1JIVA

T4 phage bgt in complex with mg2+ : form ii
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
351
structure length
351
Chain Sequence
b'MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BETA-GLUCOSYLTRANSFERASE
molecule tags Transferase
source organism Enterobacteria phage t4
publication title High resolution crystal structures of T4 phage beta-glucosyltransferase: induced fit and effect of substrate and metal binding.
pubmed doi rcsb
total genus 127
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1jivA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1jivA02
3C4QA 4AMBA 3MQFA 2GT1A 4GPBA 1JIVA 2QN3A 2XGMA 1EXVA 1FTWA 3EBOA 3IA7A 1FTQA 2QLNA 1XKXA 1NVKA 4N3BA 2FETA 2GEJA 2R60A 4M60A 2IEGA 3MTDA 1GPAA 2ACVA 2XGSA 2FF5A 3MS2A 1RRVA 3NPAA 3T3GA 1XL1A 3OTGA 3S29A 4F96A 1PNVA 4YI5A 3OY2A 3S28A 3T3DA 4G2TA 4RENA 4YUAA 1M5RA 3MT8A 1GZ5A 2VCEA 1L5QA 3G2NA 2JZCA 1HLFA 4CTOA 1P4HA 2GPNA 1QM5A 2G9RA 2ECPA 2QN1A 3D0QA 4FZRA 5DLDA 1O6CA 1NOIA 4XI9A 3MS4A 4X6LA 4RBNA 1GGNA 1YA6A 1JIUA 1UZUA 1SXPA 1WW3A 3MTBA 4N3AA 1A8IA 2PYDA 2F3SA 5D00A 3CUYA 3WAGA 2PRJA 2R68A 3L7DA 3QHPA 4WADA 3S0JA 2GM9A 3CEJA 3O3CA 4YI3A 1P2GA 1L5SA 2VSNA 3D0RA 3MRVA 2F3QA 4GZ3A 2R4TA 3TOVA 1Z6QA 3OKPA 3C4VA 1P4JA 2QN8A 4F9FA 3L7CA 3NP7A 1P4GA 3MTAA 3G2IA 1Z6PA 3EBPA 3H4TA 3QKWA 2BGUA 9GPBA 1IXYA 4GZ5A 2PRIA 1NZDA 3RSCA 5D01A 2BFWA 3COPA 2ACWA 3SYRA 1RZUA 2GPAA 3L79A 1GG8A 2BISA 2QRHA 2XCUA 2IYAA 3SYMA 4X7MA 1VGVA 3L01A 1L5VA 2HY7A 1XOIA 1XL0A 4KQ1A 3DDSA 1JG7A 2ATIA 4QLBA 4CTMA 1Y6FA 5C1DA 2PYIA 5TVGA 2YJNA 3CEHA 4AN4A 3BEOA 4XIFA 2JLBA 1WUTA 3UYLA 7GPBA 3VDMA 3PE4A 3G2LA 3GPBA 1E1YA 4MHSA 3DD1A 2XA9A 3UYKA 1C50A 2C1ZA 2QNBA 2H1FA 6GPBA 1Y8ZA 2IYFA 3TSAA 2X0FA 3S27A 1PN3A 4AMGA 3E3LA 4MICA 3L7AA 1FU4A 3H4IA 2XGOA 2IEIA 1P29A 1Z8DA 4MHOA 3ZCQA 3DDWA 3TAXA 4RIGA 4EL5A 2XA2A 3CX4A 3CUUA 4RIFA 2AV6A 1NLMA 3BCSA 2X0DA 4GZ6A 4X7RA 1JEJA 5BNWA 2XMPA 3D1JA 1F6DA 4PQGA 1FS4A 2R4UA 2SKCA 5I45A 2FFRA 5TMBA 4WHMA 3HBJA 1XC7A 4HLNA 4EJ2A 4REMA 1KTIA 3MBOA 3MT7A 2OFFA 1IIRA 1YGPA 5DU2A 1ABBA 3RSZA 4MRAA 1C8LA 1JG6A 2AW3A 2AMVA 4Z5XA 3NCHA 3BDAA 4EL0A 2QRPA 4LDPA 3CUVA 3MSCA 2XCIA 1AHPA 4CDRA 2F3PA 3MRTA 4RELA 3ZCVA 1FA9A 2WTXA 3WC4A 1H5UA 4RIIA 3FROA 4LEIA 3ZCUA 4RIEA 2Q6VA 2IW1A 3G2JA 3VDNB 2QZSA 4FKZA 2ASVA 1C8KA 2H1HA 4EKEA 2F3UA 1L5WA 1Y6GA 2G9QA 1L6IA 2G9UA 3OTIA 3Q3IA 2QLMA 3NC4A 4MI9A 1GPYA 3T7DA 3G2HA 4F97A 3BD6A 3IAAA 2VCHA 2SKEA 2X6RA 1PYGA 2QLLA 1AXRA 2O6LA 1L7XA 1LWOA 3MRXA 4L22A 2X6QA 3PE3A 1FTYA 1GFZA 3ZCSA 3RHZA 1JIXA 1K08A 3BCUA 2ZB2A 2C9ZA 4KQMA 1RZVA 3G2KA 2QRGA 2P6PA 3E3OA 2G9VA 3AMVA 2SKDA 4X7PA 5HXAA 5IKPA 2IV3A 2R66A 8GPBA 1NOJA 1GPBA 4NESA 2X0EA 4BQEA 1UQTA 3GUHA 1V4VA 1B4DA 1WV1A 1Z62A 3BD8A 3T3HA 4N3CA 1UQUA 3E3NA 1BX3A 2QN7A 1SXQA 4KQ2A 2GEKA 3HBFA 3T5TA 1NZFA 3ZCPA 3MS7A 1FC0A 5JTTA 3ZCRA 3HBMA 5DXFA 2VSYA 5LQDA 4RIHA 1E4OA 3CUTA 2C4MA 2VG8A 3CEMA 4AY5A 2QN9A 4GYYA 2QRMA 3L7BA 3CV3A 4HWGA 4M7PA 4BFCA 3OKAA 1FU8A 3NAZA 5GPBA 4WACA 3CUWA 4NEQA 4MI6A 3MT9A 3NB0A 5TMDA 2GJ4A 1EM6A 1P2BA 3OTHA 4M83A 3OT5A 3VUFA 2BGTA 1PSWA 2IUYA 2QN2A 3C48A 1P2DA 3BCRA 3OKCA 4MI3A 3OY7A 3NP9A 2IV7A 1K06A 3S2UA 3RT1A 4N39A 3ZCTA 2GPBA 5IKOA 1F0KA 3WADA 1NOKA 2KS6A 5JTUA 4NC9A 1J39A 3BD7A 1FU7A 4BQFA 4EKYA 4GYWA 2JJMA 3HBNA 1C3JA 1LWNA 2C1XA 2AZDA 3VUEA 1XV5A 2XA1A 4AY6A 3T3IA 4CTNA 1WUYA 5TMEA 3Q3HA 4BQIA 4W6QA 3Q3EA 1WV0A 2PQ6A 5ENZA 3DZCA 1WW2A 1L5RA 3T3EA 2QRQA 2F9FA 4N9WA 1QKJA
chains in the Genus database with same CATH superfamily
1VRCA 4MQMA 1YIAA 3QP9A 1YZNA 1SCQA 3EGDA 3JRXA 2HRCA 3PF8A 4XIJA 4BQNA 1QP4A 4XR9A 1L7MA 4N5HX 1JIVA 3IEKA 4KE8A 2J48A 5CVEA 3NKVA 2ZBUA 2I8LA 4X1KA 5EIAA 1FVFA 4R8VA 5JSYA 3T15A 3AVWA 4HFJA 1AQNA 3GLUA 3TJZA 4YLYA 2D3TA 5JJLA 3AI2A 5SYAA 3ZKAA 4OXRA 2VPYA 4O2BA 1QO0A 2FPPB 1MG5A 2YS6A 1KS9A 4RQUA 4WRRA 5FPYA 4ARZA 1COZA 4YCNA 2J9RA 3K92A 3KHTA 4ERNA 1KQOA 4K46A 2WVJA 4WOPA 4FXPA 2QUHA 5A02A 2FUEA 3Q2OA 3M9XA 2HCTA 1PNVA 3F4KA 4YAEA 3BTSA 5HTOA 5JI2E 2XUPA 1H6AA 1G7SA 3KQQA 3TX2A 5KYYB 1ZICA 5REQB 4L95C 2D5BA 3VVLA 4AJJA 4OBXA 1WY7A 1OWMA 1DEOA 4DT1B 5THQA 3H9UA 2HWXA 1NI5A 2CZQA 4Q4AA 3IMKA 5EJMA 3LPDA 2I4TA 1W46A 1W1IA 2AX4A 4RSHA 3RJ9A 1HR0B 1JX6A 4MRVA 1AMOA 4MYRA 4US1R 3T3OA 3QQPA 4H27A 2GDZA 3WP1B 4Q1BA 4ZDJA 2Q7XA 5I9IA 3TD2A 4CMKA 3G0IA 3IOCA 1MB9A 2DTDA 3EVEA 3F7NA 3FYUA 4KIFA 4YRBA 1CETA 1JHZA 1OKKA 2E18A 3SPXA 5EY5B 5HSGA 4UU8A 3V55A 3H2HA 3H17A 3EPLA 4J2OA 4I9GA 4O25A 3TNJA 3O7WA 3QPUA 4PX5A 2CL7X 1GGNA 2EW2A 2ZUUA 3BMOA 3CYFA 3L04A 3UT6A 5CK4A 3UT5A 4D4JA 4WIAA 1GZ4A 4YO7A 4JLJA 1I6KA 3CM0A 2ZYIA 4CG1A 1E5XA 5U4XA 1C30A 1OILA 1SMKA 1WY5A 1XRLA 1YHNA 2EP5A 3GY0A 5A62A 2VBIA 4EY7A 5IYZB 3NRCA 2OV2A 3TIFA 1CRPA 5EMHA 4J7CA 3KDAA 1XTBA 4IGAA 2QEQA 2YV1A 1ZITA 3E82A 1W1UA 2V4MA 2WB4A 4HLQB 4WDRA 5ILOA 4BQQA 5IU6A 3MJEA 1N9GB 2V45A 1Z4IA 1NY6A 1RQRA 2ZRJA 3AHCA 1X14A 4RTKA 3ETHA 1EFVA 3DXZA 3Q0EA 1JXOA 3EIQA 3I12A 5FBHA 4ZI7B 8MHTA 3O3CA 3QZUA 3MJDA 1I3KA 3HS3A 2UYGA 1ZCJA 2A9PA 4HZUA 1WMDA 1TAUA 2LRHA 4CQLA 4BMPB 4Z3KA 