1JIVA

T4 phage bgt in complex with mg2+ : form ii
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution crystal structures of T4 phage beta-glucosyltransferase: induced fit and effect of substrate and metal binding.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
molecule keywords DNA BETA-GLUCOSYLTRANSFERASE
total genus 127
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1jivA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1jivA02
2O6LA 1NOIA 2QRHA 1O6CA 2F3QA 1UQTA 1EM6A 4AN4A 4REMA 2AW3A 1C8KA 1Z6PA 1GGNA 3S28A 1XC7A 3ZCRA 2GT1A 4RIEA 1FU7A 1YGPA 4EKEA 2VCHA 3E3LA 2IEIA 2GPAA 3NCHA 1AHPA 2IYFA 2PQ6A 4BQFA 2G9UA 3G2IA 4RELA 3NC4A 3QKWA 2SKEA 2X6QA 2IYAA 2BGUA 1C8LA 3TOVA 1KTIA 4Z5XA 1FTYA 2ZB2A 3BCSA 3NAZA 4N3BA 1E4OA 3E3NA 1JEJA 4HLNA 2F3SA 1JG7A 1WW3A 2JZCA 3MT7A 3MS7A 2X0FA 3L7BA 4X7PA 1RZUA 1A8IA 2PRIA 3TSAA 3MS4A 3QHPA 3SYRA 1HLFA 2G9QA 2SKDA 3PE3A 1B4DA 3L7DA 3T5TA 4YI5A 2IV3A 2GPNA 2QLMA 4GPBA 2GM9A 5DU2A 3BD8A 2GEKA 3D1JA 3OY7A 1IIRA 4LEIA 1E1YA 3Q3HA 1JIXA 1WV1A 1FC0A 1P2GA 3G2NA 1GPBA 1XL1A 7GPBA 2KS6A 1H5UA 1UZUA 2G9RA 3BDAA 2XA1A 3Q3EA 3NPAA 2XA2A 3VDNB 1UQUA 2VSYA 3OKAA 1GPYA 5HXAA 2R66A 3C48A 3ZCUA 3C4VA 2ACWA 5I45A 5ENZA 3EBPA 2QRMA 3AMVA 3RSCA 3L7CA 1FU8A 5GPBA 3ZCPA 1Y6GA 3MTBA 1FTWA 4HWGA 2XA9A 3CUUA 2QRPA 2AV6A 3CUYA 3D0RA 2QN3A 2ATIA 4AMBA 3CX4A 3H4TA 2QLNA 3OY2A 4MI9A 2BGTA 1L5WA 3S0JA 5DLDA 1VGVA 1L5RA 3BCRA 4X6LA 3E3OA 4CTMA 1SXQA 3ZCQA 4RBNA 1YA6A 3FROA 1BX3A 1FU4A 3MQFA 2JLBA 3HBFA 1QM5A 4WHMA 1NOKA 4M83A 3OTHA 3MSCA 3RHZA 4G2TA 2AMVA 3CV3A 1L5QA 4GZ3A 4NEQA 1F6DA 3DDWA 1RRVA 3GUHA 5TMEA 3UYLA 5BNWA 3DD1A 4NESA 5TMDA 4XIFA 4GYYA 3NP9A 3NB0A 2PYDA 3ZCTA 1J39A 4GZ6A 3COPA 4NC9A 1PNVA 2SKCA 3TAXA 2FETA 2JJMA 2R4UA 1P4JA 4EKYA 1QKJA 3C4QA 1FTQA 3VDMA 1JG6A 2H1HA 3MS2A 3VUFA 3VUEA 4KQ1A 1P2DA 2FFRA 4N39A 2IV7A 2XCUA 4EL0A 1IXYA 1F0KA 2C1XA 4FZRA 2QN2A 1L6IA 4RENA 3PE4A 1K08A 2R68A 9GPBA 3D0QA 4N9WA 2P6PA 5TVGA 3HBMA 4X7RA 1XKXA 3WAGA 3L01A 2AZDA 3OKPA 3OTIA 3MRVA 4AY5A 1M5RA 2VG8A 4M60A 4MI6A 1NZDA 1L5SA 5LQDA 2ACVA 5IKOA 1P2BA 1WUYA 1GG8A 1JIUA 4RIHA 1FS4A 3T3EA 3IAAA 3ZCVA 6GPBA 4F97A 4YUAA 3T3HA 1C3JA 2C9ZA 3DDSA 4MRAA 3RSZA 3T3IA 2C1ZA 3MTDA 3CUTA 1XL0A 1Y6FA 1XOIA 4BQEA 4QLBA 1PYGA 3EBOA 4YI3A 4WADA 3G2HA 4KQMA 3BD6A 2QN8A 5TMBA 2GEJA 4W6QA 3T3GA 1RZVA 4EJ2A 2QN9A 4F96A 5C1DA 4MI3A 1Y8ZA 2BISA 4RIGA 4GYWA 1L7XA 2HY7A 3CUVA 3L79A 1L5VA 2QRGA 1Z62A 3HBNA 2IW1A 2QRQA 2BFWA 4XI9A 2PRJA 1NVKA 1JIVA 2QLLA 1V4VA 4X7MA 1LWOA 3MRXA 2QN1A 1Z8DA 3S2UA 1P4HA 1SXPA 2R4TA 3BD7A 1K06A 5DXFA 4N3CA 2X6RA 4FKZA 3DZCA 2PYIA 3CUWA 1ABBA 2OFFA 4EL5A 2XCIA 1P4GA 2XGOA 3OTGA 2GPBA 5JTTA 2QZSA 2F9FA 2QN7A 1GPAA 4M7PA 2IUYA 2X0EA 3SYMA 3GPBA 3H4IA 1LWNA 4WACA 3G2JA 2VCEA 3S29A 2VSNA 1AXRA 3MBOA 3T3DA 1GZ5A 2X0DA 5JTUA 1NOJA 3Q3IA 3BEOA 3UYKA 3MT9A 1EXVA 4BQIA 3G2KA 5D00A 3CEHA 3OT5A 4KQ2A 2H1FA 4RIFA 4N3AA 1NLMA 3MRTA 3MTAA 1PSWA 2XGMA 2WTXA 4PQGA 1GFZA 2IEGA 3NP7A 1WUTA 2ASVA 3CEMA 2XGSA 2GJ4A 1NZFA 4L22A 4MICA 2ECPA 3MT8A 3WADA 4AY6A 2G9VA 3T7DA 4AMGA 4CTOA 2FF5A 4LDPA 8GPBA 3L7AA 3OKCA 3BCUA 4BFCA 1FA9A 4MHSA 2F3UA 1C50A 3IA7A 3S27A 2F3PA 3RT1A 2XMPA 1WV0A 4F9FA 3ZCSA 4GZ5A 4CDRA 1Z6QA 4CTNA 5IKPA 2QNBA 1WW2A 3O3CA 3CEJA 2Q6VA 5D01A 2YJNA 3HBJA 2C4MA 3G2LA 1XV5A 3WC4A 4RIIA 1PN3A 4MHOA 1P29A 2R60A
chains in the Genus database with same CATH superfamily
4NBUA 4M6WB 4ECEA 1I1QB 4TZ0A 3V4PB 2QG6A 2WHYA 3FI9A 3O6VA 4Y1EA 1Y3CE 4DUPA 3ZE0B 2C5EA 2VH5R 3DMFA 1A7UA 3PFFA 1R8XA 3QFSA 2AI2A 1E1DA 2BFDA 3PA8A 1R0WA 3V4VB 3VNSA 5IWAB 1EM6A 1KS9A 3JASB 4V0QA 3U4HA 3NHPA 3W2TA 2AW3A 2RH8A 2VUHB 3T9EA 3WRXA 3KUKA 3FHCB 1YOVB 3ZCRA 1TFUA 2JAOA 1F06A 1DTEA 5AK3A 4EG6A 1J49A 5AOAA 2I3BA 2VCHA 4GP7A 3GX1A 2PY6A 1QP8A 4DA7A 3ANXA 3P19A 1W6RA 5EWJA 3UCXA 2CDRA 5B55A 4BGEA 5BORA 5JJCA 1G1MA 3AUFA 4YPVA 3IQWA 3RJZA 1P4RA 1FTNA 1IK4A 1DX6A 4TXJA 4PLPA 4LE2A 4QVIA 2O9JA 3B3JA 3T5MA 4K9MA 1HDRA 3E48A 5F77A 5G53C 3LX5A 1CRLA 4B2YA 5JCOC 3JWIA 1SKYB 2GBLA 1OLSA 1Q22A 3ZWCA 5IVDA 1SIBE 4G8DA 1XE3A 1K5GA 2Y0BA 4XTRA 3W78A 4D81A 1DEXA 2XWPA 2BFFB 1DHRA 3BHJA 3JQEA 4LZJA 1MMFB 1P7PA 3B5IA 3C8HA 3BK2A 3U60B 2IQIA 3QI2A 2ONKA 1QKKA 2WFAA 2ZP1A 3HEBA 2CLMB 3B7WA 4P36A 3GXOA 4O4LF 4PNHA 4RXMA 5FUYA 4LXUA 4V0NA 4BKQA 5EHIA 4F6CA 5J58A 2BD0A 1H1TA 1GLGA 1X3SA 2G7MC 1FFEA 1OSNA 1VKRA 1HQYE 3Q5GA 3C6QA 3MB5A 3N74A 2JGJA 3U16A 2BFDB 3EIWA 2PGIA 2XVMA 1U6JA 3B53X 3GZ4A 1G7RA 1QQ6A 3PTAA 1AKWA 1YR1A 2WYHA 4HLQB 1W1UA 4TM8A 1LEHA 4HF7A 5ICFA 3UC9A 3PC3A 4PZDA 3AUKA 4X5OA 3RKSA 1O95D 2MCFA 1Y7PA 1NDUA 2WYVA 3GFGA 1TM1E 1EFUA 5JR3A 4G63A 1F60A 4EPXA 3GGGA 1F2TB 3TR0A 2V7XA 1P74A 3DNMA 5ALXA 4BPBA 1M73E 2IP4A 1BU5A 1E79A 1X1SA 2PIAA 2GUWA 5DX0A 5KCMA 3ZV3A 3RE1A 1ZQ1A 2PMCA 1EK6A 1JIXA 4JUIA 1HDOA 4RPHA 1AXGA 5B6JA 3TNJA 2VAMA 2EKLA 3WGMA 1FBTA 1WTCA 3W8NA 1NBAA 4DMMA 1FQOA 1O8CA 4P81A 1INLA 4URYR 2WF8A 3OEEA 4TWZA 1DUVG 3ANYB 3LGSA 4M1KA 4A03A 1YDFA 3BDAA 3O75A 1AGRA 4OHOA 3BBLA 5CFZA 1U0SY 5GADl 2YJZA 2HMSA 3VU9B 3QPVA 3OEHA 3OZSA 