKUA 2CUZA 1TYAE 1JECA 1Q11A 2WSIA 4R2LA 2VTBA 2A4MA 2GKSA 1G59A 1T9GS 4Q93A 4EG4A 3H05A 1PG0A 4MUFA 3X1KA 4EGAA 1HYBA 4I6EA 4X0EA 3PXUA 3FIUA 4MQ6A 1N3LA 2DXIA 2A7XA 2XRZA 1NI5A 1NUTA 4MLPA 3TZLA 1QTQA 3KT8A 5DK4A 1NUQA 4MUEA 2WQ7A 1GTRA 1VL2A 1Q19A 3C8ZA 5LLTA 3AIIA 4OUDA 2OQ2A 1MC1A 4ZCQA 3GUZA 4ARCA 3CLTC 1WY5A 1V47A 5J59A 1WOYA 3ND5A 5BNZA 2D54A 1N2BA 2X1LA 5IHXA 1JEEA 4ZCPA 4KPUB 1JGTA 1U0BB 4HJXA 1K97A 3TNJA 3AL0C 4MUIA 4BWVA 1PFWA 2CV1A 2E89A 4DDMA 3K9WA 2QTRA 2PFSA 4XFDA 1IVSA 3DPIA 1EXDA 4EG7A 4ZCSA 1J1UA 2JANA 1TEZA 3PNYA 3SEZA 2A88A 1M83A 3L92A 1J70A 2DPLA 4NAHA 1O95C 1O94C 4G5FA 4DE5A 4EG3A 4U8HA 1WXEA 3HZRA 3IVCA 3ND7A 3IMCA 1JHDA 3NBKA 2A1UA 1F9AA 2PZAA 2V0GA 1MRZA 3KT6A 3CLUC 3LE8A 1KP3A 1WQ4A 3OP1A 3S3TA 2PG3A 1YIDA 1IQRA 2AZXA 3SZ3A 1IH8A 3FI0A 2ZUFA 1H3EA 1N1DA 1ULHA 1YUMA 1TQ8A 1GTSA 1N77A 1WXIA 5DASA 2CYAA 1GZUA 3COYA 1U3CA 4RUKA 5LFAA 1KQPA 3ZGZA 3TQOA 4OJMX 3FY4A 1Q77A 3RHSA 4MVXA 3CLUD 3SYTA 3UMVA 2BTEA 1H1TA 1Q15A 2CFOA 3UY4A 5HUHA 3AKZA 3CVYA 4MW9A 2ZP1A 1K4MA 2A1UB 3A4IA 1QRUA 3COZA 2CV2A 4MW0A 1GAXA 1NUSA
chains in the Genus database with same CATH superfamily
4C0SA 1QVZA 4YPOA 2C8JA 3VVCA 3NW9A 3ND9A 4CODB 1ZM4A 3OETA 3VPSA 1P61B 2GZDA 4N9WA 2EFEB 4C4AA 4OIFA 1IG3A 5SZJA 1L8OA 1Z36A 5AM1A 1ZOOA 2P65A 5D7BA 3PRHA 2PGXA 4KOEC 3T7IA 3IUQA 4B9AA 1OH5A 4EJSB 4NBSA 3GK3A 1L7BA 1I4TD 1KBOA 1RI1A 4LK2A 4DTCA 4R8LA 3L7DA 5H0IA 5DCWA 2JD0A 4EJSC 4BLPA 3N75A 3F5DA 3H1BA 3X1WA 1ZH0A 2Q2OA 3N7TA 4H0NA 2FZWA 3ELUA 3B1WA 3TBFA 2VHTA 1PR4A 2C8LA 1YQWA 5A9TA 1V35A 1E9SA 1OF1A 5BR7A 2PZJA 1P9OA 2RGXA 4OOFA 4PFSA 5DPMA 2C83A 3BUSA 3DD5A 3EQ9A 5BY2A 3LUJA 1QRTA 3AKEA 1KVSA 5HOEA 3K9FC 3HA5A 1P2GA 3JV7A 4MQ5A 4ZT7A 1OLSA 2FCRA 4LVOA 3RRYA 1XZEA 4TTAA 2Z4SA 1CUCA 3RYHA 1GTL1 1M2EA 1FFCA 1MCZA 2W6MA 3CLHA 1WKBA 4UTOA 2QUIA 1I10A 3PCRB 2GBLA 1FY2A 4C6TA 3EXHB 1G20E 3VR6A 2F4NA 3WDSA 1SY7A 2D2FA 2GUGA 1U2QA 3HCFA 4MV3A 2P0EA 3K2BA 5KYUB 5K0EA 1I9GA 4ACBA 2TMKA 1ZXLA 2SBTA 3SHWA 1FTQA 1U7PA 2R11A 4I50B 1HQCA 4FYJA 3EPKA 13PKA 2XCOA 2P6RA 4EITA 5TPZA 3Q2OA 4Z9FA 4KI0A 1HDRA 3D4BA 4DDKA 1DT3A 2NUPB 1PR0A 4V1CB 1EESA 1Z0SA 2N75A 3IMGA 2OXFA 1SIBE 1QM5A 1AU9A 1Y37A 1Y9AA 3FPLA 5BYKA 2YYSA 3L1HA 1GPBA 1T3TA 4MQUA 4IGFA 2X0NA 3OC6A 3G6WA 3TXYA 1G38A 1L4BA 1Y9ZA 1ZS9A 2VDUE 2ZSDA 3RFUA 3FXAA 5ES4B 4NV3A 1EM8B 5JMWA 1RJGA 4Z7JA 3G7SA 2NU7B 2OSVA 2R60A 3BBLA 4IOLA 3B1YA 3IB6A 1XYGA 3C15C 4TN5A 5DBEX 2IV3A 4DYHA 3RB8A 2CZQA 3T4PA 2J4DA 4C88A 1QIJA 4H16A 4G5SA 2RE8A 4H6VA 2M1XA 3STXA 4OX9B 3TIFA 2O2CA 2P8JA 1K2VN 1YZUA 2I6GA 1N7HA 4UZEA 2JLVA 2X0IA 2B7BA 4LKOA 4QO8A 3C85A 1KYTA 2ESRA 1ABEA 4N82A 2YQZA 1CIPA 1DKQA 3DOEA 3TRHA 1I6LA 1EP9A 2NYRA 2P0YA 1CR2A 5KHAA 4H0CA 1KPGA 4OXNA 4PZPA 4YGYA 2R25B 3ZHRA 5B1YA 4FFBA 4YRAA 5ADVA 5FCDA 4ERNA 2DERA 4D4KA 4JXKA 3PR3A 2VHVA 1KBQA 2NXCA 1PWEA 3UH0A 5EERA 3V1MA 4EY8A 3I9LA 5L8VA 3O74A 5EQDA 1UZAA 4GSLA 1J49A 2V5AA 2QG6A 3KKQA 4JC4A 5DFAA 1VFNA 4RVNA 3W2TA 4FKMA 1ONOA 4L7QA 3O1IC 4POOA 2XRMA 3JU3A 5K0TA 2Y6VA 1LPOA 3JZDA 2ZRGA 2XQIA 1QPZA 2D5LA 5JNVA 3TXXA 5CHYA 3QTTA 1B0UA 2E82A 4QWMA 4J07A 1P2BA 1M1NA 3ZJ5A 4AU1A 5HWSA 3UPTA 1WDLA 5EKDA 1VG1A 2PJUA 2QN6A 3EAGA 2ATIA 2OWDA 2XZLA 1NGSA 3JYHA 2IDMA 4EHIA 3NOQA 4LXUA 5ECDA 3ZK7A 2B20A 3O8DA 3JAMA 4P3KA 1U5CA 2IT1A 2JGMA 2VFAA 1E9FA 2PR7A 3KK0A 5FWDA 3VV2A 4BE4A 4QG3A 2AJDA 3S8MA 5IT0A 5EEHA 2IF0A 1DDGA 1MEOA 2QX9A 2A6PA 2R6ZA 4B1FA 3EULA 5EL0A 2WFAA 2ZITA 1DWQA 1I5OA 4G8DA 3WQHA 2H4HA 4ZIRB 1SA0B 1TLTA 4QWWA 1NT2A 1O6GA 3RU3A 1KH1A 5SZHB 3GPLA 3SEQA 1HR0B 3V3KA 3V2UA 2PA0A 3HG7A 1NW7A 5J4HA 1ML4A 1OE0A 3P32A 4YUVA 4EB3A 4OH1A 1Y80A 1GRQA 4Q4DA 4F2PA 2AL7A 3DCYA 3E22B 4EFLA 2O2HA 1CRQA 2BGUA 3KVVA 2X76A 3V42A 4F46A 2HRRA 2ZJBA 4BVBA 1X80B 3A3OA 5EWLA 5F78A 4DLYA 3TE7A 3KJIA 4TV8B 2W2OA 5L7WA 1WZNA 2UAGA 1PW5A 2B4KA 3CO5A 4QXAA 4N41A 1BS2A 4WJKB 3TVTA 2V54A 1BWQA 5IKXA 2AUTA 1T5HX 1VMKA 1TM7E 1J56A 1EE9A 5JD5A 4PFQA 1P91A 4Q9KA 5J2TA 3I61A 4M1WA 4RE6A 3OD1A 4RJJA 5IW8A 3N0RA 3DTVB 1LW6E 5KDOA 5JZ9A 5HIAA 3H04A 1DJOA 1GCGA 4V03A 3W8FA 3TLGB 2AG1A 3QELA 3KOZA 4U02A 4V2UA 3VH2A 4KTVE 4A3SA 5IYZF 2F17A 1EVZA 4OXXA 4DRYA 1TZMA 1UZLA 3UBTA 4DNQA 2O7VA 3PS9A 4JEHA 2I4LA 2WJJA 4GM1A 4I5IA 4NTZA 3HHEA 3NHMA 2CWWA 3VYVA 2ZB7A 3WGOA 1EDZA 4A0QA 4CT5A 2XCSB 3CH7A 1OX4B 3KSDO 2GRUA 4QASA 3O8RA 1VPVA 2BSAA 2CHGA 3AF4A 1QC5A 3ZWVA 2BAGA 1ZMTA 2GEUA 1LDEA 1I2ZA 2DECA 3GFGA 3AEYA 1K6IA 4C3ZA 2WNHA 3MF4A 4NDAA 3MWKA 2WAYA 3AK4A 4U7JA 1JWBB 3G8BA 4RSMA 7REQB 3L8EA 4UQPA 3CPSA 3Q7PA 5AW6A 3EXFB 4XIIA 2VL7A 1IG0A 3MCZA 