1JJ9A

Crystal structure of mmp8-barbiturate complex reveals mechanism for collagen substrate recognition
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
158
structure length
158
Chain Sequence
b'NPKWERTNLTYRIRNYTPQLSEAEVERAIKDAFELWSVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGILAHAFQPGQGIGGDAHFDAEETWTNTSANYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYAFRETSNYSLPQDDIDGIQAIYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrix Metalloproteinase 8
publication title The 1.8-A crystal structure of a matrix metalloproteinase 8-barbiturate inhibitor complex reveals a previously unobserved mechanism for collagenase substrate recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 48
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.34: Neutrophil collagenase.
pdb deposition date 2001-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jj9A00
4FVLA 1KAPP 1QICA 5BPAA 2Y6DA 2OW9A 1HFCA 1IAGA 1YP1A 1XFXA 1Y8JA 4PKRA 1MMRA 2O36A 1CIZA 3MA2A 1FBLA 1JIWP 1YQYA 2OVXA 1XUCA 1J7NA 2OI0A 3B92A 1C7KA 2EROA 3KWVC 1ZXCA 3HY7A 3WV3A 3LJTA 1GKDA 4I35A 3G5CA 4PKQA 2L0RA 5D2BA 4DD8A 5I12A 1MMQA 1B8YA 1DMTA 3KEKA 3TSKA 3KECA 2HU6A 4AYKA 3EDIA 3RTTA 1Q3AA 1CAQA 1CGLA 2X7MA 1GE5A 3LUNA 2OXWA 4I03A 4H1QA 3P1VA 3HDAP 4ILWD 2OXZA 3O64A 1D8MA 1IABA 3Q2GA 3KRYA 1EUBA 2ERPA 1G9KA 1KBCA 1XFVA 1KUIA 3LEAA 2OZRA 1K7QA 3USNA 2W13A 1I73A 3EWJA 4L63A 1H71P 3V96B 2MLRA 3ZUKA 4CTHA 2A8HA 3CKIA 1IAEA 1HTDA 1BKCA 4FXQA 1RMZA 4EFSA 5CXAA 4FXYP 4A7BA 1SMPA 1R54A 3LIRA 4XBHA 2CLTA 4GUYA 2MZHA 1XFWA 5LABA 3LK8A 4A3WA 2QPJA 1BKCI 2W15A 1BUDA 1A85A 3B8ZA 3HBUP 3VI1A 5L7FA 1CGFA 2D1NA 1K7GA 3HYGA 3N2UA 3HY9A 3KHIA 3NX7A 2CKIA 1ROSA 2DW1A 1MNCA 1CGEA 2JT6A 1Y93A 3BA0A 830CA 2FV5A 4AXQA 1I1IP 1USNA 1HFSA 1R55A 3LJGA 1HOVA 5D1TA 1AYKA 1ZVXA 4WKEA 5I4OA 4GQLA 1GKCA 4JP4A 4PKUA 4DPEA 1CXVA 2OW2A 2YIGA 3Q2HA 3LIKA 1JH1A 1EAKA 4H82A 1QJJA 2ERQA 2WOAA 4H76A 2V4BA 3DSLA 1O0TA 2MZEA 1SRPA 3TS4A 1SU3A 1OM6A 1FM1A 1JK3A 1CQRA 1OS2A 5I43A 1OO9A 4Q1LA 4IUWA 2XS4A 5D7WA 1PWWA 4ON1A 1R1JA 3F15A 1UEAA 3KMEA 2W14A 3LKAA 2JNPA 4DV8A 5CZMA 3LMCA 4XCTA 2X3CA 1OM7A 3VTGA 3KMCA 2MLSA 1R1IA 1G49A 4HX3A 3DWBA 3F16A 1AKLA 1IADA 3HDBA 1BSWA 1BIWA 1BQOA 3F1AA 3G42A 4PKTA 3DPEA 1XUDA 1JKYA 4L6TA 2OVZA 5BOTA 3EHYA 4WZVA 3LILA 1HV5A 2AIGP 1ZXVA 1D8FA 1PWPA 4G9LA 4JA1A 3K7NA 2YB9A 3AYKA 4H2EA 4DF9A 1RM8A 1XFUA 1DTHA 4IN9A 2D1OA 2RJPA 1IACA 2OY4A 4HMAA 4FU4A 5I2ZA 3L0TA 2I47A 3ZVSA 1L6JA 1ZTQA 1A86A 2J83A 2DDFA 3I7GA 4GR0A 1JANA 3ELMA 3F19A 4QKZA 1R1HA 4JPAA 2DW2A 456CA 3HB2P 3LE9A 1KUGA 5CUHA 1QIAA 1GE7A 4H3XA 1PWVA 4H49A 2PJTA 4GF1A 4PKSA 2K9CA 2MZIA 1AF0A 5B5OA 3WV2A 1YOUA 5I3MA 1C3IA 3SHIA 1BM6A 3F17A 3O2XA 3OHOA 4H30A 2N8RA 1ZS0A 1UTTA 1XFZA 3TT4A 3P24A 2OY2A 2X3BA 1KUHA 1Y0VA 2WO9A 1JIZA 3KEJA 