1JJ2F

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 1jj2F00
3CMAF 5GIPC 1YJWF 1RA4A 5GINC 1JJ2F 1GO0A 3ON1A 3RA5A 2QEXF 2QI2A 2QA4F 3CC7F 3CCUF 3CCLF 1E7KA 5EWRA 3JCMM 3NK7A 1VQ8F 5FLXM 2I6DA 3CCQF 3VMFB 1YJ9F 1GZ0A 3E20B 4X3LA 3CD6F 5GIOC 3CPQA 3V7QA 3CCRF 3J81M 3RA6A 1NJIH 1YIJF 3CXCF 4X3MA 3NK6A 3N4ZA 2VGMA 1N8RH 2OTLF 3CG6A 3LFOA 4BW0B 1Q81H 1K9MH 1W40A 5IT9M 3G71F 3CCJF 3J80M 4C4WC 1K73H 1VQPF 1Q7YH 2KG4A 3AGKA 1S72F 3NVKE 1T0KB 1VQ6F 1CK2A 1KC8H 3I55F 3J7AR 4BY9D 3SIVA 1VQKF 5G4UC 1ZWZA 3LWPC 1QVGF 3NVIB 5GANK 3CCSF 1Q82H 5A2QM 1RLGA 3HJWC 1KD1H 3G6EF 1DT9A 2AIFA 1IPAA 1M90H 1PXWA 3FFMA 1NMUB 1VQ7F 1M1KH 3OW2F 1VQ5F 3CC4F 3LWOC 2OTJF 3N4YA 1VQMF 1VQOF 3LWVC 1KQSF 2ALEA 2HVYD 3VI6A 2WALA 3G4SF 3IR9A 2CZWA 3NMUC 1YHQF 4NUTA 2OZBA 3CCMF 4TZZA 3E1YA 1QVFF 3LWQC 3PAFA 1SDSA 1W3EX 3GYQA 3CCEF 1VQNF 3MCAB 3JAMM 1Q86H 2OHWA 3CMEF 3CPWF 1GO1A 1W2BF 5GAPK 1YITF 1VQ9F 1VQLF 2LBWA 1K8AH 1W41A 1X52A 3O85A 2KTVA 1YI2F 3WXMB 2KTUA 3HAXD 1X7PA 3LWRC 2VGNA 2JNBA 3I56F 4LCKA 1W42A 1XBIA 3CC2F 1VQ4F 1YJNF 3SIUA 5EO3A 3PLAC 2FC3A 5FJ4C 1X7OA 2BO1A 5DCVA 5G4VC 3OBWA 3CCVF 3OBYA 3V7EA 1H7MA 2LBXA 1CN7A
chains in the Genus database with same CATH superfamily
5GIPC 1UFYA 1RA4A 2AMTA 2Z01A 1JJ2F 1GO0A 2RHHA 2VXYA 5LYJA 4ZHVA 1GX1A 2QI2A 3WJPA 2CHTA 2QA4F 5LXTB 1YGYA 1E7KA 5EWRA 3VO8A 3NK7A 1U3LA 3HKDA 5EZYB 1JN1A 2VAMA 2UZHA 3D54A 3E20B 4YJ3A 3F0DA 5LA6A 1DBFA 5GIOC 3CB2A 2ZF8A 3VIUA 3P0ZA 3V7QA 5LOVA 3LDTA 3RYFB 2CW4A 1VQVA 2CHSA 3N4ZA 3T80A 4WBNB 1ODEA 2Z1UA 1Q81H 2Z1FA 2RB9A 4IHJA 1XV2A 3JARA 3CCJF 4EI9A 3ZOPA 2BTUA 5CA1B 4C4WC 4BVRA 3N2GA 3AGKA 4DRXB 1S72F 4R40B 3VYUC 1VQ6F 2N48A 4B62A 4BY9D 4B5CA 1U3PA 5J2TA 5EYPB 1OAPA 3NVIB 4FFBB 3HJWC 4TV9B 3K0TA 2AIFA 1FNJA 3JAWB 5C8YA 4G4YA 3RYHB 5ITZA 3VTIC 3N4YA 1VQMF 1VQOF 5EZYA 2ALEA 2HVYD 2LBTA 3QTYA 3N2KB 4O4LB 2PHNA 3FBAA 4NUTA 3RYIA 3CCMF 2OTMA 3ZP7A 3E1YA 4IHJB 2F9ZC 5KMGB 4O4HA 3GYQA 3R0PA 1QU9A 1VQNF 3JAMM 1Q86H 2KGWA 2OHWA 5AVMA 4BT7A 3S03A 2HS3A 1VQ9F 3GHZA 3RYHA 5HY1A 1YITF 2Q1YA 