5CGQB 4YRPA 1VDZA 2F43A 1OFTA 4IIJF 3WOVA 3CLTD 2Y1GA 5I5GA 1OBHA 2HMTA 3W9BA 4M9CA 1BQ4A 5CH8A 2DHEA 2NUTA 2WG1A 4CG0A 1UOQA 2LIVA 2P90A 4DKJA 5JZOA 3ORSA 1OHHD 1T24A 4UEWA 1C9EA 4QM7A 1IJKA 4NS4A 3CEAA 4RKFA 1DAGA 4E5PA 3RTEA 5MFPA 1QS0A 3WJAA 2ZSFA 4MPTA 3HEBA 3UANA 4U3JB 1G3IA 3N8NA 1ZOIA 2JS7A 1P8AA 5DULA 2LKDA 3HL0A 5T5QA 4WXEA 5DP2A 4D92A 4DVGA 4LTMA 4DB2A 3I5XA 5KYKA 4XWTA 3HR8A 1Q22A 4GYKA 3ONFA 3TKLA 3RUEA 4UHKA 5KQRA 3NWEA 2GCPA 3E7PA 1U1EA 4N6OA 3S2FA 4AX8A 4C05A 2AXEA 3KR2A 1NIPA 1KMMA 1ZMXA 3LRXA 3M2TA 4HYQA 1I94B 1V5GA 1CJCA 2V7GA 5I01A 1UEXC 2ZROA 2RJ3A 4FNOA 4EDFA 4F91B 3DM9B 1TMGE 4OK3A 2WNIA 1MGOA 5CM9C 1R0CA 2WYWA 4IHKA 3TQRA 1H2YA 4YRRA 3L8GA 4FZ5A 4UVIA 3K1JA 5TS2A 2I4RA 1U8UA 1PT6A 2LDXA 4IVRA 2ZUTA 2WUVA 4EGSA 1K8QA 3H9GA 4ZV7A 3KQOA 4BZXA 4L5IA 2Z5VA 2P5YA 1YK0A 1Y6ZA 3RSOA 2YN2A 5BSKA 1JYEA 3BEOA 3JYLA 3M6UA 3BGOS 1IM2A 4L22A 1OSNA 5I8PA 3K20A 1NBEA 3DWGA 4MYCA 2R2GA 4LW8A 4Q66C 1DUIA 1G1MA 3HVJA 1UPFA 5E0OA 2EQAA 4DR6B 4S3MA 2FPLA 4YRZA 4W1RA 2J0QA 3C7CB 2ONKA 2XDAA 5DTJA 5EJ8A 1E6EA 1VL8A 2YJ5A 1RMQA 4F56A 2HYIC 3HYTA 2JJ1A 2OBNA 3GLIB 3STUA 2PSDA 4MW7A 5AUPB 4IX9A 4U2CA 5FPKA 1SMKA 3VTKA 1RQLA 3EGEA 4JBYA 3VO9A 4BNDB 3MIIA 3AEKB 3MOSA 4P92A 3KKOA 4H0FA 3INNA 4H31A 4YS6A 7YASA 1X1AA 4CLRA 1ZAYA 2WF6A 3IUNA 4Z4IA 5KYVA 4IDNA 2F8TA 1N6IA 2WOJA 5CNJA 2QE7D 1VSTA 1M1ZA 2D59A 2YXEA 2QVYX 1H8HA 3EGDA 3HJGA 4HF7A 5FPTA 1RJEA 3FGNA 3HSKA 5T8KA 2OCBA 4WQMA 4NZNA 3LGXA 2CXTA 1BQ3A 1HWYA 4X64B 5JSZA 4OU5A 3LBFA 1U94A 2NX2A 3SX4A 3UBMA 1I7QB 4KYUA 4RZ2A 3CZ9A 1V4BA 2CVZA 3I8OA 1CIVA 1WM1A 4PRKA 4AKSA 2RIPA 4EY7A 5B1EA 4S1VA 1NUAA 1QH8B 3FCCA 3UT6A 1E9AA 4QPPA 4CL8A 5E7IA 4NCBA 3UMRA 1HKHA 1SJ9A 3L0PA 1ZM9A 2HOQA 3RYFB 1EVKA 2HIGA 1PRYA 1BNCA 4UBMA 2CMKA 3IE2A 3SGLA 3WK6A 4URUR 4YMIA 1GPJA 5CX1B 4CKCB 1ZGAA 4BJHB 1I7NA 3AO0B 1GYPA 4I36A 3Q10A 2HUNA 4N39A 4CR6A 3EVCA 2X77A 3P9KA 4IQGA 3MS7A 1ZM7A 2ZSUA 4K86A 4ZPJA 4MROA 5TSDA 5EC8A 3WA7A 3DKVA 1ZJ4A 1CQIB 3BRWD 2PE5A 3A4VA 2PIAA 5ISMA 3VJRA 2RKOA 3QIAA 3PICA 1CVLA 1V45E 4FZRA 3RWOA 4F45A 3CSUA 3PDIA 2CXUA 5JLJA 2ZIGA 2G4LA 4KE6A 1QV9A 4RHUA 4FN4A 2QUJA 4L4SA 4HH4A 3KO8A 4BASA 3R7NA 1F4PA 2QUBA 2WILA 2ID8A 3TTWA 4BO3A 3HJTA 4TV8A 4UBKA 5HK9A 1HX7A 1EG2A 2QVCA 1RI4A 4I55B 5DT9A 5EJIA 4DGQA 4GT1A 2A0YA 4AN0A 5J2TB 5BSMA 3DDSA 4ENUA 1P81A 3AEUA 1JXMA 1WP4A 2W9XA 2WA1A 4ZAVA 4UDNA 3UJCA 4NK5A 3NEPX 4IJVA 5JQWA 3N70A 1RC8A 2ETXA 1UJNA 5AT1A 1MXFA 3LPNA 4C0LA 1HDEA 2C9ZA 2QX4A 5FUXA 3VPDA 2HADA 5F51A 3OJLA 1ECCA 4XYLA 5E9JA 1WHTB 3ITNA 3CF2A 1MZVA 3OEWA 4U2GA 1D2CA 3AESA 1OLOA 5DNCA 3IPXA 1PTKA 2PGDA 3EIEA 4JBWA 4KREA 3PUXA 1Q19A 3WYAA 2FWBA 3LLCA 1QFMA 2C78A 2ZQ5A 2R0QC 2XDYA 4F9GA 3I0MA 2BBTA 1VL5A 4B7CA 1SCDA 4DLNA 1JLKA 1QLHA 3M6AA 4B3XA 1DP4A 5REQA 1P60A 3JQGB 5FKJA 5TJ9A 1U0JA 1Z4JA 2EATA 3TQTA 3R2JA 4JXXA 5IP5A 1C3OA 4F06A 1RXSA 3H6KA 1P74A 3DB1A 1CC1S 2NSDA 4IZHA 4TQGA 3CJTA 1BMFD 1Y3IA 2HF8A 3M3DA 3I76A 4Z1MA 4BV8A 4C06A 3K5IA 4Q4AA 2PY6A 3X3HA 3RSSA 5GOZA 4MQBA 2NXWA 5IC5A 2FH5B 2XUZA 2PJDA 4PC1A 3WLLA 3EF3A 2EQ5A 1SIWA 2BFDA 3IVAA 4PSAA 4X6YA 3W5UA 3D1VA 3G49A 4R1LA 3OQIB 4FW8A 5EPOA 2JEYA 2JANA 3OLYA 2QLMA 4ZYVA 5JAUA 2OB1A 4JT4A 2PSFA 1NYRA 1RLIA 3N53A 2LRHA 4CKXA 2HREA 5KQLA 1TTHA 8ABPA 4DE5A 3CBGA 4KN9S 4M1KA 4PICA 1JDNA 1IE3A 4OIMA 3PPXA 1YR1A 4PNZA 5HIMA 4C7XA 3LUKA 4RU1A 4R6WA 1F38A 2IU4A 4J0FA 5BSUA 3BEDA 4TSRA 4YY3B 1PBNA 3LWNA 3DT8A 1Z07A 2H1WA 2XQGA 1VZ3A 2PRJA 4FDMA 3OF3A 4KX5A 4WY8A 5EZ5A 5L4LA 4K5QA 3WLQA 3LGSA 1D2NA 1WL8A 1XE3A 5FLEX 1DAKA 1ISMA 1U0NA 1PFKA 2K2WA 1OLXB 3CLKA 2V55B 3CUWA 3T8YA 2JJ1D 1OAOA 2O7SA 2YHIB 5E3JA 3VBCA 2PQ6A 1N1DA 3NC4A 3W8RA 3P9PA 4N12A 4ZI2A 5LDHA 3ZHUA 1L5VA 5K45A 3MJ4A 2VRCD 3EEQA 5FHQA 5C1IA 2PX5A 3ZHQA 5KTTA 2H5LA 1R10A 1NVGA 1RJDA 3NVDA 1HQDA 2WHYA 1GU0A 4BO7A 3NHUA 3MT9A 3O8LA 3OCXA 2X7HA 3UT5B 2WKSA 1V71A 1IXSB 3SYTA 4TMXA 5HMMA 4K9QA 1RMTA 1UJ4A 1E2GA 4OP3A 3QXJA 1EB9A 2VA8A 5FUWA 1ULBA 1Z0ZA 2Q5OA 3FYCA 2I1VB 3GJQA 5TLSA 3AKZA 3TMAA 5JZMA 3O75A 1V3VA 3PC7A 4A92A 1AKEA 3ESXA 4C6SA 1CY4A 1NNI1 1REQB 4PF1A 4NU5A 3UT0A 1T10A 3KZMA 1IJFA 1LC3A 3C6YA 3DL4A 3JVDA 5IVIA 3UJ8A 5C51B 4MR8B 1DBVO 3HKCB 3JWIA 3QEAZ 3HCOA 4R1MA 4WLEA 3QITA 4PAMA 3OZXA 3COSA 1A8HA 2C9OA 1E2BA 1U5AA 1R9MA 4FI3F 2PYIA 4B7UA 1OH6A 3L8CA 1TGVA 1X6VA 4QOHA 2BJVA 4ZK2A 1AT1A 4DXHA 1QYVA 2CD9A 1RACA 4DEYA 5I3ZA 1KI1A 1U2ZA 5CNIA 3MS4A 1PVDA 3KX2A 3QF7A 4PZCA 1TF7A 2HLDA 3OPYA 2MR5A 4YRLA 2IZ6A 3K0EA 3CKMA 2X7XA 4CKYA 4NPHA 3K32A 3NR2A 4KG7A 3VPGA 4AMGA 1KIAA 5DBOA 3B8HA 5F3DA 1L8AA 3E5MA 3W5IA 