1Z2AA 1R4MB 2GZHA 4JBNA 2GOYA 2AJDA 2J3MA 1SCIA 3PEEA 2G70A 4YTEA 5EGSA 4ERXA 4FDMA 3LO8A 4PO3X 2EATA 3C6XA 1VXRA 3ETHA 2IV2X 3U62A 1RFGE 1QG2A 3F9RA 4K9NA 1TJPB 4KKXB 4MJLA 2DUMA 1G8YA 3U5ZB 1G59A 2YYZA 2H1WA 2RAVA 2O2IA 1MOZA 3I45A 2E82A 3EVAA 3KQPA 3UV7A 1BEEA 4W7SA 4UVEA 1XALA 1GPMA 3AXTA 3MTBA 1G0OA 1ZRSA 4MVJA 1Z13A 1GV1A 2V9PA 3RADC 3I9V1 1RAGA 2QRPA 3ZEIA 5FX2A 5L53A 4GZLA 1EHCA 4LY0A 5TRTA 4OJYA 1R6VA 4QUDA 2FSFA 3DVSX 4G0NA 4YLGA 4KAFA 3QF7A 4A5OA 3B6JA 2XD9A 4MPPA 4URVR 2O2ZA 1W8DA 2IVFA 2A7QA 2ZWPA 4RE6A 5LR6A 1TO2E 3OX1A 4C4TA 1IU9A 3A9UA 3MG9A 2O2SA 4HP8A 5A02A 4R2KA 3VKVA 1M2EA 2Y77A 3C7CB 2XUFA 3DGEC 4GGPA 4GWGA 1XRNA 4UM9D 2XR1A 5TPWA 4INZA 4JI5B 3PFIA 1IXSB 3T06B 5JZ9A 1WR8A 3HU1A 5TSDA 1N5LA 3PXAA 3RYFB 2RI1A 1T9GR 3I37X 2O2XA 5G0VA 1CLUA 1PGQA 4LZZA 3D6FA 2WJVA 3AR7A 3GD7A 3PFHA 2FSVA 1LRJA 2IC5A 3EH2A 4AJNA 4DE5A 8MHTA 4R51A 1XJQA 3DUFB 3DBRA 3WFIA 1SPBS 3DO6A 3Q8XB 2XZPA 2X5KO 2ZT5A 2AT1A 2Z8YM 3K9BA 3L8YA 3N05A 4MTCA 4MUKA 3UHOA 1E3MA 4FFDA 4NONA 1E9VA 2CC2A 4D0SA 1JN0A 3GA7A 4XOUA 4YDRA 1NW4A 4GH5A 4B5LA 2GJAA 2PBRA 3DFMA 3DONA 4U7FA 4C7VA 3P2EA 3KHSA 4NFYA 2Q3CA 3IELA 1A5TA 2PQMA 1G8KA 4L0DA 4O1MA 1TD9A 4O4IF 1ULHA 3D6JA 1YDMA 1XTTA 3GELA 1XN4A 1U7HA 3UHPA 3Q4GA 3JU3A 4X85A 3LTNC 4JKIA 1GAQA 3NRBA 4F8EA 3PI7A 3H8WA 1WDLA 4ETMA 3VC1A 3PUZA 4IAOA 5C3UA 3V4OA 4B1FA 3GA5A 3R77A 5HM8A 2GZSA 2UV8A 3RIEA 3ZDAA 1JRLA 4QATA 5THQA 1BE0A 3NBQA 2NQ8A 2LBPA 2H1IA 4KYTA 3FMIA 4DLBA 3AUYA 2OHHA 4QECA 4XVCA 4FUTA 4J16A 3EXEB 1K4MA 4FUQA 1CUXA 5CT4A 4XFDA 1CHDA 2PFGA 4QJIA 4X63A 4BEWA 5C2JB 4WBSA 1QGOA 3RRYA 4F1KA 2P8JA 1PDWA 2ZOSA 5JAMA 4N3GA 4FGZA 2QX9A 2GZ1A 2Y1DA 1GNTA 4I50A 1XTZA 2OCIA 1P0MA 3C4QA 3NEJA 1FTQA 2QVCA 1VI5A 2YIVX 4FDVA 3MMXA 5CJJA 4PZCA 3VUFA 5A0TA 2W4IA 2OXCA 2ZSFA 3TDKA 4AS1A 1XDSA 4BNFA 2Y27A 3B2EA 1NUUA 1SZPA 2H2WA 1HWYA 1GTMA 5DCWA 5CAEA 3DE0X 1F0KA 1UFRA 3UT0A 3TXAA 4IY1A 3SHFA 4IICA 4BFTA 4GKJB 3ROEA 3BZUA 3W90A 2R7MA 4QEKA 1XU4A 1XZQA 4P2GA 1QH0A 2ZK7A 3OWHA 5AW3A 4RTNA 3MFYA 1E4YA 5JDIC 3IBCA 4G0XA 2G0TA 4I08A 3I6QA 5E4JA 4CTKA 3ZDBA 3FOCA 4KXQA 3PFGA 4FMPA 3OT1B 1EFCA 3OLQA 2JLCA 2ZTHA 2AIRA 821PA 3NKFA 3W06A 2AF3C 1XZCA 3B2QA 3IODA 2CNBA 5AXBA 1N5MA 1K7XB 1YDGA 3WAGA 3RTBA 1X14A 3ZJVA 4E5PA 2A5LA 2XCRB 2C42A 3MRVA 4DLKA 1M5RA 4G5GA 5JROA 1ZD2P 5ALEA 1N2GA 3II6X 2RHTA 2IX3A 4M60A 1Z0JA 5F9MA 3KO8A 4XDHA 4WNAB 2ZUSA 5FFFA 2C1EA 4BO3A 3NTUA 4ALIA 3QW2A 4NZYA 1MVOA 1WUYA 3MMSA 3NM4A 1E89A 1G5RA 2P30A 1NU6A 3OECA 5DF1A 5ALLA 2IP2A 1E8MA 2FP4B 3Q3VA 5LBUA 1MR3F 3SZ3A 3ROGA 3L0PA 4WN9A 4BU0A 3TL2A 4CFZA 1VP9A 3X2FA 4FD2A 4TS1A 2O7RA 1JEEA 4WGGA 2DKNA 2NYUA 4MGIR 3LWZA 3C3BA 3CKYA 1VBKA 5BW5A 1LNZA 2IYQA 1PHPA 3KJXA 1I6WA 3V2GA 1F1JA 4CMEA 1TADA 4EELA 2WU4A 4RV5A 3WQBA 3HN7A 5C8YA 4KPGA 1BOFA 3NYWA 4CZ2A 3REQA 1KBZA 2EL9A 4LYYA 4J2HA 4X71A 1QRUA 4BNLA 1X7ZA 3LCCA 2JVJA 2ZB8A 4IQ4A 1C7FA 3NAGA 3UMMA 3ADDA 1BCRA 1L7EA 1M1YB 1NYLA 4KQMA 3DEAA 1I5EA 3R6LA 2EJTA 2XPCA 2XNKA 2E5LB 2OQIA 2YZ7A 4Q7KA 5TMBA 4AWBA 1EJ2A 1U8YA 2D0DA 5DYTA 1THMA 5LDGA 3UW1A 2JJQA 3L18A 3LJKA 1G3MA 5TQVA 1EA7A 1NVXQ 3SU8A 4EJ2A 3WRYC 1EQAA 1PJAA 1ZWLA 4J16C 4OMDA 1PEAA 3IT2A 3ZHTA 1WXHA 1C2YA 2X13A 4Z1MD 2AL7A 2F17A 2HSDA 3DTVA 3BMQB 4HLDA 3O9MA 2DWUA 4O2RA 5F7XA 1PL0A 2OO7A 5MN6A 4MW7A 2EW8A 1I3LA 4L8WB 4UBJA 5F9HA 1Q1GA 4G0ZA 3OZDA 3C41J 2OECA 3DBVO 3JQBA 4GR5A 4XOIA 1TCVA 2OR3A 3NWOA 4U8GA 1E6KA 2DBZA 1O6BA 3ER6A 4D79A 1J8QA 4ER7A 2YZ2A 1WPXA 3M4NA 1N5RA 2OCKA 2PEZA 3FDZB 3R6WA 4HATA 4HWOA 4EUFA 2HUPA 3JQFA 2UVPA 1LQ2A 3WLOA 3FFAA 3RYHB 5HS6A 2P8SA 3V80A 3KJIA 3PUVA 5FKJA 4C4XA 3ZC3A 5FOQA 1Z4JA 2ZYDA 4IMRA 4NR0A 1PTJA 2CMKA 2CYBA 1F4LA 1OLXA 3DDUA 3IPYA 4UUAA 2H7VA 5G3ZA 5EP4A 3AVVA 3VKGA 1SXPA 4TKUB 5LQNA 1N6KA 4GS5A 3Q0TA 4IYJA 2DKFA 5D5HA 5A9RA 2VDOB 4X84A 1G3UA 1GSOA 3AV0B 3EFOB 4WEQA 1VHLA 3KCNA 1KDPA 5FTNA 2QAGB 4MYUA 1NBOA 5SZKB 4GLLA 1FJXA 2YBDA 1EUCB 3C7AA 3CEPB 4RF2A 4W7IA 1DIRA 5L4SA 2QM8A 5T3YA 2CSUA 2IXFA 4LMPA 1PL6A 3L84A 4U5QA 3L8ZA 4RTQA 2I7VA 3BA6A 1AQUA 3DCYA 4LW8A 3STWA 5JAIA 3MWLA 3F4LA 5ECGC 1PT8A 1VIDA 4XJVA 4D3XA 1XWWA 5A7FA 1H2RS 2RHRA 2ZULA 4KJZA 3R7LA 4DSAA 1EFAA 1P18A 4O0LA 2AQ8A 4ZO9A 5K3CA 4TPKA 2PSEA 4F21A 4WASA 5AESA 1R6DA 4LFAB 4Q9KA 2XWBF 4N47A 1LB1B 2GZAA 2W2PA 5KJ1A 1AS0A 3U6BA 1YRBA 3PXDA 1C8BA 1VCIA 3H4IA 1USKA 4G5OA 5FL7D 1FW6A 2Q3FA 1VMEA 3F6YA 1DE0A 3V1NA 4RTJA 2FX2A 3E2IA 1G63A 1A98A 4X3PA 1B93A 3NZEA 5EJ9A 1GZ5A 1NY6A 2J3JA 3I3SR 3M9WA 2H2IA 4B3TB 2FEOA 3P8ZA 4JNCA 5AT1A 1JDVA 1QAMA 3ND5A 5I7SA 4UUMA 5L9AA 4UU8A 3FUUA 5F23A 2IHBA 3O91A 2IYEA 3HCAA 5EKDA 5C52B 3DTVD 3GCXA 4BB5A 3MJSA 3KJQA 13PKA 4AO7A 1LBEA 3FUVA 2XB8A 3G2KA 4PFJA 4PHGA 1YBFA 3QWIA 4L5JA 4HYTA 4WX2B 1TT7A 3VU1A 4NEGA 3JWPA 3QE3A 3K53A 4UQLA 2O8DB 4AMUA 3R8CA 2HSEA 4BGDA 4YJKA 2NYAA 2ZUFA 4U3JB 3Q8KA 3FJOA 1GAJA 3GT4A 5A3QA 1DIBA 5CXUA 3A4VA 2REQB 5D51S 3NJRA 3JD1A 1USWA 3MRTA 3PTLA 1G19A 3ZQUA 3QJGA 5FPSA 3VMMA 1YRLA 3QFHA 1Q77A 3OCCA 2AXEA 3SDZA 4BO6A 2DERA 4TYPA 4TZ6A 4N5MA 3WQHA 4DJJA 4PQGA 4ZMRA 5A4DA 