2V9YA 3JARB 1VQLF 3HWUA 2KTVA 3WPWA 1YI2F 2KTUA 2Z1EA 3ESJA 3HTNA 2VGNA 5IJ9A 3IEQA 2JNBA 4X1YB 1TVKA 2UYNB 5C8YB 5MN4A 4WBNA 1XBIA 3CC2F 1JY8A 3ZO8A 2FGYA 3CYQA 1YJNF 3C9RA 5GONB 4C8IA 3WGKA 3L7QA 1IV4A 2QTPA 4EI7A 2BTOA 4RHAA 1H7MA 2LBXA 1CN7A 3RE3A 2MQEA 3K14A 5EB1B 3ERNA 4TV9A 5KMGA 3JAWA 4NQ3A 5EIBC 3CCLF 5CA0B 4C82A 2YXZA 2ZAUA 5GONA 1GZ0A 2HP0B 3FD5A 4BT5A 2Z1TA 3UT5B 4I55A 3CPQA 4ZHQA 3HKCB 3KJJA 3RA6A 5IJ9B 1FFXB 4X3MA 3QHDA 3VCZA 4O4HB 2R751 2HRYA 3S0WA 2VGMA 3WJQA 3WGMA 5LYJB 1N8RH 4BW0B 5IJ0B 1K9MH 3QUWA 2AIZP 2CSLA 3JASB 3JALB 2IQQA 3J80M 1J7HA 1VQPF 1Q7YH 3C9SA 3P10A 2KG4A 2GZLA 3P4EA 4I50A 4YJ3B 2PMPA 2B33A 1CK2A 5MN6A 3JATB 4HNAB 3I55F 4U39A 5G4UC 4ZHQB 3LWPC 1QVGF 5GANK 1Q82H 5A2QM 1RLGA 1KD1H 4G88A 1M90H 2H8CA 1T0AA 2G9IA 2ZODA 3B6NA 3JASA 3M1XA 1VQ5F 5JVDA 3LWOC 1W5AA 2GVIA 3N2KA 1TUBA 3VI6A 2CVLA 2LCAA 3C8LA 3NMUC 2UYJA 4XCQA 3WGLA 2DYYA 5FNVB 1W5EA 3JAKA 4TZZA 1QVFF 3PAFA 4X1IB 2NMUA 4KWEA 4BT6A 2IAFA 3CMEF 1GO1A 4RQOA 3CPWF 1W2BF 4IIJB 5GAPK 2LBWA 4U3JB 4BVQA 4NWOB 4ZOLA 3HKEA 4I50B 4ERHA 4HNAA 4FFBA 4ZHYB 1XHOA 3MBMA 3MCQA 5HY0A 4LCKA 5JQGB 3IEWA 1RQ2A 5HY4A 3S0HA 3JVHA 1VQ4F 4C81A 3E22B 4I4TA 2FC3A 5FJ4C 3VYTC 1X7OA 1FSZA 5FNVA 2RHJA 3DDNA 4BT2A 3M84A 3CCVF 2BTQB 5LP6C 3V7EA 1X25A 3VOBA 5GINC 5HP8A 3ON1A 5JQGA 2K1SA 3RA5A 3FD6A 3CCUF 4B45A 5IYZB 2H6LA 1U43A 4ZOLB 5HWEA 3HKBB 1W5BA 3F0EA 2ZVYA 4O2BB 3VOAA 3C9TA 3E22A 4I4TB 1VQ8F 1H48A 5FLXM 5LXTA 4TV8A 5J2UB 2HX0A 3WGJA 1RLUA 1YJ9F 1KNKA 1QD9A 3HKDB 3CD6F 1COMA 3WPXA 3OONA 5MN5A 3CCRF 5IJ0A 3C9UA 3NK6A 4X1IA 3CG6A 1KNJA 3RYFA 3LFOA 4ZI7B 3S06A 1W55A 4EI8A 3HKBA 3GTZA 5IT9M 4G4ZA 3ZP4A 3JATA 3HKEB 3NVKE 2HP0A 1T0KB 5J2TB 1KC8H 1UI9A 3J7AR 3SIVA 4I55B 3KE1A 1IPAA 4O4JB 5ITZB 2RHLA 5J2UA 1OFUA 1PXWA 1NMUB 1TUBB 1M1KH 5EB0A 3OW2F 3CC4F 3KHNA 3JALA 2ZOVA 2OTJF 3F0GA 4O4LA 1KQSF 4TV8B 4B46A 3LWVC 2WALA 3WJRA 5EIBD 3JAKB 3G4SF 2CZWA 1SA0B 3WGNA 2OZBA 2P6YA 3DC2A 1IV2A 5KX5A 3LWQC 3IKEA 4LNUA 3VYSC 3Q8HA 2HS0A 4O2BA 1Z5WA 2DT4A 4M8IA 5JVDB 2RHOA 5CB4B 3O85A 1YQNA 