2JBAB 3EWIA 3BS4A 1KH3A 3OIVA 2BCJQ 2GSWA 3PUJA 1WXHA 2QE7A 5ALXA 2BSQA 4CL3A 5JXGA 1GGJA 1G4HA 1UODA 2WQZA 3IAUA 5AW1A 4LF4B 3I83A 4LXHA 3OT4A 1GT91 3QQ5A 2VH5R 3IR5A 4KMOA 2OV4A 1WAMA 2GNOA 2MIIA 1BXGB 1DKLA 3NZEA 2GYWA 4XUDA 4DR5B 2IS2A 3K4HA 1LBSA 1K7EB 4ZYZA 1I3NA 2PT9A 4QELA 1S6YA 2OBYA 4V38A 1OXTA 3CGGA 3TQIA 4EUHA 3ET4A 4OBBA 1XDZA 1CR1A 4HTAA 5HQJA 3FCSB 3K0AA 4R51A 3I62A 4M37A 2MJLA 5ULLA 1GGVA 4AO7A 1QGDA 5BMVB 3GAFA 5IT9A 1L5SA 5FL7A 1QB7A 1XU4A 1M10A 3R09A 1Q0TA 2R7KA 4QAQA 2DTDA 1KP2A 2UVPB 2PUHA 1TYDE 1RTTA 2YFYA 1WZCA 1XEAA 2MINA 3EFEA 1EK2A 1Y9JA 4D99A 3CRZA 1CS0A 5MDHA 1MORA 4RFVA 2ZQZA 4TT8A 3BC1A 1GAWA 1MAVA 2PS9A 2XDQA 1T34A 5FQNA 4I4TF 4AMUA 3JD1A 3R9IA 3G2NA 3DCIA 5FBRB 2J5BA 2JLQA 2H1FA 1QJCA 1AG9A 2JIDA 3GLRA 5DEOA 4K0KB 2DWUA 4K81B 4YP5A 1NONA 1JKJA 3UHOA 3QOWA 3ELWA 4M21A 4X7RA 4KIUA 4KWCA 2Z30A 3JATB 3AR3A 5L51A 4K05A 4QBTA 3A10A 3RS2A 1C4OA 1FK8A 1FUIA 3A1NA 3ZQ6A 4B8ZA 1XRMA 1MABB 1GG9A 3X2SA 5JZBA 3NGLA 1EWVA 1V6AA 4OL9A 1YQDA 1RXWA 3TI7A 1EFVA 2JC3A 1ID8A 5JPIA 5IEJA 4B7XA 3AFHA 2W93A 2ODPA 4EG5A 1MP0A 4GD3Q 1KQ3A 3NB0A 4P3YA 2ZZMA 2YDXA 1GYQA 3M8KA 4FGKA 4MV5A 3LFUA 3STWA 2Q49A 2GAFA 3WV5A 3SZOA 5L3SB 5BOVA 2I7XA 5FQOA 3ZNNA 4CEJB 3RIYA 2HD4A 1QU2A 2D3TA 4Q9LA 2GPSA 4MDHA 1DIBA 1H93A 2QMYA 1SXIA 3I5MA 4WH0A 4W7IA 1I3MA 1XP5A 3TAUA 5DN6D 5F1KA 1GEEA 1JH9A 5HM8A 2JCYA 3CZCA 2FWNA 5CVUA 5L3RA 5C4IA 3IT3A 1HTTA 5BR8B 1JQJC 4JR1A 4NHEA 3MFQA 2GS9A 4RLHA 1YC5A 1KP9A 2WTEA 2WFZA 1OZGA 1ZXBA 4I81A 4J0HA 5D51S 1GPDG 2I6TA 4MARA 4NZMA 3EAQA 2PGLA 4U7PB 4ETIA 3HM9A 1IBRA 3R7LA 4AZ3A 1E32A 3UO8B 2H18A 1GM5A 1ZHFA 3ZXXA 3ZWYA 3KB2A 1U6JA 3C3YA 4QGGA 3PDJA 4F93B 3ORQA 4UDXX 1RKQA 3OZDA 1RW4A 4JJ8A 5K0FA 1OVGA 1E96A 3IA2A 4DSAA 1FTGA 1R9NA 5AVQA 4M4SA 4HB0A 1VPDA 2CD7A 2WP0A 3IVXA 2PQ2A 3C3XA 4NZOA 5KYYB 1QWSA 3RS5A 1JJIA 1DOHA 1QB8A 5D3MA 4YR9A 1E6LA 1E7WA 4AL4A 1VRVA 1W4CA 1Y34E 3DD1A 3RRNA 2FRDA 3LT1A 5I4BA 2QV7A 1TTPB 3JQAD 3K71B 4JLDA 1MNAA 3WKCA 2BTQA 1B3RA 3O1JC 5IVHA 1Z6XA 4NIMA 1Z68A 4D3FA 3FOEC 1T5IA 1PCXA 1X92A 4K1XA 3PEVA 4QKQA 2B1JA 2FW6A 5CYPA 4D4JA 4Y2JA 2JH8A 2DCUA 1ZUHA 2AUMA 4YCSA 2XB6A 3PYMA 3AEXA 2EBUA 4BO1A 5CDFA 4GLLA 1KYIA 4AMZA 1NYQA 1URPA 4PRLA 3NWPA 1PKEA 1EGHA 5DCLA 1DZIA 4MUAA 3OTGA 2VQEB 6AT1A 3MW8A 2FP4B 3EGCA 3KZCA 2P6PA 1SCUB 3D6VA 1U28A 1QR6A 4IG4A 1QK4A 4EO7A 4GS5A 1NHWA 1EFDN 4HAOA 2Q3DA 3T4XA 1V48A 3QFHA 621PA 1RLOA 3GRCA 1ISJA 1M2OA 2AA3A 4PCUA 5G3YA 1U0FA 4JI6B 2CUTA 3DBHB 3O03A 1QMGA 3EDRA 4KQWA 5K6TA 5J3JA 4WFKA 2IQIA 4JA0A 4XQCA 3NDIA 1HK7A 2ATEA 3I5UA 4NXNB 3GQBA 2FZKA 1QCYA 1LF0A 5JR3A 3CUKA 3OPYB 3SXPA 4BBAA 1YZFA 5TV2A 5BWOA 1FSPA 1ZW6A 2XX3A 4QHTA 3V4SA 1JHVA 3CG4A 4MGYR 2PPLA 5A3QA 1Z22A 3TR5A 1QKIA 2YXLA 3I1IA 2WM3A 1R0KA 1YR6A 2JLSA 3LSTA 4I4TA 1E0SA 2R7MA 5KSOA 1GFSA 1C1HA 4PYIA 1E5QA 3LXRA 1W44A 3I92A 1XZ8A 5ITSA 2Z98A 4KPYA 4HB4A 1E2JA 2YOGA 1AKNA 4QGFA 4ZVLA 3RVSA 1IVNA 4F12A 4L5JA 5BSGA 3ZN2A 4NY1A 2X5NA 4O33A 1TLFA 1VBMA 2ZBEA 1JILA 4HTFA 1CP3A 3DVRX 2OHFA 2YVLA 4NFYA 4UULA 3G88A 2Z6AA 2C4VA 5HBGA 3QE9Y 2H1LA 3AF1A 2FPMA 2HB6A 1E2FA 1PAUA 4YRMA 1MOSA 1FFBA 3FPEA 3EZ2A 3SS9X 5M29A 4NCJA 3BM5A 5T7BA 1GEGA 2XMDA 4M0FA 3HCAA 1EFLA 2V58A 4NS1A 3A3PA 1CVRA 3DH0A 4OYLA 3GIWA 5KNBH 1L7MA 3B2QA 2AFIE 2GK6A 2KPOA 1K3FA 2GEBA 4PSCA 2YRWA 3TJRA 1SB8A 1FNCA 2GZMA 2VJLA 4LSZA 2BH2A 2XODA 3N5KA 4UBIA 4NX2A 2NVUB 4IRXA 1XAJA 1E99A 4YV7A 1HQYE 4YDRA 1FLDA 1KOJA 1YGPA 3KYBA 2WM9B 4UXJA 3ILVA 1KZ6A 3KUUA 2Q8PA 2ZCJA 1Z2AA 3CLVA 3AZOA 5CVJA 2FDXA 2WWVD 1J09A 3IAM1 1M72A 4FCVA 3M6MD 3PQ2A 3NH6A 4JJ7A 4JJ6A 1QZUA 1NG1A 1SBNE 4RSRA 3GDWA 2RC5A 1QYXA 4UEJA 3DQQA 2RK4A 2YV2A 3HWWA 4L6IA 4N8DA 3NNDA 4UM5A 5F76A 5LKRA 4HGRA 1E1MA 1ZFNA 4RGQA 3R0JA 4QECA 4PZLA 5ILGA 1KYXA 2GF2A 4HZUB 5I9SA 3ETCA 4INAA 4AJHA 1T43A 3VPBA 4DHWA 1YE8A 3FVQA 1UP7A 3ICVA 1IOLA 4HADA 4YECA 5TF4A 3W04A 1VYTA 5KMGB 1PYOA 1Y3DE 4JVLA 5HP4A 2F90A 1CR6A 3H8JA 2OFFA 3GP8A 1M8GA 5ER6A 2FE4A 1L5GB 4ZRDA 3BRCA 2BFNA 5JALA 1SU6A 4J76A 1OIXA 3DMFA 4JLAA 4XLTA 3RHFA 5MFZA 5KWIA 2DETA 1E20A 1SR8A 1U8AA 1E8DA 2ZR7A 4YJ2B 4J2OA 2ZYWX 4R83A 1BXRA 1SQ0A 1TIPA 1TU3A 3NHYA 3PC6A 4ANFA 3M82A 4HDMB 3DF7A 5K8UA 3E1GA 1BIFA 3LY5A 4QQ8A 3LCVB 2BZGA 5DBIA 4JQZA 2QMUA 1T13A 3CKLA 1X15A 3BMCB 4GECA 2HUPA 3G7UA 4RVCA 1YQQA 4M60A 4Z0TA 3ZOKA 3MJVA 4H4CA 2O06A 5IJZA 3VNBA 1AKRA 4WEOA 4CM9A 3X1YA 3IVMA 5KYGA 1DBQA 3HYSA 3A1VA 1JDPA 3LZDA 1NVAA 1YBHA 2GCEA 3FR7A 5LZ7A 2TECE 1N1GA 3A28A 2HZ7A 4QTZA 4BNVA 1SC9A 3GUUA 3DOHA 1DLIA 3JVIA 3OOEA 3QVTA 1QRAA 4FOTA 4P6VF 3U4AA 3ZDEA 5JXWA 3D6JA 