3B2ZA 4GWMA 3LJZA 1D7XA 1GE6A 4PKVA 3LQBA 4IJOA 1OM8A 2DW0A 2OW1A 3LGPA 4GWNA 1KUKA 2E2DA 1G12A 2Z2DA 4PKWA 2DDYA 5BOYA 1UMSA 1MMPA 3EDZA 1KUFA 3DPFA 4GR8A 3EDHA 2FV9A 3LUMA 1BUVM 1BZSA 2AYKA 4R3VA 5B5PA 2W12A 5I0LA 1FLSA 2TCLA 1CK7A 1JAPA 2X3AA 3EDGA 1QIBA 1PWUA 1WNIA 3K7LA 4J4MA 1G4KA 1SLMA 2JT5A 1MMBA 3ZXHA 2JIHA 4GR3A 3LQ0A 2KRJA 1Z3JA 1O0QA 1BKCE 1QUAA 3AYUA 1JAOA 2USNA 3F18A 1GO8P 1S4BP 4WF6A 2O3EA 1OS9A 1SLNA 2OW0A 1EB6A 1SATA 5D3CA 3RTSA 1JJ9A 2XS3A 1C8TA 5H8XA 2E3XA 1UMTA 3N2VA 1IAAA 4XM6A 1B3DA 1YCMA 3EHXA 1XURA 1QJIA 1GO7P 2K2GA 2Y6CA 4AUOA 2OXUA 4G0DA 3GBOA 1ATLA 2SRTA 4XM7A 3U1RA 2WO8A 1UTZA 966CA 3UVCA 1D5JA 4JIJA 1GXDA 3WV1A 1G05A 2JSDA 3HBVP 4ZR5A 3DNGA 5JMYA 3L0VA 4WKIA 1BQQM 2J0TA 1OMJA 1PWQA 3AIGA 3E8RA 4L19A 4JQGA 1JAQA 4H84A 5L79A 1XFYA 5D1UA 1HY7A 3TVCA 1ZP5A 3DL1A 5D1SA 4XM8A 4WK7A 3I7IA 1ASTA 1ND1A 2RJQA 3OHLA 1K7IA 2POJA 1I76A 2W0DA 4AIGA
chains in the Genus database with same CATH superfamily
4FVLA 1KAPP 1QICA 5BPAA 3DTEA 2Y6DA 2OW9A 1HFCA 1IAGA 1YP1A 1XFXA 2YUFA 1Y8JA 4PKRA 1MMRA 2O36A 1CIZA 3MA2A 1FBLA 1JIWP 1YQYA 2OVXA 1XUCA 1J7NA 2OI0A 3B92A 1C7KA 2EROA 3KWVC 1ZXCA 3HY7A 3WV3A 3LJTA 1GKDA 4I35A 3G5CA 4PKQA 2L0RA 5D2BA 4DD8A 5I12A 1MMQA 1B8YA 1DMTA 3KEKA 3TSKA 3KECA 2HU6A 4AYKA 3EDIA 3RTTA 1Q3AA 1CAQA 1CGLA 2X7MA 1GE5A 3LUNA 2OXWA 4I03A 4H1QA 3P1VA 3HDAP 4ILWD 2OXZA 3O64A 1D8MA 1IABA 3Q2GA 3KRYA 1EUBA 2ERPA 1G9KA 1KBCA 1XFVA 1KUIA 3LEAA 2OZRA 1K7QA 3USNA 1TVIA 2W13A 1I73A 3EWJA 4L63A 1H71P 3V96B 2MLRA 3ZUKA 4CTHA 2A8HA 3CKIA 1IAEA 1HTDA 1BKCA 4FXQA 1RMZA 4EFSA 5CXAA 4FXYP 4A7BA 1SMPA 1R54A 3LIRA 4XBHA 2CLTA 4GUYA 2MZHA 1XFWA 5LABA 3LK8A 4A3WA 2QPJA 1BKCI 2W15A 1BUDA 1A85A 3B8ZA 3HBUP 1OZ9A 3VI1A 5L7FA 1CGFA 2D1NA 1K7GA 3HYGA 3N2UA 3HY9A 3KHIA 3NX7A 2CKIA 1ROSA 2DW1A 1MNCA 1CGEA 2JT6A 1Y93A 3BA0A 830CA 2FV5A 4AXQA 1I1IP 1USNA 1HFSA 1R55A 3LJGA 1HOVA 5D1TA 1AYKA 1ZVXA 4WKEA 5I4OA 4GQLA 1GKCA 4JP4A 4PKUA 4DPEA 1CXVA 2OW2A 2YIGA 3Q2HA 3LIKA 1JH1A 1EAKA 4H82A 1QJJA 2ERQA 2WOAA 4H76A 2V4BA 3DSLA 1O0TA 2MZEA 1SRPA 3TS4A 1SU3A 1OM6A 1FM1A 1JK3A 1CQRA 1OS2A 5I43A 1OO9A 4Q1LA 4IUWA 2XS4A 5D7WA 1PWWA 4ON1A 1R1JA 3F15A 1UEAA 3KMEA 2W14A 3LKAA 2JNPA 4DV8A 5CZMA 3LMCA 4XCTA 2X3CA 1OM7A 3VTGA 3KMCA 2MLSA 1R1IA 1G49A 4HX3A 1XAXA 3DWBA 3F16A 1AKLA 1IADA 3HDBA 1BSWA 1BIWA 1BQOA 3F1AA 3G42A 4PKTA 3DPEA 1XUDA 1JKYA 4L6TA 2OVZA 5BOTA 3EHYA 4WZVA 3LILA 1HV5A 2AIGP 1ZXVA 1D8FA 1PWPA 4G9LA 4JA1A 3K7NA 2YB9A 3AYKA 4H2EA 4DF9A 1RM8A 1XFUA 1DTHA 4IN9A 2D1OA 2RJPA 1IACA 2OY4A 4HMAA 4FU4A 5I2ZA 3L0TA 2I47A 3ZVSA 1L6JA 1ZTQA 1A86A 2J83A 2DDFA 3I7GA 4GR0A 1JANA 3ELMA 3F19A 4QKZA 1R1HA 4JPAA 2DW2A 456CA 3HB2P 3LE9A 1KUGA 5CUHA 1QIAA 1GE7A 4H3XA 1PWVA 4H49A 2PJTA 4GF1A 4PKSA 2K9CA 2MZIA 1AF0A 5B5OA 3WV2A 3DTKA 1YOUA 5I3MA 1C3IA 3SHIA 1BM6A 3F17A 3O2XA 3OHOA 