1JJ9A

Crystal structure of mmp8-barbiturate complex reveals mechanism for collagen substrate recognition
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
158
structure length
158
Chain Sequence
NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix Metalloproteinase 8
publication title The 1.8-A crystal structure of a matrix metalloproteinase 8-barbiturate inhibitor complex reveals a previously unobserved mechanism for collagenase substrate recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2001-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jj9A00
2I47A 1DMTA 2W0DA 2W13A 2J83A 2JSDA 2YB9A 5I3MA 3KMEA 2WO8A 3OHOA 1CQRA 5D2BA 2J0TA 1CAQA 2OW2A 1ASTA 3L0VA 3LE9A 1SMPA 5D3CA 3ZUKA 4GQLA 1IAAA 3B2ZA 1XFYA 1CGLA 2CLTA 4PKSA 1XUDA 1G9KA 1FLSA 3P24A 2D1NA 1CIZA 1K7QA 1G4KA 2ERPA 3KECA 5I4OA 1Y93A 1JK3A 2POJA 4GUYA 2DDYA 2XS4A 3LEAA 5B5OA 1HFSA 3HDBA 1I1IP 2W15A 4DD8A 3DNGA 2AYKA 1MMRA 4G0DA 4ON1A 2DW0A 1OO9A 1XUCA 1SLNA 1I76A 1OS9A 2AIGP 1J7NA 3BA0A 1KUIA 2X3BA 2D1OA 4PKTA 3LJZA 2FV9A 4JP4A 1S4BP 2OXUA 3DPEA 3HY7A 4H30A 3N2UA 2OVZA 1AYKA 3TT4A 3F16A 3EHYA 1L6JA 2X7MA 3VTGA 2CKIA 3EDHA 1QIAA 4ZR5A 1OS2A 1PWWA 1JANA 2A8HA 3LJGA 1Y8JA 1IAEA 1C7KA 1D8MA 1JAPA 5CXAA 3HYGA 3KEKA 4L19A 5L79A 1MNCA 1Q3AA 3HBVP 3LUNA 2OW1A 3LIRA 1QICA 1SATA 3ELMA 4JA1A 3I7GA 1C8TA 1YP1A 4FVLA 1BSWA 3USNA 3KEJA 4R3VA 1IAGA 1BKCI 3N2VA 2E2DA 5I2ZA 1QIBA 1JAQA 1JKYA 3RTTA 1YQYA 1MMBA 2HU6A 3O2XA 1ND1A 4GWNA 1BQOA 1I73A 2WOAA 2SRTA 1XFZA 2TCLA 1BKCA 1KUGA 1G05A 2DW2A 3V96B 4ILWD 1ZVXA 3F15A 4WZVA 5D1TA 4XM6A 4EFSA 1PWPA 2MLSA 2OVXA 830CA 1HFCA 3HBUP 3OHLA 1IACA 1JAOA 1XFUA 3P1VA 4FU4A 966CA 4HMAA 4I35A 1HOVA 5I0LA 1D5JA 2V4BA 1A86A 4XCTA 1WNIA 4FXYP 1KUKA 5D7WA 2JT6A 1JIZA 3ZXHA 2ERQA 1YOUA 2QPJA 2W12A 5BOTA 2OW0A 4PKUA 4PKWA 1GE6A 1ZXVA 2OY4A 3AYKA 3O64A 1QJIA 1OMJA 3LIKA 4AUOA 1K7GA 1ZXCA 1BIWA 1UEAA 2YIGA 2JNPA 1IADA 3EHXA 4H76A 4H84A 3U1RA 1ZP5A 1H71P 3LQ0A 4IN9A 1O0TA 2DDFA 2K9CA 3AIGA 1GO7P 3K7NA 3LK8A 2N8RA 5CUHA 5B5PA 3EDGA 1BM6A 3EDZA 1A85A 2X3AA 4H2EA 4IJOA 3DWBA 1MMQA 1GO8P 1CGFA 456CA 2RJPA 4AXQA 3Q2GA 4GF1A 4WF6A 1JJ9A 1GKDA 1HY7A 3WV3A 1DTHA 3TS4A 2RJQA 3LGPA 1EUBA 3KMCA 4I03A 4H1QA 4J4MA 1GKCA 1KUHA 3AYUA 2E3XA 2MZHA 1AF0A 1IABA 2Y6DA 4A7BA 2OY2A 4DPEA 1OM8A 2JIHA 1D7XA 1G49A 1BUDA 1PWVA 4PKQA 3LQBA 2Z2DA 3LJTA 1CGEA 1D8FA 1R1JA 4DV8A 4GR0A 2MZEA 3EWJA 3MA2A 4H3XA 3WV2A 2WO9A 1RM8A 2EROA 3G5CA 3LILA 4AYKA 2O3EA 3HB2P 4PKRA 1ATLA 4XBHA 1FM1A 3I7IA 1UMSA 3Q2HA 1USNA 1EAKA 4DF9A 4L6TA 1K7IA 3F18A 4PKVA 4GWMA 5JMYA 3CKIA 4WKEA 3KHIA 3HY9A 2PJTA 1SU3A 1QUAA 1KAPP 4JPAA 2OXZA 1EB6A 3LMCA 2K2GA 3SHIA 2MZIA 1O0QA 1XURA 1GXDA 4GR3A 1YCMA 1GE5A 5H8XA 4CTHA 4G9LA 1UTTA 1B8YA 1JIWP 2OXWA 1OM7A 1SRPA 4H49A 2O36A 4XM7A 3L0TA 3KRYA 