2HLHA 1J99A 1N2EA 3K16A 4IKEA 3UJ6A 1YL6A 4R1SA 3V9AA 2G36A 4YV1A 1DWPA 3DBHA 3OM0A 3JR3A 1QHHA 3UAXA 4MRNA 1TI7A 3ETEA 5DHTA 3V1LA 1IQ0A 1LDNA 4ND2A 2AS0A 3D6AA 5FWAA 5F3RA 3UC5A 3ZD8A 4HJRA 2ZJ5A 3D6MA 2ZETA 3ER8A 2ODQA 4IDGA 3SNHA 4CVNA 2Q9CA 3JD4A 4KGXA 5LQAA 2LE0A 5K0NA 2H3HA 1IONA 3UJ9A 4JT8A 4F4HA 4YJFB 2BMEA 1NOJA 2HLPA 4QUGA 5DWDA 4DANA 2O59A 5AKYA 3BMOA 3KU1A 3PRKE 4TWZA 4HDNB 1DADA 4I4IA 1SULA 4UNNA 5AYVA 3I09A 3EIXA 1PT5A 1U3DA 3GI1A 2EFYA 2NIPA 1HURA 3AP3A 2QP9X 2EARA 1EG7A 1JYFA 2Q9UA 3LWDA 3WTBA 3L4JA 3ROZA 3OG9A 4ENWA 3M2PA 4JBLA 4MGIR 1AOXA 2D1YA 1XLTA 2Y0CA 5DHSA 1WUJS 4FE4A 2HHHB 1NE7A 2FNAA 4EA6A 4EMSA 1HF3A 3TL6A 4XIYA 2QF7A 3NDPA 2GH1A 2L42A 1G21B 1XEXB 1DRUA 2XA2A 4NE7A 3PXUA 4UASA 5DTMA 3WOHA 1LQUA 4AY4A 4D0LB 2Y76A 3V33A 2A14A 1U5BB 2A7XA 3HQ4O 2FK7A 4RV9A 1XELA 5LUAA 3KT8A 3PTAA 2F3SA 3DP7A 1BC5A 4QXRA 2B0CA 4ALIA 1VYHA 4Y1RA 2Q41A 2XE6A 1DQZA 1GTRA 4MV8A 3V4FA 4QQNA 1Z6ZA 1FDUA 4CM8B 2ZSAA 4JB0A 4KQ2A 2QT0A 4PGMA 3LKBA 5EUQB 3FDJA 3T1QA 1PZXA 1JLSA 1R4AA 1V3TA 2QKYA 3UK6A 1QHGA 3R7DA 2D54A 3S44A 1KI9A 2O8DA 5LP6B 2ZRHA 5DEIA 2WJIA 3I4CA 4XSGA 3I01M 1H66A 2IZOA 4M89A 4O25A 4MS1A 4HDRA 4JKIA 3DE6X 1T1IA 2FMUA 2F9LA 3B51X 3I3OA 4WL0A 5L3SA 3WB1A 3QVWA 1N4AA 3PD7A 3EB9A 4IRMA 3W5AA 4V0OA 3PGKA 1M6VB 2FX5A 3ASZA 2V98A 2BE9A 3MS2A 4EYEA 5BW8A 3DPIA 1JHUA 2CF5A 4GBGA 3WZLA 3QPAA 4B76A 3GGSA 1Y1SA 1EXDA 1GPWB 3DB2A 2V59A 4I0WB 4EECA 4EZIA 1CHDA 1Z08A 4I3FA 4G5FA 3OP4A 5JAQA 2WSYB 3ILSA 4IQ8A 3NKLA 4EELA 3T5AA 2I9PA 2RGNC 3H2IA 5T41A 4MVJI 1K6MA 5HJ5A 5K3FA 3WMEA 1RS0A 1QAOA 5AW3A 5HCIA 2PZAA 5FV7A 2GZ1A 4MI9A 4RHEA 1UMBB 3EN0A 1TT7A 3NO4A 2G88A 1RWKA 1HZZC 1ZIYA 3FPSA 3UKJA 4W9MC 2NO4A 2C0PA 1T6BY 3DV0A 2VT2A 2PH7A 2WDPA 2NU6A 3K2QA 4UCWA 5KYYA 3C41J 4F7WA 4DW8A 4Q37A 1F60A 3MILA 1F1JA 3RG2A 3C3BA 5DASA 4MUBA 4D8WA 3I6MA 4YLEA 2FWIA 3IS3A 1N8SA 3ZYCA 2WJYA 2OAEA 3NPMA 4EK9A 2BHSA 1RWPA 2HQOA 2OZPA 3U7GA 4DLZA 1I6WA 2I6QA 2DFNA 5A4JA 2ZJ2A 1Q77A 2EKBA 3ER9A 5KUTA 5TQ0A 3DE5X 1QC5B 5UKDA 1G5HA 1EWQA 3T7RA 1U2GA 2QY6A 3HNRA 4F9EA 5JNWA 1GPYA 1TK2A 1AHHA 1V9CA 2WKRA 4KN6A 3THOA 5KREA 3NVKI 4MS3A 4CMBA 3PA8A 1ATZA 2CHVA 2J5KA 3NIFB 3QXGA 1Z5ZA 1SUCA 4BFLA 5EVJA 4E7PA 3IELA 2H0RA 4DDUA 3KQKA 2F43B 4QYTA 1EFAA 1FMJA 1GTVA 4D8VA 5AK5A 2EGUA 2FRXA 4BGUA 4DNOA 3JS5A 4X8OA 4QLOA 4DUGA 3TXAA 1YASA 2HHCA 1U63A 4URXR 2R8PA 5JECA 4UM9D 4HQNA 3KR0A 1BHO1 1ESCA 2KQUA 1V3UA 1ZGJA 3MWDB 3DF9A 4XWOA 3EMKA 1I7SB 3N0XA 2NSYA 1UBMS 2MHCA 2X0KA 4FDLA 4ZVOA 4YT4A 5BWLA 2X6QA 4DQXA 2D13A 2Z2YA 1B8UA 3VOAA 2JF0A 2HK7A 3L0SA 2OK8A 1AY0A 3RD5A 5IDYA 2PXHA 1QO7A 2YWRA 1XTBA 4UM8B 1H8EA 3F1LA 4OP2A 3EBOA 4ZPXA 3WKAA 5LQKA 2JAQA 1HDZA 2PIDA 2P35A 2QQEA 2Y0PA 1P7VA 3B1XA 3O3OB 4S1TA 5C4GB 1AGNA 3FVTA 1HO3A 3WFIA 1PSWA 4UDOA 1K86A 3UW1A 1VKRA 3FWKA 2DKFA 1NZJA 3RUDA 2NGRA 4IAOA 4XVHA 1U2DC 2WP8J 4MKRA 1VIAA 3GRZA 2RH4A 1ECJA 2R8BA 4KO4S 1YXMA 4NATA 1JHPA 2PK3A 2V97A 4OLAA 4IS3A 2ZUEA 2VHYA 2WV9A 1OJ7A 1WB9A 4Y1RB 2H2HA 3WGLA 1H2WA 3DEHA 4M87A 4Q7EA 5EY5B 2XTAA 1XK6A 2MDTA 1A98A 3FHOA 5U1PA 4ZVPA 5CD9A 2AJCA 2QQ5A 2RAFA 4JXJA 1NQAO 2Q1TA 2Z04A 3PNVA 4WTOA 4EEKA 5HPYB 1OX5A 3AF5A 2ZRCA 3H5VA 5M7EA 4LSWA 1CVIA 5HYVA 4DJAA 2BFBA 4AD8A 2W48A 4WXRA 4D9CA 5KC9A 2LKCA 4IQ4A 2VYFA 3R23A 3PXDA 3N0TA 3G2QA 4CM6A 1AGYA 3DO5A 2OORC 5DX0A 4J1NA 1W34A 5ARDA 2JLAA 1L4LA 3V4RA 1JVSA 3K9HA 2GAOA 1AXEA 1PWZA 3OPQA 5EIOA 3IEXA 1D7AA 3LBIA 3ZZ1A 4BATA 4FEEA 1G64A 1NPDA 2WMOB 4NK4A 1ZU5A 3WLEA 4GGMX 5FBVB 3EZ9A 4L51A 2IIPA 2IBTA 2CSXA 1KL7A 2HXSA 1MNQA 3MGCA 4IZIA 3FUXA 5AKEA 3ADDA 3N8DA 5I7FA 3FJYA 1PV1A 2JEOA 3BKXA 1C9KA 2HQ1A 3KSUA 4C20A 4G85A 5HRCA 4C5AA 1JG1A 1UK9A 4QA9A 1QNLA 3F97A 4YDSA 5F73A 4CMKA 1F51E 4QYWA 1K63A 4CQMB 4LRYA 2B83A 4C5CA 4YMGA 3LC7O 2XA1A 1A5BB 5THQA 4KRYA 1VKHA 2FZEA 3AHGA 1VJ5A 3VUFA 1A0OA 2ALJA 3BD7A 1GGFA 1ZEJA 2FN7A 2JA1A 2LW7A 3E8MA 4IJUA 4O4HA 2WV7A 3IUBA 4II7A 3N9IA 1YS9A 3EGDB 2OCYC 2YJZA 4WBXC 1V7CA 1TLLA 2XCIA 5HFJA 3C5CA 1E4YA 4GWLA 4LX0A 2G8LA 1XJWA 1AXRA 2J8ZA 4ZZ0A 3SJZA 2VLIA 1DTEA 2G4VA 2R5FA 1JJ7A 2Q4TA 1VIYA 1QONA 1Y7IA 4Y30A 1V8FA 4FT4A 4TMTA 5ALUA 2J7PD 5FTKA 4D26A 4TWRA 5FAKA 1SURA 3BDAA 3TNLA 3H4IA 3ZNPA 4FB5A 1FYVA 4LZZA 3R8CA 1KWKA 3VQTA 1NP3A 2PZMA 3RU7A 3MJFA 2QHXA 4ZAZA 2H9AA 3TNDA 4D2IA 3E8SA 4BO2A 3HH8A 5U4QA 1D6JA 2IH5A 1DZ3A 2PX6A 1AZWA 4NZYA 2RI6A 4IFTA 4ZD6A 4JLBA 2CL7X 3ZX5A 2XYPA 4NBWA 1KJNA 4KDRA 2IWHA 4EO4A 3HO1A 1K3TA 1H8ED 3MSXA 3G6KA 4IVPA 4DQDA 3HZZA 4YMSA 1LX7A 1A88A 4R8SA 4LQLA 3H9BA 4KXLA 2Z4TA 3X2FA 1XOIA 1JX6A 4QNMA 5C8XA 2BGIA 3T5GA 1N6KA 