1JJ2E

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1jj2E01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1jj2E02
5JVHE 4U67E 3CMEE 5GADG 1VQKE 1N8RG 2ZJQE 3CD6E 1W2BE 1Q86G 3G4SE 1YJWE 1VQ6E 3DLLE 1YIJE 1VQPE 3CC2E 3CCVE 1VQ5E 2QEXE 1Q82G 3CMAE 3J7ZG 1Q81G 1YHQE 5JVGE 1Q7YG 5DM7E 1VQLE 3I55E 3OW2E 3CXCE 5GAEG 4WFNE 5AN9B 5MLCH 1QVFE 1KQSE 3I56E 3CPWE 1K9MG 3G71E 1VQ9E 2OTLE 1YI2E 1K8AG 3CCEE 1JJ2E 3CCQE 3G6EE 3CF5E 1VQOE 3PIOE 5GAGG 4IOAE 4WFBE 5H1SI 3CCRE 1RL6A 4WCEE 3CCME 5HL7E 4IOCE 1VQME 1YJNE 1NJIG 5DM6E 3PIPE 2OTJE 1S72E 1QVGE 1K73G 1VQNE 3CCUE 4WFAE 3CCLE 4UY8G 2CQLA 1M1KG 2ZJRE 3CC4E 4WF9E 1YITE 2QA4E 1VQ8E 1YJ9E 1VQ4E 3CCJE 1VQ7E 4IO9E 3CCSE 1KD1G 2ZJPE 5GAHG 1KC8G 3CC7E 1M90G
chains in the Genus database with same CATH superfamily
5JVHE 4U67E 3CMEE 2AF5A 5GADG 1VQKE 1N8RG 5B2AO 2ZJQE 3EC5A 3CD6E 1W2BE 1Q86G 3G4SE 1YJWE 2OYBO 1VQ6E 3DLLE 1YIJE 1VQPE 3CC2E 3CCVE 1VQ5E 2QEXE 2FKJA 5B10O 1Q82G 2OY7A 3CMAE 3J7ZG 1YHQE 1Q81G 1OSPO 5JVGE 1RJLC 3CKGA 1Q7YG 5DM7E 1VQLE 3I55E 3OW2E 3CXCE 2PI3O 5GAEG 4WFNE 5AN9B 5MLCH 1QVFE 1KQSE 3I56E 3CPWE 1K9MG 3G71E 1VQ9E 2OTLE 1YI2E 1K8AG 1FJ1E 3CCEE 1JJ2E 3CCQE 3G6EE 2OL8O 3CF5E 2FKGA 1VQOE 5GAGG 3PIOE 4IOAE 4WFBE 5H1SI 3IGEA 3CCRE 1RL6A 2OY1O 4WCEE 3CCME 5HL7E 4IOCE 1VQME 1YJNE 1NJIG 5DM6E 3PIPE 2OTJE 1S72E 1QVGE 1K73G 2G8CO 1VQNE 3CCUE 4WFAE 2OL6O 2I5ZO 3AUMO 2HKDA 5B3MO 3CCLE 4UY8G 2CQLA 1M1KG 2ZJRE 3CC4E 4WF9E 1YITE 1P4PA 2OY8A 2QA4E 1VQ8E 1YJ9E 1VQ4E 3CCJE 1VQ7E 4IO9E 3CCSE 1KD1G 5B11O 2ZJPE 3CKFA 5GAHG 1KC8G 3CC7E 2OL7A 3IG9A 2OY5O 2I5VO 1M90G
chains in the Genus database with same CATH topology
5JVHE 4U67E 3CMEE 5GADG 1VQKE 1N8RG 2ZJQE 3CD6E 1W2BE 1Q86G 3G4SE 1YJWE 1VQ6E 3DLLE 1YIJE 1VQPE 3CC2E 3CCVE 1VQ5E 2QEXE 1Q82G 3CMAE 3J7ZG 1Q81G 1YHQE 5JVGE 1Q7YG 5DM7E 1VQLE 3I55E 3OW2E 3CXCE 5GAEG 4WFNE 5AN9B 5MLCH 1QVFE 1KQSE 3I56E 3CPWE 1K9MG 3G71E 1VQ9E 2OTLE 1YI2E 1K8AG 3CCEE 1JJ2E 3CCQE 3G6EE 3CF5E 1VQOE 3PIOE 5GAGG 4IOAE 4WFBE 5H1SI 3CCRE 1RL6A 4WCEE 3CCME 5HL7E 4IOCE 1VQME 1YJNE 1NJIG 5DM6E 3PIPE 2OTJE 1S72E 1QVGE 1K73G 1VQNE 3CCUE 4WFAE 3CCLE 4UY8G 2CQLA 1M1KG 2ZJRE 3CC4E 4WF9E 1YITE 2QA4E 1VQ8E 1YJ9E 1VQ4E 3CCJE 1VQ7E 4IO9E 3CCSE 1KD1G 2ZJPE 5GAHG 1KC8G 3CC7E 1M90G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVH E;  4U67 E;  3CME E;  5GAD G;  1VQK E;  1N8R G;  2ZJQ E;  3CD6 E;  1W2B E;  1Q86 G;  3G4S E;  1YJW E;  1VQ6 E;  3DLL E;  1YIJ E;  1VQP E;  3CC2 E;  3CCV E;  1VQ5 E;  2QEX E;  1Q82 G;  3CMA E;  3J7Z G;  1Q81 G;  1YHQ E;  5JVG E;  1Q7Y G;  5DM7 E;  1VQL E;  3I55 E;  3OW2 E;  3CXC E;  5GAE G;  4WFN E;  5AN9 B;  5MLC H;  1QVF E;  1KQS E;  3I56 E;  3CPW E;  1K9M G;  3G71 E;  1VQ9 E;  2OTL E;  1YI2 E;  1K8A G;  3CCE