3NX7A 4IUWA 5D1UA 3DL1A 1R1IA 4JQGA 1QJJA 5BOYA 4GR8A 3F17A 5L7FA 1HV5A 1XFWA 1CK7A 2DW1A 1UMTA 2OW9A 4JIJA 4Q1LA 1HTDA 2XS3A 1Y0VA 1B3DA 2X3CA 3DPFA 1ZTQA 1BQQM 1G12A 1GE7A 3K7LA 3GBOA 3EDIA 5D1SA 1PWUA 4WKIA 1ZS0A 1XFVA 1CXVA 1XFXA 5I43A 5I12A 1BZSA 3WV1A 1BUVM 3B92A 1MMPA 3F1AA 3TSKA 1KUFA 2W14A 3LUMA 1OM6A 3RTSA 4XM8A 2USNA 2KRJA 3LKAA 4H82A 1ROSA 1C3IA 1SLMA 2JT5A 1AKLA 3TVCA 4FXQA 3ZVSA 1FBLA 4HX3A 1UTZA 5BPAA 3KWVC 1KBCA 2L0RA 4WK7A 5CZMA 1PWQA 1R1HA 5LABA 3UVCA 2OZRA 2FV5A 4A3WA 3B8ZA 2MLRA 2Y6CA 1R55A 3HDAP 3E8RA 3DSLA 1Z3JA 3G42A 4QKZA 1BKCE 2OI0A 3F19A 3VI1A 1JH1A 1R54A 1RMZA 4L63A 4AIGA
chains in the Genus database with same CATH superfamily
2I47A 1DMTA 2W0DA 2W13A 2J83A 2JSDA 2YB9A 5I3MA 3KMEA 2WO8A 3OHOA 1CQRA 5D2BA 2J0TA 1XM5A 1CAQA 2OW2A 1ASTA 3L0VA 3LE9A 1SMPA 5D3CA 3ZUKA 4GQLA 1IAAA 3B2ZA 1XFYA 1CGLA 2CLTA 4PKSA 1XUDA 1G9KA 1FLSA 3P24A 2D1NA 1CIZA 1K7QA 1G4KA 2ERPA 3KECA 5I4OA 1Y93A 1JK3A 2POJA 4GUYA 2DDYA 2XS4A 3LEAA 5B5OA 1HFSA 3HDBA 1I1IP 2W15A 4DD8A 3DNGA 2AYKA 1MMRA 4G0DA 4ON1A 2DW0A 1OO9A 1XUCA 1SLNA 1I76A 1OS9A 2AIGP 1J7NA 3BA0A 1KUIA 2X3BA 2D1OA 4PKTA 3LJZA 2FV9A 4JP4A 1S4BP 2OXUA 3DPEA 3HY7A 3DTEA 4H30A 3N2UA 2OVZA 1AYKA 3TT4A 3F16A 3EHYA 1L6JA 2X7MA 3VTGA 2CKIA 2YUFA 3EDHA 1QIAA 4ZR5A 1OS2A 1PWWA 1JANA 2A8HA 3LJGA 1Y8JA 1IAEA 1C7KA 1D8MA 1JAPA 5CXAA 3HYGA 3KEKA 4L19A 5L79A 1MNCA 1Q3AA 3HBVP 3LUNA 2OW1A 3LIRA 1QICA 1SATA 3ELMA 4JA1A 3I7GA 1C8TA 1YP1A 4FVLA 1BSWA 3USNA 3KEJA 4R3VA 1IAGA 1BKCI 3N2VA 2E2DA 5I2ZA 1QIBA 1JAQA 1JKYA 3RTTA 1YQYA 1MMBA 2HU6A 3O2XA 1ND1A 4GWNA 1BQOA 1I73A 2WOAA 2SRTA 1XFZA 2TCLA 1BKCA 1KUGA 1G05A 2DW2A 3V96B 4ILWD 1ZVXA 3F15A 4WZVA 5D1TA 4XM6A 4EFSA 1PWPA 2MLSA 2OVXA 830CA 1HFCA 3HBUP 3OHLA 1IACA 1JAOA 1XFUA 3P1VA 4FU4A 966CA 4HMAA 4I35A 1HOVA 5I0LA 1D5JA 2V4BA 1A86A 4XCTA 1WNIA 4FXYP 1KUKA 5D7WA 2JT6A 1JIZA 3ZXHA 2ERQA 1YOUA 2QPJA 2W12A 5BOTA 2OW0A 4PKUA 4PKWA 1GE6A 1ZXVA 2OY4A 3AYKA 3O64A 1QJIA 1OMJA 3LIKA 4AUOA 1K7GA 1ZXCA 1BIWA 1UEAA 2YIGA 2JNPA 1IADA 3EHXA 4H76A 4H84A 3U1RA 1ZP5A 1H71P 3LQ0A 4IN9A 1O0TA 2DDFA 2K9CA 3AIGA 1GO7P 3DTKA 3K7NA 3LK8A 2N8RA 5CUHA 5B5PA 3EDGA 1BM6A 3EDZA 1A85A 2X3AA 4H2EA 4IJOA 3DWBA 1MMQA 1GO8P 1CGFA 456CA 2RJPA 4AXQA 3Q2GA 4GF1A 4WF6A 1JJ9A 1GKDA 1HY7A 3WV3A 1DTHA 3TS4A 2RJQA 3LGPA 1EUBA 3KMCA 4I03A 4H1QA 4J4MA 1GKCA 1KUHA 3AYUA 2E3XA 2MZHA 1AF0A 1IABA 2Y6DA 4A7BA 2OY2A 4DPEA 1OM8A 2JIHA 1D7XA 1G49A 1BUDA 1PWVA 4PKQA 3LQBA 2Z2DA 3LJTA 1CGEA 1D8FA 1R1JA 4DV8A 4GR0A 2MZEA 3EWJA 3MA2A 4H3XA 3WV2A 2WO9A 1RM8A 2EROA 3G5CA 3LILA 4AYKA 2O3EA 3HB2P 4PKRA 1ATLA 4XBHA 1FM1A 3I7IA 1UMSA 3Q2HA 1USNA 1EAKA 4DF9A 4L6TA 1K7IA 3F18A 4PKVA 4GWMA 5JMYA 4L7AA 3CKIA 4WKEA 3KHIA 3HY9A 2PJTA 1SU3A 1QUAA 1KAPP 4JPAA 2OXZA 1EB6A 3LMCA 2K2GA 3SHIA 2MZIA 1O0QA 