3S4YA 4DFDA 1Z6GA 1P4JA 1ZFNA 4G8BA 3GMSA 4YRRA 3D6MA 1DC7A 3L7CA 3HDVA 4DNPA 1N8KA 4IRUB 4RK6A 4H1WA 1CR4A 3RVOA 4IHJB 3H4TA 2WJ6A 3L43A 4C7JA 1OAKA 3P4UA 3OOSA 4OHKA 3MJHA 3PNOA 3FCEA 4L07A 1E2KA 2C8LA 4IQ8A 2IS1A 3OQHA 3FR7A 1DT3A 3KQLA 3KOZA 2CZGA 2VBGA 4B48A 2DFKB 2TMYA 3ZG6A 5JBIA 4DN6A 2VK4A 4PS1A 5FRDA 4BB6A 4V0ME 3L0BA 4YVFA 1J97A 1IRIA 1EFRD 4ZALA 3NDBB 1AUPA 1ZWKA 2VJMB 5LYJA 3DA8A 4RC9A 4TV8B 4YT8A 2R6AA 4JKIA 3VNUA 1E6KA 4L8YA 1JHXA 3P2YA 5L4LA 4QGHA 4WFJA 3CGWA 4U5XA 1AKYA 1B8OA 1VGVA 2CFCA 2CLEB 2FZEA 2YFKA 4KXLA 3WYCA 4NK4A 4LF5B 2A88A 2OMKA 3Q5GA 4ECEA 2HIAA 2PT6A 2AUNA 4D41A 2BGMA 2F7SA 3A9SA 3DOHA 3HABA 3V4LA 4AF7A 3E0XA 3LQ1A 4ZO6A 3OZAA 1TVEA 4ASUA 1KHTA 5KSYA 5CHYA 6Q21A 5IDQA 2Y1EA 1B41A 3AX6A 4R1SA 2C57A 1OROA 4WFQA 2NZXA 4RNDB 5HYVA 3GNQA 5AJWA 3ZE2B 2GZDA 3TLMA 3H1PA 4N0DA 4FMCF 1E63A 1EP1B 3EA4A 2XH8A 4EYQA 1U6JA 1P6QA 4M8LA 5KO2A 3LGSA 1W5TA 4NKRA 3UYLA 1YBMA 2OD2A 1QVRA 4JLMA 2JBAA 1ZCBA 3FPKA 1QYRA 1AO3A 3GRUA 4JU8A 2AF4C 4WOCA 5FHQA 3F71A 1OBCA 4BLOA 4ZI7A 5K4HA 1QIMA 3BIOA 4I4IA 3C6ZA 2ZJYA 4N0MA 4MHSA 1E0SA 2ZFUA 3EUAA 3TNYA 3DBHB 1G8GA 1DELA 1F6WA 2P5UA 3I53A 1JVSA 3R44A 2IXDA 4EB6A 3EFEA 4DV6B 1PFGA 5KIAA 1VBKA 3QMVA 1N9GA 3L0PA 1JSLA 4CKWA 4BVEA 4D9NA 4IWNA 3BZBA 4LUCA 4R41A 5ARCA 3WNBA 1E92A 1Y8ZA 3TSAA 3CZPA 3HVJA 1XDGA 2X22A 2X0FA 1V16B 4MRRA 2I3ZA 4CF6A 3P9CA 3Q3VA 3DE7X 4HJRA 2BSXA 3UK2A 4ZHSA 2AKYA 3G88A 3PJRA 3M3PA 1VMEA 3NKFA 1J23A 1GYRA 3I37X 4FR2A 3K0KA 3CKKA 3L0YA 1Y5MA 3V2HA 3BMOB 3WKEA 3UFXB 1S2MA 4L4ZA 3H9EO 4V1CI 5C5CA 4PLPA 1P45A 3ZWQA 3KD2A 5BNTA 1GXSB 4B2YA 2ZXFA 4CKEB 2J5KA 3SXPA 1NQVA 3I30X 2B4YA 3ZVRA 1XTKA 4AWBA 4ZKDA 3RS0A 4QJ5A 4M8NE 1XK6A 1BE6A 2PHZA 3RRXA 1LJ8A 2ZM6B 5AVXA 1DDGA 5F5XA 1X1TA 4NI5A 3WYFA 4CUJA 4IH4A 3FWHA 1RI4A 3HQ4O 3M1IA 1ST3A 1XTUA 4GZ6A 1P62B 3UFXA 3FJ1A 1WG8A 4QHTA 1EFVB 4XW2A 3KWFA 2BRUA 1ES9A 4A6PA 1SUIA 4CIAA 5C53B 2VJYA 4OOEA 4OXXA 3WAJA 2GF2A 1TLFA 2ZSFA 4B7ZA 1WWKA 5KJ6A 2VTBA 2W6NA 3MUFA 2N47A 3NI2A 2PZEA 1F6DA 3UCFA 2IXFA 5BRNA 1LI7A 4X60A 2Y1CA 2R4UA 2GEVA 3F5MA 3WGZA 5IAAA 4GC9A 2HXSA 2HHJA 2HWUA 2BFFA 3AU9A 2P2NA 1H1DA 3KKPA 5FKJA 3W7VA 4E46A 1TGYA 2WHQA 4DMUB 4AKIA 1XP8A 2X3FA 3P9XA 3ZK9A 2YHSA 3ZDFA 4Q7QA 1SHUX 2W93A 1EDEA 1SBNE 3R7AA 3C3CA 1KP3A 2VHZA 4JI1B 4JDUA 3SFTA 4BNDA 5LXTF 2W2XA 4YO8A 5DU2A 1M75A 3NC0C 3S3TA 3E15A 1LNZA 5G3YA 2QGNA 3VZBA 3WYDA 4P2GA 4B7AA 4NAHA 4DDMA 3D6NB 5ALOA 1KFJB 3RC8A 4G0UA 2WIDA 2WQ7A 1R4NA 4HV4A 3KALA 3A2KA 3IB3A 3JW8A 2IPXA 5AVZA 4IZOA 3I32A 4FFOA 1MPTA 2FEMA 1QORA 4N0QA 5JASA 5AICA 4ZOQI 2ZWPA 3DVLA 3LT0A 5GGXA 1UDXA 3OF2A 1K7XB 3N59A 4G8CA 5B58T 4HGQA 4JYPA 3SXUB 1BWSA 3L9WA 4HSGA 2PS9A 3UMGA 3GT4A 3E70C 3QUBA 3SJBA 1R50A 2QAJA 1WBBA 3BMQA 4RF5A 4J2HA 1R9JA 2EX1A 3LQYA 5U4QA 2XIJA 4QDJA 4RSMA 5P21A 3G3EA 4RD1A 5EYPA 1W35A 1L5WA 2YWJA 3MCZA 3VO9A 4BNVA 1DBQA 3D3WA 3SJUA 3EMKA 4GZLA 4XVCA 1NLUA 4ZI2A 1EBUA 4LK3A 3H5WA 3ECSA 4HAIA 1D8AA 1SUFA 1VL8A 2QLMA 4Q4LA 4W5TA 2WA1A 5DO9A 5B1DA 2XZPA 4QAJA 1SBHA 3PQ6A 3N2NA 2P9FA 1T5DX 3QWHA 1KJNA 4ZOEA 2O2JA 2WHXA 3DW3X 4XYMA 4G0OA 1DI0A 5JAPA 3U9SA 3RTDA 1FNSA 1A4RA 4M22A 4PEVA 2O8FA 1A5BB 5AUOB 2YRFA 2EP8A 3FNRA 5C8YA 3DZHA 4HNAA 4GZMA 1JFFA 2PXHA 5LZ4A 4DLAA 2WTNA 1E89A 4EZIA 1SU4A 1T8UA 3HB0A 4M1TA 1L8XA 4YALA 1L3CA 4A8JA 3GEGA 4B5KA 3E61A 1NXQA 1C2TA 4JR1A 1J90A 4D4GA 4JKYA 1FP7A 4L72A 5G53C 2BH2A 2MSWA 3W3AA 3GRRA 3CF4G 3LC1O 3ZPXA 1KARA 3R7WA 5I8PA 1G64A 3F3MA 4BZQA 1RZVA 1M72A 1Z6YA 2V9ZA 3WL8A 3TGPA 1Q1EA 3RUDA 3LZCA 4J0EA 3FA2A 4M8SA 2VRWA 5DDIP 1A7AA 1T43A 2D7CA 2XZTA 5LXTA 1VCHA 4XGIA 5BV7A 1S6YA 3AM3A 1I30A 4BN4A 5IKPA 2DB3A 3Q1LA 1T2VA 1S2DA 1YKGA 1QVAA 2RDMA 4NR0A 3TQHA 4WEOA 3ZE8A 1PCXA 3RJTA 1XNHA 4UHFA 5LQKA 3HN6A 2IV2X 4PXYA 2UUCB 2PGXA 2QSYA 4V0NA 1YZHA 4UDOA 4PNHA 5JCJD 3BORA 4MKRA 2ZI6A 3I9LA 5DOVA 1XTPA 3SBXA 2QVXX 4DM3A 2ZIGA 5FV4A 5BV0A 3VHXA 4NULA 5J40A 1PK8A 1M1XB 2O7VA 2WJHA 2Y0CA 1V2HE 2YOHA 3KQOA 3NBAA 3HWSA 1BQ3A 1D2NA 4G9BA 4P3KA 3W9SA 3LHSA 1JLMA 1KZ1A 3CZRA 3RROA 2DQ4A 4I5DA 3F9RA 2Z5VA 3EVZA 3O84A 4RJ2A 3T35A 4UTRA 1UADA 1UBMS 4AK9A 2WEKA 3X44A 4CODB 1XTSA 3TXXA 3UGJA 3HG7A 1Z0UA 4RY0A 5GMOA 3TRKA 3N8DA 4E08A 2B2NA 3NNDA 4JD5A 3VZCA 2V7QA 4YY3B 3K0EA 3HJFA 1SEPA 1MQ9A 1OWOA 2QYTA 2DJ5A 4OFZA 1PZMA 2I2AA 2HXYA 3SEZA 3FYUB 3DPIA 4FBGA 2I80A 3VBEA 5TPZD 3WNVA 3CX6A 3CUTA 2M6LA 2J67A 4MR8B 3F6CA 2C4MA 1C3EA 2DY1A 2FPUA 2REQB 1ZMBA 4JFAA 4LPKA 2V54A 4K9PA 4BCCA 3CB2A 3IVRA 3G8BA 2EV9A 1T1GA 1VCMA 1RMYA 1O3YA 2DHDA 1JU9A 4W82A 3RF6A 4J0HA 4BFSA 3STYA 2PR2A 2R25B 1G9SA 4PXSA 4CEHA 3D4LA 4QTUB 1RSZA 3KU4A 1RJFA 5ITVA 1GG9A 3THXA 4XJXA 1SXJE 2XNJA 4P3YA 2GVNA 3QFSA 2YWDA 4K8OA 2HDHA 2B8TA 3HYRA 3O4VA 4P84A 1KVQA 4C9BA 2CV2A 1UMDA 1JKJA 1FOEB 3HN7A 3AUKA 4DE5A 3M4JA 4JLWA 5DKFA 1Z4LA 3CH7A 3TK1A 5K5EA 4LDAA 1PFYA 3BTOA 4GXTA 4XWYA 5CX1A 1EM6A 1P2BA 5EZ5A 5FR2A 4G5OA 1EFCA 4I4LA 5IBPA 1UMKA 4WVFA 1RTTA 1G5FA 2A9FA 2HIGA 4B3XA 4YONB 3E84A 3ACDA 1GQ2A 2NTYC 3HN2A 5ALYA 4ZEVA 4GUDA 3F4LA 3WFIA 1N5DA 3RPEA 3LGXA 1GPJA 2C9CA 2DSNA 2QW8A 5AOCA 