4H30A 2N8RA 1ZS0A 1UTTA 1XFZA 3TT4A 3P24A 2OY2A 2X3BA 1KUHA 1Y0VA 2WO9A 1JIZA 3KEJA 3B2ZA 4GWMA 3LJZA 1XM5A 1D7XA 1GE6A 4PKVA 3LQBA 4IJOA 1OM8A 2DW0A 2OW1A 3LGPA 4GWNA 1KUKA 2E2DA 1G12A 2Z2DA 4PKWA 2DDYA 5BOYA 1UMSA 1MMPA 3EDZA 1KUFA 3DPFA 4GR8A 3EDHA 2FV9A 3LUMA 1BUVM 1BZSA 2AYKA 4R3VA 5B5PA 2W12A 5I0LA 1FLSA 2TCLA 1CK7A 1JAPA 2X3AA 3EDGA 1QIBA 1PWUA 1WNIA 3K7LA 4J4MA 1G4KA 1SLMA 2JT5A 1MMBA 3ZXHA 2JIHA 4GR3A 3LQ0A 2KRJA 1Z3JA 1O0QA 1BKCE 1QUAA 3AYUA 1JAOA 2USNA 3F18A 1GO8P 1S4BP 4WF6A 2O3EA 1OS9A 1SLNA 2OW0A 1EB6A 1SATA 5D3CA 3RTSA 1JJ9A 2XS3A 1C8TA 5H8XA 2E3XA 1UMTA 3N2VA 1IAAA 4XM6A 1B3DA 1YCMA 3EHXA 1XURA 1QJIA 1GO7P 2K2GA 2Y6CA 4AUOA 2OXUA 4G0DA 3GBOA 1ATLA 2SRTA 4XM7A 3U1RA 2WO8A 1UTZA 966CA 3UVCA 1D5JA 4JIJA 1GXDA 3WV1A 1G05A 2JSDA 3DTIA 3HBVP 4ZR5A 3DNGA 5JMYA 3L0VA 4WKIA 1BQQM 2J0TA 1OMJA 1PWQA 3AIGA 3E8RA 4L19A 4JQGA 1JAQA 4H84A 5L79A 1XFYA 5D1UA 1HY7A 3TVCA 1ZP5A 3DL1A 5D1SA 4XM8A 4WK7A 3I7IA 1ASTA 1ND1A 2RJQA 3OHLA 1K7IA 2POJA 1I76A 2W0DA 4AIGA 4L7AA
chains in the Genus database with same CATH topology
4FVLA 1KAPP 1QICA 5BPAA 3DTEA 2Y6DA 2OW9A 1HFCA 1IAGA 1YP1A 1XFXA 2YUFA 1Y8JA 4PKRA 1MMRA 2O36A 1CIZA 3MA2A 1FBLA 1JIWP 1YQYA 2OVXA 1XUCA 1J7NA 2OI0A 3B92A 1C7KA 2EROA 3KWVC 1ZXCA 3HY7A 3WV3A 3LJTA 1GKDA 4I35A 3G5CA 4PKQA 2L0RA 5D2BA 4DD8A 5I12A 1MMQA 1B8YA 1DMTA 3KEKA 3TSKA 3KECA 2HU6A 4AYKA 3EDIA 3RTTA 1Q3AA 1CAQA 1CGLA 2X7MA 1GE5A 3LUNA 2OXWA 4I03A 4H1QA 3P1VA 3HDAP 4ILWD 2OXZA 3O64A 1D8MA 1IABA 3Q2GA 3KRYA 1EUBA 2ERPA 1G9KA 1KBCA 1XFVA 1KUIA 3LEAA 2OZRA 1K7QA 3USNA 2W13A 1I73A 3EWJA 4L63A 1H71P 3V96B 2MLRA 3ZUKA 4CTHA 2A8HA 3CKIA 1IAEA 1HTDA 1BKCA 4FXQA 1RMZA 4EFSA 5CXAA 4FXYP 4A7BA 1SMPA 1R54A 3LIRA 4XBHA 2CLTA 4GUYA 2MZHA 1XFWA 5LABA 3LK8A 4A3WA 2QPJA 1BKCI 2W15A 1BUDA 1A85A 3B8ZA 3HBUP 3VI1A 5L7FA 1CGFA 2D1NA 1K7GA 3HYGA 3N2UA 3HY9A 3KHIA 3NX7A 2CKIA 1ROSA 2DW1A 1MNCA 1CGEA 2JT6A 1Y93A 3BA0A 830CA 2FV5A 4AXQA 1I1IP 1USNA 1HFSA 1R55A 3LJGA 1HOVA 5D1TA 1AYKA 1ZVXA 4WKEA 5I4OA 4GQLA 1GKCA 4JP4A 4PKUA 4DPEA 1CXVA 2OW2A 2YIGA 3Q2HA 3LIKA 1JH1A 1EAKA 4H82A 1QJJA 2ERQA 2WOAA 4H76A 2V4BA 3DSLA 1O0TA 2MZEA 1SRPA 3TS4A 1SU3A 1OM6A 1FM1A 1JK3A 1CQRA 1OS2A 5I43A 1OO9A 4Q1LA 4IUWA 2XS4A 5D7WA 1PWWA 4ON1A 1R1JA 3F15A 1UEAA 3KMEA 2W14A 3LKAA 2JNPA 4DV8A 5CZMA 3LMCA 4XCTA 2X3CA 1OM7A 3VTGA 3KMCA 2MLSA 1R1IA 1G49A 4HX3A 3DWBA 3F16A 1AKLA 1IADA 3HDBA 1BSWA 1BIWA 1BQOA 3F1AA 3G42A 4PKTA 3DPEA 1XUDA 1JKYA 4L6TA 2OVZA 5BOTA 3EHYA 4WZVA 3LILA 1HV5A 2AIGP 1ZXVA 1D8FA 1PWPA 4G9LA 4JA1A 3K7NA 2YB9A 3AYKA 4H2EA 4DF9A 1RM8A 1XFUA 1DTHA 4IN9A 2D1OA 2RJPA 1IACA 2OY4A 4HMAA 4FU4A 5I2ZA 3L0TA 2I47A 3ZVSA 1L6JA 1ZTQA 1A86A 2J83A 2DDFA 3I7GA 4GR0A 1JANA 3ELMA 3F19A 4QKZA 1R1HA 4JPAA 2DW2A 456CA 3HB2P 3LE9A 1KUGA 5CUHA 1QIAA 1GE7A 4H3XA 1PWVA 4H49A 2PJTA 4GF1A 4PKSA 2K9CA 