1XURA 1GXDA 1XAXA 4GR3A 1YCMA 1GE5A 5H8XA 4CTHA 4G9LA 1UTTA 1B8YA 1JIWP 2OXWA 1OM7A 1SRPA 4H49A 2O36A 4XM7A 3L0TA 3KRYA 3NX7A 4IUWA 5D1UA 3DL1A 1R1IA 4JQGA 1QJJA 5BOYA 4GR8A 3F17A 5L7FA 1HV5A 1XFWA 1CK7A 3DTIA 2DW1A 1UMTA 2OW9A 4JIJA 4Q1LA 1HTDA 1OZ9A 2XS3A 1Y0VA 1B3DA 2X3CA 1TVIA 3DPFA 1ZTQA 1BQQM 1G12A 1GE7A 3K7LA 3GBOA 3EDIA 5D1SA 1PWUA 4WKIA 1ZS0A 1XFVA 1CXVA 1XFXA 5I43A 5I12A 1BZSA 3WV1A 1BUVM 3B92A 1MMPA 3F1AA 3TSKA 1KUFA 2W14A 3LUMA 1OM6A 3RTSA 4XM8A 2USNA 2KRJA 3LKAA 4H82A 1ROSA 1C3IA 1SLMA 2JT5A 1AKLA 3TVCA 4FXQA 3ZVSA 1FBLA 4HX3A 1UTZA 5BPAA 3KWVC 1KBCA 2L0RA 4WK7A 5CZMA 1PWQA 1R1HA 5LABA 3UVCA 2OZRA 2FV5A 4A3WA 3B8ZA 2MLRA 2Y6CA 1R55A 3HDAP 3E8RA 3DSLA 1Z3JA 3G42A 4QKZA 1BKCE 2OI0A 3F19A 3VI1A 1JH1A 1R54A 1RMZA 4L63A 4AIGA
chains in the Genus database with same CATH topology
2I47A 1DMTA 2W0DA 2W13A 2J83A 2JSDA 2YB9A 5I3MA 3KMEA 2WO8A 3OHOA 1CQRA 5D2BA 2J0TA 1CAQA 2OW2A 1ASTA 3L0VA 3LE9A 1SMPA 5D3CA 3ZUKA 4GQLA 1IAAA 3B2ZA 1XFYA 1CGLA 2CLTA 4PKSA 1XUDA 1G9KA 1FLSA 3P24A 2D1NA 1CIZA 1K7QA 1G4KA 2ERPA 3KECA 5I4OA 1Y93A 1JK3A 2POJA 4GUYA 2DDYA 2XS4A 3LEAA 5B5OA 1HFSA 3HDBA 1I1IP 2W15A 4DD8A 3DNGA 2AYKA 1MMRA 4G0DA 4ON1A 2DW0A 1OO9A 1XUCA 1SLNA 1I76A 1OS9A 2AIGP 1J7NA 3BA0A 1KUIA 2X3BA 2D1OA 4PKTA 3LJZA 2FV9A 4JP4A 1S4BP 2OXUA 3DPEA 3HY7A 3DTEA 4H30A 3N2UA 2OVZA 1AYKA 3TT4A 3F16A 3EHYA 1L6JA 2X7MA 3VTGA 2CKIA 2YUFA 3EDHA 1QIAA 4ZR5A 1OS2A 1PWWA 1JANA 2A8HA 3LJGA 1Y8JA 1IAEA 1C7KA 1D8MA 1JAPA 5CXAA 3HYGA 3KEKA 4L19A 5L79A 1MNCA 1Q3AA 3HBVP 3LUNA 2OW1A 3LIRA 1QICA 1SATA 3ELMA 4JA1A 3I7GA 1C8TA 1YP1A 4FVLA 1BSWA 3USNA 3KEJA 4R3VA 1IAGA 1BKCI 3N2VA 2E2DA 5I2ZA 1QIBA 1JAQA 1JKYA 3RTTA 1YQYA 1MMBA 2HU6A 3O2XA 1ND1A 4GWNA 1BQOA 1I73A 2WOAA 2SRTA 1XFZA 2TCLA 1BKCA 1KUGA 1G05A 2DW2A 3V96B 4ILWD 1ZVXA 3F15A 4WZVA 5D1TA 4XM6A 4EFSA 1PWPA 2MLSA 2OVXA 830CA 1HFCA 3HBUP 3OHLA 1IACA 1JAOA 1XFUA 3P1VA 4FU4A 966CA 4HMAA 4I35A 1HOVA 5I0LA 1D5JA 2V4BA 1A86A 4XCTA 1WNIA 4FXYP 1KUKA 5D7WA 2JT6A 1JIZA 3ZXHA 2ERQA 1YOUA 2QPJA 2W12A 5BOTA 2OW0A 4PKUA 4PKWA 1GE6A 1ZXVA 2OY4A 3AYKA 3O64A 1QJIA 1OMJA 3LIKA 4AUOA 1K7GA 1ZXCA 1BIWA 1UEAA 2YIGA 2JNPA 1IADA 3EHXA 4H76A 4H84A 3U1RA 1ZP5A 1H71P 3LQ0A 4IN9A 1O0TA 2DDFA 2K9CA 3AIGA 1GO7P 3DTKA 3K7NA 3LK8A 2N8RA 5CUHA 5B5PA 3EDGA 1BM6A 3EDZA 1A85A 2X3AA 4H2EA 4IJOA 3DWBA 1MMQA 1GO8P 1CGFA 456CA 2RJPA 4AXQA 3Q2GA 4GF1A 4WF6A 1JJ9A 1GKDA 1HY7A 3WV3A 1DTHA 3TS4A 2RJQA 3LGPA 1EUBA 3KMCA 4I03A 4H1QA 4J4MA 1GKCA 1KUHA 3AYUA 2E3XA 2MZHA 1AF0A 1IABA 2Y6DA 4A7BA 2OY2A 4DPEA 1OM8A 2JIHA 1D7XA 1G49A 1BUDA 1PWVA 4PKQA 3LQBA 2Z2DA 3LJTA 1CGEA 1D8FA 1R1JA 4DV8A 4GR0A 2MZEA 3EWJA 3MA2A 4H3XA 3WV2A 2WO9A 1RM8A 2EROA 3G5CA 3LILA 4AYKA 2O3EA 3HB2P 4PKRA 1ATLA 4XBHA 1FM1A 3I7IA 1UMSA 3Q2HA 1USNA 1EAKA 4DF9A 4L6TA 