3OZCA 3VZPA 4BLSA 3ASYA 2QD4A 4WTOA 1Z8HA 1ZJYA 3EIWA 4JY7A 3IOEA 1MJ5A 2PH3A 4R2IA 4UC0A 5B3KA 1F38A 1Q6YA 2AR7A 2QXTA 4RZIA 4C4PA 1P7CA 2YHUA 3C5EA 4NYIR 3LTNC 1NW5A 1H0KA 5AJHA 1E2PA 2H4JA 1TADA 2DOKA 4BMNA 2FMFA 1NOKA 4NJMB 3CA8A 1K6EA 1PGJA 1A8QA 3OZVA 2ZM5A 3A9RA 1KOJA 3QVLA 1TW2A 1UEXC 3U1VA 3R6LA 2Q3DA 3CX3A 5DHQA 5B36A 3ORRA 1B26A 3NJ4A 4S0XA 3WLTA 4AZTA 5A6VA 1XZLA 3KJFA 4Q9HA 1T9ZA 1V6SA 3II6X 5J5VA 4PSCA 4A3SA 3KXPA 1DL5A 1XTTA 3HLYA 3HP1A 4WLFA 3CRQA 3G8CA 3QVVA 4QOEA 3VMMA 1HORA 4D6YA 3B8EA 3L84A 2J6CA 5CLQA 5C7LO 2XD9A 3SHQA 3BICA 4P6VF 5F7ZA 4AYWA 4PYIA 4OHMA 1NW9B 4E88A 2XMBA 4TS1A 4BPRA 5CVUA 1IBMB 3C87A 3COWA 1E2DA 2H7VA 4H4CA 1SKUA 2M32A 5ENZA 3KKLA 3Q3GE 1JMVA 2HMYB 3AGQA 2QZ9A 3M0EA 4Q21A 3TTSA 2EEZA 3T3EA 4R8KA 1OGIA 4ZVVA 1OA0A 2D1TA 4NBSA 3TBHA 3U9TA 2FLVA 5HBGA 2RI1A 3IP7A 2QTZA 4IMPA 1CR0A 1NUTA 1TZCA 1UP7A 4OQZA 5KDLA 4BNHA 4E1VA 3ZGZA 2YIJA 2NO4A 1U0HC 2QMQA 4XWAA 5CFZA 2IF2A 5IBCA 1I24A 1DOAA 1K4KA 3ETEA 2FLKA 4MP6A 1BO6A 3KJHA 1MO6A 2WJ3A 3U4HA 2O8EB 2GEJA 4FE4A 1J8DA 3ZU6A 1HT2E 1QCCA 2AQ8A 4NAUA 1CULC 1JSXA 4PHHA 3URKA 3TQRA 4C29A 2VTDA 3REQA 3GCZA 1HZZC 4LKRA 4R0VA 2J30A 3LM8A 3BF8A 4LZLA 5G1NA 1OV6A 2X6TA 5AW7A 3HCRA 3W34A 1MUUA 4P1ZA 1H3FA 1PZGA 5H3LA 4YI5A 4QYIA 4QDXA 1EJ6A 1KO7A 1TZBA 4D0GA 1BW9B 1CIJA 3QXSA 2IODA 4BO2A 2HJGA 3IE1A 2I1WA 5F33A 4KWCA 4QOHA 4EFMA 1MVOA 3P9IA 5DX0A 2GGSA 1M83A 4BX2A 4DIKA 3C7AA 5A4KA 3K0SA 1JJVA 4YFVA 2A5FA 1M73E 5AHKA 2EKBA 1J5EB 3CNNA 4FU0A 3VU3A 3R9XA 3EIEA 3QFHA 2DVMA 4LX0A 4XCVA 2ZI4A 1N4AA 1UK8A 1Z22A 4XJSA 1QHYA 1V4NA 2AMJA 2DT8A 2X1HA 4BVKA 5J4KA 1KJQA 2ECPA 2AD5A 1GUYA 2R0QC 4N6OA 1V7ZA 3JWEA 4GSLA 2BKXA 5DCLA 1GRNA 2G82A 2HCRA 3VVMA 3SQMA 4FI3F 2NT3A 3Q8LA 4JI3B 2O59A 1SVLA 2P8SA 5C52B 1XDWA 1I4WA 3E2IA 2Y27A 4C1NA 1MOZA 1NFFA 2O2IA 3NNNA 1CWUA 1G5QA 3ORQA 4J4HA 1AMUA 4B3TB 1VXRA 1MVNA 2EKLA 1U99A 3GJSA 3NZEA 2DTEA 3AEQA 2HH9A 4HKTA 3GK3A 1G8YA 3AB8A 3UHFA 2IF0A 1E2GA 3UH1A 4CV1A 1WETA 1WW3A 1C3OB 3MZ0A 1JUDA 3WGIA 4KO2S 4P3OA 4LOLA 4TYQA 1JE1A 1T26A 1TVMA 1DCKA 3CJRA 3FLBA 3R5HA 4NE9A 5D00A 4M36A 4C0KA 4GNKA 1KMMA 3N2ZB 4YJ2B 3GA7A 3T0GA 2UXCB 1IB0A 3IR6A 5AW6A 1QFMA 3PJDA 2A0WA 2Y77A 3ZLBA 5K7SA 2AYYA 1GAWA 4HRVA 5KTOA 4IMIB 3ZZUA 1NUSA 3WK9A 2HZBA 1O0SA 2PGNA 5AWFC 4B82A 1TA4A 2R62A 2WVAA 2ZXEA 1FRQA 2J07A 3K09A 2F1JA 2O0JA 2XGGA 3D0RA 4KLAA 3RTBA 4FWTA 4YUVA 4CNQA 4O33A 5KYWA 2GXQA 2XBLA 1FFEA 3W90A 3VNVA 1H2HA 1O6BA 1UFKA 4QEDA 2C7RA 2BEWB 1PNTA 4PLTA 4M1EA 1GVHA 3NP7A 4L5CA 3G2IA 1YB5A 3AM5A 3HBLA 3PS9A 4NMXB 3P9SA 4GNRA 4KDEA 4D6XA 3EBPA 4DUGA 5K9ZA 4YJ2F 4Z1OA 5JYDA 3EG9A 2P5YA 5KQMA 1XLVA 2G6BA 4ZO9A 1ZW6A 5E6RA 4G1CA 1ZK4A 5KPJA 1ZM9A 3LWBA 2XNSA 1LS1A 1QK3A 1XQ1A 2M1XA 2IHBA 3MTJA 4MUBA 4NOMA 4ON9A 2HJWA 1BHSA 3RTGA 5K0GA 1KE2A 3TIIA 2CD7A 4YTEA 1QTRA 1I2AA 5B3JC 5IJ0A 3IB6A 4PYKA 3FE2A 3OM1A 1X1QA 1YONA 3SIPA 1DIGA 3ZHXA 4JR0A 2ZKLA 4DSZA 4ENVA 1PQUA 1LDGA 1RZUA 2JGJA 4PSKA 3RUPA 3PUIA 4F60A 2LCFA 2Z30A 5BQ3A 1Z7BA 1EWVA 2W22A 3U7QA 1KI4A 3IIEA 3WE7A 1SHKA 2ZS8A 4WL0A 4TVOA 5KVCA 1H9BA 5I9SA 1O54A 4H0NA 5EWJB 1L7QA 5AKLA 4ZCTA 5B7GA 2XWJI 3CG0A 5JWRA 5KREA 3NCTA 3WYNA 5HR5A 1RLOA 2PZ8A 5DN9A 4Y6LA 3GA0A 4CT0A 2JW5A 1VLVA 4M99A 4B83A 4DS3A 5JV5A 1KXZA 2ODWA 5AM0A 2MSKA 4LFBB 1QVWA 1OCEA 4R5HA 1RM5A 2WDZA 2IPAB 4F56A 4EHHA 2GNOA 3CRVA 3QE3A 3QLUC 5ENVA 3MIZA 2AEJA 2IBMA 2O3JA 2GBCA 3KV3O 4C0QC 4ZQFA 4I8DA 1Y7PA 3ER9A 4RPIA 3AFMA 2QP3A 3A1EA 1C7EA 1E6WA 1R88A 1NZJA 1ZU5A 3GCGA 4RKEA 3BRQA 4QUBA 4Z6KA 5JANA 4UVEA 1NT2A 4E21A 2PWYA 4FYIA 3SQNA 3LUFA 4C7VA 1BGVA 1FB5A 3NONA 4X64B 4CKWB 3RV4A 1ECBA 4R69A 2Z3VA 2JNWA 3PEEA 4KK3A 4U4AA 4YJ3A 1UPTA 4U2BA 3W06A 2AE2A 3EGIA 4BLRA 2QRVA 1H05A 2XQJA 3I83A 5JBNA 3OLQA 4N5MA 2GD1O 5FPSA 3M49A 2XXAB 1W25A 1BDMA 2IZ1A 1UBTS 4ICIA 3UC5A 3MMXA 1G7CA 1VBNA 4L8FA 4DEXA 4EF5A 1PR5A 2P2GA 2IZ6A 3R6TA 2QAGA 2Q07A 2V7XA 4JJKA 2A0FA 2A5LA 5KKAA 3SFVA 4WXPA 4CCWA 5HF8A 3ROKA 5BSEA 2NZYA 4IVNA 5HRAA 4KUHA 3CW9A 4HEA6 4X1IA 2QE6A 1XPRA 1D1TA 1G1AA 4KPYA 1MENA 1X9GA 2LUOA 1UBFA 1YZKA 2LWIA 3D7LA 4OMDA 5EKDA 4NFSA 3VNBA 3VTFA 2CVFA 3CNHA 3ESZA 1NJ5A 2AN4A 5CCDA 1PF7E 3B8HA 5K01A 1O95C 3WICA 1P0CA 2BDEA 3FJOA 3FSGA 1QFYA 2AWOA 4W6ZA 1QIHA 1Q7GA 2E82A 2GZSA 1ZJ5A 3N2LA 2NAPA 3OPQA 4JIGA 4K03A 3TZCA 5JATA 4MR7A 2ZSIA 2Q8PA 4FFNA 1GL7A 3LKVA 1KH2A 3ANLA 4DA0A 3LVQE 1SULA 2VDRB 1T10A 2CFOA 1VFPA 3K2QA 1T4DA 2IYTA 1I94B 1LSUA 3LBHA 3L1JA 1XVVA 2GWRA 3AP3A 2HGSA 4Z2AA 3W5BA 4P0QB 2NYUA 4AURA 3HXQA 4MKZA 4H31A 1HURA 2OSBA 1KSGA 1AD2A 2IY8A 2PSSA 1Q91A 2D0PB 3NBFA 2ZSKA 4PBTA 4QUIA 3KVRA 1PFQA 2VPXA 1T2FA 1ZRMA 3B6EA 2ZRAA 1X7HA 2I2FA 5SZJA 3F2IA 5TARA 2IXAA 3ZZTA 1EESA 1HEIA 1NVUQ 2VF5X 4WHMA 4IVQA 3OJCA 4LBVA 1IOLA 4MVCA 1N3YA 1DJPA 3DCYA 3WRWA 4D4IA 3U44A 3UKDA 4RZ3A 4X3PA 3CLUC 2EBUA 2ZJ6A 2HSJA 3W1WA 2XZOA 4I1SA 1AOXA 4N47A 2CL6X 1TAGA 2PK3A 1DT5A 3INNA 4WEQA 3ST7A 5KX5B 3E22B 3I42A 4FINA 4EG0A 2OD9A 1HLDA 4E3WA 3LRXA 2Q2NA 3QH4A 1VA5A 4LDPA 4D3XA 1BHJA 1DRWA 2XKBA 2EC5A 3PNMA 2VK2A 4IJQA 2O07A 1WXIA 3QVJA 3WB1A 2F3PA 4RELA 5E3IA 