2MZIA 1AF0A 5B5OA 3WV2A 3DTKA 1YOUA 5I3MA 1C3IA 3SHIA 1BM6A 3F17A 3O2XA 3OHOA 4H30A 2N8RA 1ZS0A 1UTTA 1XFZA 3TT4A 3P24A 2OY2A 2X3BA 1KUHA 1Y0VA 2WO9A 1JIZA 3KEJA 3B2ZA 4GWMA 3LJZA 1D7XA 1GE6A 4PKVA 3LQBA 4IJOA 1OM8A 2DW0A 2OW1A 3LGPA 4GWNA 1KUKA 2E2DA 1G12A 2Z2DA 4PKWA 2DDYA 5BOYA 1UMSA 1MMPA 3EDZA 1KUFA 3DPFA 4GR8A 3EDHA 2FV9A 3LUMA 1BUVM 1BZSA 2AYKA 4R3VA 5B5PA 2W12A 5I0LA 1FLSA 2TCLA 1CK7A 1JAPA 2X3AA 3EDGA 1QIBA 1PWUA 1WNIA 3K7LA 4J4MA 1G4KA 1SLMA 2JT5A 1MMBA 3ZXHA 2JIHA 4GR3A 3LQ0A 2KRJA 1Z3JA 1O0QA 1BKCE 1QUAA 3AYUA 1JAOA 2USNA 3F18A 1GO8P 1S4BP 4WF6A 2O3EA 1OS9A 1SLNA 2OW0A 1EB6A 1SATA 5D3CA 3RTSA 1JJ9A 2XS3A 1C8TA 5H8XA 2E3XA 1UMTA 3N2VA 1IAAA 4XM6A 1B3DA 1YCMA 3EHXA 1XURA 1QJIA 1GO7P 2K2GA 2Y6CA 4AUOA 2OXUA 4G0DA 3GBOA 1ATLA 2SRTA 4XM7A 3U1RA 2WO8A 1UTZA 966CA 3UVCA 1D5JA 4JIJA 1GXDA 3WV1A 1G05A 2JSDA 3DTIA 3HBVP 4ZR5A 3DNGA 5JMYA 3L0VA 4WKIA 1BQQM 2J0TA 1OMJA 1PWQA 3AIGA 3E8RA 4L19A 4JQGA 1JAQA 4H84A 5L79A 1XFYA 5D1UA 1HY7A 3TVCA 1ZP5A 3DL1A 5D1SA 4XM8A 4WK7A 3I7IA 1ASTA 1ND1A 2RJQA 3OHLA 1K7IA 2POJA 1I76A 2W0DA 4AIGA 4L7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FVL A;  1KAP P;  1QIC A;  5BPA A;  2Y6D A;  2OW9 A;  1HFC A;  1IAG A;  1YP1 A;  1XFX A;  1Y8J A;  4PKR A;  1MMR A;  2O36 A;  1CIZ A;  3MA2 A;  1FBL A;  1JIW P;  1YQY A;  2OVX A;  1XUC A;  1J7N A;  2OI0 A;  3B92 A;  1C7K A;  2ERO A;  3KWV C;  1ZXC A;  3HY7 A;  3WV3 A;  3LJT A;  1GKD A;  4I35 A;  3G5C A;  4PKQ A;  2L0R A;  5D2B A;  4DD8 A;  5I12 A;  1MMQ A;  1B8Y A;  1DMT A;  3KEK A;  3TSK A;  3KEC A;  2HU6 A;  4AYK A;  3EDI A;  3RTT A;  1Q3A A;  1CAQ A;  1CGL A;  2X7M A;  1GE5 A;  3LUN A;  2OXW A;  4I03 A;  4H1Q A;  3P1V A;  3HDA P;  4ILW D;  2OXZ A;  3O64 A;  1D8M A;  1IAB A;  3Q2G A;  3KRY A;  1EUB A;  2ERP A;  1G9K A;  1KBC A;  1XFV A;  1KUI A;  3LEA A;  2OZR A;  1K7Q A;  3USN A;  2W13 A;  1I73 A;  3EWJ A;  4L63 A;  1H71 P;  3V96 B;  2MLR A;  3ZUK A;  4CTH A;  2A8H A;  3CKI A;  1IAE A;  1HTD A;  1BKC A;  4FXQ A;  1RMZ A;  4EFS A;  5CXA A;  4FXY P;  4A7B A;  1SMP A;  1R54 A;  3LIR A;  4XBH A;  2CLT A;  4GUY A;  2MZH A;  1XFW A;  5LAB A;  3LK8 A;  4A3W A;  2QPJ A;  1BKC I;  2W15 A;  1BUD A;  1A85 A;  3B8Z A;  3HBU P;  3VI1 A;  5L7F A;  1CGF A;  2D1N A;  1K7G A;  3HYG A;  3N2U A;  3HY9 A;  3KHI A;  3NX7 A;  2CKI A;  1ROS A;  2DW1 A;  1MNC A;  1CGE A;  2JT6 A;  1Y93 A;  3BA0 A;  830C A;  2FV5 A;  4AXQ A;  1I1I P;  1USN A;  1HFS A;  1R55 A;  3LJG A;  1HOV A;  5D1T A;  1AYK A;  1ZVX A;  4WKE A;  5I4O A;  4GQL A;  1GKC A;  4JP4 A;  4PKU A;  4DPE A;  1CXV A;  2OW2 A;  2YIG A;  3Q2H A;  3LIK A;  1JH1 A;  1EAK A;  4H82 A;  1QJJ A;  2ERQ A;  2WOA A;  4H76 A;  2V4B A;  3DSL A;  1O0T A;  2MZE A;  1SRP A;  3TS4 A;  1SU3 A;  1OM6 A;  1FM1 A;  1JK3 A;  1CQR A;  1OS2 A;  5I43 A;  1OO9 A;  