1K7IA 3F18A 4PKVA 4GWMA 5JMYA 4L7AA 3CKIA 4WKEA 3KHIA 3HY9A 2PJTA 1SU3A 1QUAA 1KAPP 4JPAA 2OXZA 1EB6A 3LMCA 2K2GA 3SHIA 2MZIA 1O0QA 1XURA 1GXDA 4GR3A 1YCMA 1GE5A 5H8XA 4CTHA 4G9LA 1UTTA 1B8YA 1JIWP 2OXWA 1OM7A 1SRPA 4H49A 2O36A 4XM7A 3L0TA 3KRYA 3NX7A 4IUWA 5D1UA 3DL1A 1R1IA 4JQGA 1QJJA 5BOYA 4GR8A 3F17A 5L7FA 1HV5A 1XFWA 1CK7A 3DTIA 2DW1A 1UMTA 2OW9A 4JIJA 4Q1LA 1HTDA 2XS3A 1Y0VA 1B3DA 2X3CA 3DPFA 1ZTQA 1BQQM 1G12A 1GE7A 3K7LA 3GBOA 3EDIA 5D1SA 1PWUA 4WKIA 1ZS0A 1XFVA 1CXVA 1XFXA 5I43A 5I12A 1BZSA 3WV1A 1BUVM 3B92A 1MMPA 3F1AA 3TSKA 1KUFA 2W14A 3LUMA 1OM6A 3RTSA 4XM8A 2USNA 2KRJA 3LKAA 4H82A 1ROSA 1C3IA 1SLMA 2JT5A 1AKLA 3TVCA 4FXQA 3ZVSA 1FBLA 4HX3A 1UTZA 5BPAA 3KWVC 1KBCA 2L0RA 4WK7A 5CZMA 1PWQA 1R1HA 5LABA 3UVCA 2OZRA 2FV5A 4A3WA 3B8ZA 2MLRA 2Y6CA 1R55A 3HDAP 3E8RA 3DSLA 1Z3JA 3G42A 4QKZA 1BKCE 2OI0A 3F19A 3VI1A 1JH1A 1R54A 1RMZA 4L63A 4AIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I47 A;  1DMT A;  2W0D A;  2W13 A;  2J83 A;  2JSD A;  2YB9 A;  5I3M A;  3KME A;  2WO8 A;  3OHO A;  1CQR A;  5D2B A;  2J0T A;  1CAQ A;  2OW2 A;  1AST A;  3L0V A;  3LE9 A;  1SMP A;  5D3C A;  3ZUK A;  4GQL A;  1IAA A;  3B2Z A;  1XFY A;  1CGL A;  2CLT A;  4PKS A;  1XUD A;  1G9K A;  1FLS A;  3P24 A;  2D1N A;  1CIZ A;  1K7Q A;  1G4K A;  2ERP A;  3KEC A;  5I4O A;  1Y93 A;  1JK3 A;  2POJ A;  4GUY A;  2DDY A;  2XS4 A;  3LEA A;  5B5O A;  1HFS A;  3HDB A;  1I1I P;  2W15 A;  4DD8 A;  3DNG A;  2AYK A;  1MMR A;  4G0D A;  4ON1 A;  2DW0 A;  1OO9 A;  1XUC A;  1SLN A;  1I76 A;  1OS9 A;  2AIG P;  1J7N A;  3BA0 A;  1KUI A;  2X3B A;  2D1O A;  4PKT A;  3LJZ A;  2FV9 A;  4JP4 A;  1S4B P;  2OXU A;  3DPE A;  3HY7 A;  4H30 A;  3N2U A;  2OVZ A;  1AYK A;  3TT4 A;  3F16 A;  3EHY A;  1L6J A;  2X7M A;  3VTG A;  2CKI A;  3EDH A;  1QIA A;  4ZR5 A;  1OS2 A;  1PWW A;  1JAN A;  2A8H A;  3LJG A;  1Y8J A;  1IAE A;  1C7K A;  1D8M A;  1JAP A;  5CXA A;  3HYG A;  3KEK A;  4L19 A;  5L79 A;  1MNC A;  1Q3A A;  3HBV P;  3LUN A;  2OW1 A;  3LIR A;  1QIC A;  1SAT A;  3ELM A;  4JA1 A;  3I7G A;  1C8T A;  1YP1 A;  4FVL A;  1BSW A;  3USN A;  3KEJ A;  4R3V A;  1IAG A;  1BKC I;  3N2V A;  2E2D A;  5I2Z A;  1QIB A;  1JAQ A;  1JKY A;  3RTT A;  1YQY A;  1MMB A;  2HU6 A;  3O2X A;  1ND1 A;  4GWN A;  1BQO A;  1I73 A;  2WOA A;  2SRT A;  1XFZ A;  2TCL A;  1BKC A;  1KUG A;  1G05 A;  2DW2 A;  3V96 B;  4ILW D;  1ZVX A;  3F15 A;  4WZV A;  5D1T A;  4XM6 A;  4EFS A;  1PWP A;  2MLS A;  2OVX A;  830C A;  1HFC A;  3HBU P;  3OHL A;  1IAC A;  1JAO A;  1XFU A;  3P1V A;  4FU4 A;  966C A;  4HMA A;  4I35 A;  1HOV A;  5I0L A;  1D5J A;  2V4B A;  1A86 A;  4XCT A;  1WNI A;  4FXY P;  1KUK A;  5D7W A;  2JT6 A;  1JIZ A;  3ZXH A;  2ERQ A;  1YOU A;  2QPJ A;  2W12 A;  5BOT A;  2OW0 A;  4PKU A;  4PKW A;  1GE6 A;  