1JJ2K

Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
145
Chain Sequence
b'TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The kink-turn: a new RNA secondary structure motif.
pubmed doi rcsb
molecule tags Ribosome
total genus 29
structure length 145
sequence length 150
ec nomenclature
pdb deposition date 2001-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1jj2K02
4.10.990.10 Few Secondary Structures Irregular Molecule: Ribosomal Protein L15; Chain: K; domain 1 Molecule: Ribosomal Protein L15; Chain: K; domain 1 1jj2K01
2QEXO 3CMAO 3CCJO 3CCUO 3CCML 1QVGK 1YI2L 3I56L 3OW2K 1M90P 1VQ9O 1QVFK 2OTLO 1N8RM 1YHQL 3CCRO 1NJIP 2OTJL 1JJ2K 3CC4L 1K73P 1YJ9L 1Q82M 3CXCN 1VQ4L 3CPWK 1YJWO 1YITO 3CD6L 1W2BN 1VQMO 1VQKL 1YJNL 1VQPL 1VQ5L 1VQ7O 1K9MM 1KD1P 3I55O 1M1KP 3G6EL 1Q7YP 1VQ6L 1K8AM 2QA4O 3CCLL 3G71O 1VQNL 2OTJO 1VQOO 1KQSK 1S72L 1YJ9O 3CCEL 3CMEO 3CCVL 1VQ8O 3G4SL 3CCQL 1VQLL 1YIJO 1VQ7L 3CC7L 1Q86M 3CC2O 2QEXL 3CMAL 3CCJL 3CCUL 1QVGN 1KC8M 3CCMO 1YI2O 3G6EO 3OW2N 3I56O 1K8AP 1Q81M 1N8RP 1QVFN 1VQ9L 1M90M 2OTLL 1YHQO 3CCRL 1S72O 1JJ2N 1Q82P 3CC4O 1NJIM 1VQ4O 3CPWN 1VQLO 1YJWL 3CCSL 3CD6O 1VQML 1VQKO 1YJNO 1W2BK 1VQPO 1K9MP 1VQ5O 1Q81P 3I55L 1KD1M 1M1KM 1VQ6O 2QA4L 3CCLO 1Q7YM 3G71L 1KQSN 1VQNO 1VQOL 3CCEO 3CMEL 3CCVO 1VQ8L 3CCSO 1K73M 3CXCK 3G4SO 1Q86P 3CCQO 1YIJL 1KC8P 1YITL 3CC7O 3CC2L
chains in the Genus database with same CATH superfamily
2QEXO 4W8KA 3CMAO 3CCJO 3CCUO 3CCML 1QVGK 1YI2L 3I56L 3OW2K 5DQTA 1M90P 1VQ9O 1QVFK 2OTLO 1N8RM 1YHQL 3CCRO 1NJIP 2OTJL 1JJ2K 3CC4L 1K73P 1YJ9L 1Q82M 3CXCN 1VQ4L 3CPWK 1YJWO 1YITO 3NKDA 3CD6L 1VQMO 1W2BN 4QDLA 1VQKL 1YJNL 1VQPL 1VQ5L 1VQ7O 1K9MM 4N06A 4XTKA 1KD1P 3I55O 1M1KP 3G6EL 1Q7YP 1VQ6L 1K8AM 2QA4O 5DQZA 3CCLL 5DS5A 3G71O 5DS4A 1VQNL 2OTJO 1VQOO 1KQSK 1S72L 1YJ9O 3CCEL 5DS6A 3CMEO 3CCVL 1VQ8O 3G4SL 3CCQL 1VQLL 1YIJO 1VQ7L 3CC7L 1Q86M 3CC2O 2QEXL 3CMAL 3CCJL 3CCUL 1QVGN 1KC8M 3CCMO 1YI2O 3G6EO 3OW2N 3I56O 4P6IC 1K8AP 1Q81M 2YZSA 4WJ0A 5FCLA 1N8RP 1QVFN 1VQ9L 1M90M 2OTLL 1YHQO 3CCRL 1S72O 1JJ2N 1Q82P 3CC4O 1NJIM 1VQ4O 3CPWN 1VQLO 1YJWL 3CCSL 3CD6O 1VQML 1VQKO 1YJNO 1W2BK 1VQPO 1K9MP 1VQ5O 1Q81P 3I55L 5DLJA 1KD1M 1M1KM 1VQ6O 2QA4L 3CCLO 1Q7YM 3G71L 1KQSN 1VQNO 3GODA 1VQOL 3CCEO 3CMEL 3CCVO 1VQ8L 3CCSO 1K73M 3CXCK 3G4SO 3CCQO 1Q86P 1YIJL 1KC8P 1YITL 3CC7O 3CC2L
chains in the Genus database with same CATH topology