3SIXA 4B75A 4W5QA 1EFAA 4DJDC 2DTXA 2WTXA 1IVNA 3NO4A 4JJ8A 2NUTB 4XKJA 3TI9A 2AFIB 4RIIA 4MEJA 2YWEA 2J33A 3AI3A 1QC5A 3WC4A 4DZRA 2W2LA 1RLTA 4PC2A 4HWTA 3L6UA 3KFLA 4E2ZA 4RZXA 1UBLS 2B9VA 2X3UA 3HHPA 4WLNA 3IC5A 1W88A 3ZWWA 4F3CA 4UTVA 5A0VA 5BNZA 3C74A 4E2XA 2ZWIA 1MV8A 2WSLA 4EKEA 5COBA 2Q5FA 5DXAA 1QIFA 4BCDA 1YO6A 3U60B 3HFGA 1E7YA 5D3QA 5BR4A 2O54A 3OAAD 1OBHA 3CZQA 1ENPA 3KPJA 2H1SA 3OPXA 2IHVA 4PAOA 3RVDA 2VHCA 2JH3A 5C7OO 4JP1A 4HI0E 2ZB7A 2UZ0A 4QBKA 2ZAYA 2EXXA 4XRGA 3C6XA 2W98A 2WKPA 1IPHA 3HZRA 1QDEA 1J5PA 3G2HA 3LCVB 4KHZA 3ROMA 1V9CA 3ZHZA 1OFHA 4F97A 1VJCA 5KNBH 2CKMA 3B7PA 3PWKA 1FMJA 4O4LA 4K3UA 2QMOA 4I5GA 4D1YA 3C5CA 4RD4A 4TMTA 4BV9A 3CVWA 1XDSA 3KDPA 1R8QA 4QQ8A 3RVBA 4C87A 4EI9A 1ANKA 1QIDA 3TCKA 5EE5B 4BTLA 3GUYA 4Y6OA 5DP2A 4TL6A 2VJPA 5CM8B 1RVV1 4GL4A 5CEEA 3GB9A 2VUTA 5FTLA 3EZNA 2XMRA 1KDTA 3SDBA 3W6ZA 2NZ8A 4JT4A 3QSYA 2PSEA 2BEJA 2BLNA 3I2HA 1J56A 4INZA 1G8MA 2J0EA 3DHWC 3G2KA 2GXAA 4MW6A 4HB0A 3IUBA 2WT9A 4US2R 4Q7JB 3MFQA 5SY6A 3DLPX 1XZHA 3MXOA 4W1RA 3L82B 5IAEA 1F9EA 1YFJA 1GVNB 3IUNA 4MWDA 4ZCSA 3WLOA 2Q9BA 4OHPA 5IC4A 3GRFA 1BAPA 1GN8A 3AJDA 1XJWA 1E3QA 4EM6A 2OVBA 2IV3A 3R7WB 2W48A 3W5DA 3IPLA 3RSQA 1OVMA 4M1SA 1TMGE 1PYOA 4IDAA 2ORYA 3VR4A 4A8PA 1P2TA 3KXLA 3JAKA 4Y1EA 4R05A 1GKUB 4KMSA 4DMRA 1V4VA 3WGLA 3JQCA 3Q7IA 3BD8A 4IY1A 3IBYA 4FFRA 5FNVB 2EW1A 2HADA 2OYRA 3ZJ5A 2P68A 4HNRA 1AVTA 1XPJA 3UWKA 1HDZA 2QVCA 2RGEA 1RXUA 4DLWA 4R3NA 3TQCA 2DQKA 3LD9A 4IWYA 4UEKA 1XVUA 1QGAA 1VG1A 2IKSA 4Y2HA 4FOLA 5E0OA 3A6ZA 5DNWA 2AK2A 3QUQA 5ILQA 4A4DA 3PIRA 3N5KA 4GI1A 4MPJA 1KGSA 3T5TA 4A91A 5JD3A 1M0WA 5ESWA 2ORED 4EVIA 4DEVA 4LJ8A 4ER0A 1ABEA 1YCGA 3QEBZ 1FFBA 1G8JA 4RLFA 4D02A 3REGA 4G86A 3QTBA 3V1UA 1TTHA 1MIOB 3PUXA 4RKYA 4DV4B 1XRPA 2P4SA 3TNLA 3GW8A 4DG5A 2JC3A 3NOQA 1P1RA 3BFPA 2Y68A 3LIPA 2CLLB 1ZYUA 1EGHA 2CXHA 1ZH4A 1LBTA 3DDHA 4OLFA 4KXNA 4RMJA 1YR6A 3RS8A 3U37A 4D9FA 2VBFA 3PQ4A 4UCQA 3I73A 2C95A 4PLYA 1JAHA 2XOKD 3E58A 1IJEA 5CB4F 1KEEA 1K5DA 2VOJA 4P7BA 3SN6A 2PWZA 1WUKS 2WIJA 1HSOA 5KTYA 5C1BA 3U81A 1J0BA 3AC0A 2HA3A 3D7NA 4HX2A 3MD0A 2VFAA 4M1QA 1ZQ9A 2PJDA 5BV1A 4KPEC 2HRRA 5G4LA 3N8GA 1JAYA 3R6DA 1P73A 2C96A 1XVAA 3BTVA 4OHCA 5HF5A 2JFXA 1MHTA 1Z0FA 3KKQA 4YRFA 3W0LB 2W2KB 1XDUA 1P19A 5FWNA 4WGGA 3QHAA 4FQ7A 2D8AA 3KAJA 5KTPA 3MHTA 1RXCA 1KEUA 2IE0A 1PSWA 3D8SA 2QN2A 3JS5A 1E20A 5T3YA 2P4QA 4J0QA 2R1UA 4FGJA 3LG2A 2HQRA 2J41A 3UK6A 3DDUA 2ZTUA 1CUIA 3ZTWA 3E8SA 1JDUA 5E7QA 2AMLA 3IAS6 3LPLA 4YAGA 2WYHA 1EX6A 1YA4A 1II0A 2BI7A 3AILA 1A9OA 1CB7A 1F2UB 3CO0S 5LBTA 2Y4NA 2CL0X 2FXIA 2Q0HA 5T8KC 1KK0A 1D0SA 3HKCB 4M4SA 4BWYA 2N3ZA 4CCYB 4E7PA 1D3AA 4GBGA 4DR6B 1EI9A 1JEDA 1Q7RA 1Z4KA 3LX8A 2OGTA 4I36A 4Z9BA 5CA1A 4ARCA 2P7IA 2BSAA 1OREA 4HRYA 2X5XA 3JWJA 4JNKA 4MVJG 3BUSA 3HI4A 4OO3A 2Q3HA 3EUEA 4LK2A 4EITA 4FPXA 5ICFA 3VOAA 2Q3LA 1ZAKA 1M2KA 4G3XA 2JFOA 2M6RA 3CT6A 2VXBA 4HAZA 3DE4X 2Z6VA 4XE5A 2BDTA 4DADA 4RV5A 4DIBA 1F8FA 3K0AA 4W6QA 4UXJA 4C0XA 5ADVA 1ITZA 3B51X 5L4SA 3UB3A 4MUYA 4ZRNA 2MDTA 3BKWA 1LV8A 1E2UA 1Y3HA 3D6JA 2IYQA 3BRSA 3OBIA 2CDAA 2JGKA 2E4VA 3RSSA 2DCMA 3QLTA 3PNSA 2H48A 1DAIA 2ISQA 3QNUA 3PENA 2GAAA 4UVDA 4UXHA 5DWDA 4ZRDA 1RIIA 2VQEB 4BVFA 5DTQA 5D86A 1EZ4A 1U8UA 4G23A 4GBED 3W9UA 2J3KA 4BMZA 2F43A 2QM8A 3E18A 1P61B 5BP7A 4FGZA 2W2NA 2MT9A 5EHXA 1FTWA 2GM3A 1ECFA 3IA7A 4A15A 4TS4A 3FWYA 3HNPA 4L74A 1HA3A 4XJTA 3WFJA 3LRTA 1ATIA 1L8LA 4WLVA 5JFTA 1UBOS 5BNFA 1A27A 3MTDA 1HV8A 4PZDA 2YJGA 3BWXA 3MS2A 1FRNA 3DR3A 3EGEA 4Y2TA 3TG2A 2I54A 2PY6A 2VT6A 3AKEA 4B34A 1CR6A 3DEFA 3LVFO 1OIVA 1Y1PA 1XRRA 2JVKA 3LOPA 1GKIA 4XLZA 4CW7A 1U4OA 1G4AE 1CU1A 2JIQA 4D8YA 1BCSB 1RXEA 1YDHA 3C1AA 3KLPX 3PG5A 3FAZA 4NMLA 4RDHA 4D4LA 1TIPA 1E59A 1YRQA 2FVYA 3RRMA 3GUCA 4V0LA 3TQSA 2AE1A 4PYJA 5HOQA 1VSUA 4HRXA 5JSQA 1A9PA 4J1QA 4I1PA 4OVKA 4U1RA 1X87A 4PPQA 1ORDA 1QJ4A 1CDZA 1RWOA 3W78A 1J2YA 1FDSA 4HOYA 4FYYA 3H11B 4WBNA 5JYCA 5DT2A 4G0XA 1VHWA 2H65A 1T3SA 3FXAA 4M9UA 3TTTA 1MC5A 3TUZC 1YRBA 4P0PB 1YJCA 4BAUA 2CXPA 1UXJA 2HDWA 4AO7A 4KYVA 4MWCA 2A9QA 5K3OA 1SHTX 5LIRA 2C2WA 5H8WA 4Z53A 4DZTA 3WL4A 3FYTA 1PK9A 3FCSB 4II2A 4RY9A 4A2CA 3PA8A 3NPMA 2X14A 3GDOA 4IEIA 3OQ1A 1V26A 2WMNB 1RCTE 1KBOA 3ADPA 4M1KA 2GHRA 2Y1GA 5FYQA 1BU8A 5I5GA 5DHFA 5EVJA 1VQ1A 2IFTA 5F9MA 2I4RA 5BWNA 2GCEA 2O8CB 1I5OA 1KF0A 1YBHA 1ZRNA 4KMMA 4MO9A 5CA1F 3MG9A 3C14C 3BE6A 5D5HA 3T9CA 2X15A 5ALDA 4ZCIA 5DYGA 3QOFA 1Z0KA 4NAVA 1RFGE 2DLCX 3V6LA 3ZN2A 5HKKA 2OGSA 4MITA 2P1DA 4I8XA 4Z4QA 1GFWA 5AK6A 2ZJ7A 4HXFB 2BFDB 2GPSA 2ZYTX 3JQ9A 4RX1A 1N2CB 4N5LA 4O4HB 4E07A 3K70B 4AP6A 3EB9A 4XX0A 3TINA 2FG5A 3R0XA 3L02A 4NYIQ 1VC2A 1X19A 4JLDA 4RHEA 3NHFA 3NUGA 1KDYA 1UR5A 3MJCA 5D6NA 3HVHA 2XOKA 4QEKA 5BRJA 1U0GA 2AH5A 3TNFA 2VSNA 3OD5A 3V00A 4GR4A 3ZWPA 3CXUA 1JSRA 2XNDD 3H3FA 5JH7B 1LDEA 5ALLA 1NLYA 3S70A 3X1YA 1KAHA 3G2QA 3M6XA 4U7DA 3IRUA 3FCXA 4D9JA 2D2FA 4YN3A 3GJQA 4LRQA 4U00A 3VOBA 4QYXA 3ZTTA 2YUIA 3PC8A 2V98A 4MVJF 5IVIA 1W44A 2F8MA 3LO5A 4WK4B 5DT9A 5DWQA 1U2GA 3C3YA 1BS2A 3ZNOA 1EZ1A 4WI1A 2WWGA 1OX6A 1SXJC 3C2QA 