3HAXD 1FNKA 1X7PA 1PF5A 4BVSA 3I3FA 3ELCA 3KJKA 3FPIA 4TUYA 3D00A 5HP7A 2CWJA 5JCOC 3SIUA 4F6RB 1VK3A 1U40A 3MDOA 2BO1A 5LA6B 4ZHWA 3M4SA 5G4VC 2VAWA 5DCVA 3S0YA 1ONIA 3LYBA 3OBWA 3K12A 3OBYA 5HY2A 3BYQA 3IKFA 3CMAF 5B8FA 1YJWF 4X20B 3RYCB 1VH8A 1SZQA 4IIJA 5LP6A 5JCOA 2QEXF 2I6RA 3CC7F 1JD1A 4BT4A 5HXZA 2EWCA 4O2AB 3JCMM 1CLIA 2I6DA 3CCQF 3VMFB 1JFFB 2HS4A 5CA0A 3TD3A 2L26A 4X3LA 1FFXA 4X1KA 4O4IA 3J81M 1NJIH 1YIJF 3CXCF 1Z5VA 2OTLF 5LP6B 4TUYB 5JH7B 3K2XA 3MQWA 1W40A 1W581 3G71F 4DXDA 2GLZA 2ZVZA 4F6RA 1K73H 2YYEA 3D01A 5HXUA 3TD4A 1NQ3A 2VAPA 1VQKF 3LMEA 1QAHA 1ZWZA 2H8EA 4YJ2A 4O4JA 5IYZA 3CCSF 4X20A 3F6MA 3G6EF 1DT9A 2HQSC 1RQ7A 5EYPA 1JFFA 1TVKB 2UYNA 1VQ7F 2W8BC 3FFMA 4EB6A 4O2AA 1IV1A 2Q1XA 1W59A 4PWTA 2R6R1 2HRUA 3CYPB 3IR9A 1W5FA 5EAZA 1YHQF 4X1KB 4E6EA 2UYPA 4ZI7A 3V3TA 5LOVB 2UYKA 3RYCA 1H47A 1SDSA 1W3EX 3S02A 3CCEF 5JH7A 3MCAB 4U3JA 1Q8RA 1IV3A 5BMVA 3I7TA 4EB6B 1R1MA 1K8AH 2IG8A 1W41A 4G4WA 1X52A 3KIZA 3N2GB 4YJ2B 3WXMB 1VHAA 4BT3A 4BVTA 3EORA 4G4XA 1SA0A 4O4IB 1W57A 3LWRC 3UT5A 3I56F 1W42A 4X1YA 3IMPA 4C8GA 1XRGA 4ZK7A 5BMVB 4C8EA 3V4DA 2HP3A 4G4VA 3U0OA 5EO3A 5CA1A 3PLAC 5CB4A 4DRXA 3F0FA 5KX5B 3TD5A 3HKCA 4LNUB 3RYIB
chains in the Genus database with same CATH topology
3CMAF 5GIPC 1YJWF 1RA4A 5GINC 1JJ2F 1GO0A 3ON1A 3RA5A 2QEXF 2QI2A 4NQ3A 2QA4F 3CC7F 3CCUF 5HXZA 3CCLF 1E7KA 5EWRA 5HWEA 3JCMM 3NK7A 1VQ8F 5FLXM 2I6DA 3CCQF 3VMFB 1YJ9F 1GZ0A 3E20B 4X3LA 3CD6F 5GIOC 3CPQA 3V7QA 3CCRF 3J81M 3RA6A 1NJIH 1YIJF 3CXCF 4X3MA 3NK6A 3N4ZA 2VGMA 1N8RH 2OTLF 3CG6A 3LFOA 4BW0B 1Q81H 1K9MH 4EI8A 1W40A 5IT9M 3G71F 4EI9A 3J80M 3CCJF 2GLZA 4C4WC 1K73H 4BVRA 1VQPF 1Q7YH 2KG4A 3AGKA 1S72F 3NVKE 5HXUA 1T0KB 1VQ6F 1CK2A 1KC8H 3I55F 3J7AR 4BY9D 3SIVA 1VQKF 5G4UC 1ZWZA 3LWPC 1QVGF 3NVIB 5GANK 3CCSF 1Q82H 5A2QM 1RLGA 3HJWC 1KD1H 3G6EF 1DT9A 2AIFA 1IPAA 1M90H 1PXWA 3FFMA 1NMUB 1VQ7F 1M1KH 3OW2F 1VQ5F 3CC4F 3LWOC 2OTJF 3N4YA 1VQMF 1VQOF 3LWVC 1KQSF 2ALEA 2HVYD 3VI6A 2WALA 3G4SF 3IR9A 2CZWA 3NMUC 1YHQF 4XCQA 4NUTA 2OZBA 3CCMF 3V3TA 4TZZA 