4EG3A 1SXJB 3EOAI 3NP7A 4MNTA 4DR2B 4UHHA 4UTXA 4WBNA 3U48A 2PKCA 3OQVA 3PFKA 4ME6A 4BP8A 3DWFA 3O93A 2XCTB 2QTBA 4P31A 3IMEA 4DSZA 3E7FA 4HVAA 4XR9A 2XGSA 1NQOA 3HSSA 3QOXA 4Q1AA 4IOJA 4Z7NB 3P20A 4TV9B 1U9IA 5C5DA 3D43A 1F2TA 3QEMB 4WWHA 3VR4D 3UFBA 2V7PA 3DMHA 4IF6A 5DBEX 4AMYA 1S4QA 3I9OA 4Z2AA 1S8FA 3T5CA 3KLPX 2AQHA 1RWPA 5EZYB 4NBSA 1W46A 1FA9A 4MHSA 5HOQA 3B6KA 2REXB 4JYBA 5FA5A 3VR6H 2CUTA 1HTBA 3PQ3A 4UOQA 2IYTA 4MOWA 4UREA 4XDZA 5FTMA 3RUIA 4Q1VA 3TAHA 2A94A 2J08A 5BW8A 2QPLA 3LYUA 5BMOA 5JHGB 1FQWA 3BN3A 4N5NA 3IAM6 5BMVF 2I2BA 1M9NA 2ILTA 1BA3A 1BFDA 1T9BA 2ODPA 2ODQA 4C89A 3UEOA 2WIBA 4GZMA 4PZUA 1BCSB 1JKJA 1ZK2A 2YXNA 3HYLA 1KPIA 3LLSA 2R6ZA 1MAHA 1W1WA 3MAAC 1WMBA 3OFVA 1FXUA 4HYEA 4LV8B 3FTCA 3GRZA 5C31A 3WJ2A 4M8SA 1U9CA 3LUAA 1MBZA 4MWCA 1IQPA 1T6BY 3H11B 4YY3B 2H51A 4IUDS 4NYMQ 3FFWA 3T1OA 2H17A 1U65A 2I29A 3H17A 3NJ8A 3QVUA 3THSA 2QMHA 2DGDA 5DEOA 4UZSA 3WGKA 4JZKA 2EJVA 4PZ9A 4NCIA 5LQAA 1ZEMA 2RG1A 5KU7A 2I6QA 5F3WB 1GL9B 3EIFA 2RGBA 1FY2A 4CKEB 5EJ7A 3AEYA 2WQZA 3LUPA 3H5VA 1SBIA 3I1JA 3TJMA 4YMSA 2V96A 4HYQA 4CIAA 1KY4A 1F8YA 1U2GA 3ZZ0A 5E7IA 1V8PA 3HS3A 1T2EA 3FPEA 2FEPA 4MVCA 4OHMA 3E3LA 1JEQB 4JQCA 5B57C 4QYMA 4UHDA 3N87A 2Q1XA 2HJVA 5HR5A 1XA3A 1JJAA 1NBWB 4DC0A 3B13B 2H8GA 4RHTA 2DCMA 3HCDA 5EVCA 3WMGA 3U5TA 5C46F 1N6LA 5ALQA 2JFZA 2ADOA 2SKEA 4EPTA 4LDNA 3OA2A 1FDRA 3KQTA 1XCMA 2X6QA 3R0VA 1U0BB 1C8LA 3HMKA 3H3FA 1JYSA 1PZFA 5KMGA 3R5SA 5C8XA 2EFJA 3AR6A 5F33A 1Y80A 4U3JA 1TO6A 3ET5A 3GMDA 4GXQA 4IGKA 1MX5A 5DGCA 3LT4A 5EJ2A 2PAAA 2VQSA 4BE9A 5CJPA 2NTNA 3VTKA 3EXIA 1G5PA 3G9ZA 3COVA 4GR9A 1IEQA 3P45A 1EESA 3KLOA 1KEVA 1EM8B 2HWXA 3DJFA 3VH1A 4L74A 1JKJB 4GVLA 1JPNA 1XXLA 1QTQA 1A8IA 3K70C 1HNWB 4HDRB 1G8FA 2CLOB 2ERYA 3QHPA 3OCJA 2I2CA 2O3QA 1FXWA 1AQLA 4H60A 4DQ0A 2BH9A 1IOZA 1P1IA 4RF3A 3I23A 5DBIA 2HXSA 1DQRA 1MG0A 2QLMA 5GONF 1DRVA 5KU1A 3EQ7A 1E3WB 1K98A 4AC9A 4AZ0A 1FYXA 4ZICA 8ADHA 4U9HS 3C16C 4R1PA 1QO0A 3TNLA 4WLUA 4DLSA 1UK7A 1WE2A 1WMEA 2ZWOA 1Z6AA 4QDUA 3TBKA 4JROA 3UPTA 1GHTA 4Z9FA 2XCLA 3PNMA 5F1KA 1D7OA 2ERXA 2HLPA 3LVRE 3UMJA 4XCQA 1MH1A 1G5FA 1MENA 1Z12A 2IA5A 1JR3E 5ECDA 3UMGA 3DYBA 1WV1A 4I6GA 1M8PA 3QELA 4FT4A 5HIMA 2Z6UA 2A0XA 4R1OA 1UZMA 2KBFA 2JGDA 2OUKA 2YMMA 3M9XA 4PRYA 1I4WA 1Z28A 3K09A 2OZVA 4MVJG 2QSZA 3A6GA 4OHUA 1ZRMA 1YS2X 3ZBQA 1CUCA 3N6VA 5IDVA 2B8TA 1XZGA 1ZU5A 3M49A 3PGXA 5EGNA 3KSRA 2D8MA 3RKUA 3FPJA 1NYTA 1NLYA 2B35A 2WAXA 2YICA 3NPAA 2IUUA 1U2GC 1I0IA 4HDMB 4KGZA 1D2EA 1I7DA 3DLHA 2XBMA 3A6LA 1T8UA 1EYZA 3NRJA 4HNHA 2VSYA 2YUTA 4G97A 1KZHA 3ZV6A 1KNQA 4U0KA 3ZWAA 4BXOA 4A0QA 3IURA 4DRZA 2VHYA 3C87A 4JJIA 3RJ5A 1UBFA 4ZEOA 4E5DA 1G18A 4LGYA 4GYKA 5A9SB 4KRGA 5ALOA 1DC8A 1QFZA 2O19A 5JSYA 1JJVA 4N48A 1VL1A 3EBPA 1P1HA 3PC4A 4QU8A 1FP4A 2QZ4A 3A2NA 4L4SA 3NHBA 1Y6GA 3EQ8A 2L17A 4Q1DA 3RSSA 1KC3A 2XA9A 3SQNA 4HOYA 5HKOA 1B7GO 2QYOA 5DBOA 5E6RA 2F9LA 1N1GA 2BFBA 2XMZA 2BHSA 2QIPA 5ED0A 2UUPA 3DWGA 5BW6B 3CN7A 3LZ6A 1R27A 3Q6IA 3VKFA 3W5VA 4HDKB 4UULA 1ENZA 2VHVA 4GEKA 5TE9A 4PLGA 5KWSA 4AKHA 2JW5A 3AINA 2YV5A 3IXLA 1JYEA 4HQ0A 1WBBA 3ZWNA 4TTTS 1RWBA 1NN5A 5B1EA 3DSRA 3IRVA 4AJ9A 2C8VA 4LJLA 4WEOA 2W6IA 1MQ9A 2HHAA 2AEJA 4MUAA 1HMPA 5CUQA 1BMFD 2PX8A 2WF9A 1POXA 1V4NA 2PSDA 4JP3A 4JJKA 4URWR 2E48A 3LRTA 4EYSA 5FH9A 1Z56C 5DM0A 4LRWA 4XSGA 2W90A 5LUAA 4O4IB 1XEAA 3R20A 1HM5A 5AVJA 3WICA 2WYOA 1V5EA 4M83A 1W8IA 3QXSA 1R8JA 4DT1A 4H16A 5TR9A 2HT1A 5C8YB 3NIFB 2X8AA 3O1IC 2JDID 4DZTA 5IBPA 4O5OA 5A9SA 2OCGA 2MDTA 3L4BC 1M67A 2J0EA 1P91A 3L02A 2MT9A 4X97A 1W4LA 3NH6A 3OUUA 4ASUA 3WK4A 1ECJA 5GM1A 4D0GA 2PUWA 3FZGA 2GARA 3U4DA 1PJ4A 2Z6QA 2M98A 4NEQA 2BDUA 1JR3A 4OX9B 2IHTA 1YDWA 2RB4A 3BWYA 3OUTA 1NFFA 4OIFA 4UNQA 5DOVA 5CA1B 2G17A 3PNKA 4U1RA 3WA7A 4ZAFA 3KETA 2X5JO 1G5HA 3C3DA 3V7FA 1OU4A 2EL7A 5AW6A 1E6CA 4LF4B 3ESRA 1PNQA 3IUYA 4M8NE 3GOHA 3U9LA 1AC5A 1SD5A 4MAFA 4OHBA 1JEYA 4HAUA 1YA8A 2M9MA 2R1TA 1OOEA 4TTPA 3HFSA 3HB4X 2FZ4A 2KW5A 1NMQA 5DX8A 3ERCA 3ME5A 5A0VA 3WIOA 5AVRA 5KNDH 3I62A 2YVUA 1NW3A 2QD1A 3GI1A 4Y9RA 3P0IA 3PR2B 5AKXA 4BGUA 4IXTA 2ODEA 3TZKA 3ZXXA 4TMXA 4AQYB 1P1JA 4PXAA 4J4HA 4D74A 2IITA 4MVXA 4PPQA 4HVTA 1CUSA 1K66A 4GXNA 4B3XA 2IEDA 1U1EA 4NG5A 1VJGA 1KFJB 2PCJA 5HRCA 1E1QA 1L7OA 4B74A 3DBRB 1JAZA 1HMYA 2PDAA 1T8TA 1T6ZA 2F64A 2W5UA 1MN6A 2A9KA 4IIBA 4IIHA 5IDQA 1ZICA 3PCRB 4BUZA 4DIOA 2BGNA 4QO8A 2P2LA 3HDJA 3ZE9A 4MQ6A 2JLQA 2C96A 3QF4B 3RTAA 4D7AA 2J5KA 3D02A 4DIBA 5ITVA 2C57A 5IKMA 4B33A 3M5WA 2NMVA 2R7NA 4E94A 1D1QA 3IOCA 2ZBRA 4FYYA 1AMOA 1KAOA 1NQXA 4QWWA 1J5XA 1BA2A 2IHJA 2QN2A 1RLIA 3LC1O 4HDCA 2WJ6A 2VSOA 3BGSA 3BTUA 4CI0B 1ZNXA 2NUAA 2DYKA 9GPBA 3FSGD 4KHPB 1CFJA 2HBYA 1EUDB 4Y9TA 5DFAA 3C14C 3HH8A 1ZL0A 1WVMA 3HKCB 3IUQA 5AW0A 5K0FA 4K5QA 4ZC8A 3NTXA 1E7RA 5JLJA 4DM4A 5L3SB 5G1OA 2P35A 4BE7B 4RM2A 4PBTA 2RHHA 1XKXA 1QYCA 3JRNA 4Q6BA 3O9VA 2I4IA 4PO9A 4RH1A 4L8GA 3O2SB 3OKPA 4MVYA 1OA1A 2AF4C 1T3LA 1X9HA 3I1FA 4YB8A 3OETA 1ONSA 1S6YA 1JG2A 1QHGA 2ZQ5A 4PC6A 5JI2E 4Y1RB 3B5EA 3UBMA 3S2FA 4LYGA 1XVIA 1I1NA 1U7OA 3E5MA 3GD5A 