3RANA 4UM9B 1E66A 5KWVA 3IOYA 1NI3A 4Q3KA 1W4CA 1W34A 4B3JA 3LY8A 4WN3A 3MFYA 1L5KA 1RQ7A 3LXXA 2H4HA 3JVUA 1A5ZA 1DJLA 1XFAA 2FTKE 4UATA 4ZCQA 2EHDA 2OWEA 3JQ6A 4TMKA 3OO0A 3NWEA 3LUJA 1CX9B 1QKIA 3VHQA 5T8KA 1P1BA 1Y3FE 5KNCA 5H02A 3KVNA 2RAPA 2HYDA 3A4LA 3ESAA 1CJMA 4NNOA 3COPA 4I99A 3G89A 1D04A 2PU7A 5T41A 4CFSA 1KMQA 4TM7A 1RKXA 3BMXA 1QFSA 2O14A 4L08A 3THYA 4QRHA 5F2OA 3A70A 3FKSA 3CONA 2QUKA 3LDAA 3SVTA 4F0JA 2W6PA 2O7QA 2H0RA 4AKTA 2CWDA 4JYZA 1T8TA 2P8JA 5GJWC 5TXGA 1EGQA 4BJ6A 2PRYA 3AR6A 5SV2A 4HPXB 5K8LA 1MFZA 2FSVC 1TJ4A 1WF6A 4Z2YA 1H2RS 1TEVA 2JFVA 3OIFA 1XJQA 4WXMA 3AHFA 3PICA 3WK6A 1KJ8A 3FWKA 3SKVA 1MGOA 1DE0A 4KQ1A 2IL1A 3PUWA 2FJPA 4BBZA 3ZV3A 3AR2A 1IPFA 3NLLA 1DJQA 4N6GA 4DMHA 2BZ1A 4CTMA 2EIHA 2XI4A 1JJBA 4WNAB 4QLBA 2YHIB 3F8SA 1F8XA 2PGIA 4BKOA 3I04M 3NTLA 2YWCA 3UJ6A 2UZ1B 3LAWA 4H77A 1EMDA 1TJNA 1MAAA 1F9AA 3ZZ0A 1QGYA 3Q98A 3R23A 4BX0A 4JL8A 3CR3C 3BEOA 4FYMA 4LJ6A 4XIFA 4TS3A 1DIHA 3VPGA 4RTNA 1JF8A 3OZTA 1RI3A 4HDKB 2WF6A 3ZH9B 5JAZA 2HF7A 4GKKB 5GJBA 1GSAA 1LSJA 4MIEA 4ZQEA 3ZWKA 5FDFA 2Y9MB 4BVHA 4E5MA 5ADWA 4TKVA 5I7WA 4QBHA 2WDPA 1PD1A 1FMFA 4BJ3A 4C3ZA 3IMFA 2I6SA 3V48A 1QQ7A 4CGZA 4HFMA 1WXFA 2DBYA 2Q5QA 1FX0B 1GQOA 5AMXA 1JH9A 5L4NA 3VSDA 4G89A 4EO9A 4G5YA 4H4DA 5EMMA 4OIFA 4LYHA 2GO7A 3C5HA 4FLEA 2FW1A 2OSVA 3EGDB 4U2CA 3D7MA 4J3NA 3UPUA 1GKLA 2VXYA 3IUMA 3SGLA 4YIHA 3ILYA 4JXJA 1B6SA 1NAHA 4LN1A 2WIAA 1CZNA 4URUR 3K9WA 2JI6A 2PD4A 2ZTLA 2XKKA 3OU6A 2JH9A 1TNDA 1WE2A 2YHIA 5T4BA 1MZPA 2CXNA 3SWWA 2B5WA 5JCOA 4OI1A 3R9KA 1P29A 3F6BX 2BEUA 4XEUA 3FOFC 1OH7A 1TC2A 3ILSA 4P4NA 5EKUA 4XM1A 5KYYA 5TEVA 1FLNA 3DDWA 1L8OA 1UFRA 4ETWA 3N2YA 1X77A 2Q9CA 1VDZA 1BN7A 4CMHA 4QELA 4NCAA 4R1LA 3H6HA 1A7UA 3X1XA 4FKBA 1E8NA 1SA0A 1ARZA 1Z34A 2EQAA 3T3PB 2J4FA 4KH0A 3ZR4B 1VKNA 1ADJA 3MTIA 4DIUA 4AJOA 3GXOA 4OREX 5IBRA 4RULA 3QVTA 2JLXA 3AUJB 2UZ4A 3FCCA 1X9HA 1JEJA 4QO7A 2AXQA 2FZWA 4OPMA 4FUQA 5J4YA 5BW5A 5EP1A 4UHDA 3LFTA 1KVRA 4M38A 1O7JA 1YRAA 3ANTA 3OJ0A 4U2FA 1EVKA 2QMEA 4IIJA 1EA7A 4QXRA 16PKA 2FFQA 1Y1TA 1OFGA 4G5FA 1IBKB 1RRGA 4UQOA 5HRUA 1RHMA 3ESXA 4IO1A 4NH0A 2ZJZA 5EJ2A 2RGUA 3GFSA 3LWDA 3K2EA 2OBLA 1G38A 2WV9A 1VJ0A 1JALA 4EGAA 1APBA 1I9CA 3HTXA 1AS2A 1HF3A 4PSVA 4X44A 1VJ1A 3KYCA 3HO8A 1Y3BE 3JVVA 4HCJA 2IU0A 1JG6A 4WQMA 4QOGA 1E2JA 1TE2A 4AKHA 3BDAA 4Y9RA 4YLEA 4EW2A 2DERA 4DRXB 5K6TA 1JEAA 1DAKA 2FW7A 2VPQA 4RYLA 2X9VA 1CG6A 2YFQA 3DO6A 1W0KA 3E4DA 5I7EA 4DA6A 4AT1A 1USVA 1H5UA 3L0SA 3UJCA 4DR5B 4OLHA 4B9AA 3L1IA 4IX9A 5FWXA 4OHYA 5FTMA 3SK0A 3AESA 2B34A 2P78A 4DQDA 2Q6VA 1CQPA 1CSEE 2ZBGA 5DBHX 4N0PA 2YYYA 3VDNB 4M87A 4BX8A 3WK4A 3KL4A 4IIGA 4FDLA 1FJXA 3B78A 4TUYF 1S8NA 3K2BA 4Q00A 1MW8X 1HLPA 1V7PC 3PC4A 4LF9B 1BGWA 1NP7A 2VRCA 1PX0A 3BGDA 4IS2A 4KN8A 3BKXA 1PTJC 4G5GA 3CF2A 2ZUDA 4F9GA 1BZYA 4C30A 3EQ2A 4DTCA 4XWKA 1T6ZA 1GQSA 3ME5A 5CFMA 1GPMA 2PMWB 1Z5VA 4U9IS 5CURA 4KBYA 4BWFB 2UXBB 2V6MA 1KVSA 3K4HA 2ZIFA 1TTPB 1J25A 5AI0A 2VYVD 2PMFA 1J8VA 3JQFA 3HYSA 1K8QA 4ZT3A 2ZRKA 1J0AA 5LB4A 2X2EA 1Z56C 5E9AA 1EE2A 4B4DA 1SGWA 4NV3A 4CG2A 3TWOA 1YR8A 4OHOA 4Y7DA 2ZPAA 3AF3A 2X6RA 3GGDA 3SSMA 1KRHA 3ZE6A 4O08A 3GT7A 1XXHB 1YRWA 3VDRA 3WQSB 1ORWA 1RBZA 2Z0MA 1WD5A 3L7MA 1ZEJA 1PJ8A 1AS0A 1G6OA 3ECAA 3MXTA 2PUDA 1V45E 3X1MA 3TQQA 3FMIA 4OBEA 5JLAA 4FSHA 4L78A 4EHKA 1ZVJA 4IO0A 5AP9A 3VH3A 3KZKA 2H1VA 3HB9A 4I8IA 4O1IA 3RVMA 2W9XA 3E05A 1YQXA 5K0CA 3A1DA 3UFBA 1FJGB 3CRZA 3EBLA 4CM8A 3A6KA 5FP0A 2I99A 4RK7A 4QFMA 3CRMA 4CDNA 3D59A 4CR7A 4ZI7F 2IVFA 4BXOA 2I3GA 1UAGA 5JZ9A 4DLUA 1PYDA 1UFOA 1XA0A 4F8EA 2C99A 4EHNA 4E5KA 3L4JA 5H82A 3N05A 4Y9SA 3O8QB 4ZIRB 2KI5A 3Q8WA 4DLSA 1I1QB 4E0BA 1JB1A 1RYFA 3RS3A 4RWZA 3UJNA 3U80A 3UTDA 1QDLB 3RLIA 2C7PA 2LIPA 2ORIA 2D7DA 2PX3A 1JQBA 5LMNB 3PI7A 4YFYA 1N6IA 2VRNA 3TW6A 1A76A 1X8JA 2A58A 2VC2B 3K32A 1TUGA 3R74A 2REBA 5IYZA 3HUUA 4FDTA 5IHXA 3TLXA 4ANFA 2RJNA 2WWWA 3NAQA 4G1VA 5CBPB 1QBKC 2R96A 5AW3A 3AHGA 3MOGA 5C7IO 2OHGA 1S9DA 4U02A 4MS3A 5B58C 3DXYA 1JPJA 3SHFA 1MRNA 4RMHA 4DABA 4I6JA 5JCXA 4MUHA 2GBPA 1FL9A 3U4QB 2E37A 2NYVA 4M1OA 3ZHOA 1QWSA 1Z17A 3HDJA 3S40A 4XA8A 2QV0A 3AIOA 8ADHA 2X8WA 1EFPB 1ZVMA 1XX6A 2QM7A 1J24A 4PLWA 4PQYA 4C4AA 4IDPA 3NT4A 1Z6AA 3UN1A 1JHAA 3CWCA 1PGOA 4IW3B 1TFUA 3FDJA 1ENZA 3TRHA 3WA6A 2UZ3A 4MDFA 1FQKA 2WWRA 2G04A 1M6NA 3DEIA 3ESRA 3RVSA 4PC6A 2Q45A 2WWXA 3B53X 1KVTA 2FUCA 4GMFA 1U3DA 2OZEA 3HRKA 3OP4A 3PR3A 1NC1A 1Y6RA 2X9LA 1Z7EA 3R5FA 4B9EA 2NLOA 4MX8A 1BJTA 2ONZA 3B13B 4QU0A 2QTMA 4XYBA 3VBCA 4DLRA 4NYJQ 4QT4A 3NYIA 1WSAA 4IDOA 4CEHB 1BKYA 1EIZA 1B00A 1Y33E 4PV7A 1K7CA 1P1CA 2QTNA 4K81B 1JW9B 1NUQA 5KINB 1BMQA 1Q0QA 4EA9A 3ZZNA 4KIJA 2GJ4A 1QHIA 5BVHA 3OWHA 1E6UA 2P62A 3WGTA 4DIMA 5IT9A 1G7RA 2BFNA 2BFPA 2FJUA 3FKJA 4M7WA 1COWD 4RHXA 3ONDA 2ZRBA 1QP7A 1N2BA 1OBFO 2ZIVB 1YB2A 1TVCA 4UZSA 4QUEA 1HTTA 4OL9A 1TFRA 5FI1B 3ZZ1A 3KDSE 2QUZA 1P2DA 3OKCA 4II3A 1CRZA 4DKJA 1L8QA 4PBSA 1XQXA 4N8SA 4WINA 4DR7B 4PO3X 1D5WA 1D07A 1K3UB 1NXTA 1QHFA 5BYAA 1VPWA 4DXAA 3QEJA 4GHWA 1YQUA 2VQ6A 1RZRD 2QUAA 5CBKA 5B1YA 3K53A 1P7ZA 1QX3A 2AW5A 1DUVG 