1ZXV A;  2OY4 A;  3AYK A;  3O64 A;  1QJI A;  1OMJ A;  3LIK A;  4AUO A;  1K7G A;  1ZXC A;  1BIW A;  1UEA A;  2YIG A;  2JNP A;  1IAD A;  3EHX A;  4H76 A;  4H84 A;  3U1R A;  1ZP5 A;  1H71 P;  3LQ0 A;  4IN9 A;  1O0T A;  2DDF A;  2K9C A;  3AIG A;  1GO7 P;  3K7N A;  3LK8 A;  2N8R A;  5CUH A;  5B5P A;  3EDG A;  1BM6 A;  3EDZ A;  1A85 A;  2X3A A;  4H2E A;  4IJO A;  3DWB A;  1MMQ A;  1GO8 P;  1CGF A;  456C A;  2RJP A;  4AXQ A;  3Q2G A;  4GF1 A;  4WF6 A;  1JJ9 A;  1GKD A;  1HY7 A;  3WV3 A;  1DTH A;  3TS4 A;  2RJQ A;  3LGP A;  1EUB A;  3KMC A;  4I03 A;  4H1Q A;  4J4M A;  1GKC A;  1KUH A;  3AYU A;  2E3X A;  2MZH A;  1AF0 A;  1IAB A;  2Y6D A;  4A7B A;  2OY2 A;  4DPE A;  1OM8 A;  2JIH A;  1D7X A;  1G49 A;  1BUD A;  1PWV A;  4PKQ A;  3LQB A;  2Z2D A;  3LJT A;  1CGE A;  1D8F A;  1R1J A;  4DV8 A;  4GR0 A;  2MZE A;  3EWJ A;  3MA2 A;  4H3X A;  3WV2 A;  2WO9 A;  1RM8 A;  2ERO A;  3G5C A;  3LIL A;  4AYK A;  2O3E A;  3HB2 P;  4PKR A;  1ATL A;  4XBH A;  1FM1 A;  3I7I A;  1UMS A;  3Q2H A;  1USN A;  1EAK A;  4DF9 A;  4L6T A;  1K7I A;  3F18 A;  4PKV A;  4GWM A;  5JMY A;  3CKI A;  4WKE A;  3KHI A;  3HY9 A;  2PJT A;  1SU3 A;  1QUA A;  1KAP P;  4JPA A;  2OXZ A;  1EB6 A;  3LMC A;  2K2G A;  3SHI A;  2MZI A;  1O0Q A;  1XUR A;  1GXD A;  4GR3 A;  1YCM A;  1GE5 A;  5H8X A;  4CTH A;  4G9L A;  1UTT A;  1B8Y A;  1JIW P;  2OXW A;  1OM7 A;  1SRP A;  4H49 A;  2O36 A;  4XM7 A;  3L0T A;  3KRY A;  3NX7 A;  4IUW A;  5D1U A;  3DL1 A;  1R1I A;  4JQG A;  1QJJ A;  5BOY A;  4GR8 A;  3F17 A;  5L7F A;  1HV5 A;  1XFW A;  1CK7 A;  2DW1 A;  1UMT A;  2OW9 A;  4JIJ A;  4Q1L A;  1HTD A;  2XS3 A;  1Y0V A;  1B3D A;  2X3C A;  3DPF A;  1ZTQ A;  1BQQ M;  1G12 A;  1GE7 A;  3K7L A;  3GBO A;  3EDI A;  5D1S A;  1PWU A;  4WKI A;  1ZS0 A;  1XFV A;  1CXV A;  1XFX A;  5I43 A;  5I12 A;  1BZS A;  3WV1 A;  1BUV M;  3B92 A;  1MMP A;  3F1A A;  3TSK A;  1KUF A;  2W14 A;  3LUM A;  1OM6 A;  3RTS A;  4XM8 A;  2USN A;  2KRJ A;  3LKA A;  4H82 A;  1ROS A;  1C3I A;  1SLM A;  2JT5 A;  1AKL A;  3TVC A;  4FXQ A;  3ZVS A;  1FBL A;  4HX3 A;  1UTZ A;  5BPA A;  3KWV C;  1KBC A;  2L0R A;  4WK7 A;  5CZM A;  1PWQ A;  1R1H A;  5LAB A;  3UVC A;  2OZR A;  2FV5 A;  4A3W A;  3B8Z A;  2MLR A;  2Y6C A;  1R55 A;  3HDA P;  3E8R A;  3DSL A;  1Z3J A;  3G42 A;  4QKZ A;  1BKC E;  2OI0 A;  3F19 A;  3VI1 A;  1JH1 A;  1R54 A;  1RMZ A;  4L63 A;  4AIG A; 
#chains in the Genus database with same CATH topology