3RIGA 2I3DA 1BSVA 4UOZA 1USKA 3PEUA 4CV1A 2HNAA 4EI7A 3HMKA 1B8OA 3H4VA 3NG1A 4AZTA 2DH6A 1Q12A 2PM8A 4ZO4A 1UPBA 4O63O 1VMDA 5D5HA 4D9IA 2NUAA 2YS7A 1Q0ZA 5JYDA 3KJZA 2GKGA 1DARA 3F4KA 1EUYA 2GBGA 4TQAA 3HABA 3V48A 4NFLA 3U4HA 1BEZA 1AA6A 2QM0A 2QUKA 3RTBA 1R0XA 5DCYA 2ZXUA 1QSGA 1LI7A 2HM7A 2AXNA 2GNAA 5A3JA 2QENA 3GJSA 4GXNA 2J4FA 2C2WA 1U1CA 3OTOB 2GLXA 3IR7A 3PLRA 5DX8A 1IBKB 5HOQA 3KQNA 4YJ2F 2OFWA 3VVBA 7MHTA 3A4TA 4CQMD 2ZEJA 1EYZA 2RHCA 1WHTA 3OECA 1NW8A 4IBOA 3KRTA 4RJLA 3AUKA 4Z0HO 4JVMA 3M89A 3B85A 1UBNA 4CUKA 1O9BA 2FU5C 3L04A 1DC3A 1JA1A 3GLKA 4JEUA 4J2TA 3GFSA 5D5PA 5HFAA 4BLOA 1NPTO 3PHLA 1ZUNA 2VJBA 3MXOA 4ZO8A 1W0KA 3ZHBA 4JIMA 4LFAB 3DAHA 3EVGA 3Q1KA 3INYA 2A33A 5L3ZA 1W2HA 4AIRA 1SNYA 2XVMA 3OFND 2DKNA 3IX7A 2JRLA 3L7KA 3GC6A 3BSFA 3CZ4A 6LDHA 2B36A 3LPAA 4ZQIA 1CEXA 4CFSA 4CCYB 4M1SA 2AN9A 2GPTA 2GM5A 3R0QA 4RK5A 4WRRA 1R8QA 5AUOB 4C4TA 3WLKX 1PT7A 2CN1A 1ODSA 3QKSB 4W8OA 1W49A 2TSYB 2HMAA 1SOMA 4DC1A 3CYFA 4A0HA 1TM4E 3KUXA 3N8KA 5G1PA 5CVDA 5C8YA 3WYBA 3ZBPA 3BTOA 1IHOA 3ZZNA 1JHYA 2C97A 5KX5A 3E3NA 1E5DA 3AKDA 4BFSA 1FYEA 1GCAA 1Y4ZA 4DEVA 2OYRA 4BS9A 4MVJG 1KFKB 1VLLA 4RQBA 1J33A 1J8FA 4MVCA 5G1OA 5LP6A 4ZI7F 5EJ5A 2EFGA 3CZRA 3NBXX 3V8MA 1IUKA 1JW9B 1O1YA 2BPOA 3FOBA 3SIXA 3M6LA 5B3KA 3OX1A 5C5CA 3PI6A 4YJ2A 4U2KA 3VU0A 4M8KA 1IY8A 2GBLC 1X77A 3EGIA 4ZT2A 1YIAA 1JFFA 3NALA 1N4DA 5LCXA 2JZCA 4EVQA 1UT5A 2VHEA 4BQFA 3GJXC 4RABA 2WZQA 2E18A 3KL4A 3VYTB 1FVOA 1WHSB 4L15A 5FBLB 5JWRA 3KQLA 2QTAA 1BDBA 3THXB 4PCLA 5DLDA 1WQ3A 3ZWOA 1VJCA 2AQIA 1NMZA 3WGUA 3RTGA 1YZGA 3GLVA 5DNYB 3AR9A 4OHYA 4B87A 2PAFA 3AVVA 1E92A 5TMPA 2Q8NA 3HUDA 1MVLA 1OBCA 2C4MA 4H6PA 2G25A 2ZUWA 4YHHB 5TNXA 2CVQA 3TLMA 4C1BA 5TC4A 4AYXA 1UZUA 1FVHA 1FTWA 1P17A 2NSJA 5I4IA 1IN1A 1I9CA 4WLFA 2FMIA 1CRZA 4ZJYA 4YI5A 2A5JA 4KQKA 3ADCA 5CNMA 3CUYA 4ME6A 1YTUA 1GR1A 1RBQA 2DSNA 1Z2CA 3G13A 4O4LA 3JRXA 3MPUA 3AOEC 4Y6OA 5TT0A 3HVUA 2NVWA 1MPTA 2PBLA 2YX1A 4FBMA 4DF3A 4KITB 3Q3EA 3ENWA 4LJ4A 1EBUA 4PXYA 1SO8A 1UJ5A 4QDUA 3WWOA 2AYZA 5E1BA 2FUCA 2HV8A 1P3JA 3ECCA 4Q3NA 3ZPXA 2BKAA 4Z9YA 3ZV7A 4IJMA 3FHCB 4LJLA 3HU1A 1L4EA 3PCTA 1B14A 3QVGA 2UUCB 2HWXA 1NMEA 4F5WA 5G2OA 2H4JA 2PBRA 4CG3A 4DM7A 3IALA 4PZYA 3TTVA 5EHXA 1PEAA 1SG9A 1M6YA 2IXFA 1RVDA 3CPHA 3FNRA 3L0OA 4EJ0A 2ZB2A 2Y1KA 3NM4A 2YJ4A 4RCVA 5EE3A 3AWIA 3TBHA 2BYTA 2O4CA 4D74A 4EKDA 4L8WB 3P7MA 1OROA 3LYHA 4U0KA 2GPWA 1WMBA 2OM2A 2QXTA 3EBLA 1AB5A 3P52A 3PJFA 4NZ9A 4X41A 3TD9A 1K88A 1ISRA 1B8VA 3NI2A 3V55A 1YBAA 3PFGA 5MGBA 2RDMA 2QB5A 4EPVA 4RZQA 4HVAA 3RYTC 2W83A 1Z4LA 1YQTA 4DIKA 4LE2A 5ARBA 2EDAA 4Y2SA 2ROQA 3OTHA 4Z54A 3QHQA 1PQYA 2Y93A 1Z2PX 1ZYUA 2YY7A 1VSQA 2GN9A 3UH1A 2W4IA 1KYYA 4BMCA 2ZSEA 4H3SA 4HEA1 1U9IC 4MJLA 5MN5A 2YN0A 1OBOA 1FDTA 5LQMA 5EA2A 3GAMA 3LWBA 4E5MA 2JGRA 2AKAB 4R9UC 4JHLA 3W2EA 3T3IA 6CHYA 4PHGA 4IX1A 2ZM5A 3EQ2A 1C7QA 1NI3A 2WF5A 2IYWA 3PFHA 4C7MA 3RJ9A 1TQ6A 1R6AA 3EY4A 3IIIA 4GFDA 2I87A 2IYAA 3JAWB 1MX5A 2VWHA 4JDUA 4KB5A 3V1NA 1U3GA 4PPGA 4Q3KA 2WVGA 2FZGA 3Q8MA 1ECBA 4E3WA 4MMXB 2XHZA 1KZYC 1I33A 3K53A 3M7IA 4C0HA 1Q0SA 1FVXA 1OXXK 3G1TA 5TE9A 3OPXA 1JR3D 4GXRA 5SY6A 3UCFA 1IMJA 2UYGA 2IH2A 2J33A 1DC4A 3MAGA 2VQFB 3OMLA 5CT9A 1E5XA 4X00A 3H5TA 3TVDA 4LOAA 3CE6A 4UM7A 2XADA 3IUYA 3F7OA 1FFSA 1L4KA 4Y3UA 4DV0B 3LVBA 4OEHA 3HACA 4NBKA 5DI3B 5BV1A 1YS1X 1MO2A 4PS1A 3R9WA 4G37A 3T0GA 1R37A 5HKBA 1CDZA 4MWBA 2I9KA 2QTWB 4GR4A 1DX4A 1I4OA 2W2LA 1UBTS 4S2EA 3L1VA 1T9BA 4G97A 3PGVA 4ID3A 3TLZA 3AR5A 1FXWA 2RJNA 3DNMA 1GT6A 3LHSA 3QLTA 4L4XA 3MINA 3L9XA 3EG9B 4NYIR 3HKCA 5THKA 1JFFB 1SXJC 4X9XA 2C7PA 2FWJA 1PS0A 3NVAA 4L9AA 4N49A 1EI9A 5IFKA 1ZUD1 4A8PA 4PYQA 5I9MA 3VKHA 2AFHE 2XCUA 4UTVA 4YRFA 1DSSG 3QMMA 1JFTA 3AF6A 5DNUA 4LRQA 4E30A 1WCYA 2I5PO 2XB9A 5AXDA 5L7TA 2E7ZA 3SM9A 4B74A 2QBYA 4NH0A 1QGUB 3P20A 1JDVA 2WWTA 1RZVA 3GFPA 5ECWA 4WLNA 2V6JA 5EMLA 4JITA 1YRBA 2G5GX 1THGA 4D25A 4EUNA 1BHSA 5KHOC 2C04A 4FYXA 4RPLA 2VBIA 2VSNA 3SF8B 4FWBA 4HLCA 1R18A 3NKFA 3D6HA 5IBRA 1OW3B 4H60A 4MZDA 2CMFA 3ONEA 2BL4A 2VI5A 1UKEA 2GESA 2IHUA 2ZYVX 3C6MA 4Z4EA 2J0SA 2ZIUB 5IBCA 1QGYA 1IUOA 3KV1A 3L43A 2BLLA 3LQFA 1L4YA 3GEIA 2PWPA 4O3FA 3SQWA 4QEKA 1QQ7A 4GRAA 2E1RA 1GKIA 4Y2UA 2Z8YA 4HY3A 4QPCA 5EAIA 3WBBA 1KHTA 3FE2A 3HRHA 1XWFA 1O95C 1P9WA 1WB4A 3DFUA 2IZZA 4G26A 4HAYA 2Y8EA 1SUWA 3TR0A 4X20A 1QP4A 1AKYA 1M7BA 3OA0A 4XQ9A 2ZUSA 4IQ0A 1VYUA 4HDSA 4XSHA 4EJMA 4OLBA 2ZVQX 5F64A 4LEIA 2DMRA 3GEGA 1KIMA 2GN1A 3CLUC 3IMKA 3UAYA 4F6RB 2C2HA 3S2SA 4ENTA 3PWKA 3G9QA 3FFXA 1YRYE 2JH3A 1BDMA 2HA4A 5HF8A 3A2MA 4ROTA 2P6NA 1GTSA 2WMNB 