E;  1JJ2 E;  3CCQ E;  3G6E E;  3CF5 E;  1VQO E;  3PIO E;  5GAG G;  4IOA E;  4WFB E;  5H1S I;  3CCR E;  1RL6 A;  4WCE E;  3CCM E;  5HL7 E;  4IOC E;  1VQM E;  1YJN E;  1NJI G;  5DM6 E;  3PIP E;  2OTJ E;  1S72 E;  1QVG E;  1K73 G;  1VQN E;  3CCU E;  4WFA E;  3CCL E;  4UY8 G;  2CQL A;  1M1K G;  2ZJR E;  3CC4 E;  4WF9 E;  1YIT E;  2QA4 E;  1VQ8 E;  1YJ9 E;  1VQ4 E;  3CCJ E;  1VQ7 E;  4IO9 E;  3CCS E;  1KD1 G;  2ZJP E;  5GAH G;  1KC8 G;  3CC7 E;  1M90 G; 
#chains in the Genus database with same CATH topology
 5JVH E;  4U67 E;  3CME E;  2AF5 A;  5GAD G;  1VQK E;  1N8R G;  5B2A O;  2ZJQ E;  3EC5 A;  3CD6 E;  1W2B E;  1Q86 G;  3G4S E;  1YJW E;  2OYB O;  1VQ6 E;  3DLL E;  1YIJ E;  1VQP E;  3CC2 E;  3CCV E;  1VQ5 E;  2QEX E;  2FKJ A;  5B10 O;  1Q82 G;  2OY7 A;  3CMA E;  3J7Z G;  1YHQ E;  1Q81 G;  1OSP O;  5JVG E;  1RJL C;  3CKG A;  1Q7Y G;  5DM7 E;  1VQL E;  3I55 E;  3OW2 E;  3CXC E;  2PI3 O;  5GAE G;  4WFN E;  5AN9 B;  5MLC H;  1QVF E;  1KQS E;  3I56 E;  3CPW E;  1K9M G;  3G71 E;  1VQ9 E;  2OTL E;  1YI2 E;  1K8A G;  1FJ1 E;  3CCE E;  1JJ2 E;  3CCQ E;  3G6E E;  2OL8 O;  3CF5 E;  2FKG A;  1VQO E;  5GAG G;  3PIO E;  4IOA E;  4WFB E;  5H1S I;  3IGE A;  3CCR E;  1RL6 A;  2OY1 O;  4WCE E;  3CCM E;  5HL7 E;  4IOC E;  1VQM E;  1YJN E;  1NJI G;  5DM6 E;  3PIP E;  2OTJ E;  1S72 E;  1QVG E;  1K73 G;  2G8C O;  1VQN E;  3CCU E;  4WFA E;  2OL6 O;  2I5Z O;  3AUM O;  2HKD A;  5B3M O;  3CCL E;  4UY8 G;  2CQL A;  1M1K G;  2ZJR E;  3CC4 E;  4WF9 E;  1YIT E;  1P4P A;  2OY8 A;  2QA4 E;  1VQ8 E;  1YJ9 E;  1VQ4 E;  3CCJ E;  1VQ7 E;  4IO9 E;  3CCS E;  1KD1 G;  5B11 O;  2ZJP E;  3CKF A;  5GAH G;  1KC8 G;  3CC7 E;  2OL7 A;  3IG9 A;  2OY5 O;  2I5V O;  1M90 G; 
#chains in the Genus database with same CATH homology
 5JVH E;  4U67 E;  3CME E;  5GAD G;  1VQK E;  1N8R G;  2ZJQ E;  3CD6 E;  1W2B E;  1Q86 G;  3G4S E;  1YJW E;  1VQ6 E;  3DLL E;  1YIJ E;  1VQP E;  3CC2 E;  3CCV E;  1VQ5 E;  2QEX E;  1Q82 G;  3CMA E;  3J7Z G;  1Q81 G;  1YHQ E;  5JVG E;  1Q7Y G;  5DM7 E;  1VQL E;  3I55 E;  3OW2 E;  3CXC E;  5GAE G;  4WFN E;  5AN9 B;  5MLC H;  1QVF E;  1KQS E;  3I56 E;  3CPW E;  1K9M G;  3G71 E;  1VQ9 E;  2OTL E;  1YI2 E;  1K8A G;  3CCE E;  1JJ2 E;  3CCQ E;  3G6E E;  3CF5 E;  1VQO E;  3PIO E;  5GAG G;  4IOA E;  4WFB E;  5H1S I;  3CCR E;  1RL6 A;  4WCE E;  3CCM E;  5HL7 E;  4IOC E;  1VQM E;  1YJN E;  1NJI G;  5DM6 E;  3PIP E;  2OTJ E;  1S72 E;  1QVG E;  1K73 G;  1VQN E;  3CCU E;  4WFA E;  3CCL E;  4UY8 G;  2CQL A;  1M1K G;  2ZJR E;  3CC4 E;  4WF9 E;  1YIT E;  2QA4 E;  1VQ8 E;  1YJ9 E;  1VQ4 E;  3CCJ E;  1VQ7 E;  4IO9 E;  3CCS E;  1KD1 G;  2ZJP E;  5GAH G;  1KC8 G;  3CC7 E;  1M90 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...