3E1YA 1QVFF 3LWQC 3PAFA 2F9ZC 1SDSA 1W3EX 3GYQA 3CCEF 1VQNF 3MCAB 3JAMM 1Q86H 2OHWA 3CMEF 3CPWF 1GO1A 1W2BF 5GAPK 1YITF 5HY1A 1VQ9F 1VQLF 2LBWA 1K8AH 1W41A 4BVQA 1X52A 3O85A 2KTVA 1YI2F 3WXMB 2KTUA 3HAXD 4BVTA 1X7PA 3LWRC 2VGNA 4BVSA 2JNBA 3I56F 5HY0A 1W42A 4LCKA 3D00A 1XBIA 5HY4A 3CC2F 1VQ4F 2FGYA 5HY2A 1YJNF 3SIUA 5EO3A 3PLAC 2FC3A 5FJ4C 1X7OA 2BO1A 4EI7A 5DCVA 5G4VC 3OBWA 3CCVF 3OBYA 3V7EA 1H7MA 2LBXA 1CN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CMA F;  5GIP C;  1YJW F;  1RA4 A;  5GIN C;  1JJ2 F;  1GO0 A;  3ON1 A;  3RA5 A;  2QEX F;  2QI2 A;  2QA4 F;  3CC7 F;  3CCU F;  3CCL F;  1E7K A;  5EWR A;  3JCM M;  3NK7 A;  1VQ8 F;  5FLX M;  2I6D A;  3CCQ F;  3VMF B;  1YJ9 F;  1GZ0 A;  3E20 B;  4X3L A;  3CD6 F;  5GIO C;  3CPQ A;  3V7Q A;  3CCR F;  3J81 M;  3RA6 A;  1NJI H;  1YIJ F;  3CXC F;  4X3M A;  3NK6 A;  3N4Z A;  2VGM A;  1N8R H;  2OTL F;  3CG6 A;  3LFO A;  4BW0 B;  1Q81 H;  1K9M H;  1W40 A;  5IT9 M;  3G71 F;  3CCJ F;  3J80 M;  4C4W C;  1K73 H;  1VQP F;  1Q7Y H;  2KG4 A;  3AGK A;  1S72 F;  3NVK E;  1T0K B;  1VQ6 F;  1CK2 A;  1KC8 H;  3I55 F;  3J7A R;  4BY9 D;  3SIV A;  1VQK F;  5G4U C;  1ZWZ A;  3LWP C;  1QVG F;  3NVI B;  5GAN K;  3CCS F;  1Q82 H;  5A2Q M;  1RLG A;  3HJW C;  1KD1 H;  3G6E F;  1DT9 A;  2AIF A;  1IPA A;  1M90 H;  1PXW A;  3FFM A;  1NMU B;  1VQ7 F;  1M1K H;  3OW2 F;  1VQ5 F;  3CC4 F;  3LWO C;  2OTJ F;  3N4Y A;  1VQM F;  1VQO F;  3LWV C;  1KQS F;  2ALE A;  2HVY D;  3VI6 A;  2WAL A;  3G4S F;  3IR9 A;  2CZW A;  3NMU C;  1YHQ F;  4NUT A;  2OZB A;  3CCM F;  4TZZ A;  3E1Y A;  1QVF F;  3LWQ C;  3PAF A;  1SDS A;  1W3E X;  3GYQ A;  3CCE F;  1VQN F;  3MCA B;  3JAM M;  1Q86 H;  2OHW A;  3CME F;  3CPW F;  1GO1 A;  1W2B F;  5GAP K;  1YIT F;  1VQ9 F;  1VQL F;  2LBW A;  1K8A H;  1W41 A;  1X52 A;  3O85 A;  2KTV A;  1YI2 F;  3WXM B;  2KTU A;  3HAX D;  1X7P A;  3LWR C;  2VGN A;  2JNB A;  3I56 F;  4LCK A;  1W42 A;  1XBI A;  3CC2 F;  1VQ4 F;  1YJN F;  3SIU A;  5EO3 A;  3PLA C;  2FC3 A;  5FJ4 C;  1X7O A;  2BO1 A;  5DCV A;  5G4V C;  3OBW A;  3CCV F;  3OBY A;  3V7E A;  1H7M A;  2LBX A;  1CN7 A; 