3GROA 4IOMA 4WFKA 1P2FA 2WIDA 3H42B 1UJ5A 4C07A 2FTKE 1GG8A 2I6TA 2MR6A 4YP9A 4E51A 1AE1A 1UBOS 2W0SA 3L0IB 3OURA 4LZNA 4H3HB 4HV4A 3EBLA 3WDSA 4CTJA 1OYOA 3DPIA 2FPPA 5EEHA 4YXWD 2B9VA 1G20A 2PGAA 4NBWA 1C9DB 5DSXA 3CH7A 2NNWB 4DQVA 1D5CA 4WTOA 3TIFA 1PZHA 4GEGA 4AZTA 2A3NA 4HUJA 4Y6GB 1NW6A 3LW8A 4LQ4A 1UBMS 4AZSA 2FG5A 1M0SA 2BFMA 2CHQA 3DP7A 4PHHA 4TWRA 4BMXA 1J90A 1VDZA 1YZKA 5B58C 1KEEB 2Y0EA 1SOUA 5DW3A 3W2IA 3E9RA 2CDNA 1IZ0A 3ISVA 5B37A 4JVSB 4EJSA 3FDFA 3F46A 4Z7OB 1WQ4A 3M8KA 1HE2A 2VK2A 4FFOA 4LNUA 1XEWY 2P91A 3P94A 3GFVA 4I55B 4XYMA 5D2CA 1NSTA 4TL9A 1SIWA 4FEYA 3PUHA 3LYHA 3UAYA 2EIXA 1VXOA 3L4EA 3D3JA 2AOTB 2ISCA 4E5VA 1GQ2A 1J4AA 1JPJA 2QENA 4MRSA 2O8NA 4B85A 5MFZA 1BX1A 5EUCA 4WDRA 4I1SA 3CLRC 5JAHA 1EXWA 2FG7C 3QU5A 4Z2YA 4BAGA 2R86A 4HN9A 2XQFA 3BQ9A 3L79A 5E2BA 2IY9A 2C2KA 2FVXA 2QRGA 2V74B 1X7YA 3HBNA 4LJ5A 3FW1A 4XM0A 3SR3A 3UXMA 4HEA1 2OHIA 1RYDA 3ELYA 3H9GA 2P0YA 3NOVA 1QHIA 1OILA 2EYQA 4GUDA 2V5UA 3UFXA 3M4JA 1PWZA 2I6GA 5LMNB 1TYCA 1I94B 1I7LA 3D81A 1NUPA 5DN6D 3W05A 4EHBA 1B1CA 2Z58A 3Q6MA 1W1IA 3O26A 4QBHA 1SU6A 3H5TA 3IBFA 2CD7A 5CDHA 5KYTA 4JV5B 4IF4A 5DEIA 3GLIE 1QWOA 5KBYA 2Q2QA 3R40A 1LVUA 1XI2A 1MAWA 3D4NA 2N0SA 1V7PC 5K0TA 3GN2A 1UMDA 1KE1A 5JARA 5FUQA 1RWKA 2JHGA 2XCQA 3BE6A 5BV2P 9LDTA 2W98A 1ZYUA 1USVA 4N12A 4TTRA 3ZHVA 4XCXA 1EIWA 1HFWA 1LJLA 4KFCA 1SR8A 4JCOA 1ZGAA 4D0RA 2P0AA 2PT6A 5KYVA 2P3LA 4RKEA 3S1AB 3QE0A 1PW5A 4TTQA 3ZWYA 5E9QA 5JDIA 1CY4A 4RJKA 3ZJTA 1J8DA 4IH4A 5E6RB 4F9TA 1CTQA 1RMTA 2MYNA 3VOAA 3ZNPA 5IARA 4M76B 3NCTA 1ISJA 3IQXA 4N6NA 2YKGA 4JVOA 4DZRA 1WCYA 5I4IA 3G8DA 4HZIA 4P0QB 3SF8A 4Y7CA 4ZQEA 4XVRA 1AQIA 3FCOA 3GPBA 1XRSB 2H4FA 2ZIAA 3D4IA 3CZ4A 4IVPA 3A7DA 1PDVA 2A0FA 4EP1A 2VCEA 4RMJA 1EGMB 4LNHA 2FEKA 2VT6A 2ZI3A 2VA9A 3E1GA 4Q3CA 3ZQ4A 1K7FB 1VG8A 2ZIXA 1MCZA 5BUSA 1SXJD 3EUEA 1AUQA 2M6KA 3AHEA 4CDMA 1V2HE 2GTIA 1CCWA 1N2BA 1NQUA 1OAAA 2QJRA 1JFFA 5AW5A 3SQMA 3ZHXA 5U4XA 4D41A 1N7JA 2O7QA 1ONOA 3IA2A 4DXAA 4V3CA 4MYRA 2HWWA 4Z4GA 4D5GA 5EJ4A 5BVHA 4MSUA 5A5EA 5BQ5A 1WIWA 4HDSB 2OGSA 3JQAD 4HNVA 2VP5A 1KO4A 2NU6B 1EK1A 2HGZA 1EXVA 1FMCA 3DZGA 2V45A 4V0MA 2HRCA 2C00A 2B4KA 3CEHA 2O5EA 4YMUA 3DZJA 1RRCA 1QHHA 1WXFA 1RRKA 3N59A 3NTLA 4MAAA 1C5KA 2W9XA 1A5ZA 1Z4LA 1O0SA 4NBLA 5G4LA 5ITSA 3T7CA 5LC1A 1X19A 2J6BA 3DHWC 3C3AA 2R85A 1L5OA 2JIQA 2W2OA 5JAOA 1B8VA 1UT5A 2OP1A 2H4XA 1PSWA 1GPJA 2ZBEA 3MERA 4KXLA 4L5BA 5KYNA 4W5WA 4PYKA 1YI1A 4K26A 4RC9A 2FWBA 3VI3B 4XEUA 4AZ0B 1Q7GA 1G4AE 1ZW1A 4H7DA 4I9GA 1DO0A 1EI9A 4L4ZA 4C7MA 4WCFB 4ZALA 1SU4A 2AI3A 3QYAA 1NAIA 5EIXA 2UUBB 2C7GA 1K2WA 1N5IA 2B7CA 1LDNA 4M1ZA 3HSYA 5D85A 2Z98A 5EZ5A 4COOA 1XQ6A 2XZDA 3ZY4A 2XTAA 5BRAA 1O5IA 3TQRA 5HE8A 4XJSA 5G2OA 2FRVA 2J0UB 5AXDA 4AY6A 5A7HA 5LZ9A 1GPNA 2OCYC 3BMQA 1W87A 1MTOA 2AEMA 2VZ9A 8GPBA 1T3ZA 5BN5A 2XOKD 4RJLA 4C0JA 5FFMA 5CFMA 3SK0A 4FBLA 3LDUA 4ZC1A 4ZJZA 4TXHA 4RD3A 5JIBA 3HXQA 3DS8A 1C9NA 1SRRA 3HCCA 3QNUA 1JG4A 3FSJX 5IDYA 2XQVA 2BBOA 1XZDA 3FNEA 3KTAA 3NQ41 4O2BF 1OI2A 1KDTA 1YO6A 2Q4OA 3LHDA 3PQDA 4KB5A 1QE0A 3HV0A 3AUSA 3E03A 1TM4E 5DLPA 1LQUA 3FF1A 3F90A 4NV3A 4R6XA 3SSNA 4DLYA 3O8CA 5CFPA 3KZMA 2C5GA 4FFPA 5GJBA 4IDPA 1Z5VA 2GD0A 3K8QA 3ADOA 2RIPA 3NBMA 4FOLA 2Z1NA 2Q7DA 1JWBB 1L5ZA 1NJ2A 1UZLA 1DPGA 1P8AA 2HMUA 2VP0A 3WKBA 3E5HA 4L5YA 4LXQA 2ZDQA 3E6AA 3GUCA 4ENUA 4V03A 3EZ9A 1YTUA 2IUTA 4V0LA 2BFOA 2YWXA 2R6CA 5FWNA 4CCYA 1N2HA 1T10A 4EB3A 1X2EA 4GFDA 1E6MA 4QOEA 5MN4A 7MHTA 1I4DD 2R7AA 2YRWA 3O2NA 2OOKA 4NBVA 4TQAA 1Z25A 5GP1A 1I6KA 5JD4A 3I42A 1RPNA 1E9AA 1RS0A 5A3JA 1XLUA 2VO1A 2PR7A 3KL4A 3LXRA 3WLFA 4A2QA 1MP0A 3AYZB 5DRYA 3WNVA 2WJAA 2OCDA 3S28A 1TUIA 5EZYF 4A36A 3FNIA 3P9XA 5G02A 3HA5A 1FU7A 4C0BA 4IO1A 4NARA 4DR5B 1X1AA 4MUJA 4KACA 1RWWA 3W5DA 3OP1A 4DUZB 7MDHA 5ER9A 4YRAA 4BQFA 5C7LO 2XTMA 4G8JA 4JQYA 3ZGLA 5C1PA 1BYIA 4GOJA 4INPA 4W8HA 5BQPA 3TZ6A 3B1VA 3P9ZA 5DULA 5CVTA 5BSVA 2AZMA 1NX6A 4F1WA 2FPLA 2KPOA 4DY6A 4R2HA 1GGEA 2FSHA 3ABQB 3EQ2A 4G36A 3ZWXA 3F96A 3PP8A 4HHEA 2HI0A 4YONB 4CLXA 3ABZA 4YCJA 4C4RA 3FWZA 4DWWA 5C7OO 5DIZA 2BGUA 3TOVA 1HEUA 1WXIA 2NADA 5D3ZA 3U7GA 4I1PA 3JQGB 4TYQA 3H5AA 3L7IA 1IRXA 1OV6A 3HVIA 1JIJA 1ZOIA 5AVTA 1MHPA 2RDMA 3ETNA 4TS9A 4D9BA 4X6UA 3S5UA 1J0XO 4O63O 4KO3S 4EVRA 4H31A 3U4QB 1TRKA 2QTGA 2A1UB 3MT7A 4CDGA 1O96B 2C2XA 1YMVA 1Z2OX 8ABPA 3DLPX 3D6UA 2G6TA 4BAUA 1E6LA 2O8BB 3FTPA 3PE3A 3H1FA 4QXRA 3UJ7A 2P9EA 1QS0A 3L6UA 1GGHA 1DEHA 1CUJA 3I4LA 5DN6A 1RDFA 3QYJA 1EFLA 1NY5A 4TLAA 1YS7A 2CNNA 1Z26A 3BULA 4KE9A 1K8QA 4XXHA 1FNCA 1NXSA 3C6YA 3OBIA 4XD7D 4DMCA 3A25A 3ZZTA 3SJAA 1LV7A 1E0AA 1SRQA 3D7LA 2NYRA 2J87A 4W82A 1SHLA 5PGMA 3TQQA 4BFLA 4AWAA 3RIMA 5HQJA 2PZLA 3GZNB 1JSRA 2JIZD 3G0BA 1JHAA 4JKYA 4UARA 2F1KA 4B4VA 2HKIA 3PA6A 4UKDA 1ST3A 3VR3D 1JAYA 4FWTA 2WUFA 4C7OA 1EUZA 4NDAA 2PUEA 5JCOA 5LDDC 3PNPA 4MR7B 3OTOB 2UXDB 3KAJA 4U5XA 1GPBA 1PAUA 4UD6A 2FW1A 3E1KA 5DHRA 1DS6A 4CGZA 1GNSA 3CH6A 4EM6A 1YFZA 1FNDA 1VMIA 1EZ4A 4H59A 4B71A 3D6AA 1WB4A 3WZMA 2JJ2A 2WUDA 5FBZA 4A0SA 1A27A 4QC2A 3PUJA 4YAIA 2PO7A 4ZCSA 3H2ZA 