 2I47 A;  1DMT A;  2W0D A;  2W13 A;  2J83 A;  2JSD A;  2YB9 A;  5I3M A;  3KME A;  2WO8 A;  3OHO A;  1CQR A;  5D2B A;  2J0T A;  1XM5 A;  1CAQ A;  2OW2 A;  1AST A;  3L0V A;  3LE9 A;  1SMP A;  5D3C A;  3ZUK A;  4GQL A;  1IAA A;  3B2Z A;  1XFY A;  1CGL A;  2CLT A;  4PKS A;  1XUD A;  1G9K A;  1FLS A;  3P24 A;  2D1N A;  1CIZ A;  1K7Q A;  1G4K A;  2ERP A;  3KEC A;  5I4O A;  1Y93 A;  1JK3 A;  2POJ A;  4GUY A;  2DDY A;  2XS4 A;  3LEA A;  5B5O A;  1HFS A;  3HDB A;  1I1I P;  2W15 A;  4DD8 A;  3DNG A;  2AYK A;  1MMR A;  4G0D A;  4ON1 A;  2DW0 A;  1OO9 A;  1XUC A;  1SLN A;  1I76 A;  1OS9 A;  2AIG P;  1J7N A;  3BA0 A;  1KUI A;  2X3B A;  2D1O A;  4PKT A;  3LJZ A;  2FV9 A;  4JP4 A;  1S4B P;  2OXU A;  3DPE A;  3HY7 A;  3DTE A;  4H30 A;  3N2U A;  2OVZ A;  1AYK A;  3TT4 A;  3F16 A;  3EHY A;  1L6J A;  2X7M A;  3VTG A;  2CKI A;  2YUF A;  3EDH A;  1QIA A;  4ZR5 A;  1OS2 A;  1PWW A;  1JAN A;  2A8H A;  3LJG A;  1Y8J A;  1IAE A;  1C7K A;  1D8M A;  1JAP A;  5CXA A;  3HYG A;  3KEK A;  4L19 A;  5L79 A;  1MNC A;  1Q3A A;  3HBV P;  3LUN A;  2OW1 A;  3LIR A;  1QIC A;  1SAT A;  3ELM A;  4JA1 A;  3I7G A;  1C8T A;  1YP1 A;  4FVL A;  1BSW A;  3USN A;  3KEJ A;  4R3V A;  1IAG A;  1BKC I;  3N2V A;  2E2D A;  5I2Z A;  1QIB A;  1JAQ A;  1JKY A;  3RTT A;  1YQY A;  1MMB A;  2HU6 A;  3O2X A;  1ND1 A;  4GWN A;  1BQO A;  1I73 A;  2WOA A;  2SRT A;  1XFZ A;  2TCL A;  1BKC A;  1KUG A;  1G05 A;  2DW2 A;  3V96 B;  4ILW D;  1ZVX A;  3F15 A;  4WZV A;  5D1T A;  4XM6 A;  4EFS A;  1PWP A;  2MLS A;  2OVX A;  830C A;  1HFC A;  3HBU P;  3OHL A;  1IAC A;  1JAO A;  1XFU A;  3P1V A;  4FU4 A;  966C A;  4HMA A;  4I35 A;  1HOV A;  5I0L A;  1D5J A;  2V4B A;  1A86 A;  4XCT A;  1WNI A;  4FXY P;  1KUK A;  5D7W A;  2JT6 A;  1JIZ A;  3ZXH A;  2ERQ A;  1YOU A;  2QPJ A;  2W12 A;  5BOT A;  2OW0 A;  4PKU A;  4PKW A;  1GE6 A;  1ZXV A;  2OY4 A;  3AYK A;  3O64 A;  1QJI A;  1OMJ A;  3LIK A;  4AUO A;  1K7G A;  1ZXC A;  1BIW A;  1UEA A;  2YIG A;  2JNP A;  1IAD A;  3EHX A;  4H76 A;  4H84 A;  3U1R A;  1ZP5 A;  1H71 P;  3LQ0 A;  4IN9 A;  1O0T A;  2DDF A;  2K9C A;  3AIG A;  1GO7 P;  3DTK A;  3K7N A;  3LK8 A;  2N8R A;  5CUH A;  5B5P A;  3EDG A;  1BM6 A;  3EDZ A;  1A85 A;  2X3A A;  4H2E A;  4IJO A;  3DWB A;  1MMQ A;  1GO8 P;  1CGF A;  456C A;  2RJP A;  4AXQ A;  3Q2G A;  4GF1 A;  4WF6 A;  1JJ9 A;  1GKD A;  1HY7 A;  3WV3 A;  1DTH A;  3TS4 A;  2RJQ A;  3LGP A;  1EUB A;  3KMC A;  4I03 A;  4H1Q A;  4J4M A;  1GKC A;  1KUH A;  3AYU A;  2E3X A;  2MZH A;  1AF0 A;  1IAB A;  2Y6D A;  4A7B A;  2OY2 A;  4DPE A;  1OM8 A;  2JIH A;  1D7X A;  1G49 A;  1BUD A;  1PWV A;  4PKQ A;  3LQB A;  2Z2D A;  3LJT A;  1CGE A;  1D8F A;  1R1J A;  4DV8 A;  4GR0 A;  2MZE A;  3EWJ A;  3MA2 A;  4H3X A;  3WV2 A;  2WO9 A;  1RM8 A;  2ERO A;  3G5C A;  3LIL A;  4AYK A;  2O3E A;  3HB2 P;  4PKR A;  1ATL A;  4XBH A;  1FM1 A;  3I7I A;  1UMS A;  3Q2H A;  1USN A;  1EAK A;  4DF9 A;  4L6T A;  1K7I A;  3F18 A;  4PKV A;  4GWM A;  5JMY A;  4L7A A;  3CKI A;  4WKE A;  3KHI A;  3HY9 A;  2PJT A;  1SU3 A;  1QUA A;  1KAP P;  4JPA A;  2OXZ A;  1EB6 A;  3LMC A;  2K2G A;  3SHI A;  