4Q1L A;  4IUW A;  2XS4 A;  5D7W A;  1PWW A;  4ON1 A;  1R1J A;  3F15 A;  1UEA A;  3KME A;  2W14 A;  3LKA A;  2JNP A;  4DV8 A;  5CZM A;  3LMC A;  4XCT A;  2X3C A;  1OM7 A;  3VTG A;  3KMC A;  2MLS A;  1R1I A;  1G49 A;  4HX3 A;  3DWB A;  3F16 A;  1AKL A;  1IAD A;  3HDB A;  1BSW A;  1BIW A;  1BQO A;  3F1A A;  3G42 A;  4PKT A;  3DPE A;  1XUD A;  1JKY A;  4L6T A;  2OVZ A;  5BOT A;  3EHY A;  4WZV A;  3LIL A;  1HV5 A;  2AIG P;  1ZXV A;  1D8F A;  1PWP A;  4G9L A;  4JA1 A;  3K7N A;  2YB9 A;  3AYK A;  4H2E A;  4DF9 A;  1RM8 A;  1XFU A;  1DTH A;  4IN9 A;  2D1O A;  2RJP A;  1IAC A;  2OY4 A;  4HMA A;  4FU4 A;  5I2Z A;  3L0T A;  2I47 A;  3ZVS A;  1L6J A;  1ZTQ A;  1A86 A;  2J83 A;  2DDF A;  3I7G A;  4GR0 A;  1JAN A;  3ELM A;  3F19 A;  4QKZ A;  1R1H A;  4JPA A;  2DW2 A;  456C A;  3HB2 P;  3LE9 A;  1KUG A;  5CUH A;  1QIA A;  1GE7 A;  4H3X A;  1PWV A;  4H49 A;  2PJT A;  4GF1 A;  4PKS A;  2K9C A;  2MZI A;  1AF0 A;  5B5O A;  3WV2 A;  1YOU A;  5I3M A;  1C3I A;  3SHI A;  1BM6 A;  3F17 A;  3O2X A;  3OHO A;  4H30 A;  2N8R A;  1ZS0 A;  1UTT A;  1XFZ A;  3TT4 A;  3P24 A;  2OY2 A;  2X3B A;  1KUH A;  1Y0V A;  2WO9 A;  1JIZ A;  3KEJ A;  3B2Z A;  4GWM A;  3LJZ A;  1D7X A;  1GE6 A;  4PKV A;  3LQB A;  4IJO A;  1OM8 A;  2DW0 A;  2OW1 A;  3LGP A;  4GWN A;  1KUK A;  2E2D A;  1G12 A;  2Z2D A;  4PKW A;  2DDY A;  5BOY A;  1UMS A;  1MMP A;  3EDZ A;  1KUF A;  3DPF A;  4GR8 A;  3EDH A;  2FV9 A;  3LUM A;  1BUV M;  1BZS A;  2AYK A;  4R3V A;  5B5P A;  2W12 A;  5I0L A;  1FLS A;  2TCL A;  1CK7 A;  1JAP A;  2X3A A;  3EDG A;  1QIB A;  1PWU A;  1WNI A;  3K7L A;  4J4M A;  1G4K A;  1SLM A;  2JT5 A;  1MMB A;  3ZXH A;  2JIH A;  4GR3 A;  3LQ0 A;  2KRJ A;  1Z3J A;  1O0Q A;  1BKC E;  1QUA A;  3AYU A;  1JAO A;  2USN A;  3F18 A;  1GO8 P;  1S4B P;  4WF6 A;  2O3E A;  1OS9 A;  1SLN A;  2OW0 A;  1EB6 A;  1SAT A;  5D3C A;  3RTS A;  1JJ9 A;  2XS3 A;  1C8T A;  5H8X A;  2E3X A;  1UMT A;  3N2V A;  1IAA A;  4XM6 A;  1B3D A;  1YCM A;  3EHX A;  1XUR A;  1QJI A;  1GO7 P;  2K2G A;  2Y6C A;  4AUO A;  2OXU A;  4G0D A;  3GBO A;  1ATL A;  2SRT A;  4XM7 A;  3U1R A;  2WO8 A;  1UTZ A;  966C A;  3UVC A;  1D5J A;  4JIJ A;  1GXD A;  3WV1 A;  1G05 A;  2JSD A;  3HBV P;  4ZR5 A;  3DNG A;  5JMY A;  3L0V A;  4WKI A;  1BQQ M;  2J0T A;  1OMJ A;  1PWQ A;  3AIG A;  3E8R A;  4L19 A;  4JQG A;  1JAQ A;  4H84 A;  5L79 A;  1XFY A;  5D1U A;  1HY7 A;  3TVC A;  1ZP5 A;  3DL1 A;  5D1S A;  4XM8 A;  4WK7 A;  3I7I A;  1AST A;  1ND1 A;  2RJQ A;  3OHL A;  1K7I A;  2POJ A;  1I76 A;  2W0D A;  4AIG A; 
#chains in the Genus database with same CATH topology