4H7DA 3R9XB 1JEOA 4BYGA 2EWVA 4MRMB 4WMLA 4BQFA 4F5WA 1XELA 4CMEA 1ZGZA 2Q1WA 3KR0A 3KB6A 4X62B 1CNEA 4P93A 3VUEA 4CDGA 3EH1A 2L69A 2VSXA 3AIKA 1B0ZA 2VNHA 4NYMR 1GV0A 1G2OA 1A7KA 1OGYA 2DWUA 2HRZA 3AJEA 3PQCA 3CN9A 2OUIA 3IJPA 4PYNA 1WB5A 4FS8A 3C3JA 1R27A 5JYEA 1FE8A 2JFFA 2HPAA 5EJ4A 3P0JA 1JDBB 4ZKEA 2W83A 4Q6BA 3NAMA 1XTQA 3UWSA 3IVGA 1KK2A 2VUSA 1PLLA 2DKFA 2K87A 1OTYA 4RETA 1U0NA 3BWMA 3IAFA 1FYDA 3L6RA 4JBHA 2I6FA 2JK0A 3IP6A 4F3RA 4ZJUA 1ND5A 3BWCA 4ZP1A 4IZHA 4JJFA 1N6LA 4KQFA 2CHGA 4O8ZA 1YZYA 2V03A 4KW7A 3KKNA 3U6KA 2BFEB 1MW9X 2UVDA 2HSDA 3C7TA 1AQ6A 4BATA 1U7WA 3NIWA 1T5HX 1O94C 3AJ9A 4GPBA 2JJ1A 3B9QA 5DTRA 3VR2A 4BBAA 3DUFA 3PGJA 3RWOA 4HNHA 5DSXA 4A27A 1AN9A 3U3ZA 2HU5A 3QM1A 3C1TA 3MMNA 4PLZA 3I8XA 3NT5A 5ESRA 1XKXA 2VNIA 1YJXA 3SZUA 3TZEA 1TCBA 3KYJB 4UHHA 3QFRA 1PT5A 3ZWBA 7ADHA 3V4PB 3H1EA 4IHKA 1XMSA 5C46F 5HS6A 3HB4X 4FFVA 4QU8A 4RSRA 4M9ZA 1C9EA 1N36B 1RRVA 3FIUA 3OFJA 3PFKA 3TB4A 1NP3A 1XL1A 3CRNA 5FO1A 2AOVA 2WFAA 2VATA 3Q7RA 3SM3A 4AU1A 3S1LA 4KNYA 3O4JA 2NSDA 1AZTA 1RXYA 1FUEA 5HQJA 1YVPA 4V1CB 4FN4A 4R1TA 1ZH8A 4G2TA 4G67A 1T8WA 1Y81A 1I0LA 2VDQB 4M88A 1EJ2A 1YACA 3GUZA 1YVRA 1ZHHA 3LXRA 2JGDB 4RTJA 2NXCA 3BB4A 3B3AA 5EZ6B 4TTVA 1D1QA 3UTCA 4JCOA 1JG3A 1PUXA 4MO2A 3BE4A 4XEHA 2Q2OA 2FK7A 4DA4A 4NBKA 2E0IA 1A4XA 1IMJA 1GPLA 1WVGA 3GGOA 2O3UA 4UARA 4UNQA 4WOBA 3NOVA 3KSAC 3LT5A 2V6BA 5ELLA 1CQIB 2Z9DA 1I7QB 4PICA 4UAUA 3GBVA 3O1JC 4R40A 5HTKA 3OJFA 3ZYCA 1KRXA 1O6CA 1FTGA 2Z4SA 3H5TA 1NOIA 2MSNA 3N0XA 3QMWA 3IELA 4FDVA 4OHUA 5AD1A 1JEYB 5M5BA 1UM8A 2XVAA 1HETA 4UBIA 4YACA 2D5IA 2VYND 5JY1A 3GFFA 4S12A 4NYMQ 1STOA 2JJ8A 2LCQA 4ZREA 3KUDA 2Y0DA 1TO6A 2HN9A 2PX6A 2V7WA 1N9ZA 3A4YA 5KTRA 1U8YA 5SY4A 1T13A 4NBUA 1I36A 4QU5A 3DEKA 5DV9A 4EELA 5HQ3B 2QQ5A 4KVZA 4O5AA 1YUMA 3V1LA 2GILA 1LFAA 3LNTA 3HYCA 1WTAA 1Q84A 3E2PA 4ESHA 2DBZA 2YY7A 2XCSB 1ZD3A 2JLQA 3OEHA 2WPDD 4LTDA 4NX2A 3ER8A 4PWYA 4C04A 3OQVA 3R0QA 5TX7A 2F3QA 5F7XA 3X2EA 5JNVA 3TOVA 3JXEA 5FF9A 1ISGA 4XM0A 1Z6QA 1IBLB 1BVUA 1UBSB 3S2FA 3V33A 2PEZA 4YXWD 3NKLA 3F67A 3OA2A 4U3JB 3EXIA 3QLUA 5JC1A 2G67A 3OZBA 3FOZA 3CFYA 4FK8A 1FW6A 4IM7A 4LYEA 2HL6A 1JKFA 3T3MB 2IEZA 1JFVA 3AR5A 3HA3A 4E5DA 1C7IA 1GNRA 2H9YA 3IIKA 4BEWA 4QQNA 2CJWB 4Y2UA 5HPYB 4NG5A 3O75A 3PHBE 1GKYA 2FWIA 5KHLB 3DFFA 1V3UA 2X1MA 2EJCA 1BWQA 3QOXA 2O19A 1SHZA 3TTXA 3E81A 4BP3A 3VDXA 1Q22A 2YIMA 4ZZIA 5D5QA 2C77A 2OCBA 4Y2SA 5PGMA 5T67A 4CIDA 1B6RA 5TQVA 1PNRA 1TVKA 1N3LA 3RIXA 3IESA 3KZNA 3M1LA 1Q17A 4R1NA 4KQWA 4OA8A 1DG1G 4OIMA 3QELB 1G3RA 3PC6A 4PIMA 3GRCA 1GOTA 3B70A 3CR7A 4TLEA 3GGJA 3GNTA 5CFNA 5J9FA 1GG8A 1CJSA 2BISA 1AGPA 5G4KB 3JSXA 3SYNA 2J0SA 7ABPA 1SIWA 3N87A 2VJKA 4GX2A 4UHJA 4F5EA 1WAMA 1RHQA 2NU9B 3R3SA 4R7GA 2BC9A 3ACBA 3PUHA 4HG2A 2I87A 1Y6QA 4PPGA 3G59A 3ZWAA 2HJ9A 2PCJA 3NM6B 1MABA 3VU0A 5CK5A 3VU8A 5LFAA 3DR5A 4U6SA 5CX4A 3K4QA 1TQ2A 4CZ2A 3BWBA 3KFVA 3OAAA 4JU9A 3C8DA 3ANSA 1MRZA 1XDDA 1QONA 1TECE 4I4CA 3GCDA 3WTCA 4D8UA 1GTSA 2CBXA 3DDOA 3LL4A 4ZVPA 4YRMA 2WAOA 4POOA 5MHTA 3VR5A 5KOYA 3ISVA 4HVTA 4HDMA 2CJWA 3VNAA 4HUJA 5KU1A 3CXRA 1RWVA 2QAIA 2PYIA 4XPIA 1YB6A 4B1FA 3TFWA 3IDFA 3SZMA 2KLBA 2YNMD 5JCOC 4IXTA 1W7AA 2GNPA 3AT1A 1FLAA 4D7AA 1CZKA 5JNWA 5C3MA 2HA5A 1YIOA 1VPTA 3N75A 3PGMA 1ETHA 4KE7A 1QUFA 2I6QA 4G5HA 4WZBB 5L3RA 5ALUA 4HS9A 2OCKA 3PU6A 4P38A 4XD7A 1NDUA 3G2LA 2NU9A 2GFHA 3Q72A 3RT7A 5IPFA 4YP9A 3BWYA 3ETJA 4J6FA 4B5LA 2H0AA 3NHAA 3KYIB 1NI4B 4LZJA 3FNQA 2QRVB 1M2OA 2FEPA 5LLSA 4C03A 1YFLA 3GRPA 3N39C 1L5ZA 1SK8A 1AM4D 2APJA 4L3OA 1KK1A 3P7MA 3DV0B 3IPCA 3IAS1 5E6SB 3PUJA 4O4JF 3JVIA 3E9NA 1I6WA 2COUA 1ZWLA 2PKCA 3ECCA 3LBFA 4GXRA 4DV5B 1X1DA 3RAEC 1TKRA 3Q9LA 1OHHA 2O3QA 3RJ5A 2CFIA 1GWNA 3KC2A 2C5LA 1XDZA 3JVEA 1UMCA 2PMEA 3D4IA 1U8CB 1L3IA 3PF9A 2O50A 4G63A 1NIJA 5DNYB 3UB4A 5TS2A 2IYNA 2D1RA 4YV7A 2GKGA 3I72A 2BBWA 1YVEI 3LYHA 1FU4A 2BMFA 3DAGA 5GM1A 4EY4A 1SFRA 2JH8A 2WUGA 3H4IA 1MQAA 3M5DA 4JZKA 1LSSA 1M34B 1OR8A 2QTCA 4Q9JA 2VSFA 4AUNA 3PRHA 1W9MA 3F6PA 3PXCX 2ZVDA 1R37A 2Y2VA 3JV7A 2QN6A 4WJKB 3TAXA 3K0AB 1S1CA 4C08A 4E12A 2BKLA 4UULA 1GAEO 1ZZEA 1XI2A 1W2GA 2OHHA 3DBOB 2W43A 1EVIA 3ZKWA 4KBGA 1CRLA 1U1EA 1SXGA 4MLZA 3UAOA 2C0QA 3JQAB 4FIDA 3P27A 3ETLA 4TL7A 3WGGA 4CLEA 1RADA 3CMMA 2J9FA 1WDTA 1UJ5A 2JFQA 5KTNA 2YN4A 5L7YA 1L5MA 2O8DB 2W2TA 2X0JA 4AZ3B 3L7IA 4D9HA 1LC3A 3EOZA 2I76A 2WU3A 3FPHA 1IWOA 4J3JA 3ZV4A 2EDCA 4N54A 2WUVA 2VDJA 3B38A 1MH1A 1N2JA 2MINB 1NRJB 1C0LA 2GJSA 1E2QA 1SC4A 1GN9A 2IZ7A 3DVAB 1NUHA 2VHUA 3AB3A 4IKPA 1RDFA 3NOOA 4XR4A 2MYNA 2YCBA 2AD1A 3UMYA 2VJDA 3U7FB 3HBJA 4HUQA 1I6LA 2QTLA 3D6AA 1A97A 4R2LA 5EMLA 1MLDA 1DPFA 2EGHA 3FRHA 3RS9A 2ADOA 4REMA 1V47A 2H4FA 2G06A 4KYIB 4N5IX 2F2TA 2O2GA 2ERXA 3ICPA 4GM4A 3SLRA 3VGJA 5KOJA 3VR6A 1HFEL 1X7XA 1Z8FA 1LJUA 4JT2A 2OFFA 4ALNA 1BEZA 1NNSA 1C1YA 3KLNA 3PGVA 1XPOA 1UC9A 3EZYA 3ND5A 3R0ZA 4R1PA 5I7VA 3NCHA 1DAFA 4HAOA 4NZZA 3GHYA 2QRPA 4R83A 4V0OA 3VPFA 4BB9A 4YV1A 4TZ0A 5CT5A 2C84A 4NH4A 1AHPA 1FRVA 3HCOA 3U4CA 2JFNA 2GZMA 1ZM2A 1QWOA 3L7KA 4X63A 2OLJA 4ZOLA 1NJ6A 4MYSA 5TQ2A 