2MZI A;  1O0Q A;  1XUR A;  1GXD A;  1XAX A;  4GR3 A;  1YCM A;  1GE5 A;  5H8X A;  4CTH A;  4G9L A;  1UTT A;  1B8Y A;  1JIW P;  2OXW A;  1OM7 A;  1SRP A;  4H49 A;  2O36 A;  4XM7 A;  3L0T A;  3KRY A;  3NX7 A;  4IUW A;  5D1U A;  3DL1 A;  1R1I A;  4JQG A;  1QJJ A;  5BOY A;  4GR8 A;  3F17 A;  5L7F A;  1HV5 A;  1XFW A;  1CK7 A;  3DTI A;  2DW1 A;  1UMT A;  2OW9 A;  4JIJ A;  4Q1L A;  1HTD A;  1OZ9 A;  2XS3 A;  1Y0V A;  1B3D A;  2X3C A;  1TVI A;  3DPF A;  1ZTQ A;  1BQQ M;  1G12 A;  1GE7 A;  3K7L A;  3GBO A;  3EDI A;  5D1S A;  1PWU A;  4WKI A;  1ZS0 A;  1XFV A;  1CXV A;  1XFX A;  5I43 A;  5I12 A;  1BZS A;  3WV1 A;  1BUV M;  3B92 A;  1MMP A;  3F1A A;  3TSK A;  1KUF A;  2W14 A;  3LUM A;  1OM6 A;  3RTS A;  4XM8 A;  2USN A;  2KRJ A;  3LKA A;  4H82 A;  1ROS A;  1C3I A;  1SLM A;  2JT5 A;  1AKL A;  3TVC A;  4FXQ A;  3ZVS A;  1FBL A;  4HX3 A;  1UTZ A;  5BPA A;  3KWV C;  1KBC A;  2L0R A;  4WK7 A;  5CZM A;  1PWQ A;  1R1H A;  5LAB A;  3UVC A;  2OZR A;  2FV5 A;  4A3W A;  3B8Z A;  2MLR A;  2Y6C A;  1R55 A;  3HDA P;  3E8R A;  3DSL A;  1Z3J A;  3G42 A;  4QKZ A;  1BKC E;  2OI0 A;  3F19 A;  3VI1 A;  1JH1 A;  1R54 A;  1RMZ A;  4L63 A;  4AIG A; 
#chains in the Genus database with same CATH homology
 2I47 A;  1DMT A;  2W0D A;  2W13 A;  2J83 A;  2JSD A;  2YB9 A;  5I3M A;  3KME A;  2WO8 A;  3OHO A;  1CQR A;  5D2B A;  2J0T A;  1CAQ A;  2OW2 A;  1AST A;  3L0V A;  3LE9 A;  1SMP A;  5D3C A;  3ZUK A;  4GQL A;  1IAA A;  3B2Z A;  1XFY A;  1CGL A;  2CLT A;  4PKS A;  1XUD A;  1G9K A;  1FLS A;  3P24 A;  2D1N A;  1CIZ A;  1K7Q A;  1G4K A;  2ERP A;  3KEC A;  5I4O A;  1Y93 A;  1JK3 A;  2POJ A;  4GUY A;  2DDY A;  2XS4 A;  3LEA A;  5B5O A;  1HFS A;  3HDB A;  1I1I P;  2W15 A;  4DD8 A;  3DNG A;  2AYK A;  1MMR A;  4G0D A;  4ON1 A;  2DW0 A;  1OO9 A;  1XUC A;  1SLN A;  1I76 A;  1OS9 A;  2AIG P;  1J7N A;  3BA0 A;  1KUI A;  2X3B A;  2D1O A;  4PKT A;  3LJZ A;  2FV9 A;  4JP4 A;  1S4B P;  2OXU A;  3DPE A;  3HY7 A;  3DTE A;  4H30 A;  3N2U A;  2OVZ A;  1AYK A;  3TT4 A;  3F16 A;  3EHY A;  1L6J A;  2X7M A;  3VTG A;  2CKI A;  2YUF A;  3EDH A;  1QIA A;  4ZR5 A;  1OS2 A;  1PWW A;  1JAN A;  2A8H A;  3LJG A;  1Y8J A;  1IAE A;  1C7K A;  1D8M A;  1JAP A;  5CXA A;  3HYG A;  3KEK A;  4L19 A;  5L79 A;  1MNC A;  1Q3A A;  3HBV P;  3LUN A;  2OW1 A;  3LIR A;  1QIC A;  1SAT A;  3ELM A;  4JA1 A;  3I7G A;  1C8T A;  1YP1 A;  4FVL A;  1BSW A;  3USN A;  3KEJ A;  4R3V A;  1IAG A;  1BKC I;  3N2V A;  2E2D A;  5I2Z A;  1QIB A;  1JAQ A;  1JKY A;  3RTT A;  1YQY A;  1MMB A;  2HU6 A;  3O2X A;  1ND1 A;  4GWN A;  1BQO A;  1I73 A;  2WOA A;  2SRT A;  1XFZ A;  2TCL A;  1BKC A;  1KUG A;  1G05 A;  2DW2 A;  3V96 B;  4ILW D;  1ZVX A;  3F15 A;  4WZV A;  5D1T A;  4XM6 A;  4EFS A;  1PWP A;  2MLS A;  2OVX A;  830C