 4FVL A;  1KAP P;  1QIC A;  5BPA A;  3DTE A;  2Y6D A;  2OW9 A;  1HFC A;  1IAG A;  1YP1 A;  1XFX A;  2YUF A;  1Y8J A;  4PKR A;  1MMR A;  2O36 A;  1CIZ A;  3MA2 A;  1FBL A;  1JIW P;  1YQY A;  2OVX A;  1XUC A;  1J7N A;  2OI0 A;  3B92 A;  1C7K A;  2ERO A;  3KWV C;  1ZXC A;  3HY7 A;  3WV3 A;  3LJT A;  1GKD A;  4I35 A;  3G5C A;  4PKQ A;  2L0R A;  5D2B A;  4DD8 A;  5I12 A;  1MMQ A;  1B8Y A;  1DMT A;  3KEK A;  3TSK A;  3KEC A;  2HU6 A;  4AYK A;  3EDI A;  3RTT A;  1Q3A A;  1CAQ A;  1CGL A;  2X7M A;  1GE5 A;  3LUN A;  2OXW A;  4I03 A;  4H1Q A;  3P1V A;  3HDA P;  4ILW D;  2OXZ A;  3O64 A;  1D8M A;  1IAB A;  3Q2G A;  3KRY A;  1EUB A;  2ERP A;  1G9K A;  1KBC A;  1XFV A;  1KUI A;  3LEA A;  2OZR A;  1K7Q A;  3USN A;  1TVI A;  2W13 A;  1I73 A;  3EWJ A;  4L63 A;  1H71 P;  3V96 B;  2MLR A;  3ZUK A;  4CTH A;  2A8H A;  3CKI A;  1IAE A;  1HTD A;  1BKC A;  4FXQ A;  1RMZ A;  4EFS A;  5CXA A;  4FXY P;  4A7B A;  1SMP A;  1R54 A;  3LIR A;  4XBH A;  2CLT A;  4GUY A;  2MZH A;  1XFW A;  5LAB A;  3LK8 A;  4A3W A;  2QPJ A;  1BKC I;  2W15 A;  1BUD A;  1A85 A;  3B8Z A;  3HBU P;  1OZ9 A;  3VI1 A;  5L7F A;  1CGF A;  2D1N A;  1K7G A;  3HYG A;  3N2U A;  3HY9 A;  3KHI A;  3NX7 A;  2CKI A;  1ROS A;  2DW1 A;  1MNC A;  1CGE A;  2JT6 A;  1Y93 A;  3BA0 A;  830C A;  2FV5 A;  4AXQ A;  1I1I P;  1USN A;  1HFS A;  1R55 A;  3LJG A;  1HOV A;  5D1T A;  1AYK A;  1ZVX A;  4WKE A;  5I4O A;  4GQL A;  1GKC A;  4JP4 A;  4PKU A;  4DPE A;  1CXV A;  2OW2 A;  2YIG A;  3Q2H A;  3LIK A;  1JH1 A;  1EAK A;  4H82 A;  1QJJ A;  2ERQ A;  2WOA A;  4H76 A;  2V4B A;  3DSL A;  1O0T A;  2MZE A;  1SRP A;  3TS4 A;  1SU3 A;  1OM6 A;  1FM1 A;  1JK3 A;  1CQR A;  1OS2 A;  5I43 A;  1OO9 A;  4Q1L A;  4IUW A;  2XS4 A;  5D7W A;  1PWW A;  4ON1 A;  1R1J A;  3F15 A;  1UEA A;  3KME A;  2W14 A;  3LKA A;  2JNP A;  4DV8 A;  5CZM A;  3LMC A;  4XCT A;  2X3C A;  1OM7 A;  3VTG A;  3KMC A;  2MLS A;  1R1I A;  1G49 A;  4HX3 A;  1XAX A;  3DWB A;  3F16 A;  1AKL A;  1IAD A;  3HDB A;  1BSW A;  1BIW A;  1BQO A;  3F1A A;  3G42 A;  4PKT A;  3DPE A;  1XUD A;  1JKY A;  4L6T A;  2OVZ A;  5BOT A;  3EHY A;  4WZV A;  3LIL A;  1HV5 A;  2AIG P;  1ZXV A;  1D8F A;  1PWP A;  4G9L A;  4JA1 A;  3K7N A;  2YB9 A;  3AYK A;  4H2E A;  4DF9 A;  1RM8 A;  1XFU A;  1DTH A;  4IN9 A;  2D1O A;  2RJP A;  1IAC A;  2OY4 A;  4HMA A;  4FU4 A;  5I2Z A;  3L0T A;  2I47 A;  3ZVS A;  1L6J A;  1ZTQ A;  1A86 A;  2J83 A;  2DDF A;  3I7G A;  4GR0 A;  1JAN A;  3ELM A;  3F19 A;  4QKZ A;  1R1H A;  4JPA A;  2DW2 A;  456C A;  3HB2 P;  3LE9 A;  1KUG A;  5CUH A;  1QIA A;  1GE7 A;  4H3X A;  1PWV A;  4H49 A;  2PJT A;  4GF1 A;  4PKS A;  2K9C A;  2MZI A;  1AF0 A;  5B5O A;  3WV2 A;  3DTK A;  1YOU A;  5I3M A;  1C3I A;  3SHI A;  1BM6 A;  3F17 A;  3O2X A;  3OHO A;  4H30 A;  2N8R A;  1ZS0 A;  1UTT A;  1XFZ A;  3TT4 A;  3P24 A;  2OY2 A;  2X3B A;  1KUH A;  1Y0V A;  2WO9 A;  1JIZ A;  3KEJ A;  3B2Z A;  4GWM A;  3LJZ A;  1XM5 A;  1D7X A;  1GE6 A;  4PKV A;  3LQB A;  4IJO A;  1OM8 A;  2DW0 A;  2OW1 A;  3LGP A;  4GWN A;  