1ETUA 1YUMA 2EEPA 4MVJE 1G2PA 3DMTA 3OZEA 3FRIA 3GZTB 1L4UA 1DTWB 3KBBA 3SS8A 1M66A 5IT4A 1XTVA 3FMGA 3V4PB 3K9LA 3CIOA 3OBIA 1J8QA 3SKVA 3MOGA 3UAGA 1DMRA 4TMKA 4WBSA 5EZYF 4AJ1A 3FRHA 4ZAFA 1Q21A 3I2YX 2C1ZA 4MRPA 3V4VB 4D0NA 2YASA 1G2IA 3OI7A 5KI6A 5FI5A 4BEJA 1VL1A 2H63A 5F98A 1VHQA 4OJTA 3QI7A 3CSDA 2ZBUA 3OIUA 3QU7A 4F04A 1W75A 1YJAA 1NKTA 4DIFA 4LSMA 1PJ8A 2HPHA 1X14A 2RGGA 4FX5A 2CFSA 3PC8A 4Q18A 2P9EA 4L0DA 3JCZA 1FSZA 1WU8A 1XFDA 3WGJA 3ZZ0A 2VYCA 5LDDC 1QHFA 1A4RA 4C5BA 1H85A 4X24A 1MQ9A 1JTFA 3NDBB 3H5OA 2BUCA 1JWAB 3PTZA 1EBFA 4GLBA 4NF2A 4RXUA 3BULA 1EHYA 1R0ZA 1YNSA 2QTNA 4HL6A 5LUBA 3S70A 5FPYA 1ZUWA 2F6RA 3SSMA 4W9NA 2AOVA 2RAVA 4I14A 5CMLA 3B8EA 3IDQA 2I54A 1RNLA 1QRRA 2XYGA 4Q1EA 1YZ3A 1LF5A 3OU7A 1ENOA 5LNK1 4JFAA 1WR8A 2HU8A 4WCFB 4BMXA 5KYXB 5GV8A 1XALA 1NW9B 4QYIA 1XLWA 3EH1A 4MW5A 2I2WA 2J7PA 2XNSA 3GEMA 1F3LA 1X1EA 3HUFA 3M4ZA 4DA7A 3EUAA 3R7WA 4PANA 4I50F 4L0QA 2VOEA 4BXOA 1RTKA 1E2DA 1V25A 3OLVA 1SBTA 1JA0A 3V00A 1G5FA 3AHHA 1PNVA 3EZLA 5DM0A 5AUQA 4OK5A 1K7YA 4ZN6A 2BV3A 2Q27A 4UNQA 4ZV9A 3KB8A 1J06A 5BQ3A 1NSFA 5ALWA 4AP9A 1XPJA 2GCNA 4C30A 2C07A 2CNWD 3DHNA 3E61A 4BQOA 4DL9A 2XBUA 4G25A 3ZCXA 4M1MA 2BONA 1MH1A 3JZAA 3EEFA 4F4CA 3ZQKA 1US8B 3JZFA 3L49A 1BAPA 3RSHA 3IHLA 1IZYA 4E7OA 1TM2A 1O94A 3E9DA 1OWOA 3G17A 3O73A 1XTRA 5L6LB 4RV4A 4FYPA 3GEEA 3GRAA 1XTTA 3OOHA 2GASA 4HQOA 4ND3A 4EG6A 1BDIA 2YVAA 2R44A 4QUJA 2DHCA 3C39A 1P1RA 3CNLA 1OZFA 4BP3A 3WNQA 4J0DA 5EESA 3GLHB 4N5MA 4JLOA 3ED1A 1WW3A 2COUA 1BVYF 2P7HA 3GP3A 1DG1G 4QAJA 4UU0A 4C14A 1ZL2A 5JPDA 1W85A 4D9EA 1F48A 2C31A 4W4TA 5AXCA 4DLVA 3FGOA 2NPFA 4OSEA 3V7NA 1HNNA 3R8FA 3COWA 1NP6A 3RLIA 1N2IA 4U8GA 5L4NA 1CUBA 2W2PA 3WLNA 1PJ2A 4DPLA 1E2HA 2G9VA 4ZC1A 2OC4A 1A2QA 3IXQA 1T5BA 4OLHA 4QVKA 1GUYA 4IV0A 2OHGA 1ZEMA 1ZISA 3VSCA 5HZHA 4RL6A 4QHSA 2P3SA 5AKLA 3PRYA 2D5BA 3WGHA 3K9GA 3K2IA 4DSOA 4EAAA 5FPPA 4WBNF 2Q7XA 3KUKA 4B34A 1I5EA 1VJ1A 1ZDMA 2XI4A 3HEMA 5DXFA 1UFVA 2CLMB 3JVVA 3ZVRA 2YZ7A 1QRSA 2BKEA 2C7QA 3AFGA 4NYMR 3VNVA 3VJMA 5D3KA 1OAAA 5CU7A 4IIYA 3IDFA 3REQA 2E0IA 2DPMA 2DTXA 1ZNXA 3OLWA 5DM70 3H3FA 2OHHA 4GVPA 4WEQA 2OFOA 3FROA 3MWFA 2EKZA 4K9KA 4NZPA 4GZ3A 3U3RA 1L5NA 3HDYA 3F49S 3P2IA 1O5IA 1Q14A 3NBYC 4UBNA 3UFBA 2PXXA 3ZHZA 3AMVA 1VCHA 5AWFC 2JAXA 3AETB 5CA0B 2EKDA 4PLHA 5JJBA 1N5DA 4LYDA 2AW3A 2AG8A 3OU6A 2DPXA 3RTCA 3C5VA 3EISA 2CFRA 2QORA 3GYBA 1ZVVA 1ECFA 2Q3FA 5COBA 1EGAA 1KPHA 1GL6A 1TU4A 1MKYA 2OCAA 2IPXA 1W46A 2EW2A 4P4SB 3NBUA 4H7IA 2J9XB 1WSAA 2QSJA 2DQ4A 3E9QA 1SFRA 2DFDA 2IEDA 4UQOA 5WRFA 1E3IA 1S1CA 4HNUA 3IIEA 4M0MA 5K8JB 1LI5A 3HZHA 3SHFA 2RHGB 4UZFA 1CUVA 4LYGA 2DZDA 4R8RA 2XYRA 3DFIA 1SG6A 5GM1A 1QQBA 1OXMA 1LJUA 2AR9A 3I39X 3NYWA 2I7CA 2XMBA 4CMIB 1D2AA 1MAHA 2XGMA 2ZPUA 4V24A 1C7FA 4HPWA 1VECA 1GZDA 3QH4A 1CQPA 4L57A 1VG0B 3ML1A 2CYCA 1R6TA 1Z5UA 4JYPA 3BL6A 1K8XB 1X7WB 1YFKA 2HA2A 4RK1A 4II2A 3ED5A 4AWAA 2PH1A 3F7MA 1NFFA 2C96A 2ST1A 3NV7A 3UXYA 5JCOC 3JXEA 3VH1A 3OEEA 2COEA 2PEYA 1C9MA 4CM1A 3C16C 2G70A 1VHLA 4U9UA 4LVUA 1P5FA 4S1WA 4XLLA 2ZAIA 1KSHA 1GDHA 5CDGA 1XZJA 2JBHA 2A0KA 2VAVA 1WOMA 3QMVA 4GI1A 4HXYA 4DCVA 5TGTA 1LVUA 3RC3A 5CDHA 1JDUA 2AE2A 3Q7TA 4RANA 3SHQA 5B2FA 2GAJA 3EZYA 3HJHA 4RZXA 3A32A 1EXWA 3JYOA 1JALA 3HB4X 3GEPA 3HN6A 4KQ6A 2FEKA 4TKVB 5TQ2B 2GB4A 2QYOA 1RYBA 4LZAA 1KMNA 2JFBA 4MYHA 2DHDA 4L7VA 1U1FA 1ND6A 1C9NA 2VPTA 4EB6A 3M49A 1QDUA 3RYCA 3S81A 4PN3A 1QANA 5COAA 3ZCQA 5JHGB 3N2YA 2CC2A 3U81A 4BC0A 4FD2A 3JQBA 3ZVKA 4B79A 1V4VA 2GZ2A 3PNLA 1U0GA 2G5PA 4V0MA 2WPNA 4N5DA 3C4VA 2P91A 1U9IA 2P7IA 2JL1A 1E4VA 4M38A 4A0FA 1VSUA 4HS4A 2C2OA 1YVRA 1AQUA 3QBJA 3TQFA 1I30A 1V1JA 1N6LA 2C2ZA 4P4NA 3C6BA 2WIJA 5EWLB 1KDVA 4IIFA 4JU9A 4O2AB 3GRRA 4V1CA 3ZIDA 3EZ6A 5HCUA 3I6YA 3RVPA 1NJFA 4CDNA 1QG6A 3EYAA 3IT2A 3T3OA 3TTYA 2JFFA 4NBLA 3DEZA 2M6RA 2DWPA 5FI1B 3NBQA 4CUZA 4RYLA 3C74A 1QHHB 4ZKDA 4OYHA 3ZH2A 1E62A 3U1TA 4RTKA 2J3EA 4EFNA 1D2RA 1P0CA 3L7OA 3TZKA 4WESB 1NQ5A 3KLMX 3FKSA 4HKTA 4KQIA 3U4DA 1RAFA 2W0MA 1QO0A 4IDQA 3P2OA 3S0JA 4YBZA 3V8VA 1T4GA 2I03A 2YTZA 4QBIA 5I9IA 3H0CA 5LZ2A 4FKZA 3IP7A 3GUHA 5CDYA 4C9BA 4JOCA 5C8ZA 2AHOA 2JFQA 2AK3A 3QMWA 4RZ3A 5FJJA 2SKEA 1F2TA 1GXSB 1XZNA 3QA9A 4Y2YA 3TNFA 4U00A 1YKFA 1WXXA 2C5GA 2ZAYA 3CRW1 4M6WA 3THRA 2P9QA 3JD0A 3WL4A 4F1KA 3DE2X 4QX6A 1WZUA 2E4YA 2G83A 2P41A 1TAHA 4Z4QA 1YA6A 1UKVY 2WFMA 1FYDA 4HAIA 4GPBA 1RYNA 1BS9A 1KNXA 2FSFA 5JE8A 2XUHA 1BWRA 3IKTA 1IOZA 1TC1A 2PGNA 1O08A 3LVRE 1I0IA 3N05A 3QEMA 4XGNA 3O82A 1V7ZA 2Q5JA 4MVJF 4Y9DA 3SBXA 3RSZA 4EABA 5JTTA 1W88B 3DXXA 3GU3A 2EVWX 1GNVA 1YQGA 