A;  1HFC A;  3HBU P;  3OHL A;  1IAC A;  1JAO A;  1XFU A;  3P1V A;  4FU4 A;  966C A;  4HMA A;  4I35 A;  1HOV A;  5I0L A;  1D5J A;  2V4B A;  1A86 A;  4XCT A;  1WNI A;  4FXY P;  1KUK A;  5D7W A;  2JT6 A;  1JIZ A;  3ZXH A;  2ERQ A;  1YOU A;  2QPJ A;  2W12 A;  5BOT A;  2OW0 A;  4PKU A;  4PKW A;  1GE6 A;  1ZXV A;  2OY4 A;  3AYK A;  3O64 A;  1QJI A;  1OMJ A;  3LIK A;  4AUO A;  1K7G A;  1ZXC A;  1BIW A;  1UEA A;  2YIG A;  2JNP A;  1IAD A;  3EHX A;  4H76 A;  4H84 A;  3U1R A;  1ZP5 A;  1H71 P;  3LQ0 A;  4IN9 A;  1O0T A;  2DDF A;  2K9C A;  3AIG A;  1GO7 P;  3DTK A;  3K7N A;  3LK8 A;  2N8R A;  5CUH A;  5B5P A;  3EDG A;  1BM6 A;  3EDZ A;  1A85 A;  2X3A A;  4H2E A;  4IJO A;  3DWB A;  1MMQ A;  1GO8 P;  1CGF A;  456C A;  2RJP A;  4AXQ A;  3Q2G A;  4GF1 A;  4WF6 A;  1JJ9 A;  1GKD A;  1HY7 A;  3WV3 A;  1DTH A;  3TS4 A;  2RJQ A;  3LGP A;  1EUB A;  3KMC A;  4I03 A;  4H1Q A;  4J4M A;  1GKC A;  1KUH A;  3AYU A;  2E3X A;  2MZH A;  1AF0 A;  1IAB A;  2Y6D A;  4A7B A;  2OY2 A;  4DPE A;  1OM8 A;  2JIH A;  1D7X A;  1G49 A;  1BUD A;  1PWV A;  4PKQ A;  3LQB A;  2Z2D A;  3LJT A;  1CGE A;  1D8F A;  1R1J A;  4DV8 A;  4GR0 A;  2MZE A;  3EWJ A;  3MA2 A;  4H3X A;  3WV2 A;  2WO9 A;  1RM8 A;  2ERO A;  3G5C A;  3LIL A;  4AYK A;  2O3E A;  3HB2 P;  4PKR A;  1ATL A;  4XBH A;  1FM1 A;  3I7I A;  1UMS A;  3Q2H A;  1USN A;  1EAK A;  4DF9 A;  4L6T A;  1K7I A;  3F18 A;  4PKV A;  4GWM A;  5JMY A;  4L7A A;  3CKI A;  4WKE A;  3KHI A;  3HY9 A;  2PJT A;  1SU3 A;  1QUA A;  1KAP P;  4JPA A;  2OXZ A;  1EB6 A;  3LMC A;  2K2G A;  3SHI A;  2MZI A;  1O0Q A;  1XUR A;  1GXD A;  4GR3 A;  1YCM A;  1GE5 A;  5H8X A;  4CTH A;  4G9L A;  1UTT A;  1B8Y A;  1JIW P;  2OXW A;  1OM7 A;  1SRP A;  4H49 A;  2O36 A;  4XM7 A;  3L0T A;  3KRY A;  3NX7 A;  4IUW A;  5D1U A;  3DL1 A;  1R1I A;  4JQG A;  1QJJ A;  5BOY A;  4GR8 A;  3F17 A;  5L7F A;  1HV5 A;  1XFW A;  1CK7 A;  3DTI A;  2DW1 A;  1UMT A;  2OW9 A;  4JIJ A;  4Q1L A;  1HTD A;  2XS3 A;  1Y0V A;  1B3D A;  2X3C A;  3DPF A;  1ZTQ A;  1BQQ M;  1G12 A;  1GE7 A;  3K7L A;  3GBO A;  3EDI A;  5D1S A;  1PWU A;  4WKI A;  1ZS0 A;  1XFV A;  1CXV A;  1XFX A;  5I43 A;  5I12 A;  1BZS A;  3WV1 A;  1BUV M;  3B92 A;  1MMP A;  3F1A A;  3TSK A;  1KUF A;  2W14 A;  3LUM A;  1OM6 A;  3RTS A;  4XM8 A;  2USN A;  2KRJ A;  3LKA A;  4H82 A;  1ROS A;  1C3I A;  1SLM A;  2JT5 A;  1AKL A;  3TVC A;  4FXQ A;  3ZVS A;  1FBL A;  4HX3 A;  1UTZ A;  5BPA A;  3KWV C;  1KBC A;  2L0R A;  4WK7 A;  5CZM A;  1PWQ A;  1R1H A;  5LAB A;  3UVC A;  2OZR A;  2FV5 A;  4A3W A;  3B8Z A;  2MLR A;  2Y6C A;  1R55 A;  3HDA P;  3E8R A;  3DSL A;  1Z3J A;  3G42 A;  4QKZ A;  1BKC E;  2OI0 A;  3F19 A;  3VI1 A;  1JH1 A;  1R54 A;  1RMZ A;  4L63 A;  4AIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...