#chains in the Genus database with same CATH topology
 5GIP C;  1UFY A;  1RA4 A;  2AMT A;  2Z01 A;  1JJ2 F;  1GO0 A;  2RHH A;  2VXY A;  5LYJ A;  4ZHV A;  1GX1 A;  2QI2 A;  3WJP A;  2CHT A;  2QA4 F;  5LXT B;  1YGY A;  1E7K A;  5EWR A;  3VO8 A;  3NK7 A;  1U3L A;  3HKD A;  5EZY B;  1JN1 A;  2VAM A;  2UZH A;  3D54 A;  3E20 B;  4YJ3 A;  3F0D A;  5LA6 A;  1DBF A;  5GIO C;  3CB2 A;  2ZF8 A;  3VIU A;  3P0Z A;  3V7Q A;  5LOV A;  3LDT A;  3RYF B;  2CW4 A;  1VQV A;  2CHS A;  3N4Z A;  3T80 A;  4WBN B;  1ODE A;  2Z1U A;  1Q81 H;  2Z1F A;  2RB9 A;  4IHJ A;  1XV2 A;  3JAR A;  3CCJ F;  4EI9 A;  3ZOP A;  2BTU A;  5CA1 B;  4C4W C;  4BVR A;  3N2G A;  3AGK A;  4DRX B;  1S72 F;  4R40 B;  3VYU C;  1VQ6 F;  2N48 A;  4B62 A;  4BY9 D;  4B5C A;  1U3P A;  5J2T A;  5EYP B;  1OAP A;  3NVI B;  4FFB B;  3HJW C;  4TV9 B;  3K0T A;  2AIF A;  1FNJ A;  3JAW B;  5C8Y A;  4G4Y A;  3RYH B;  5ITZ A;  3VTI C;  3N4Y A;  1VQM F;  1VQO F;  5EZY A;  2ALE A;  2HVY D;  2LBT A;  3QTY A;  3N2K B;  4O4L B;  2PHN A;  3FBA A;  4NUT A;  3RYI A;  3CCM F;  2OTM A;  3ZP7 A;  3E1Y A;  4IHJ B;  2F9Z C;  5KMG B;  4O4H A;  3GYQ A;  3R0P A;  1QU9 A;  1VQN F;  3JAM M;  1Q86 H;  2KGW A;  2OHW A;  5AVM A;  4BT7 A;  3S03 A;  2HS3 A;  1VQ9 F;  3GHZ A;  3RYH A;  5HY1 A;  1YIT F;  2Q1Y A;  2V9Y A;  3JAR B;  1VQL F;  3HWU A;  2KTV A;  3WPW A;  1YI2 F;  2KTU A;  2Z1E A;  3ESJ A;  3HTN A;  2VGN A;  5IJ9 A;  3IEQ A;  2JNB A;  4X1Y B;  1TVK A;  2UYN B;  5C8Y B;  5MN4 A;  4WBN A;  1XBI A;  3CC2 F;  1JY8 A;  3ZO8 A;  2FGY A;  3CYQ A;  1YJN F;  3C9R A;  5GON B;  4C8I A;  3WGK A;  3L7Q A;  1IV4 A;  2QTP A;  4EI7 A;  2BTO A;  4RHA A;  1H7M A;  2LBX A;  1CN7 A;  3RE3 A;  2MQE A;  3K14 A;  5EB1 B;  3ERN A;  4TV9 A;  5KMG A;  3JAW A;  4NQ3 A;  5EIB C;  3CCL F;  5CA0 B;  4C82 A;  2YXZ A;  2ZAU A;  5GON A;  1GZ0 A;  2HP0 B;  3FD5 A;  4BT5 A;  2Z1T A;  3UT5 B;  4I55 A;  3CPQ A;  4ZHQ A;  3HKC B;  3KJJ A;  3RA6 A;  5IJ9 B;  1FFX B;  4X3M A;  