5D86A 1FRZA 4R3NA 1GVNB 5FOSA 1F12A 2YQZA 3TLGB 2GHTA 2VTEA 1Y1TA 4CM7A 5IU6A 1W85B 4M8KA 3PE6A 1Q21A 2QLTA 3BIXA 5CT6A 3U26A 4YCBA 3WB2A 3TCKA 1OPRA 1VG0B 4NBKA 5KTOA 3B3AA 3ZCUA 1EDZA 3EDMA 1QVRA 3JYOA 4A2WA 1FYFA 2V7UA 5F64A 1T4MA 4YXWA 3WZ2A 4K9DA 2WDZA 3ZDZB 3G8YA 5ILGA 4L85A 5J43A 2NZJA 3F6BX 1FTWA 5JAUA 1XHLA 4L1KA 4LE1A 1A04A 3R7DA 4B3DA 3E61A 4Y3UA 5C1IA 3ZHRA 3VR2A 2ATIA 4J1SA 5LNK6 2UUCB 4BNXA 2Z8XA 3TNYA 2VNAA 2KQUA 3UVEA 1UCFA 3PK0A 5J2UB 4D9IA 3AQ4A 2O2YA 1AG9A 1B14A 2V0CA 2HDHA 3CR7A 4MKIA 4GC5A 3GJTA 4Y18A 2GPSA 2B3DA 2FN3A 3NXKA 2BMAA 5SY6A 3S0JA 4DDUA 2X4GA 3OHPA 4CMBA 5AVSA 1KH3A 2Y1OA 3U6KA 1V25A 1K9VF 3R23A 4CTMA 2PD6A 3OPMA 3RK0A 4R01A 4Z4CA 4Q7LA 3A1DA 3CNNA 4MJ3A 5JLAA 2EP8A 1OT3A 3M89A 1E4EA 1HNZB 5IWCA 5AK5A 3GL9A 3KKQA 5LOVB 4LBVA 2QMUA 4N54A 2NU8A 1EDEA 2IY7A 5IVIA 3TE7A 3PNQA 1HETA 1NE2A 3U17A 1JHPA 3F7NA 5B7PA 3LUGA 1FFDA 3RYHA 1C1DB 4R0MA 1UDRA 2XB9A 3CPHA 3GT3A 3OFKA 1EMDA 2BKEA 4Z0PA 1PS9A 1MPTA 4QUGA 1CVRA 4TLMB 4DR3B 2OL4A 1AO3A 3ZWQA 1KEEA 5CFOA 2J48A 5J59A 2ZVQX 2GSDA 4PPGA 2OD2A 4ZCLA 2Z2XA 3KSDO 2GYWA 4F2WA 3RJTA 1NIJA 2V6FA 4OQ4A 2ZZKA 5EMHA 5L4NA 1Y7HA 3SFVA 4MDHA 4CCWA 1E2BA 3AF5A 4MWDA 4JI3B 2O5CA 4ZD6A 4IUBS 3DV0A 3DD1A 4A0RA 5TLSA 1P72A 1H8EA 3V8BA 2FQXA 3GJQA 4BWGA 3Q7SA 5EIEA 1HOTA 1MB4A 1R6UA 4KQJA 3M6MD 2BJWA 3U7FB 4UDNA 4R68A 1VRCA 1TUBB 1N2JA 2IYRA 4PN3A 2RK3A 1XEXB 2WLTA 3WSTA 4Q3LA 1YRWA 4GBMA 5KSYA 3DZKA 4WECA 2C2MA 3CH5A 4P3PA 4Q1CA 4JB3A 3FTDA 3QZUA 1N2IA 1CETA 3ESYA 2LPMA 3ZZMA 3KUCA 2F4NA 3SLKA 3LXMA 4ZN6A 1KNXA 3CUKA 3TM5A 2LXNA 2AVDA 3PQCA 2CBZA 4A6DA 3ZW8A 2VNHA 1Z3IX 2PO5A 2POCA 3EGVA 4UUPA 1VYUA 3N7UA 4TSRA 4NFLA 1FVOA 4BFXA 1SFRA 2Q5CA 2MYTA 2JD1A 4HDOB 3ANSA 1XWFA 5F2EA 2B4RO 3E7DA 5LCXA 3UWSA 1EJBA 5AXCA 1G2QA 4ZXPA 1JR3D 1UPAA 1G20E 3RU9A 1FMLA 3OF2A 3QK7A 4R5HA 5GONB 1SVLA 2LP4Y 4KL8S 3SIWA 4LTNA 1B8NA 1I2CA 1WUJS 5ALVA 3WYAA 3EF3A 4OCZA 1NNLA 1YCGA 2Y2VA 1SKBA 3ZWMA 1E7WA 2AOUA 2ZJ7A 4B3FX 3L43A 4R2IA 2BPOA 1OBFO 4PIMA 3TI9A 5TQJA 1QH1A 4Y30A 2HTEA 3JAWB 2X9GA 3L7YA 3B9RA 1W0JA 4RENA 4AKIA 4RVGA 2IGTA 4DLTA 1Z6YA 2D4AA 2HZBA 1UPCA 3PDCA 1KKUA 2JI8A 1PW7A 1FYDA 1F5SA 1MKYA 5HW0A 3DAHA 1ZINA 2HFKA 1JDNA 2FFQA 1KZ4A 3VGPA 1H4VB 3OE1A 3CVJA 3RU3A 5IT5A 4LJSA 3IDAA 2N3ZA 5HZGA 1DBSA 4W9NA 4B79A 3A1UA 2VHEA 1YV9A 1PZMA 3GNTA 1D07A 4IDHA 1XTBA 2MOKA 1LTHR 4PVCA 2CT8A 1VIVA 2G80A 3T54A 4AY5A 4BP3A 2D8AA 1Z82A 3P5BA 4ILEA 4JX9A 1XQ9A 2VZ0A 2A0WA 4U9IS 4E7PA 5F98A 4JUAA 2JLRA 4YCNA 4PPYA 4JOQA 3ZQKA 1GA4A 4JBWA 4JC5A 3L06A 2AI1A 5ISMA 1CR1A 4Z51A 4D1YA 2ISQA 4R1NA 1PCXA 1JIUA 1NLFA 3JARA 3V7YA 1ITZA 4KLZA 2XZLA 1WHSA 2AJBA 4UNPA 4D80A 1Y6RA 3L5KA 3COWA 4DQDA 5JFTA 1CIPA 3FPCA 3ZCVA 5K4GA 2ZE5A 1ODLA 3BX1A 1P5JA 2IWRA 1M34B 1KI4A 2F67A 1K0UA 1U8ZA 2R00C 1W48A 4P7GA 1HO3A 4ALMA 4HRVA 2ORVA 2GBIA 4GLFA 5F4BA 1TVKA 1O5TA 3M1YA 5CVJA 5D3MB 1BH2A 5F7OA 5IDXA 2W2LD 5EJAA 4LVUA 3JAMA 5LYJF 1TI7A 1J9GA 4G86A 1Y3FE 3RIYA 4GX2A 3UT5A 2QRJA 4RY0A 1SURA 1G6HA 4K28A 4P0TA 3F73A 4HEQA 2VC2B 3BPSA 1CQJA 3KG2A 5AKZA 2DKOA 4OAQA 2VAVA 3QX3A 2MIIA 2WRZA 4L95C 4JSTA 4OHKA 3RFFA 1NG9A 4KGVA 1LDGA 2OAP1 2VP9A 3WYBA 3EMDA 4TMYA 2H3EA 4G0UA 3EGXB 3PQ4A 4MPRA 2JLSA 1X94A 1E6UA 1E5VA 3PGLA 2REOA 4GE3A 4JZYA 5JXGA 4TV8B 3JWEA 3P97A 4B09A 3PVZA 1ECLA 2VHTA 3AEUA 2AG5A 3IKJA 4YJFB 1C3LA 4RA9A 2QRZA 1U3WA 4WOJA 3ZUPA 3OE4A 1L5VA 1CU1A 2Q3LA 1J99A 4C6SA 4NV0A 5KQGA 1UBEA 5FPKA 4KMOA 3JQFC 2XGGA 5DX1A 2LW7A 4S1OA 5HKLA 4AJJA 1JX6A 4Q7QA 2VHWA 1Y5NA 1U99A 1LWOA 1Q5PA 1Z6XA 3NYIA 3OE5A 5FPPA 4KR3A 1AKVA 5C18A 1X7GA 3U3JA 4KI7A 4P34A 4PZ0A 1UM8A 4QLOA 4YJGB 5KSPA 4C6HA 1RI2A 3UMCA 1TLLA 4ERNA 4N6GA 2HOQA 2FQQA 1E2PA 5IC4A 5KMGB 1RACA 2FCRA 3EOZA 1RM5A 4HFMA 3RVLA 4GM4A 1AIPA 1RVV1 1T8SA 2EZ9A 4S1NA 4YGYA 1ZM4A 3LWNA 1MOPA 3AF1A 3CUWA 4KPFC 3WQSB 5EPEA 2HL6A 5K9ZA 4RYLA 1SG9A 1XAIA 4NJEB 3OZFA 4R2XA 2BFCB 4HNUA 3NMUF 2OB1A 2MSLA 1IY0A 1ABFA 1FFXA 4YT4A 3W77A 2J9FB 2F9FA 2V5AA 3HLYA 4PV7A 4ZI5A 1USGA 3ANLA 4ZXFA 2BBSA 2BSAA 4FXOA 1OBCA 1M6NA 4GSKA 3BMNB 4FGWA 4IW3B 4LHXA 4NEHB 1P60A 1SXJA 3I6BA 5AFSA 3V6MA 1O94C 1OZ0A 4BOYA 4TZKA 3AHJA 4ZWNA 5IAAA 1UT6A 3JPWA 3G2JA 2GKGA 5KWIA 3BYZA 3HJGA 4IDGA 1GPDG 2GZ3A 2NO6A 3I2JA 1PNRA 1T5IA 2YN4A 4IXDA 5HMMA 4L9WA 2CXXA 2YY6A 4PYJA 2F59A 4IFEA 3MJEA 5DHQA 2O7NA 1ACLA 1NVAA 5B2EA 2I91A 4I7EA 3JZMA 5T67A 3EXG1 4UDOA 3KYDA 4ABYA 4ZI2A 3WB9A 2C97A 4HAOA 5FFNA 4CUJA 5BRJA 5FNZA 3FZYA 3UYKA 2JA1A 5BSHA 2HADA 1L7MA 3VFDA 1XZIA 5DVZA 3S3TA 1BE6A 2XLCA 3T3MB 4RAOA 1JSLA 2J3IA 1GTVA 4I66A 3ICPA 3PWSA 5B64A 4XQEA 4YHHB 3LWDA 2QR3A 3GLUA 1R12A 2B1QA 4G24A 4L07A 1EWVA 1C7EA 1K8RA 1FBNA 3FDJA 3QNWA 4B3JA 1RYYA 5F1YA 3E9EA 4ZDIA 4GPIB 1BQ4A 1NXVA 2Q21A 3O3MB 4KRYA 4RUKA 3UT6A 1LBSA 2RGDA 5TY0A 4F8JA 3HLKA 1Q84A 2OVFA 2RGEA 2V97A 1GL6A 4KN8A 3RGWS 4YMHA 3UMFA 1GAEO 3IHKA 2IH4A 3QMWA 3PLAE 2QX8A 2GK7A 1BHQ1 3HY3A 5C9ZA 5A5VA 4NJMB 1LA2A 2PL1A 2R8XA 5K8UA 3L0SA 4DREA 4D99A 4Z8YA 2GYUA 5C3MA 4FFRA 1KZ1A 4B9AA 1WKVA 1QCDA 2BHTA 1M2OA 2AOWA 4MKHA 1B16A 3B3GA 1Z47A 1KFBB 