1KUK A;  2E2D A;  1G12 A;  2Z2D A;  4PKW A;  2DDY A;  5BOY A;  1UMS A;  1MMP A;  3EDZ A;  1KUF A;  3DPF A;  4GR8 A;  3EDH A;  2FV9 A;  3LUM A;  1BUV M;  1BZS A;  2AYK A;  4R3V A;  5B5P A;  2W12 A;  5I0L A;  1FLS A;  2TCL A;  1CK7 A;  1JAP A;  2X3A A;  3EDG A;  1QIB A;  1PWU A;  1WNI A;  3K7L A;  4J4M A;  1G4K A;  1SLM A;  2JT5 A;  1MMB A;  3ZXH A;  2JIH A;  4GR3 A;  3LQ0 A;  2KRJ A;  1Z3J A;  1O0Q A;  1BKC E;  1QUA A;  3AYU A;  1JAO A;  2USN A;  3F18 A;  1GO8 P;  1S4B P;  4WF6 A;  2O3E A;  1OS9 A;  1SLN A;  2OW0 A;  1EB6 A;  1SAT A;  5D3C A;  3RTS A;  1JJ9 A;  2XS3 A;  1C8T A;  5H8X A;  2E3X A;  1UMT A;  3N2V A;  1IAA A;  4XM6 A;  1B3D A;  1YCM A;  3EHX A;  1XUR A;  1QJI A;  1GO7 P;  2K2G A;  2Y6C A;  4AUO A;  2OXU A;  4G0D A;  3GBO A;  1ATL A;  2SRT A;  4XM7 A;  3U1R A;  2WO8 A;  1UTZ A;  966C A;  3UVC A;  1D5J A;  4JIJ A;  1GXD A;  3WV1 A;  1G05 A;  2JSD A;  3DTI A;  3HBV P;  4ZR5 A;  3DNG A;  5JMY A;  3L0V A;  4WKI A;  1BQQ M;  2J0T A;  1OMJ A;  1PWQ A;  3AIG A;  3E8R A;  4L19 A;  4JQG A;  1JAQ A;  4H84 A;  5L79 A;  1XFY A;  5D1U A;  1HY7 A;  3TVC A;  1ZP5 A;  3DL1 A;  5D1S A;  4XM8 A;  4WK7 A;  3I7I A;  1AST A;  1ND1 A;  2RJQ A;  3OHL A;  1K7I A;  2POJ A;  1I76 A;  2W0D A;  4AIG A;  4L7A A; 
#chains in the Genus database with same CATH homology
 4FVL A;  1KAP P;  1QIC A;  5BPA A;  3DTE A;  2Y6D A;  2OW9 A;  1HFC A;  1IAG A;  1YP1 A;  1XFX A;  2YUF A;  1Y8J A;  4PKR A;  1MMR A;  2O36 A;  1CIZ A;  3MA2 A;  1FBL A;  1JIW P;  1YQY A;  2OVX A;  1XUC A;  1J7N A;  2OI0 A;  3B92 A;  1C7K A;  2ERO A;  3KWV C;  1ZXC A;  3HY7 A;  3WV3 A;  3LJT A;  1GKD A;  4I35 A;  3G5C A;  4PKQ A;  2L0R A;  5D2B A;  4DD8 A;  5I12 A;  1MMQ A;  1B8Y A;  1DMT A;  3KEK A;  3TSK A;  3KEC A;  2HU6 A;  4AYK A;  3EDI A;  3RTT A;  1Q3A A;  1CAQ A;  1CGL A;  2X7M A;  1GE5 A;  3LUN A;  2OXW A;  4I03 A;  4H1Q A;  3P1V A;  3HDA P;  4ILW D;  2OXZ A;  3O64 A;  1D8M A;  1IAB A;  3Q2G A;  3KRY A;  1EUB A;  2ERP A;  1G9K A;  1KBC A;  1XFV A;  1KUI A;  3LEA A;  2OZR A;  1K7Q A;  3USN A;  2W13 A;  1I73 A;  3EWJ A;  4L63 A;  1H71 P;  3V96 B;  2MLR A;  3ZUK A;  4CTH A;  2A8H A;  3CKI A;  1IAE A;  1HTD A;  1BKC A;  4FXQ A;  1RMZ A;  4EFS A;  5CXA A;  4FXY P;  4A7B A;  1SMP A;  1R54 A;  3LIR A;  4XBH A;  2CLT A;  4GUY A;  2MZH A;  1XFW A;  5LAB A;  3LK8 A;  4A3W A;  2QPJ A;  1BKC I;  2W15 A;  1BUD A;  1A85 A;  3B8Z A;  3HBU P;  3VI1 A;  5L7F A;  1CGF A;  2D1N A;  1K7G A;  3HYG A;  3N2U A;  3HY9 A;  3KHI A;  3NX7 A;  2CKI A;  1ROS A;  2DW1 A;  1MNC A;  1CGE A;  2JT6 A;  1Y93 A;  3BA0 A;  830C A;  2FV5 A;  4AXQ A;  1I1I P;  1USN A;  1HFS A;  1R55 A;  3LJG A;  1HOV A;  5D1T A;  1AYK A;  1ZVX A;  4WKE A;  5I4O A;  4GQL A;  1GKC A;  4JP4 A;  4PKU A;  4DPE A;  1CXV A;  2OW2 A;  2YIG A;  3Q2H A;  3LIK A;  1JH1 