3QHD A;  3VCZ A;  4O4H B;  2R75 1;  2HRY A;  3S0W A;  2VGM A;  3WJQ A;  3WGM A;  5LYJ B;  1N8R H;  4BW0 B;  5IJ0 B;  1K9M H;  3QUW A;  2AIZ P;  2CSL A;  3JAS B;  3JAL B;  2IQQ A;  3J80 M;  1J7H A;  1VQP F;  1Q7Y H;  3C9S A;  3P10 A;  2KG4 A;  2GZL A;  3P4E A;  4I50 A;  4YJ3 B;  2PMP A;  2B33 A;  1CK2 A;  5MN6 A;  3JAT B;  4HNA B;  3I55 F;  4U39 A;  5G4U C;  4ZHQ B;  3LWP C;  1QVG F;  5GAN K;  1Q82 H;  5A2Q M;  1RLG A;  1KD1 H;  4G88 A;  1M90 H;  2H8C A;  1T0A A;  2G9I A;  2ZOD A;  3B6N A;  3JAS A;  3M1X A;  1VQ5 F;  5JVD A;  3LWO C;  1W5A A;  2GVI A;  3N2K A;  1TUB A;  3VI6 A;  2CVL A;  2LCA A;  3C8L A;  3NMU C;  2UYJ A;  4XCQ A;  3WGL A;  2DYY A;  5FNV B;  1W5E A;  3JAK A;  4TZZ A;  1QVF F;  3PAF A;  4X1I B;  2NMU A;  4KWE A;  4BT6 A;  2IAF A;  3CME F;  1GO1 A;  4RQO A;  3CPW F;  1W2B F;  4IIJ B;  5GAP K;  2LBW A;  4U3J B;  4BVQ A;  4NWO B;  4ZOL A;  3HKE A;  4I50 B;  4ERH A;  4HNA A;  4FFB A;  4ZHY B;  1XHO A;  3MBM A;  3MCQ A;  5HY0 A;  4LCK A;  5JQG B;  3IEW A;  1RQ2 A;  5HY4 A;  3S0H A;  3JVH A;  1VQ4 F;  4C81 A;  3E22 B;  4I4T A;  2FC3 A;  5FJ4 C;  3VYT C;  1X7O A;  1FSZ A;  5FNV A;  2RHJ A;  3DDN A;  4BT2 A;  3M84 A;  3CCV F;  2BTQ B;  5LP6 C;  3V7E A;  1X25 A;  3VOB A;  5GIN C;  5HP8 A;  3ON1 A;  5JQG A;  2K1S A;  3RA5 A;  3FD6 A;  3CCU F;  4B45 A;  5IYZ B;  2H6L A;  1U43 A;  4ZOL B;  5HWE A;  3HKB B;  1W5B A;  3F0E A;  2ZVY A;  4O2B B;  3VOA A;  3C9T A;  3E22 A;  4I4T B;  1VQ8 F;  1H48 A;  5FLX M;  5LXT A;  4TV8 A;  5J2U B;  2HX0 A;  3WGJ A;  1RLU A;  1YJ9 F;  1KNK A;  1QD9 A;  3HKD B;  3CD6 F;  1COM A;  3WPX A;  3OON A;  5MN5 A;  3CCR F;  5IJ0 A;  3C9U A;  3NK6 A;  4X1I A;  3CG6 A;  1KNJ A;  3RYF A;  3LFO A;  4ZI7 B;  3S06 A;  1W55 A;  4EI8 A;  3HKB A;  3GTZ A;  5IT9 M;  4G4Z A;  3ZP4 A;  3JAT A;  3HKE B;  3NVK E;  2HP0 A;  1T0K B;  5J2T B;  1KC8 H;  1UI9 A;  3J7A R;  3SIV A;  4I55 B;  3KE1 A;  1IPA A;  4O4J B;  5ITZ B;  2RHL A;  5J2U A;  1OFU A;  1PXW A;  1NMU B;  1TUB B;  1M1K H;  5EB0 A;  3OW2 F;  3CC4 F;  3KHN A;  