2QEXO 4W8KA 3CMAO 3CCJO 3CCUO 3CCML 1QVGK 1YI2L 3I56L 3OW2K 5DQTA 1M90P 1VQ9O 1QVFK 2OTLO 1N8RM 1YHQL 3CCRO 1NJIP 2OTJL 1JJ2K 3CC4L 1K73P 1YJ9L 1Q82M 3CXCN 1VQ4L 3CPWK 1YJWO 1YITO 3NKDA 3CD6L 1VQMO 1W2BN 4QDLA 1VQKL 1YJNL 1VQPL 1VQ5L 1VQ7O 1K9MM 4N06A 4XTKA 1KD1P 3I55O 1M1KP 3G6EL 1Q7YP 1VQ6L 1K8AM 2QA4O 5DQZA 3CCLL 5DS5A 3G71O 5DS4A 1VQNL 2OTJO 1VQOO 1KQSK 1S72L 1YJ9O 3CCEL 5DS6A 3CMEO 3CCVL 1VQ8O 3G4SL 3CCQL 1VQLL 1YIJO 1VQ7L 3CC7L 1Q86M 3CC2O 2QEXL 3CMAL 3CCJL 3CCUL 1QVGN 1KC8M 3CCMO 1YI2O 3G6EO 3OW2N 3I56O 4P6IC 1K8AP 1Q81M 2YZSA 4WJ0A 5FCLA 1N8RP 1QVFN 1VQ9L 1M90M 2OTLL 1YHQO 3CCRL 1S72O 1JJ2N 1Q82P 3CC4O 1NJIM 1VQ4O 3CPWN 1VQLO 1YJWL 3CCSL 3CD6O 1VQML 1VQKO 1YJNO 1W2BK 1VQPO 1K9MP 1VQ5O 1Q81P 3I55L 5DLJA 1KD1M 1M1KM 1VQ6O 2QA4L 3CCLO 1Q7YM 3G71L 1KQSN 1VQNO 3GODA 1VQOL 3CCEO 3CMEL 3CCVO 1VQ8L 3CCSO 1K73M 3CXCK 3G4SO 3CCQO 1Q86P 1YIJL 1KC8P 1YITL 3CC7O 3CC2L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QEX O;  3CMA O;  3CCJ O;  3CCU O;  3CCM L;  1QVG K;  1YI2 L;  3I56 L;  3OW2 K;  1M90 P;  1VQ9 O;  1QVF K;  2OTL O;  1N8R M;  1YHQ L;  3CCR O;  1NJI P;  2OTJ L;  1JJ2 K;  3CC4 L;  1K73 P;  1YJ9 L;  1Q82 M;  3CXC N;  1VQ4 L;  3CPW K;  1YJW O;  1YIT O;  3CD6 L;  1W2B N;  1VQM O;  1VQK L;  1YJN L;  1VQP L;  1VQ5 L;  1VQ7 O;  1K9M M;  1KD1 P;  3I55 O;  1M1K P;  3G6E L;  1Q7Y P;  1VQ6 L;  1K8A M;  2QA4 O;  3CCL L;  3G71 O;  1VQN L;  2OTJ O;  1VQO O;  1KQS K;  1S72 L;  1YJ9 O;  3CCE L;  3CME O;  3CCV L;  1VQ8 O;  3G4S L;  3CCQ L;  1VQL L;  1YIJ O;  1VQ7 L;  3CC7 L;  1Q86 M;  3CC2 O;  2QEX L;  3CMA L;  3CCJ L;  3CCU L;  1QVG N;  1KC8 M;  3CCM O;  1YI2 O;  3G6E O;  3OW2 N;  3I56 O;  1K8A P;  1Q81 M;  1N8R P;  1QVF N;  1VQ9 L;  1M90 M;  2OTL L;  1YHQ O;  3CCR L;  1S72 O;  1JJ2 N;  1Q82 P;  3CC4 O;  1NJI M;  1VQ4 O;  3CPW N;  1VQL O;  1YJW L;  3CCS L;  3CD6 O;  1VQM L;  1VQK O;  1YJN O;  1W2B K;  1VQP O;  1K9M P;  1VQ5 O;  1Q81 P;  3I55 L;  1KD1 M;  1M1K M;  1VQ6 O;  2QA4 L;  3CCL O;  1Q7Y M;  3G71 L;  1KQS N;  1VQN O;  1VQO L;  3CCE O;  3CME L;  3CCV O;  1VQ8 L;  3CCS O;  1K73 M;  3CXC K;  3G4S O;  1Q86 P;  3CCQ O;  1YIJ L;  1KC8 P;  1YIT L;  3CC7 O;  3CC2 L; 
#chains in the Genus database with same CATH topology