2CNKA 2G6BA 1BEUB 3AOGA 4GOND 3C43A 1LDBA 4JJ7A 2JI7A 4LBYA 3L7AA 4PCLA 4RZHA 4ZVRA 4YT8A 4H3KB 5BWCA 2QE6A 2DQSA 3QUAA 3P27A 2IUFA 2AYYA 4UMEA 5DMXA 1Z22A 4J6FA 4MQ5A 4W9NC 4N7RA 2F8MA 4XQ0A 2AFHE 2YXPX 3A11A 2ZWIA 3T15A 4R8KA 1RLOA 1W85A 2QU8A 6AT1A 4B0OA 4UFNA 4X1OA 3KWFA 4DDHA 3KPUA 3M3DA 5IKPA 4QGBA 1YJBA 2DUJA 5EKTA 2VYNA 3A6DA 1A2BA 1W0KA 1NQVA 3CSUA 4FYHA 3ZNOA 3A6HA 1G17A 3AO0B 5KJFA 1NUSA 1JTFA 1ZHOA 4F3TA 2E6KA 2PMDA 2QG4A 4MIOA 4KVFA 5HKKA 2AKAB 4BEJA 3I0NA 3OUZA 4CEJB 2IODA 1FRFS 1UWCA 3WNCA 3LLMA 3UJ6A 1EM8A 4HGQA 4OAOA 5G0WA 3PT9A 4NK4A 1Y81A 2M6SA 3GJ6A 1TA9A 4KPUA 2VNKA 3SYNA 1JHYA 2CK3D 2HPHA 3UPDA 5KNBA 2F3QA 3VXKA 2PG3A 5LA6B 1DKRA 5DB4A 1SIUA 1CQZA 2WEKA 4M8IA 4NPHA 4TL7A 2Q28A 1WZCA 2LDBA 3E15A 1EGQA 1T15A 3LOUA 4XASA 3LA6A 3EZFA 2GEVA 4KOEC 3RV4A 5KNDD 4FDUA 2ALJA 4WZ6A 1U81A 3ILHA 5BUZA 1Q0UA 4OI1A 3U31A 4EENA 3QVLA 2G67A 5K8CA 2JLWA 5HJ7A 4FQ8A 4G89A 5A3VA 2Q07A 2P9TA 4LRTB 5FRDA 3EWSA 3K72B 3ZVLA 5J2UA 5GV8A 3FHTA 4X1KA 3OQIA 5ALJA 4PG8A 3TW8A 1CK4A 1EVJA 1V7CA 3P4YA 2PGLA 4F72A 4UM5A 7AT1A 2BF4A 3RT9A 4YRKA 3GLIA 1LPMA 3L5OA 3NC4A 4MW1A 4RD2A 4GG1A 5TPZD 3GRAA 1YKSA 2IHUA 2PHZA 4U7DA 2F6RA 4UHJA 3EZXA 1IWOA 5CDFA 3U3XA 1QP7A 3JATB 4POOA 2GCOB 3CF0A 3KVOA 3B1XA 4L6IA 4WN9B 1PSZA 3RS5A 1P45A 5THXA 1K1EA 2BRUA 5JVDA 1NVWQ 1T2DA 1TYAE 1UMKA 1ZLXA 2DHCA 2IGBA 4XVQA 2OGZA 2OZLA 4YNBA 2TECE 3S2EA 4BNVA 4DSUA 3SSMA 1CLEA 3NHYA 4GAEA 3W8EA 3WMWA 1IJEA 2Y2UA 1IG0A 2O8DA 2HYIC 2WV7A 3KR2A 1V8FA 2WIAA 3L7BA 4ITUA 1SOVA 2NTJA 1LPOA 1L4EA 1NVTA 4G85A 4RKWA 1U4SA 4KP7A 2PRIA 4W99A 4A4DA 3S5JA 2ONCA 3SYRA 1T5OA 4OJMX 4CKWA 4M1MA 2SKDA 4XVUA 4ARZB 1VBFA 3C3WA 3FBTA 1A4XA 3H5RA 1B4DA 4P4LA 5G4KA 2P9FA 5GOTA 3H0KA 3UGKA 4BRWA 4EO4A 4F4HA 3JQ9C 1YGYA 3DEYX 3UTDA 3WGYA 5HWSA 3OCWA 4K9LA 3LX6A 5A06A 3LI2A 4TMZA 4U63A 3DOCA 1SCAA 3FKSD 2NLOA 3E5RA 1M10A 1AK9A 2X5NA 1ZCFA 3LWBA 3AEUB 3D1JA 2YTZA 1YB2A 3TNFA 1FFGA 2E3JA 1WSAA 2DMRA 2H4YA 5LZ7A 1U2QA 3CLUD 5EZYA 2WM9B 3FB4A 2NU9A 4LF9B 3ZDYB 3SPXA 2R25B 5EIOA 4E30A 3G7NA 4MH0R 3S99A 1GU1A 3X1XA 3G2NA 4UEOA 3EWIA 3Q9SA 3D9QX 3M1LA 4KYUA 4Z9XA 5FBKA 1IOVA 5CW1A 4IGEA 4FSXA 3UMBA 1D7AA 2D3WA 3T9DA 4BZQA 1CZOA 2V0GA 3AVWA 4WOCA 2KB0A 2FI1A 3PIDA 3NC1C 1KERA 2AN4A 4V0OA 4ZU3A 5LXTF 1T29A 3M6UA 3SZUA 3VH4A 4GW3A 1E0KA 2J4CA 2QTMA 1WDMA 1ZUNB 1AHIA 3WSWA 3QNMA 4HLCA 1YASA 4MKFA 5FR1A 2AR9A 3SIXA 3WL4A 1M8KA 2A1UA 4HFRA 2WKQA 4NMXB 4EDFA 2FSPA 3K96A 1DWOA 4IVQA 4MYSA 1WLSA 1KO1A 1Q7EA 4QODA 2B4TO 2QXYA 2I03A 3N58A 5H7XA 2XADA 1BDHA 3GEIA 2YASA 7ABPA 3GN1A 3PIRA 4H0CA 1E0JA 2D06A 1VJ0A 4WESA 1JLRA 1CZHA 1V9SA 2MSEB 3UK1A 3A2LA 2VPQA 4J0JA 4C4AA 2L82A 3FDXA 2BCGY 1CJVC 1GNPA 1L7PA 2H0QA 2PBFA 5AW2A 2QQGA 1GL3A 4N5DA 1HT2E 4EG1A 1SUIA 4LDQA 4DMRA 2R79A 2Z5GA 3H4TA 3PC2A 2W37A 5DGTA 4A6XA 4CLOB 1KAMA 4ZT6A 2Q1SA 2J4FA 3OZEA 4JT8A 4EYQA 4MLCA 4HVCA 1SEVA 5CK4A 5EJFA 1L5RA 4W7HA 3QLVA 3OD5A 1TM5E 1YB7A 4HS4A 5DO9A 5KHLB 2BIFA 4CM9D 3NHMA 1A0OA 4FNAA 1E18A 4B2PA 5C7YA 5JH7F 2X41A 3QEOA 3B85A 4QICA 4BQSA 5EQTA 1XF9A 1G9TA 1SK8A 1UKZA 1V5GA 4I1YA 2R1VA 1AKUA 2WK1A 4WOBA 4EB6B 4X1YA 4Z6KA 1KO8A 2RGNA 5CA1F 3TRFA 4FHGA 1J33A 4ZOLF 2QRLA 3ETEA 4KYIB 4D2IA 3WL6A 1MO3A 1ZM7A 4WKGA 1DJNA 1TYEB 2QV0A 3MSCA 3VR5H 3V8NA 1YJAA 5JISA 5IS2A 1NRJB 3GMTA 1A82A 3RK1A 4HZGA 2QZ9A 2HLNA 3H5IA 1V6AA 2FCAA 2GZ2A 2Q5IA 4FIZA 3VJMA 2ID7A 1DRWA 3AKEA 4TYMA 1VSUA 2FAXA 4EA7A 5IJAA 1F6DA 1R4NA 3VNAA 2Z2KA 3SG0A 4PE5B 3UH0A 5A4IS 2B9EA 3DMPA 5B4UA 4JL5A 4M53A 3KYCB 3TXYA 1GKUB 10MHA 4C6TA 3JY6A 2PKQP 4B3CA 4Q82A 2I66A 3DB2A 5ANRB 4DV1B 3ZNQA 3A3KA 4YCCA 2FR1A 3G6WA 3RVRA 3U7QB 2W6JD 5LIPA 1EU1A 3E7XA 5DYIA 4ARBA 1SIOA 3KXLA 2OSVA 2NXJA 4LC9A 2CVZA 2JGDB 1THGA 1W0KD 1S96A 1D6SA 1AKYA 4LF8B 1TLTA 1ISPA 1M72A 2AWNA 3NYQA 4N1AA 4NVRA 4FHCA 3GPLA 3C1OA 3OKFA 4TLBA 3X1DA 1RKUA 3KVYA 4A6PA 5J1TB 2V7TA 4IV0A 2AOXA 2B0CA 1G3QA 2E4YA 3UJDA 1KEKA 1ZK1A 1P80A 4IWXA 1P9OA 3ADPA 3FPHA 4DVGA 1QE3A 1ZRHA 1ESMA 1I2BA 2YUIA 3LT0A 5KYWB 1T4CB 2PBLA 2DF8A 1GARA 2BMJA 2NSLA 5ELMA 1LLUA 1UMDB 1YIDA 3O8QA 2IZ7A 4RNCA 4CFYA 1R18A 5AI8A 4R0VA 4DQKA 3M6WA 2P68A 4NDZA 3HACA 4MGEA 4OKSA 1ZJJA 2ENUA 3N0RA 2I62A 2JIZA 3CB4A 3SFTA 4C5AA 3EPKA 4Q4HA 2E1RA 1R4ZA 2NZ2A 5IAEA 3T5AA 2R5FA 5AM0A 3KJEA 2D13A 4PSKA 5IAJA 1HQCA 3A4YA 1Q0HA 3QFRA 4MULA 3R7NA 3W1WA 1YL6A 5L40A 4KJXA 2BEVA 2D2FA 2FJ0A 1CE8B 3JASA 4BY9E 1PR6A 2D3TA 3TTTA 3BVPA 2JFBA 1PG0A 3D7SA 4GMDA 3HKEB 1O6FA 2FEAA 3R3SA 1T5BA 4PGMA 5E3IA 1XCJA 4GGOA 1FSPA 2A30A 3RYIA 4YJHB 1NWCA 2BN4A 2EZ8A 3L01A 3T3PB 1SVKA 2NGRA 3MM4A 2DFNA 2Q2WA 3T6KA 4BGIA 4EZEA 4UM9B 4C7BA 2PZFA 4KDCA 3GRFA 3PQEA 4FCWA 4RHUA 1A5SB 2FW7A 3INRA 3OJCA 1NZDA 3W79A 4N41A 3UOWA 2ZRCA 3CG4A 4F6LA 4U4AA 4C3UA 2H5JA 1UZAA 3LKDA 2YXBA 3HUTA 1R74A 5I7EA 5CYFA 5DXJA 5GMOA 4OOFA 4ZJUA 2E0IA 3GAAA 1TVEA 3MLEA 4NMHA 2C5BA 1KJWA 1C4OA 1I8TA 4Z99A 1Y9AA 5CB0A 4OLAA 2C2ZA 4AKEA 4C0XA 2JIDA 5HK9A 1Q20A 4MW0A 3LC2O 3QTTA 4OB8A 4F97A 3GJ8A 1II0A 4B81A 4KVAA 1CQIB 1ZD3A 3VMFA 4EG4A 1L7BA 3DNFA 5CEEA 5B2ZA 3TLBA 3HFGA 3JQ8B 1OJLA 