3WWEA 1PX2A 1A96A 4OHVA 2G7ZA 1YZ3A 4O5OA 4GBMA 2DP4E 3QWBA 4O2RA 2JGDA 2NTVA 3SHOA 3T9EA 1C4WA 3CCFA 3DVRX 3RU9A 3M1YA 3MGKA 1RTKA 4BDTA 1OLUA 1P33A 2CUTA 3GDFA 5BQXA 2IPLA 1YZVA 1T24A 2ZIAA 3GJ5A 2A57A 4FHCA 1E2LA 2JAWA 4EF6A 4ER7A 5KVSA 2JLZA 3THWA 4Z4EA 2IHTA 5IAOA 3JQ7B 4X8LA 3OT4A 1V8ZA 4JWTA 4RAQA 4Z0TA 4JVNA 3UMBA 4A73A 2D4HA 2AR9A 4XDGA 3ZV5A 3B1WA 2QV7A 3ELWA 2G28A 3MELA 3G9XA 2PKQP 1BDJA 4CNBA 1JT9A 2GCGA 1I14A 4MTCA 3CZ9A 4RDCA 5HRCA 4BS9A 2C29D 3THYB 4JVMA 4G25A 2FWRA 3RB8A 2FMTA 2CYCA 1NPTO 5AOVA 2ZKIA 3SVZA 3VGPA 5AQ1A 4KR6A 1NATA 2G0AA 4G0WA 4NATA 4P31A 1BU5A 4J0FA 4YHHB 1DWQA 4HX9A 1SG9A 4M49A 3TLGA 1Q21A 2H5IA 3LUBA 5AKHA 1LPOA 4Q1AA 1FCJA 1XNGA 1Y4ZA 1J8MF 3QMMA 3N9IA 3AIMA 4JEHA 2O6LA 4L0QA 1CS0B 1L7XA 1UP6A 4UOZA 1B3RA 1Q3KA 3QV1A 2BW0A 2PO7A 3L7YA 4E1BA 1ZXXA 3HJAA 2NSLA 4KPUA 3AUYA 1XXHE 3L8FA 5AVVA 2NU6B 5MN6A 2JCVA 1B1AA 1NHWA 1ZN7A 1M5UA 2IJGX 3U3OA 4MQLA 3PFIA 2OHVA 3PJFA 1J2EA 4WVLA 5JJBA 4DUGD 4EGQA 3E3OA 3GRAA 1JVNA 3TLCA 4BZZA 3GMDA 2ZATA 3JZIA 1QR2A 2QQ0A 5AO9A 3VPHA 2FVXA 4KQCA 4NLLA 2G8NA 2XBMA 1UT8A 3DS8A 4BE4A 4Q34A 3TPCA 1TIBA 2MYTA 1GL3A 4J0DA 4XZ3A 5B1SA 1T15A 2JATA 1LBSA 4C06A 3ITNA 1FLVA 1CXZA 4MRMA 2FSVA 2B7LA 1UK9A 5M2QA 1OT3A 1E3MA 5JNUA 1M7HA 4RWEA 1GRRA 1UP4A 2X23A 2QAGC 2VO1A 2WKRA 3G0DA 3KEMA 4DXDA 5JDCA 5JJ5A 2E87A 4KFRA 2RGNA 4F38A 1YRHA 1OFIA 1QS0A 2GA8A 5HIAA 4EDHA 2WYOA 3DE6X 2GYVA 2RGWA 1E5DA 4KO1S 4B3BA 3H2BA 1P44A 3DPSA 3UQZA 3ITEA 4UNIA 1TU0A 1ECPA 1P6UA 3H65A 3G5LA 1YQQA 3FLMA 3I8OA 1R3DA 2PBFA 1HLGA 5ANRB 1B15A 1ORTA 3H8WA 5KEIA 2QA5A 1E1KA 3T7EA 1UOOA 3DYIA 2F17A 1Z8NA 3G13A 5DXFA 4M9XA 2C8JA 3ZZMA 7YASA 1Z2AA 2V4UA 3LLCA 2VEDA 1LY1A 1NN5A 1T1RA 2FQWA 2Z95A 2X4GA 3IVCA 3ORSA 1CZUA 1YA6A 1T9GR 4OJTA 3WQBA 1EBBA 4AJ9A 3WXMA 1W88B 3V9PA 2QN9A 5B6JA 4G01B 3SLGA 3RU7A 4JHXA 4UM8B 1JPUA 3OUUA 5IMSA 1EUCA 1T6NA 1TF2A 2IEDA 2JBHA 4Y6RA 1EDOA 2P91A 3ENQA 1L5OA 4YGYA 4Z0HO 4PIVA 3RYHB 5KQRA 1U1GA 3CUWA 3UANA 2O23A 4Q4JB 2OMEA 4G09A 3AUUA 1H69A 1VDMA 3N2GB 2A3NA 4PZLA 3THRA 1G6Q1 3E1KA 4KPGA 4C7MA 1FFDA 1H9AA 3R5KA 3Q40A 4G0MA 3RTAA 2ZT6A 4YCDA 2C42A 3H1BA 5JXJA 1R0WA 1WMBA 4TM8A 2BR3A 3RYFB 5D7BA 3JZAA 4D9EA 4L9WA 4OH1A 1ADBA 4L9RA 4MP8A 5G0VA 3RC7A 3X2SA 4LYAA 1DP4A 1U5CA 3OA0A 4GICA 1EVZA 3DMPA 1GZHB 3GLRA 1PJQA 3LS2A 3WYGA 4B79A 3E7DA 1K2WA 2FWMX 5BVHB 1QAMA 1Y9ZA 1K3TA 4PC3A 2WQ6A 3JPWA 5B3JA 4XLTA 2QVBA 1VG8A 3JQ7A 4DCNA 2WF5A 1A50B 2X5JO 4I1UA 2J85A 4F91B 3IMGA 1FYEA 3NRBA 5H9WA 4JUFA 2IOFA 2P27A 1VGQA 4EMBA 2WF9A 5BN1A 3OLCX 3WIBA 3ANNA 5AKEA 1E1RD 3WFZA 4AJEA 3G5TA 5HMMA 4HEA1 5CT9A 3RJMA 5I6DA 3GO4A 4RY2A 2Z8ZA 4B2PA 1L7BA 1LWNA 2YIVX 2VPZA 3FFWA 4DWOA 3FDZA 1I4TD 2E6KA 3FFAA 1U1CA 2DFVA 3Q0IA 3KPUA 3NTVA 2W2KA 3DAYA 4ZYVA 2PLRA 4MMZB 1OWNA 1T5TA 3QBJA 3I9OA 4XSVA 1Q6ZA 1I3LA 3ZGVA 3W5CA 3I1JA 2QX9A 3PEYA 4LCEA 4KGZA 5BN3B 2VDMB 1ACLA 4RPJA 1VSQA 4PRZA 1YHZA 2VHWA 4AJ2A 1SCBA 2BOVA 3DLBA 3AESB 3P9PA 4G1BA 1K8YB 3DV9A 4P4SA 3WMGA 4G1FA 2QY6A 3UJ7A 1GSHA 4PQEA 1TC1A 4HBGA 5DI3A 2PWAA 3MHPA 4RMIA 5MGNA 1HUQA 3DZ8A 2H1IA 4DA7A 4AYXA 2FA9A 3IILA 3FRIA 1D6JA 2PZGA 2CHQA 2VH2A 1EK5A 3FB1A 1TJPB 1V3VA 1XXHA 3P5SA 4AJHA 1W581 1ZK1A 5EUQB 4CHTA 3KYDA 1IN8A 1UAAA 3SF8B 3AVUA 1YJAA 3BDIA 2O3RA 2C5HA 1A2BA 5KJ1A 4LDNA 2JAXA 5T6MA 2IEGA 5JUWA 1L4KA 2ES4A 4HQLA 4YRNA 1TEZA 1QR6A 3H9QA 5PNTA 4KLCA 1Q20A 2FWNA 2ZR9A 1PWEA 4F5ZA 2QX4A 4ALJA 4DB2A 2FG7C 3PWSA 1NVMB 1GGHA 3MN1A 4WZBA 4TVSA 1VHQA 2V5UA 3JQDA 2W42A 1OU4A 2PRZA 4CI9A 3HI6A 2XADA 3SKYA 1KZ9A 1O96A 3ONVA 5HDQA 3P9QA 1RAGA 3KT0A 4EJ6A 2PXCA 1N75A 1EXWA 3CTPA 2ZLBA 3ET5A 4L9SA 4M89A 3OZGA 3QPCA 4OK3A 3WBKA 2XNKA 5JQWA 3QPBA 3V7NA 3HR7A 3PNLA 4JB0A 1ZUNB 2VCEA 3QKRA 2R9VA 2BMEA 4NYJR 1P9WA 1VHDA 2E21A 3F74A 5F7JA 4XIGS 1QGZA 1UFQA 2HHLA 4A6EA 1HLFA 4ND8B 4C2AA 1H85A 4CTOA 4MCHA 1Q0RA 1CW2B 1W6RA 1YOBA 1H3NA 1ZGCA 2JANA 3IR7A 2F67A 4LXHA 3GYBA 4OQPA 2CYBA 1PD0A 2R8PA 2XY4A 1A95A 3R5XA 4G5RA 2PBRA 1YBAA 4ZAGA 4CQMA 4FB4A 2O0HA 4BDSA 3C5VA 1QH1B 3DKKA 3IEMA 1A69A 1BFDA 1X7WA 4IILA 4WOJA 5ICGA 2DH5A 4JIMA 3KEQA 4MS1B 3L1KA 1XGKA 1JQJC 3RK1A 3D4BA 3IJEB 1CQWA 3JQRA 2JEOA 1BYIA 1P0MA 2A94A 3ZDRA 1LLFA 2GJ9A 2FN8A 4I50B 1R8XA 3F97A 3GAFA 3GCXA 3GFOA 3GQVA 4MKXA 3F46A 3TZHA 3ZW8A 4NCBA 1NQXA 1FDRA 1E0KA 1PT9A 4PCVA 4B71A 1KDPA 4KDFA 4NHOA 1SVWA 1TVKB 3BH7A 4W5NA 1V6AA 2GXUA 1FSSA 2ZUVA 3EWSA 1JECA 3GN1A 3PBKA 3WLNA 2AI1A 2P0EA 3JZMA 3V4VB 3K5WA 1YK1A 1HRDA 5AJYA 4FFSA 1IUOA 3KR1A 3OJEA 4MYUA 4RGQA 1BWPA 4YIKA 3RR2A 5FL3A 3N2KA 4HDMB 4BUJA 1GILA 3A1SA 3NM4A 5AM4A 3DT6A 4ZARA 2XNHA 5GM2A 2O8BB 2IHZA 2XBUA 3GLIA 3HJGA 4DSUA 3Q8MA 2Z9BA 1VCIA 3MT0A 4N7JA 3F6RA 5JEDA 4IHJA 5DVZA 4EG3A 1LC0A 3ANMA 3EQ6A 1CJBA 2IOHA 4OL0A 4XOUA 3TGWA 1DAMA 2OXFA 5D8DA 5JS2A 1Z0SA 2DM6A 3KT3A 3WX0A 4TZTA 4L4RA 1XTZA 2PMKA 4N5DA 4YYZA 1WMAA 5BN4B 2OGUA 1CUVA 4NL4H 3ROTA 3V4SA 4ARIA 3UK7A 1NXWA 2XODA 3VTKA 1TQDA 3NHJA 3LY5A 5EQTA 4A23A 1KY2A 3S55A 4PR3A 4ENTA 3CW2A 3JTEA 2KB0A 3K1YA 1WPRA 1DARA 5CB4B 2TSYB 4JVSB 4RCYA 2YASA 3K8YA 2OOKA 3R8CA 1FFCA 2I7TA 2ERYA 2A1UB 