 2QEX O;  4W8K A;  3CMA O;  3CCJ O;  3CCU O;  3CCM L;  1QVG K;  1YI2 L;  3I56 L;  3OW2 K;  5DQT A;  1M90 P;  1VQ9 O;  1QVF K;  2OTL O;  1N8R M;  1YHQ L;  3CCR O;  1NJI P;  2OTJ L;  1JJ2 K;  3CC4 L;  1K73 P;  1YJ9 L;  1Q82 M;  3CXC N;  1VQ4 L;  3CPW K;  1YJW O;  1YIT O;  3NKD A;  3CD6 L;  1VQM O;  1W2B N;  4QDL A;  1VQK L;  1YJN L;  1VQP L;  1VQ5 L;  1VQ7 O;  1K9M M;  4N06 A;  4XTK A;  1KD1 P;  3I55 O;  1M1K P;  3G6E L;  1Q7Y P;  1VQ6 L;  1K8A M;  2QA4 O;  5DQZ A;  3CCL L;  5DS5 A;  3G71 O;  5DS4 A;  1VQN L;  2OTJ O;  1VQO O;  1KQS K;  1S72 L;  1YJ9 O;  3CCE L;  5DS6 A;  3CME O;  3CCV L;  1VQ8 O;  3G4S L;  3CCQ L;  1VQL L;  1YIJ O;  1VQ7 L;  3CC7 L;  1Q86 M;  3CC2 O;  2QEX L;  3CMA L;  3CCJ L;  3CCU L;  1QVG N;  1KC8 M;  3CCM O;  1YI2 O;  3G6E O;  3OW2 N;  3I56 O;  4P6I C;  1K8A P;  1Q81 M;  2YZS A;  4WJ0 A;  5FCL A;  1N8R P;  1QVF N;  1VQ9 L;  1M90 M;  2OTL L;  1YHQ O;  3CCR L;  1S72 O;  1JJ2 N;  1Q82 P;  3CC4 O;  1NJI M;  1VQ4 O;  3CPW N;  1VQL O;  1YJW L;  3CCS L;  3CD6 O;  1VQM L;  1VQK O;  1YJN O;  1W2B K;  1VQP O;  1K9M P;  1VQ5 O;  1Q81 P;  3I55 L;  5DLJ A;  1KD1 M;  1M1K M;  1VQ6 O;  2QA4 L;  3CCL O;  1Q7Y M;  3G71 L;  1KQS N;  1VQN O;  3GOD A;  1VQO L;  3CCE O;  3CME L;  3CCV O;  1VQ8 L;  3CCS O;  1K73 M;  3CXC K;  3G4S O;  3CCQ O;  1Q86 P;  1YIJ L;  1KC8 P;  1YIT L;  3CC7 O;  3CC2 L; 
#chains in the Genus database with same CATH homology
 2QEX O;  4W8K A;  3CMA O;  3CCJ O;  3CCU O;  3CCM L;  1QVG K;  1YI2 L;  3I56 L;  3OW2 K;  5DQT A;  1M90 P;  1VQ9 O;  1QVF K;  2OTL O;  1N8R M;  1YHQ L;  3CCR O;  1NJI P;  2OTJ L;  1JJ2 K;  3CC4 L;  1K73 P;  1YJ9 L;  1Q82 M;  3CXC N;  1VQ4 L;  3CPW K;  1YJW O;  1YIT O;  3NKD A;  3CD6 L;  1VQM O;  1W2B N;  4QDL A;  1VQK L;  1YJN L;  1VQP L;  1VQ5 L;  1VQ7 O;  1K9M M;  4N06 A;  4XTK A;  1KD1 P;  3I55 O;  1M1K P;  3G6E L;  1Q7Y P;  1VQ6 L;  1K8A M;  2QA4 O;  5DQZ A;  3CCL L;  5DS5 A;  3G71 O;  5DS4 A;  1VQN L;  2OTJ O;  1VQO O;  1KQS K;  1S72 L;  1YJ9 O;  3CCE L;  5DS6 A;  3CME O;  3CCV L;  1VQ8 O;  3G4S L;  3CCQ L;  1VQL L;  1YIJ O;  1VQ7 L;  3CC7 L;  1Q86 M;  3CC2 O;  2QEX L;  3CMA L;  3CCJ L;  3CCU L;  1QVG N;  1KC8 M;  3CCM O;  1YI2 O;  3G6E O;  3OW2 N;  3I56 O;  4P6I C;  1K8A P;  1Q81 M;  2YZS A;  4WJ0 A;  5FCL A;  1N8R P;  1QVF N;  1VQ9 L;  1M90 M;  2OTL L;  1YHQ O;  3CCR L;  1S72 O;  1JJ2 N;  1Q82 P;  3CC4 O;  1NJI M;  1VQ4 O;  3CPW N;  1VQL O;  1YJW L;  3CCS L;  3CD6 O;  1VQM L;  1VQK O;  1YJN O;  1W2B K;  1VQP O;  1K9M P;  1VQ5 O;  1Q81 P;  3I55 L;  5DLJ A;  1KD1 M;  1M1K M;  1VQ6 O;  2QA4 L;  3CCL O;  1Q7Y M;  3G71 L;  1KQS N;  1VQN O;  3GOD A;  1VQO L;  3CCE O;  3CME L;  3CCV O;  1VQ8 L;  3CCS O;  1K73 M;  3CXC K;  3G4S O;  3CCQ O;  1Q86 P;  1YIJ L;  1KC8 P;  1YIT L;  3CC7 O;  3CC2 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...