2MR5A 1EWKA 4K8OA 4QYSA 5B3JA 4W9MC 1C3OA 1G6OA 3UJAA 4P4GA 5BT8A 4LYEA 3TD2A 4WLFA 5CBPB 1NDHA 1QIFA 3ESAA 4ES6A 1AVTA 4AJLA 4QLBA 1XKQA 1GZVA 1YRQA 1Z39A 2Y92A 4FYKA 3C5VA 1Y9ZA 4CM8A 4ZQGA 4KXYA 5CB4B 3AL0C 1DKUA 3OOYA 1O54A 1A1SA 3RC7A 4TVOA 4A8JA 1GPH1 1JYFA 2ETXA 2WWTA 4RVNA 4DPKA 1PJTA 2JAWA 3EISA 1PQWA 4KDRA 2XNJA 4NWIA 5D7NA 4DJEC 2VBGA 5C1DA 4H7IA 3FA2A 2MSKA 5CA0A 1D2HA 2YW2A 2ZSUA 1NKVA 3JVDA 3OVMA 4W8GA 4DNQA 4OXQA 5DBGA 1P7VA 1WD7A 2XQIA 3W8RA 5AO9A 3GWGA 4LSWA 1XRLA 4GYWA 4CN9A 1WL8A 1C1XB 1AZSC 1NNSA 1J2TA 2OE2A 2Q3EA 3CZQA 3OLZA 4XIGS 4D6XA 3G6KA 4EJ0A 4F7DA 2IW1A 5LQCA 3M81A 3ACDA 3LCJA 3RC1A 4GX1A 1CR4A 4EUSA 1OC2A 2ODNA 1ZMBA 5CDFE 3ZY6A 4BUJA 1WY5A 1JWAB 2ZTVA 4FFNA 4OVKA 3JZAA 4YWJA 1AQJA 3BS4A 3FPAA 4PG6A 5BXYA 1EFTA 2YXLA 4AUKA 3R09A 2WW8A 4URXR 5DNCA 2DC1A 2KM1A 2FMTA 4Q4HB 2P27A 3FLAA 3EARA 1SWVA 3FMOB 3VM6A 2GK3A 4IX9A 2L69A 4QEZA 4D4GA 3W5BA 3FNFA 1JMYA 1IQ0A 5D87A 4CIBA 1OH8A 5F21A 2JJ1D 1RIFA 5JPIA 2GXAA 4OUKX 1E2LA 1RLTA 2G0AA 4M8LA 3HGTA 2BP7B 1XZHA 2IXAA 3CO5A 4J49A 2PL3A 4QGHA 5HEKA 3WBJA 1SKQA 2Z95A 3I58A 4TMKA 5L45A 5E2IA 3KV3O 3NNNA 1QFYA 5CH5A 1GZ7A 3K92A 1ES9A 4JJGA 1RWNA 2C2HA 1YHNA 2GPBA 2W2MA 4U2BA 1DBRA 3ODGA 5K0BA 5KPDA 3H97A 1T6NA 2HXGA 2A57A 4B8ZA 1DVRA 3RUAA 2VPPA 5KNCD 2QL7A 4QTTB 1AH2A 1FLDA 1Z29A 2W2LA 2YDYA 4FVTA 5F1PA 3BF8A 2RGGA 4E09A 2Q8NA 2PUBA 2B1JA 3M3PA 5SV2A 5EZSA 4BTVA 4MA4A 1H2WA 1FUKA 4GI3A 4AW9A 4K6MA 3D6TB 3ONVA 3WOHA 1TCCA 5ALZA 1WCIA 5CDYA 4FI3F 4FGLA 1N9KA 3UANA 1LPNA 2P3OA 4Y7DA 2CFOA 3VVCA 3NEPX 1G2IA 2NUPA 3JQAA 4Z7QB 1NOJA 4N40A 4ZYTA 4NZMA 4DCPA 1U31A 2OV8A 1C3VA 4IXMA 3N2GB 4QLAA 3FR8A 4KE7A 1EFPB 3RANA 2F43A 5H81A 1EPUA 3ZY3A 4ZVKA 1VL2A 1NXOA 4F3NA 2VNSA 1JJBA 1NNEA 1WHSB 4N7JA 1B23P 1SQ6A 3DL7A 3S44A 5E0KB 3UJ9A 1BWRA 4YQZA 1K0FA 1JVSA 2RK6A 2ZRNA 1ZCAA 3ZCXA 1IH8A 3DDOA 1NJ6A 1GDTA 5ARDA 1AN9A 2LV8A 4U2EA 2ATCA 1K27A 3QYPA 2BFCA 1NWHA 1QIDA 5E1OA 1GUDA 4N0PA 4EI8A 3DCNA 3K2EA 3UXYA 1VOTA 2CFIA 3UXEA 1NMYA 1ZRNA 2Y6UA 3NASA 1WG8A 2NZWA 3IH5A 3QXGA 2JGRA 2EHJA 2P9ZA 3V55A 5I8WA 3U56A 3UB3A 2NPOA 3RUFA 4CT4B 1GFZA 2H2HA 2EJUA 1JDPA 3ASVA 2YMPA 1FRQA 3NHWA 1MLDA 1VTKA 3OICA 1GO2A 2EJWA 2HEGA 4BVAA 4Q16A 2CB9A 3QKIA 2HO5A 4RZXA 1SUSA 2WWRA 3PQ8A 1JHRA 4B3MB 3OM1A 2DG2A 2J0UA 3CZMA 1JKXA 2ZLBA 3GPCA 1XQWA 4RGQA 1LV8A 1M5TA 1TLFA 1GNVA 2VEOA 4QJ4A 3TQFA 4BJ5A 4QYXA 4EFNA 5KNBD 1HG0A 1KP9A 2FNAA 3KPJA 2GBFA 3ESBA 4JUBA 4XQ9A 4PGGA 4Q3OA 4CMHA 5AJWA 3T7DA 3RC3A 4LRQA 2GLUA 2Y1GA 4YJDA 4F3KA 3GLGB 4BBAA 2ZG6A 3B20A 1GTZA 3WFZA 3UHJA 5M29A 1V3TA 4ER5A 2TMDA 1IN5A 4UU1A 3D6HA 1GPUA 2UYOA 1N32B 4WKBA 2IS2A 1NMXA 1TIPA 5DISB 1GFSA 2CMDA 3G68A 3IQZA 4QM7A 4FW9A 4E32A 1RXEA 1X80B 4F9FA 3ZCSA 3FPFA 4REQA 3PUIA 1T25A 1ZUWA 1NAHA 3V33A 4YT2A 3RJMA 1WO8A 3ZD6A 5BSFA 2W6QA 4BLUA 2EKBA 4HSGA 4XARA 4NFHA 4LUCA 4ZQBA 1JXOA 1TF7A 2FVYA 3TTUA 3NHFA 1LKZA 1PN3A 3TJZA 1UJMA 3V1LA 3HYRA 5CFRA 1DARA 4YO7A 1RBYA 2ZPTX 2JIRA 2IDJA 3GBVA 1KMQA 1AZTA 1HV8A 5P8WA 4A1FA 5B4VA 5DBFA 1E20A 2PUVA 3UK6A 4PZEA 4EI9A 4OXRA 1PWEA 1VKZA 2HPZA 4M49A 4YJ3B 2EV9A 1BO6A 2RHGB 3HKDB 1C8KA 2IVZA 1JSCA 4UDYX 3USCS 1CZNA 4A10A 4A5SA 1VDMA 4U7TB 4Y6PA 1IONA 5AR1A 2OBFA 1G16A 4HQNA 1YUMA 3FUTA 4TLDA 3CJQA 4RA9B 3OAAD 4YQFA 2R87A 4MYTA 4ZT2A 4FEGA 1BJRE 2ZJ5A 5CURA 4OU5A 4UNIA 2HU5A 3COJA 2G1KA 1QV7A 5M04A 4MMYB 3EVFA 3DFFA 4F85A 1MRZA 1DFHA 5J9FA 3DFUA 5EP3A 1J8YF 2YDXA 2ZSIA 5AJXA 4Y1FA 3I8XA 1MB3A 1KU0A 1TGYA 3ZBTA 4W5JA 2R6R1 4MZDA 2ZYAA 2FPGA 4RMNA 4QUIA 2G5GX 1FMTA 1NL3A 1YQ9A 3VR6D 1EZZA 2ZB2A 3MWDA 4G6ZA 1B76A 1Z0SA 1D1PA 1T2UA 1XJCA 2V6BA 5IH7A 3KKZA 2EP7A 1DJLA 4UTRA 5WRFA 1ZL2A 3REGA 1R3DA 5J3JA 1G20B 2IYNA 2WT8A 4XH9B 3BCSA 5KYYA 2R97A 3F5QA 1Q6YA 1PL8A 3E3NA 4PQRA 3ZE1B 4HLNA 3G17A 3BWXA 1UOOA 3WYCA 3IUBA 8ATCA 3VYVA 3G9TA 3VYUB 3IL2A 2GVNA 3C8DA 3K05A 3F74A 5AYVA 2ZWMA 4AJHA 4BX9A 1KVUA 4B3BA 4GLBA 4ARAA 1QH1B 3MWYW 4JGGA 5FWYA 1X7ZB 2HA5A 2UYQA 1VRWA 3MEQA 2XUPA 3C7DB 1KKLA 3LKZA 5AXAA 4C6RA 3CB2A 2VH2A 4I50F 5DRTA 4YUVA 1WPQA 2HIMA 1EUYA 5JEDA 1ABEA 4K6GA 3F5FA 3IDZA 2GEKA 1YFLA 2BKXA 4TMFA 1Y5RA 2Q4TA 5KOHA 2EKQA 5ELXA 1QLHA 2W2KA 1RQPA 4W5OA 4JH0A 2XTZA 4FR2A 3E8SA 3AKCA 4RZSA 4ZRDA 1QB7A 2BR3A 1N6OA 1SHJA 4GM1A 5A0FA 3DBLB 1C7QA 4L6CA 4QWMA 1GJRA 5HM6A 1N57A 2PKQO 2R1UA 1E6EA 1T24A 5KYWA 2CFCA 2XF2A 3QLUC 2B4QA 1WB5A 3LECA 4BPRA 7GPBA 2F90A 2JI6A 2RB5A 4J2TA 3T7KA 2GD6A 1SUWA 2R6GA 1ECBA 4LYDA 4MR9B 3QI7A 1Y7IA 1IJFA 1Z7WA 3TN7A 5JMTA 4AG6A 1A4RA 1K6MA 4NS1A 4TMVA 1L7VC 2VQ3A 4J0HA 1ZNZA 4XZ3A 1GGJA 3MBKA 4DYHA 2IYSA 5B3AA 4XCVA 3B6ZA 4S3MA 1I7SB 1VG1A 2BE7A 2XWQA 2IH2A 2PX0A 3ZLJA 1QVZA 1U2DA 2LVBA 1N6IA 2VAWA 1K88A 4NOKA 4WA7A 2JS7A 1CXZA 2QY9A 4CNQA 1XVTA 3RRFA 2HCTA 2RONA 4Z4QA 3AEKA 5I45A 2A33A 3WQRA 4AAYA 3L7CA 1FU8A 5KOJB 1FE8A 3N2KA 3HKDA 3KKPA 3RRMA 4DCSA 5GGXA 3GLHE 7YASA 1TA0A 2P0EA 5AKGA 3SEZA 4UCFA 3GJ3A 1KJJA 1U7ZA 2EFYA 2OC4A 2WUEA 3BA1A 4Q1FA 2E5WA 1ZGZA 4MXDA 3ZHCA 1Q74A 3CX4A 4AMBA 2Q5EA 3L92A 2PPVA 3K09C 1PO7A 2P9BA 3EZ2A 5AM1A 2V65A 4XQCA 2IQ5A 1UJNA 1KI8A 