A;  1EAK A;  4H82 A;  1QJJ A;  2ERQ A;  2WOA A;  4H76 A;  2V4B A;  3DSL A;  1O0T A;  2MZE A;  1SRP A;  3TS4 A;  1SU3 A;  1OM6 A;  1FM1 A;  1JK3 A;  1CQR A;  1OS2 A;  5I43 A;  1OO9 A;  4Q1L A;  4IUW A;  2XS4 A;  5D7W A;  1PWW A;  4ON1 A;  1R1J A;  3F15 A;  1UEA A;  3KME A;  2W14 A;  3LKA A;  2JNP A;  4DV8 A;  5CZM A;  3LMC A;  4XCT A;  2X3C A;  1OM7 A;  3VTG A;  3KMC A;  2MLS A;  1R1I A;  1G49 A;  4HX3 A;  3DWB A;  3F16 A;  1AKL A;  1IAD A;  3HDB A;  1BSW A;  1BIW A;  1BQO A;  3F1A A;  3G42 A;  4PKT A;  3DPE A;  1XUD A;  1JKY A;  4L6T A;  2OVZ A;  5BOT A;  3EHY A;  4WZV A;  3LIL A;  1HV5 A;  2AIG P;  1ZXV A;  1D8F A;  1PWP A;  4G9L A;  4JA1 A;  3K7N A;  2YB9 A;  3AYK A;  4H2E A;  4DF9 A;  1RM8 A;  1XFU A;  1DTH A;  4IN9 A;  2D1O A;  2RJP A;  1IAC A;  2OY4 A;  4HMA A;  4FU4 A;  5I2Z A;  3L0T A;  2I47 A;  3ZVS A;  1L6J A;  1ZTQ A;  1A86 A;  2J83 A;  2DDF A;  3I7G A;  4GR0 A;  1JAN A;  3ELM A;  3F19 A;  4QKZ A;  1R1H A;  4JPA A;  2DW2 A;  456C A;  3HB2 P;  3LE9 A;  1KUG A;  5CUH A;  1QIA A;  1GE7 A;  4H3X A;  1PWV A;  4H49 A;  2PJT A;  4GF1 A;  4PKS A;  2K9C A;  2MZI A;  1AF0 A;  5B5O A;  3WV2 A;  3DTK A;  1YOU A;  5I3M A;  1C3I A;  3SHI A;  1BM6 A;  3F17 A;  3O2X A;  3OHO A;  4H30 A;  2N8R A;  1ZS0 A;  1UTT A;  1XFZ A;  3TT4 A;  3P24 A;  2OY2 A;  2X3B A;  1KUH A;  1Y0V A;  2WO9 A;  1JIZ A;  3KEJ A;  3B2Z A;  4GWM A;  3LJZ A;  1D7X A;  1GE6 A;  4PKV A;  3LQB A;  4IJO A;  1OM8 A;  2DW0 A;  2OW1 A;  3LGP A;  4GWN A;  1KUK A;  2E2D A;  1G12 A;  2Z2D A;  4PKW A;  2DDY A;  5BOY A;  1UMS A;  1MMP A;  3EDZ A;  1KUF A;  3DPF A;  4GR8 A;  3EDH A;  2FV9 A;  3LUM A;  1BUV M;  1BZS A;  2AYK A;  4R3V A;  5B5P A;  2W12 A;  5I0L A;  1FLS A;  2TCL A;  1CK7 A;  1JAP A;  2X3A A;  3EDG A;  1QIB A;  1PWU A;  1WNI A;  3K7L A;  4J4M A;  1G4K A;  1SLM A;  2JT5 A;  1MMB A;  3ZXH A;  2JIH A;  4GR3 A;  3LQ0 A;  2KRJ A;  1Z3J A;  1O0Q A;  1BKC E;  1QUA A;  3AYU A;  1JAO A;  2USN A;  3F18 A;  1GO8 P;  1S4B P;  4WF6 A;  2O3E A;  1OS9 A;  1SLN A;  2OW0 A;  1EB6 A;  1SAT A;  5D3C A;  3RTS A;  1JJ9 A;  2XS3 A;  1C8T A;  5H8X A;  2E3X A;  1UMT A;  3N2V A;  1IAA A;  4XM6 A;  1B3D A;  1YCM A;  3EHX A;  1XUR A;  1QJI A;  1GO7 P;  2K2G A;  2Y6C A;  4AUO A;  2OXU A;  4G0D A;  3GBO A;  1ATL A;  2SRT A;  4XM7 A;  3U1R A;  2WO8 A;  1UTZ A;  966C A;  3UVC A;  1D5J A;  4JIJ A;  1GXD A;  3WV1 A;  1G05 A;  2JSD A;  3DTI A;  3HBV P;  4ZR5 A;  3DNG A;  5JMY A;  3L0V A;  4WKI A;  1BQQ M;  2J0T A;  1OMJ A;  1PWQ A;  3AIG A;  3E8R A;  4L19 A;  4JQG A;  1JAQ A;  4H84 A;  5L79 A;  1XFY A;  5D1U A;  1HY7 A;  3TVC A;  1ZP5 A;  3DL1 A;  5D1S A;  4XM8 A;  4WK7 A;  3I7I A;  1AST A;  1ND1 A;  2RJQ A;  3OHL A;  1K7I A;  2POJ A;  1I76 A;  2W0D A;  4AIG A;  4L7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...