3JAL A;  2ZOV A;  2OTJ F;  3F0G A;  4O4L A;  1KQS F;  4TV8 B;  4B46 A;  3LWV C;  2WAL A;  3WJR A;  5EIB D;  3JAK B;  3G4S F;  2CZW A;  1SA0 B;  3WGN A;  2OZB A;  2P6Y A;  3DC2 A;  1IV2 A;  5KX5 A;  3LWQ C;  3IKE A;  4LNU A;  3VYS C;  3Q8H A;  2HS0 A;  4O2B A;  1Z5W A;  2DT4 A;  4M8I A;  5JVD B;  2RHO A;  5CB4 B;  3O85 A;  1YQN A;  3HAX D;  1FNK A;  1X7P A;  1PF5 A;  4BVS A;  3I3F A;  3ELC A;  3KJK A;  3FPI A;  4TUY A;  3D00 A;  5HP7 A;  2CWJ A;  5JCO C;  3SIU A;  4F6R B;  1VK3 A;  1U40 A;  3MDO A;  2BO1 A;  5LA6 B;  4ZHW A;  3M4S A;  5G4V C;  2VAW A;  5DCV A;  3S0Y A;  1ONI A;  3LYB A;  3OBW A;  3K12 A;  3OBY A;  5HY2 A;  3BYQ A;  3IKF A;  3CMA F;  5B8F A;  1YJW F;  4X20 B;  3RYC B;  1VH8 A;  1SZQ A;  4IIJ A;  5LP6 A;  5JCO A;  2QEX F;  2I6R A;  3CC7 F;  1JD1 A;  4BT4 A;  5HXZ A;  2EWC A;  4O2A B;  3JCM M;  1CLI A;  2I6D A;  3CCQ F;  3VMF B;  1JFF B;  2HS4 A;  5CA0 A;  3TD3 A;  2L26 A;  4X3L A;  1FFX A;  4X1K A;  4O4I A;  3J81 M;  1NJI H;  1YIJ F;  3CXC F;  1Z5V A;  2OTL F;  5LP6 B;  4TUY B;  5JH7 B;  3K2X A;  3MQW A;  1W40 A;  1W58 1;  3G71 F;  4DXD A;  2GLZ A;  2ZVZ A;  4F6R A;  1K73 H;  2YYE A;  3D01 A;  5HXU A;  3TD4 A;  1NQ3 A;  2VAP A;  1VQK F;  3LME A;  1QAH A;  1ZWZ A;  2H8E A;  4YJ2 A;  4O4J A;  5IYZ A;  3CCS F;  4X20 A;  3F6M A;  3G6E F;  1DT9 A;  2HQS C;  1RQ7 A;  5EYP A;  1JFF A;  1TVK B;  2UYN A;  1VQ7 F;  2W8B C;  3FFM A;  4EB6 A;  4O2A A;  1IV1 A;  2Q1X A;  1W59 A;  4PWT A;  2R6R 1;  2HRU A;  3CYP B;  3IR9 A;  1W5F A;  5EAZ A;  1YHQ F;  4X1K B;  4E6E A;  2UYP A;  4ZI7 A;  3V3T A;  5LOV B;  2UYK A;  3RYC A;  1H47 A;  1SDS A;  1W3E X;  3S02 A;  3CCE F;  5JH7 A;  3MCA B;  4U3J A;  1Q8R A;  1IV3 A;  5BMV A;  3I7T A;  4EB6 B;  1R1M A;  1K8A H;  2IG8 A;  1W41 A;  4G4W A;  1X52 A;  3KIZ A;  3N2G B;  4YJ2 B;  3WXM B;  1VHA A;  4BT3 A;  4BVT A;  3EOR A;  4G4X A;  1SA0 A;  4O4I B;  1W57 A;  3LWR C;  3UT5 A;  3I56 F;  1W42 A;  4X1Y A;  3IMP A;  4C8G A;  1XRG A;  4ZK7 A;  5BMV B;  4C8E A;  3V4D A;  2HP3 A;  4G4V A;  3U0O A;  5EO3 A;  5CA1 A;  3PLA C;  5CB4 A;  4DRX A;  3F0F A;  5KX5 B;  3TD5 A;  3HKC A;  4LNU B;  3RYI B; 