4R3WA 3DL4A 1QIMA 1VGVA 1QWSA 3EE6A 1KMMA 3PPYA 5GOZA 5JSUA 1LLQA 4Q7JB 2C95A 1DQZA 3OG9A 3M82A 4QA9A 4EITA 5SZJA 3FYHA 4JOSA 4KN9S 1W2GA 2Y1CA 2I55A 1FPQA 3N5CA 3R6GA 4RFSB 5FNVB 4AO8A 1TYZA 2F2TA 5BURA 4KI0A 2JLBA 2WIFA 3QPUA 3HBFA 4M21A 4CPDA 5AM5A 4C43A 3TPCA 4PBRA 2F1IA 1R6TA 4RDXA 2FR8C 3RC2A 2BWJA 1ZOPA 2CVHA 3NIBA 4BB9A 3GVCA 1PGOA 1TMYA 1ZVQA 1GKLA 2YWJA 4TLEA 3AUJB 3BILA 4MLDA 4NCHA 3ZW9A 1SCKA 2D5IA 2IE8A 3MCWA 5H4GA 1L7QA 1TZBA 2WD8A 1VSQA 2DPMA 2YJ3A 3NAQA 2H92A 1CS4C 1UJ2A 2ZSBA 1BVHA 4C29A 2B99A 3CV3A 4JYCA 2VDLB 3QVSA 1D5WA 4ARSA 2WY2D 4QXPA 4TROA 5BYAA 3PXEA 1JU4A 1SXJC 1VSTA 1ZNWA 4EATA 1G7TA 2ZYWX 1UINA 3SYLA 1U7TA 1VP3A 3RRJA 3OEED 4RTRA 3OJLA 1K9SA 2E4XA 4GYYA 4Y2RA 2Z5LA 1AX9A 3ML1A 1K97A 3TLZA 4J07A 5BSMA 4EYGA 2QDKA 3O8BA 3IOEA 4BX8A 3TLJA 3H7IA 1ZM2A 2QUAA 1SC4A 3HTXA 2GLTA 4B34A 5C35A 1M2KA 4QVKA 1M83A 1RCFA 1FX0B 4BX3A 3P26A 1X77A 3E18A 4OSEA 3KFVA 2ZREA 4Q4LA 3Q6NA 5E0OA 1E9CA 1TYBE 2Z1MA 3JSXA 4R8LA 3CGGA 3W3ZB 4JJ8A 4YP5A 4AS2A 4C7KA 2CZQA 4MYDA 5DNYB 2IS1A 2EEPA 3WX0A 1HA3A 1YA4A 3G2OA 4HJRA 3SJUA 3FKJA 4MTLA 4MDEA 2J3DA 1WSDA 4ZVMA 3FZQA 4LG1A 1IHPA 2J09A 3U0VA 4LC1A 3BJEA 1C0EA 3PEFA 2O0KA 1QC5A 3IGFA 1HRKA 1IBLB 1U3TA 1MNQA 2VSFA 3F4BA 4C87A 5JD3A 4YQYA 1TL7C 2AXNA 4KNYA 4ZRNA 2CE7A 1GV0A 3O8NA 3QVGB 3V4LA 1DFGA 1OB2A 3ZVNA 4AJ1A 2Q50A 3T12A 4S04A 2Z9DA 4IDEA 1IN4A 1UK9A 2GXQA 3CW2A 4PIPA 4HAZA 5E38A 5K0SA 5GM2A 4FYMA 3LZDA 1CUZA 1G2OA 1W2HA 3DVAB 1IAVA 2AZXA 5IJ0A 4GBJA 5H82A 2ZE8A 4GSLA 4LNUB 2IFTA 4BLVA 3IO3A 2QW1A 2WYUA 3KB8A 4JEMA 5JVDF 3WP0A 3PE4A 3QV1A 5H02A 3RRZA 1FIUA 1SCUA 3GDFA 1Q0LA 2OCBA 3QENA 1GL7A 1NPYA 2FOXA 3A4MA 4GO1A 3V4RA 4WJZA 2A78A 1HY3A 1PX2A 4ZRMA 3X1YA 1YR8A 4PR0A 5FTWA 2VBCA 1LBQA 3QITA 4JLPA 4U2GA 4PYQA 2YNMD 5FUXA 4ZMSA 4GL4A 2NZVG 3JQ7A 4I4TA 1EB9A 4X1IA 2YMLA 2C20A 3DMRA 1RRPA 3OI7A 2DHDA 2Q27A 2A6PA 2VZLA 1JEAA 5HFAA 5CA0F 2IXEA 5JBIA 3BT7A 3VPGA 1B6GA 1SBZA 1W4BA 1P5HA 3SJZA 5E1MA 1H8ED 2ID4A 1ZG3A 2WTAA 2W22A 1WSBA 4QUEA 4WGFA 2JC3A 2W2KB 4DDKA 1LLFA 4UFPA 3PJRA 3I1YA 1D6NA 4XYBA 5IKOA 2R1ZA 3MVEA 1M0EA 3OIVA 4K0KB 1EA5A 4AKGA 3D7NA 1PYOA 2QZZA 1ZPDA 3KZNA 3PUKA 3PKJA 4ZQCB 2Q3BA 3T3EA 4YRMA 2DT5A 4JFRA 4BN5A 5F2KA 4QASA 3ORYA 4CE6A 1U80A 2CNWA 3BIWA 1EXDA 4BBJA 1I9GA 3NOQA 3W5UA 2NAPA 1Z75A 4I4TF 2AFHB 1Z0AA 5EHZA 3TZHA 1VMKA 5HIAA 1PT7A 1N6PA 1SXIA 1C3JA 2A9RA 2XXJA 4KCGA 4MRAA 4QJ5A 4BKUA 5E1DA 4L9RA 1MGOA 2F48A 1UBJS 4JLWA 4ZODA 5JO9A 4COKA 1U8CB 5JECA 1B42A 4N4AA 4AWXA 2CXTA 3TX2A 3UJPA 4RQUA 5B5SA 4GNRA 1SJ9A 2QX7A 4KFTA 3RVBA 1KSGA 1F7VA 2ACEA 1GTJ1 2ANCA 4DEVA 3MWEB 1PYGA 3E05A 1FFCA 2E89A 4CM1A 2XCSB 3G2HA 4EMUA 4Q5IA 5EIAA 2YBEA 4BNZA 1VHTA 1KR2A 1N5KA 3BRWA 3PUWA 4YYEA 3K6SA 2ZB4A 1C0IA 1U1CA 3DBHA 3KAKA 2HRDA 3P71T 1XBTA 4M1WA 4N49A 2SHKA 5FWAA 5K03A 1OXMA 2CLKB 1MV8A 2H65A 2RFLA 1AQNA 5BV0A 1ISMA 2AEEA 1JB1A 1B73A 4ARIA 4PFSA 1DSSG 2A92A 4RVFA 3KQVA 1HYEA 3LDAA 1XZFA 4RHCA 5HKBA 3MWKA 4ZT3A 2HK9A 4IUYA 5BYBA 4WSOA 1JBQA 3TYXA 4UVHA 3FCCA 4R83A 2O8EA 2O4CA 1P0FA 1V41E 1KL7A 1ORTA 4I3HA 1JIVA 1P5ZB 2WKPA 2XJ9A 3TO5A 2ZVDA 3WLJA 2C3YA 2C7QA 3FI0A 2QN1A 3EGIA 4Q15A 4DLWA 3TF5A 4M1OA 2RGWA 2QTWB 4LY3A 1GSAA 5I9IA 1NR5A 3M2TA 4X00A 2I5PO 3SR4A 1RJ9B 3CKKA 1IC6A 2JKZA 2MTBA 1UKVY 3L1KA 3LBNA 3WA6A 1ODTC 3A1WA 4TRNA 2F4VB 4KAXA 2X6RA 1ECPA 3B12A 3D3QA 1PJCA 3EG9A 3OE7D 4CKXA 4CRWB 4PTLA 1GUBA 1RKVA 4BVLA 4F3CA 3F8SA 5KQSA 3CZCA 4HBGA 2XUKA 1IZ7A 2ET6A 1KYWA 1VE6A 3ITNA 4M89A 4HGPA 2RK4A 1NMSA 4ZU6X 4DA9A 5KYXA 2F8TA 3I30X 3FPSA 3HFRA 2P41A 1VLZA 2AQIA 2JD0A 2FWJA 3IMCA 2QM7A 5LU8A 2ZEJA 3DOHA 4NMMA 1EVZA 1KGDA 3HVRA 3K4PA 1T9CA 2Q4EA 5CXXA 3DQPA 3LQYA 421PA 1BW9A 1Y0BA 5CA0B 5K6RA 1A8UA 3KAQA 5CLGA 5AMXA 4DDMA 1DLIA 3GBPA 2VDMB 4MGZR 4RGBA 3ZE2B 2WVAA 4YQEA 1JQBA 4I1RA 2B2NA 4LWQA 4H2DA 2PZEA 1PT9A 2FSUA 3PFNA 4PVDA 5FOVA 4YRJA 2Z8YA 4V0KA 2NVOA 3RVMA 3U39A 3KFXA 5K8VA 4J9UE 2G5CA 1UOEA 1HDZA 2NXNA 2IXTA 3F6RA 3E53A 1KVSA 3HCRA 1SBQA 5IC5A 3KQWA 3T4XA 5JATA 5L3QB 1TF2A 5TNXA 3GLFB 1OH6A 5DM1A 3Q8WA 4RO0A 5JCPA 4DMUB 2PLNA 3NV9A 2C98A 4DF3A 2DCUA 2Q0XA 3CX3A 3QUTA 5TQ0B 5KUTA 4RPGA 1QK5A 4RVHA 5I47A 2CHUA 2AJCA 4NH0A 3SYTA 2B20A 5DI3A 2ZI9A 4B6SA 4IDOA 1XUOA 3GEMA 2P4HX 2QUIA 4OGLA 2V4UA 5FYDA 4BMCA 3TLGA 5JAZA 2Z5VA 1WVIA 1OX5A 4XWOA 5EJ6A 5I3CA 3THYB 2C88A 1BH6A 3D7RA 2BFAA 3QUSA 2FPGB 1NVFA 4IJKA 3EUFA 4TZTA 3W6NA 2WNHA 3R6DA 3EPPA 1QH8B 4EDHA 4F5EA 5ITZA 3GXBA 4FONA 1RPAA 1J07A 1G1AA 4ND8B 1U1FA 4YA6A 5EA2A 1YC2A 5LP6B 4IWYA 1UOPA 1F1BA 1YNOA 3V34A 1C30B 2RAFA 4FFVA 3ZDDA 1DJPA 4I5IA 3I52A 4C0LA 6CHYA 1T1JA 3H99A 3IP9A 4H08A 2DM6A 1KI9A 3FNHA 2XUAA 2PMWB 1Q12A 2HO4A 3R3YA 2IEGA 4ZOLA 2PAFA 1M1XB 2HCBA 4Y9DA 5T57A 4QGFA 4D46A 4HSEA 3WLRA 4YK7A 5F5NA 1JDZA 5DTEA 1H2AS 1VFPA 4FSDA 4MW2A 3NDIA 2HA0A 5EQJB 4D8WA 2D6FA 1S9DA 2ZZNA 1BXZA 4UFOA 1EK2A 3P2MA 3HKEA 4TXMA 2P7HA 3H1EA 3W5HA 1ZO8A 3AEXA 1YJXA 1JG1A 2V1XA 2X1HA 5K5EA 4ZEWA 1OR8A 1B41A 2V9ZA 3A4NA 3RUPA 1WA5A 5T5QA 3PKZA 2ZBUA 1NLZA 1N8KA 4WW0A 4OGFA 4CTOA 4EIWA 1T2VA 4UNSA 4G5HA 5CLLA 4ER0A