4EY3A 2IH4A 1B3BA 1WW8A 3I2JA 3NC1C 3SDBA 3WK4A 1DHRA 4ALJA 1VLMA 3AW9A 4MUHA 1YB2A 4KNWA 5HE8A 2WIFA 4W5RA 2BGGA 2KHZA 5BSWA 4KLRA 1W35A 3H1AA 2XE8A 3H13A 4TT3D 3RUHA 1BOFA 2FSSA 4DZZA 1NMQA 2O5EA 3R5HA 4WKOA 5JJIA 3LL7A 4BFCA 4HGOA 1PD0A 2REBA 5ECYA 3RHZA 3IVRA 1G0OA 3V8EA 3D6FA 3WSTA 4OQQA 2X1VA 4BC1A 3R5TA 4D9HA 3FJ1A 4KH0A 3ENNA 4OA8A 5J23A 4L8FA 1XDGA 4FCTA 4QJ4A 4RA9A 5FUVA 1YR8A 1YULA 2ZK7A 3QE3A 2CGEA 4MW1A 1C30B 2Q07A 1W76A 3LDGA 3NTQA 4YXWA 3VGJA 3L4BC 3HA2A 3X44A 3DS8A 3UGQA 2ZJ7A 3Q9UA 5LMCA 4C04A 2QT1A 2BIFA 2YWDA 2YW9A 5JH7F 3FTFA 1P45A 3IERA 1G17A 4D5GA 3N2GA 3ASYA 4LI3X 3GGOA 3GGJA 4MINA 5AK3A 4AULA 1VM6A 3C70A 9ATCA 5AW4A 1O5TA 3DLTA 3X1ZA 3K5HA 3LC0A 1XRNA 3LO8A 3INGA 3QPWA 1O6ZA 5EYPB 3ID6C 5CDFE 3DXYA 2MSEB 2EL7A 4KVZA 2QVXX 3QBEA 4KQ1A 4AVYA 1E2EA 3FNHA 1LQTA 2P2SA 2FOXA 1R4MB 4FMPA 2QN8A 4IIBA 3VPCA 3VSDA 4F3CA 4JKOA 1VDMA 1ZC4A 4F85A 2V9CA 3ISJA 1DVRA 4Y67A 3ZJVA 4P4TA 5U4XA 1GPLA 1Q2UA 2HKIA 2D62A 3E48A 1KXZA 1H4TA 3QX7A 3DHEA 1HG1A 4MP8A 1T8UA 5K3FB 2PFGA 3ZVLA 2BEKA 5CURA 1D6MA 2FW1A 3O8BA 3SJ7A 4Q34A 1I4LD 4A5OA 2XKAA 3EOAI 3L0DA 4R8MA 1Y3BE 2JGLA 1E0KA 1V3QE 4HOYA 5B6PA 4G1EB 1LNSA 4G1VA 2ILTA 2OG1A 3G59A 4PG6A 4LMRA 4OQDA 5E2IA 1Z4QA 3OZAA 1GV1A 4BNIA 3QEBZ 1SEPA 1TM3E 1FUUA 5K4HA 3KLNA 3CVOA 4P7KA 1V4NA 1QORA 1JHZA 4JR0A 1VGRA 1Y8QB 5ALKA 2TMDA 3IODA 5CK4A 5KNBD 1XNQB 1OGJA 3P97A 4Y7DA 3F67A 2JFGA 3T7JA 1KWGA 1DPFA 3L7MA 3MELA 3BWDD 2VSQA 2J6IA 1YRWA 3WRVA 1Q1QA 1HNWB 3ESCA 3LT5A 2HBYA 1EUCB 3HBFA 3O95A 3EDOA 1KKUA 4KXNA 2IS1A 3NAQA 5DYTA 3CXUA 4KK4A 1LX6A 1VPLA 2VXBA 4WJLA 5ICEA 3BMXA 5I7UA 5T3UA 3TAHA 3ZKWA 3CKYA 4FN5A 3T7SA 4E5VA 4TXMA 1LVHA 1KDRA 2R8ZA 1ULZA 2OQVA 5FTJA 3I9FA 2R3SA 2WM2A 3ZQ4A 3A36A 3ICEA 5KVVA 1SZCA 4DLXA 1FU8A 3AERA 2VTKA 1DAIA 4CQJA 2XRZA 3ABSB 4M6WB 3T99A 4RBNA 3WIEA 2IPLA 3E70C 4MLPA 4MEJA 2QA5A 2VDVE 1R8YA 1TYEB 1E9EA 1LPSA 1NVEA 1UC5B 4OLJA 1KU6A 1L7EA 4IMIB 2B82A 1F4VA 3CVJA 4OB7A 4XB1A 3WYEA 4BIMA 4BECA 1XCBA 2HO4A 4FGZA 3QWHA 3U80A 1MC1A 4C78A 1WDMA 1Y7HA 4G0XA 5DMHA 5J59A 2ZJYA 1N3YA 2RBKA 4A8HA 1B2RA 1N3BA 2FZCA 3OPYI 2IW3A 3IULA 4JJIA 3G5MA 5EQJB 4YUYA 1NUHA 1N7GA 1YZQA 4I3GA 2G07A 4XOUA 3TOSA 1MO3A 1M76A 4U6NA 1K97A 4GQBA 4UEOA 1Q44A 3ECSA 1BJRE 4AZ0A 1DI0A 1G9XA 5DHFA 1KEEA 3N2IA 5EJ9A 1FDOA 3L7IA 4LHYA 2VA9A 3DFZA 4G4SP 4X44A 5TT1A 4CNBA 2DBQA 4NHOA 3THSA 3SHVA 1RDFA 4W1SA 2PZEA 4X91A 2ZYAA 2ZYUX 4I46A 5CGZA 1EVJA 1VHWA 3F8TA 4HAWA 2UVQA 3IPCA 4NYMQ 5CJPA 3VZSA 4GZLA 1JIVA 4BRSA 1AHIA 1QTIA 1J70A 2I7TA 1G9TA 2DPLA 3L46A 1O94C 4CM9D 2CEAA 2RC6A 4D46A 1ZUIA 5H4HA 3W77A 4EQZA 3MCVA 2AI2A 2FUG1 1PJLA 3TWOA 4MITA 4URYR 1RQ7A 2A57A 1G20A 3D7SA 4GMHA 3C0KA 2PU7A 4JKYA 3SYLA 3GQVA 1P1IA 3H86A 2XA9A 4ZHQA 1V2HE 3HRKA 2UUBB 3F4BA 2JVJA 4TZ6A 3GZ4A 1GY8A 3R7WB 2XB4A 2ZUBA 4JI3B 1PNRA 5HJ2A 1CR0A 3SZ3A 1U98A 1XXHB 2ZE5A 3I01A 1TQ8A 1Q1ZA 4TSFD 2K4MA 4DCPA 1I0LA 1TVCA 2V4UA 2CYAA 3CEJA 3H6GA 3ZOZA 3EFBA 5FI0B 1G60A 3FKJA 1KO1A 3EQ7A 5LJLA 3NPAA 4GAEA 1DPGA 1IBSA 1KQPA 1TUIA 2WYUA 2XD9A 4XUGB 5L3QA 4W5NA 4MA0A 1ICIA 1PZNA 2UVPA 4KQ9A 3NHKA 1BE1A 2HDNB 4IJQA 5JATA 1JG6A 1X7WA 2IOYA 2E85A 4M9QA 4BX8A 3MB5A 3PK0A 5JLAA 3RFCA 1ZHOA 3QWFA 1YUBA 2CFOA 3E2MA 3RJTA 2ORVA 1Y8ZA 1L5OA 3TOCA 5HUHA 2B4RO 2NV2B 3AHDA 1F2UA 3E5HA 1K4MA 3A4IA 3E9NA 3H2BA 4WOPA 1ZM2A 3AVUA 2XNHA 5FA5A 2FFAA 3QEOA 3SDSA 3BMQA 1QVVA 3VOBA 3VYSB 5AHRA 4AF7A 5JZVA 2JNWA 2AD1A 4HEJA 4JJGA 5MHTA 1LZLA 4GF5A 3O4RA 4XFKA 1OWMA 4PRZA 5FH9A 1RPJA 1XQYA 3F7TA 5IAAA 3PTLA 3TLBA 5A4MS 2BH9A 3Q9LA 3UAZA 5C18A 3GNQA 3C3MA 3B5IA 5COQA 3ZWPA 2PKRA 2YC2C 3DXFA 4H3HB 3SQOA 5GTDA 2QRNA 3E58A 3Q0IA 4B32A 3IP5A 5DWVA 2GDJA 2SCUA 1RWMA 3K9BA 3UF0A 3A2NA 1GLGA 4A8TA 2B8WA 2P62A 2Y4OA 3FZEA 3HSYA 4X3OA 3W5CA 1QDLB 4OKSA 1A8UA 4PGFA 2O8NA 1XTKA 3ZXUB 3QUBA 5JYBA 4GG1A 4RX1A 1D4AA 1UK7A 3Q85A 3IRUA 1HGXA 1V7QA 1VKJA 2J46A 4FHZA 1X8XA 4I99A 3MTEA 4LYFA 3SR3A 1TECE 3LS2A 2PU5A 3RH0A 4A03A 2XXJA 4IINA 4XDZA 1K7CA 3GJRA 4RQUA 4ZO9A 3NUQA 4EHFA 4YIHA 3K0FB 4AUKA 2AC2A 1KR5A 1XWWA 1GKKA 2OZLA 2VP3A 3FCOA 4ZVSA 5ALJA 4FHGA 2H1CA 4JJZA 2QE6A 4XIFA 2FSVC 3MJTA 1T5TA 5JBQA 1PEYA 2DWOA 2X2OA 2PUTA 3CHYA 4MICA 5IH3A 1HYQA 4WA7A 5FFNA 4KO2S 2HJHA 4PTLA 3ERCA 3FWNA 3UMCA 4B3MB 1DHTA 2IF2A 3T7DA 1CQJA 1ABBA 3KB1A 1G7TA 2MSLA 5CUQA 5AK6A 2JAUA 4MVWA 2OC9A 4UJ3A 1JNYA 4N3GA 3ROXA 3F5QA 2PXAA 5FD8A 4W5OA 1T3HA 3ANSA 2HNKA 3VPXA 3I6BA 2HQSA 4B3IA 1GRNA 4L85A 2QAIA 4Q47A 3BIOA 3KVNA 1T15A 4U39A 5A06A 3TRFA 1Z18A 5IXSA 4RTPA 4BRZA 1G8YA 3TLYA 5CT4A 1AQYA 1AQJA 5BMVA 1NLZA 2ERYA 3TW6A 1Z5WA 5CPFA 3SJBA 