#chains in the Genus database with same CATH homology
 3CMA F;  5GIP C;  1YJW F;  1RA4 A;  5GIN C;  1JJ2 F;  1GO0 A;  3ON1 A;  3RA5 A;  2QEX F;  2QI2 A;  4NQ3 A;  2QA4 F;  3CC7 F;  3CCU F;  5HXZ A;  3CCL F;  1E7K A;  5EWR A;  5HWE A;  3JCM M;  3NK7 A;  1VQ8 F;  5FLX M;  2I6D A;  3CCQ F;  3VMF B;  1YJ9 F;  1GZ0 A;  3E20 B;  4X3L A;  3CD6 F;  5GIO C;  3CPQ A;  3V7Q A;  3CCR F;  3J81 M;  3RA6 A;  1NJI H;  1YIJ F;  3CXC F;  4X3M A;  3NK6 A;  3N4Z A;  2VGM A;  1N8R H;  2OTL F;  3CG6 A;  3LFO A;  4BW0 B;  1Q81 H;  1K9M H;  4EI8 A;  1W40 A;  5IT9 M;  3G71 F;  4EI9 A;  3J80 M;  3CCJ F;  2GLZ A;  4C4W C;  1K73 H;  4BVR A;  1VQP F;  1Q7Y H;  2KG4 A;  3AGK A;  1S72 F;  3NVK E;  5HXU A;  1T0K B;  1VQ6 F;  1CK2 A;  1KC8 H;  3I55 F;  3J7A R;  4BY9 D;  3SIV A;  1VQK F;  5G4U C;  1ZWZ A;  3LWP C;  1QVG F;  3NVI B;  5GAN K;  3CCS F;  1Q82 H;  5A2Q M;  1RLG A;  3HJW C;  1KD1 H;  3G6E F;  1DT9 A;  2AIF A;  1IPA A;  1M90 H;  1PXW A;  3FFM A;  1NMU B;  1VQ7 F;  1M1K H;  3OW2 F;  1VQ5 F;  3CC4 F;  3LWO C;  2OTJ F;  3N4Y A;  1VQM F;  1VQO F;  3LWV C;  1KQS F;  2ALE A;  2HVY D;  3VI6 A;  2WAL A;  3G4S F;  3IR9 A;  2CZW A;  3NMU C;  1YHQ F;  4XCQ A;  4NUT A;  2OZB A;  3CCM F;  3V3T A;  4TZZ A;  3E1Y A;  1QVF F;  3LWQ C;  3PAF A;  2F9Z C;  1SDS A;  1W3E X;  3GYQ A;  3CCE F;  1VQN F;  3MCA B;  3JAM M;  1Q86 H;  2OHW A;  3CME F;  3CPW F;  1GO1 A;  1W2B F;  5GAP K;  1YIT F;  5HY1 A;  1VQ9 F;  1VQL F;  2LBW A;  1K8A H;  1W41 A;  4BVQ A;  1X52 A;  3O85 A;  2KTV A;  1YI2 F;  3WXM B;  2KTU A;  3HAX D;  4BVT A;  1X7P A;  3LWR C;  2VGN A;  4BVS A;  2JNB A;  3I56 F;  5HY0 A;  1W42 A;  4LCK A;  3D00 A;  1XBI A;  5HY4 A;  3CC2 F;  1VQ4 F;  2FGY A;  5HY2 A;  1YJN F;  3SIU A;  5EO3 A;  3PLA C;  2FC3 A;  5FJ4 C;  1X7O A;  2BO1 A;  4EI7 A;  5DCV A;  5G4V C;  3OBW A;  3CCV F;  3OBY A;  3V7E A;  1H7M A;  2LBX A;  1CN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...