2P1ZA 3D0KA 2OCPA 2YYZA 2ODAA 5GJVC 2H7XA 4YPFA 2Z1MA 4FN5A 4G5XA 3VXKA 2ZUFA 3DNFA 3FCUB 4P5PA 3O90A 2CF5A 4L0CA 4URYR 5AIAA 5H16A 3IQIX 4C4SA 5AHOA 3UXMA 1YQWA 2ACWA 1BJRE 5IG2A 2PZAA 4RZ2A 3P0RA 3HKEA 4GAEA 1UDBA 1KEWA 2PH5A 2YL2A 4MKHA 1HNXB 4U2KA 4I9NA 3ZU4A 4YDHB 4CQMD 3ZJ4A 3LKBA 2P2CA 4DCUA 4DSTA 2C4HA 1FBTA 2CNBA 2G70A 4GX1A 4X7MA 2HNAA 1NN3A 1U65A 2ZQ5A 4WNCA 4ARBA 2MSLA 1FDIA 2XYPA 2BF4A 1JI3A 5ITZA 3HNOA 3S6JA 3G1TA 5IJ0B 2UU9B 1QU3A 3MMPA 3SBEA 2H59A 3DT9A 3ZHCA 4PU0A 1H4VB 2QVZX 1L7RA 3I9FA 1ZGGA 2RCNA 4PLFA 1JG7A 4QDZA 1W2HA 1N2SA 3MLBA 5JRZA 5J2TB 2XCLA 4IXMA 5A2GA 2D1FA 2RHDA 4BNUA 1TCVA 2Q5JA 1U3TA 2Q49A 2QB5A 4RO0A 4ZPXA 3BG5A 5HGXA 2O8BA 4GRAA 4B3SB 4HGYA 2Z6AA 1W75A 4B6EA 1RPZA 2W6ZA 4Q15A 5JDCC 5F1KA 2PKQO 3K1JA 4RH0A 4HAYA 3PJEA 4GOND 1L5HA 1U1DA 4NMHA 4E5SA 1BFKA 1E64A 2W6ID 4AN4A 2IT1A 1E3EA 1RYDA 1E9DA 2ONCA 3GARA 3TSZA 3KJGA 2GN2A 3H8SA 2EWMA 2R2GA 3JQQA 1GNLA 4QGGA 7GPBA 3EGXA 3V42A 1EXMA 1U3VA 4GKVA 2IPMA 1P2SA 1P80A 1LQ2A 1U94A 2I2CA 1Q77A 1FBNA 2XSZD 1DUIA 2ZAMA 3A3PA 1ODKA 2W6CX 3HWRA 4RQAA 4RVSA 5LD2B 3QJGA 5JVDA 5TF4A 3RRYA 3BA6A 1C50A 5T6BA 3C3DA 4IDBA 4WZBE 4DR2B 1ZSVA 4ZVUA 1R8SA 4K6CA 5EZSA 1O89A 1WRBA 2BFDA 1P4RA 3QKSA 4Y2XA 4QRIA 1XAIA 2YV4A 3ZXYA 3KETA 1L4NA 3R3YA 3TEJA 3RIYA 3VYRB 2VF4X 3UBMA 3D54D 3SLKA 1RWWA 3DV0A 3LFHA 4JLAA 1U28C 1RHRA 4U0JA 4BNKA 2J7KA 4M7OA 1E9BA 1SOVA 2BJWA 2B92A 2XXBA 4LF8B 4YCJA 4RL4A 4DMLA 4PGHA 1N6RA 1EWYA 4L27A 1B7GO 3GAZA 3RTEA 1G6HA 1HXHA 3P32A 4KX5A 1BX1A 4I4NA 1FTSA 1QK5A 4M0MA 3ZQKA 1RVDA 5GADl 4HH0A 2PKWA 2AN5A 1I3NA 3ENNA 3ZWMA 4JLKA 2YOFA 5ABPA 2ZUBA 2QW1A 4XB1A 5JPCA 3W3ZB 2B94A 1CFZA 1NT4A 1BXGB 4YJFB 4U5QA 2G0TA 2AX3A 4YMSA 5F12A 3EXHC 4B2IA 5CG1A 2FEOA 3LYAA 4A8JC 4QPJC 1FUKA 1P9OA 2JHGA 1CUBA 2OLEA 3FUTA 1RXSA 3NDJA 4EZEA 2RHRA 5BXQC 2FPWA 1E9SA 2FR8C 4RHFA 1PVOA 3I6QA 1A1VA 5ALQA 4I46A 4LRYA 1C41A 3A6JA 1I1HA 1W5SA 3ND6A 2GYYA 4FDUA 2BHLA 3GELA 3H97A 1IN5A 1GPDG 3MGCA 3PNPA 2IDMA 4L28A 7REQA 5E2AA 1C8VB 3TXYA 5EIBC 2XVMA 2ZYAA 4RH1A 4ZVLA 2EKZA 1NM5A 3WKDA 1M1YE 1TUIA 5FR1A 3A6PC 2J45A 3KTAB 1QKKA 4HLNA 1IM8A 3EZXA 3PQFA 1N9KA 4KVAA 3UT5B 4ZJZA 1GFIA 3GXBA 3KU1A 3O2NA 1D1PA 4PINA 4WKOA 5ERGB 2A5GA 3OI7A 1KTIA 1AKNA 4DMMA 3JALB 3I5AA 4PWZA 1Q7CA 4O0MA 2AF3C 1UM9B 3PHGA 4MRAA 4B47A 1TF7A 4P80A 4DILA 2FN4A 1KAGA 5COAA 3TFOA 3MWJA 1S3SA 3KT6A 3O1LA 1QZUA 4D8VA 3LCRA 3EARA 4UDNA 3RARA 3UUWA 4CDRA 3VOTA 1BJKA 1GGJA 2RH8A 3SE0A 3FZNA 4EATA 4UUAA 1IWPB 1G2IA 4OI4A 3EZFA 1NDQA 2HTFA 3L1VA 4NBVA 2FZCA 1Q2UA 3NV7A 4E94A 5AKJA 4IKOA 1XFDA 1EDDA 4O4HA 1TD9A 4RJTA 1C3LA 4HDSB 5LU9A 4M86A 3JQ8A 1KZ4A 4EHAA 3B5IA 5K8CA 1RP1A 2J5QA 2YX1A 4DBVO 1P0IA 4Z0NA 4LRWA 2BT4A 4NU5A 5DH9A 3UAWA 2D1SA 3I39X 4NENA 1FQOA 3KPYA 4AXBA 2VPWA 1G20E 1USGA 1V71A 1VPEA 2WICA 1H2YA 3BAZA 3BGIA 4JYCA 4PPFA 4A82A 5LWQA 2X5OA 1K9VF 2GYUA 1QRUA 1TYEB 1I51A 2A33A 2PAFA 5LPNA 1DEAA 1I2ZA 2O52A 1K27A 1U7HA 3LBAA 3BQMB 3OTIA 4MYTA 3M89A 1GPYA 1UBHS 1THMA 1XMPA 2NNWB 3RYFA 5KYNA 3QTTA 1GU1A 1KYQA 1Y7LA 1L4LA 5DSTA 3RYCA 1I7DA 5AKKA 4AZSA 2AXPA 2Y1WA 2P3LA 3IAAA 1F6BA 3Q7TA 4ITUA 4BE9A 1DBVO 2O1EA 4MQUA 1WZ2A 4LHWA 1XKLA 3EE6A 5CH8A 4QYWA 4CI0B 1JI0A 2NW6A 2V0NA 4GWGA 4A8TA 5C32A 5EEGA 3LF2A 5HE8A 3GHHA 3WGJA 3WLLA 1CY7A 2GRJA 3E3MA 3KB1A 1LCIA 2XD4A 1GFZA 4MGYR 3H9GA 4TTTS 2EATA 5HA5A 2V4ZA 3RHTA 3T4PA 2I7CA 1XRMA 5JVDF 2HNBA 4HWKA 4A9AA 1GQRA 4X71A 5CVVA 1SY7A 5IX8A 1UEIA 2PD6A 4S04A 4CETA 2R65A 3STXA 1GUFA 4IVPA 3TOZA 2IXEA 4EW6A 4LJSA 5BQOA 1F3OA 2J3QA 2H8KA 3GLIE 4M0KA 4P32A 3ZJVA 4JLBA 5AJVB 1T36A 4WXEA 2CNLA 2VDOB 1H4TA 4B85A 1VRWA 2PT9A 5FBKA 3CW8X 2XRYA 3CKYA 1M8JA 3KAPA 1L5YA 1Y89A 2DUUA 3WRXA 1TAQA 4W5OA 1KYIA 5KTTA 2BFBA 3RBAA 3QUCA 2OM2A 4FWBA 2DE0X 2Q4BA 2ZE7A 1V5FA 1X80B 2DWQA 4Q1FA 2JLVA 3L5OA 4QXAA 4LFAB 1KEVA 1QV7A 1XVLA 3GUHA 4Q4AB 5E3HA 4AY2A 4IJ6A 1BHO1 1ZGBA 2FEAA 3NHSA 4OG2A 4ZYWA 2ZBDA 3HZOA 3BJRA 5CAEB 4MJ3A 1IY0A 3MJSA 5JHGB 2QP4A 3J7TA 1SBYA 5CCBA 3IAUA 2YBEA 1N6NA 3OTOB 1T2AA 2PD3A 3F6YA 3A9TA 4F1JA 5C2JB 3AEUB 3V3KA 4ZGWA 1E2IA 2G5TA 4OXIA 3CUEF 1C0EA 1Q3HA 3LV8A 5B4TA 2GB4A 1TJ5A 5BURA 3P2KA 3T7TA 1A8HA 5HZHA 4GXQA 3CT4A 2TS1A 1PI3A 5KYUB 4TV9B 2NVWA 2YXDA 2ROQA 3K8ZA 4H35A 4LHEA 4OXYA 5ALIA 5JO9A 4CIBA 1NBHA 2B1QA 3U3RA 4R9RA 2X41A 4O2BB 3OPMA 1BVYF 2VWGA 2X4IA 4X8OA 3G0HA 1HFJA 1HYGA 1XZMA 3BBPA 1UJ6A 2ZROA 1CDEA 2PLNA 3LNCA 1UJ2A 5EUMA 2QE7D 1WULS 1ML3A 4OK6A 4RTQA 2B9EA 3AOEC 5A9SA 4MRSA 5IXJA 2ZRMA 1AURA 1XLTA 2IUUA 1QRRA 4Y2PA 4JI4B 3IVMA 4GYYA 4J3FA 3PXXA 5LA6B 1IJBA 3BHJA 1DKNA 5JH7F 4ZV7A 2BPOA 3G0BA 3C5WP 3KLBA 2ODEA 4OQDA 1LQTA 4TLBA 1TYCA 5IASA 5DM0A 2E85A 4WACA 3ILVA 1D6MA 2G4LA 3FVQA 4GIBA 5ECYA 1K0FA 1C3VA 3IERA 4MH0R 1GZ6A 3BDVA 3WWCA 5C8XA 5LCXA 4L7QA 2QBYB 3VR6D 2X40A 2Y3IA 1TUBB 4O2BF 4NZYA 5JW6A 5KSOA 5KOHA 3NBQA 4XXHA 1P5HA 3VKHA 4YJGB 3RQIA 1R0ZA 4M83A 3E0QA 3FPLA 1DMSA 4URVR 3QBTA 1G3QA 2UUPA 1YR9A 3OT5A 3PHJA 4PR0A 1G9TA 2GHQA 3EFBA 2JFBA 2OP0A 2PV0A 1JHRA 4LRSB 5DYWA 5AXDA 5SYMA 3ET4A 5TT0A 3SSAA 4CIXA 4QOJA 3S8EA 1UPXA 5IT0A 1KFBB 1SXJD 3EHEA