1V39A 4R2IA 5GADl 4RD6A 1SGWA 3AI1A 1E5TA 2F62A 2I8LA 5KB3A 3BA6A 4Z7QB 1I1OA 1GZ7A 5BN5B 3OT5A 4OPMA 4UUQA 3TQHA 3ZDFA 4S1NA 2IYTA 1RP1A 4AP6A 4PLWA 4WOCA 1LSSA 4BGIA 3CEMA 5HILA 4AG3A 1T25A 1N6HA 2HO5A 2REQB 3MHTA 3W2FA 1YNOA 4EP1A 1N57A 1AGPA 2JD1A 3HKEA 1T8YA 3OZRA 2HLNA 4IDHA 1WLSA 3GA7A 3ZDAA 3NNSA 2Q5CA 1EE2A 3BE6A 4JOBA 2GO7A 1INLA 3PFIA 1MB3A 4Q00A 1VCMA 3GWGA 2OO7A 3QF4B 4NAUA 3ZXIA 4QOFA 4CE6A 2O3UA 3WHPA 5CB0A 3VR6H 3T1YB 2VATA 1V0JA 1W4ZA 2FW7A 3WP0A 3BFJA 1QXSA 2DE0X 2F48A 5LXTF 2F2TA 4HQ0A 1QOPB 1XROA 3OIFA 4Y6QA 3U48A 1XHFA 3W05A 1V1RB 1GILA 3PC3A 1MEJA 3WRYA 1MIOA 2C03A 2C5FA 2JATA 4FMDF 4IDFA 4JP2A 3AX6A 3U49A 4A16A 5CB8A 5JCXA 1WUKS 2EGGA 4C1NA 3HXOA 4U2EA 2WTBA 3OHPA 1RBZA 4Q7KA 5J4YA 1TAUA 2NYAA 2EEZA 1JNXX 2AEFA 3JQEA 2A9VA 2VQSA 2PWZA 1Z26A 3O4IA 3PD0A 4JL5A 3PFFA 4X5OA 3UK7A 5I4CA 4BNMA 3C6XA 2V45A 3VAAA 5M3BA 1BEEA 1I8TA 2XCRB 2JIZA 4CHTA 1Z63A 1JBEA 3F96A 4OVKA 4TLCA 4XA8A 3DKKA 5AO9A 2ZUDA 4PG8A 3FUTA 4IXDA 4Y2QA 3PUHA 5EHQA 4UPEA 5IRCD 2ZIXA 3AZPA 2C3PA 1TKRA 4IHJB 4EQ6B 2G9ZA 2QTMA 3IDSA 1GQQA 2XOKD 3Q3GE 3WZMA 5IAOA 4J29A 4MQ4A 2J6CA 1E7SA 2RMKA 3F78A 4HGPA 2H2DA 1LRKA 2CE7A 4TX1A 4MIYA 4RVGA 5BV0A 4O2AA 2FYTA 2ZIVB 4HUQB 3EW9A 5CEJA 1K5GA 4L3OA 4PLPA 3W9SA 1MVNA 2QR3A 1QCZA 2J85A 2XUPA 3F6CA 1KI2A 4JYBA 3L6CA 3EMVA 4PHTA 4HPJB 1BXRB 1D2HA 1Z5NA 2JLCA 4HX5A 1HL7A 1NURA 1NT4A 2WAAA 2DUWA 1EP2B 5C35A 1A9XA 4IOMA 1HDYA 1T35A 3ZGNA 4DSTA 2C99A 3LQ2A 5ADHA 4US0R 2HNBA 3E7WA 2EBWA 2MWMA 4PINA 2D74A 4V0QA 4RK6A 5B1DA 2XGSA 3MTQA 5IUKC 1XPOA 4LRWA 2C42A 3SYNA 3OJXA 4RJIA 3SXUB 1G5PA 2DHRA 1YGYA 3JY6A 4CV3A 4Y2XA 3UXEA 2O0MA 1NFRA 3QBVA 1R6XA 2HRCA 2OK7A 1I6MA 1B6GA 3L4BA 3OQ1A 3UOGA 2BGRA 4Z5XA 3THXA 2E4ZA 3C43A 1OTXA 4LISA 4NOKA 1CDDA 4D98A 2JW5A 5F52A 4P93A 2N47A 3EASA 4PYLA 3S2GA 4DV1B 2YFQA 1GKLA 3DVQX 3TW0A 1ZA1A 1JEOA 2PSSA 3O91A 5DSZA 3B78A 4YP7A 1T91A 3A2KA 1W52X 2V03A 2C92A 5LJIA 3PX3A 1V6CA 2PSEA 5SZKB 5A03A 5E1MA 3KKZA 5EP4A 3CY6A 3H1PA 1MXHA 4J0GA 4QJBA 2XT0A 4E6PA 3U4MA 4I4LA 3V7YA 3WMWA 5BV2P 3B3JA 1K7SN 3I6QA 4R7TA 2HJRA 4EA7A 1Z9BA 1JIXA 3KJXA 2WR8A 4JCCA 1A9OA 4P3XA 5JJLA 1VB3A 2XEDA 2G1UA 3W78A 3LUHA 1EK6A 2WJ4A 3F90A 5KYUA 1VJ0A 5TQVA 2HWUA 3RVBA 1ZESA 3R5XA 3W5DA 2E5LB 2X13A 1PJ4A 1XNJA 3D54D 3JQ8B 1X39A 5C3UA 1CS4C 3KEFA 3VZBA 2LDBA 2LTAA 2GZHA 4IR7A 3K09A 4EKIA 3N8GA 2ZYRA 4B6PA 3VMMA 5JDCA 1PK9A 2XQJA 4CBVA 4MHTA 1M73E 4I4NA 4B40A 1T0JB 3Q5GA 4FFOA 1RQXA 1SHJA 3EH2A 2EZ8A 3NGMA 3ZBQA 2WAXA 1ULTA 4QXPA 4BEBA 3PV0A 4G86A 3JQ9A 1JZSA 3T7AA 1IM8A 3HY4A 1JIIA 1VMIA 2R2AA 3D8UA 3L8MA 5DI3A 1YI0A 2GHQA 4Q3BA 3V8PA 3WBFA 1XLTC 2C4NA 2Y4NA 2KWIA 1N1MA 3A6KA 5C52B 3MJEA 1EK0A 3IUJA 2RHHA 2CNLA 3OU2A 1VE9A 2JA2A 2YNMD 4ZK6A 3NYRA 5AKXA 4YYEA 4BGDA 4X94A 1Z6QA 1I32A 3H0KA 4H17A 4E1BA 2PRSA 3R44A 4O1IA 2YOHA 3A06A 3EUFA 3UN1A 1HT3A 1QF6A 2H2AA 1GWNA 1TEXA 4EDHA 3I3SR 2Q3LA 3T95A 2RG1A 1EFTA 2VDOB 1NR7A 2X0JA 4GQAA 4X6LA 1FCJA 2IA5A 2J0UA 3ELYA 4Y18A 4JI1B 2C54A 3SQNA 2NVUA 3RG8A 4LHVA 3WWDA 1FDRA 3QXSA 1J8VA 1VIVA 1O57A 2O5RA 2BGKA 1FPQA 3EIQA 3O94A 1YHZA 4EUSA 1GAJA 5KOJA 1EMDA 2E49A 4M0KA 1R8SA 3HKEB 4ALNA 4ZCTA 1Z29A 1MFZA 3NBFA 3WV4A 1T29A 3KXDA 4DT1A 4CF7A 4IMPA 2JJYA 4E33A 2H6EA 5HJEA 4XM0A 1QGUA 1MQ8B 4M0LA 5AJXA 1SHKA 1TMOA 4PPQA 3GO4A 1ZJWA 3RBAA 4ZZ2A 1SQFA 3A9SA 5CDTA 1P1KA 1XF1A 4TV9A 5LYJF 3DTVA 1DBSA 2C00A 2E1PA 1TYCA 3UWOA 3M5CA 1MDFA 1K6JA 2UUPA 3IIMA 4MQLA 2O7RA 1DG3A 2YWFA 3EVEA 2F4VB 3LK6A 3M1LA 1ZN7A 4FFMA 1NYLA 3KELA 5LC1A 2A1TR 4C03A 5LQJA 3VKWA 1ES9A 3KHTA 4LECA 2A1TS 4OHCA 1CY7A 2CK3D 3MMNA 3P9RA 4W9NC 5B6JA 2P78A 5E9WA 3QFCA 1GL7A 3JPYA 4BVAA 3GZNA 4OHUA 4KOAA 2IK8A 2JDIA 1JHQA 4OMUA 3NHBA 1X1QA 3A1WA 1WULS 5EE1A 4G0UA 3TDMA 1JSLA 1FUEA 2ACEA 4NENA 4XB2A 2WLSA 1G8MA 4G9GA 3PITA 2A94A 3SP1A 2XSZD 1IEQA 1E6MA 3URMA 2PN1A 2J41A 3L79A 4LOKA 4MS4A 5HA5A 3WIUA 1TCCA 3FFAA 4DMLA 1GL3A 2UVDA 1MVOA 4Z9BA 1M8PA 3HSSA 1W0JA 2C5HA 5TEVA 1JPUA 2QJFA 2VQ6A 4L75A 3DDCA 4YDHB 5JU6A 4OBXA 1RABA 1T5LA 5I9BA 4DIDA 1XD8A 4QATA 1R5BA 2AZ4A 1XU7A 2J9RA 3R5JA 4A1FA 2CBXA 2D00A 3HGMA 1M7GA 4JYMA 1DXYA 1QPBA 2KS6A 2OEPA 5FNVA 3SBDA 5DBGA 2JJ2A 3S5JA 3WLSA 1GNPA 1P2TA 3SC2A 3IAFA 4INOA 3AR7A 3K3PA 2IU0A 2X0DA 5BWBA 5BN3A 1GD1O 2LWIA 3EVNA 4KPUA 4G9EA 3OJEA 2YHBA 1CUZA 1ZGZA 3P0EA 3WAKA 3QFFA 2X42A 1EWRA 2QIOA 4GLFA 4Q4JA 2XIJA 3BCRA 1GGMA 3IDZA 4UXHA 1N2CB 4OXIA 4LXGA 2PV7A 1H4SA 4RS3A 5FJIA 3EC2A 4JLJA 5AFSA 2J3HA 4R8VA 1M0EA 1PKXA 2J3QA 2QGFA 1YFZA 3BD8A 3NMUF 1M0SA 2UZ0A 3HY6A 4RH1A 1NM5A 4G1FA 3I4LA 3JPWA 1UIMA 1MF7A 3KTDA 1R5NA 4MW4A 5JQGB