1JJXA

Solution structure of recombinant human brain-type fatty acid binding protein
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
131
structure length
131
Chain Sequence
b'VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRAIN-TYPE FATTY ACID BINDING PROTEIN
publication title Solution structure of fatty acid-binding protein from human brain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 29
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2001-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1jjxA00
1HQPA 2AT0X 3S26A 4EDEA 4K19A 3EBKA 5L8IA 1ALBA 1X8UA 1SY2A 4LZVA 4HPAA 4UU2A 4A1HA 1EPBA 5D48A 2JU3A 2GTFX 5LKFA 1EW3A 1TVQA 4YKOA 4YDBA 2W2FA 5D8JA 4IMNA 2W2BA 1JV4A 3BDRA 4WBKA 2Q9SA 2Q2PA 5F58A 1ERBA 2ACPX 1SXUA 1A18A 4ZHGA 4CK4A 5KIDA 1YP6A 3U03A 4ZFXA 5KICA 1IKJA 5H8TA 1A57A 3TGAA 2R56A 1GX8A 4TKHA 3U9PC 3HK1A 4Y0SA 3NX1A 3STNA 3I0AA 2R74A 2N93A 4R0BA 2HZRA 3F8AA 2RA6A 3PH5A 1BSYA 4I9SA 5HZ8A 4LKPA 3WJCA 1SXYA 1X89A 5LJCA 5B29A 1FELA 1D3SA 1G74A 1BM5A 5HZ6A 4AZOA 2AL0X 1KXOA 2LBAA 3ELZA 3O2YA 5EZ2A 3B2LA 3OJYC 3STKA 3P6GA 1LIEA 1GM6A 3KFFA 2G79A 1DFVA 1MVGA 3TGBA 4QZUA 4HPDA 1BSOA 4YCHA 3FW5A 1YP7A 4ORYA 4IB8A 3KZAA 3D96A 3FLLA 2MO5A 4QYPA 3FENA 1OEEA 4TKJA 1NP4A 4M6SA 4XMFA 5JR8A 2AT8X 5LJKA 5L8OA 1GKAB 2JU8A 4EEJA 3UEUA 2NNQA 3K3LA 4NP1A 4YGGA 2POAA 1QY0A 4IB9A 3ZQ3A 3HWEA 4ORWA 5C0NA 1X71A 1ICMA 2AT3X 1GKAA 3AKMA 2QO6A 2XKLA 3FA8A 3FEPA 1AELA 4RUUA 3DSZA 1SY0A 2QOSC 5BVSA 3MVFA 1LFOA 4GRJA 1TOWA 3WJEA 4DQ4A 5KHPA 1DF3A 1LF7A 1G85A 3VG4A 3HWDA 1B56A 1QFTA 1TXLA 2FR3A 1DZJA 2O62A 1HN2A 4D6AA 2A3FX 5IO6A 3APVA 4TKBA 1OBUA 1IKEA 1OBQA 5FFHA 1H91A 1E02A 2XSTA 1MX7A 2FS6A 3IA8A 4ES7A 2CM4A 1OPAA 2HMBA 5F1EA 1KQWA 3B2JA 3TGCA 1KZWA 5K06A 2X45A 1JYJA 3BX7A 1FTPA 4I3CA 3TF6A 2IFBA 1EALA 1HMTA 3P6EA 1GT1A 4XMHA 4EXZA 5D4AA 5AQ6A 4ZHHA 1E00A 3VG7A 2FS7A 2FTBA 1E5PA 3JS1A 3KFHA 1QWDA 3IFBA 1UREA 1JBHA 1B8EA 2K23A 1O1UA 4ARHA 4TJZA 4GE1A 4ODDA 5IO7A 3VG5A 1D2UA 2A13A 4QAEA 3PP6A 4GKCA 1OBPA 2ALLX 4AZMA 1QY2A 2AT6X 4N7CA 4XMCA 2OVDA 4YMYA 1HMRA 2G7BA 4XMDA 1YIVA 1DZMA 4AZQA 2K62A 4ORSA 1VPRA 1DZKA 3EYCA 4MVIA 5H9LA 3BLGA 2JN3A 2NNDA 1AVGI 3F9DA 3EBWA 3CWKA 3WJGA 5HWZA 5CE4A 3GAQA 1QFVA 1BBPA 4DQ3A 4IAWA 2A2UA 4YFPA 5DPQA 1ZNGA 3O22A 2L5PA 2PY1A 4ZHCA 2FLJA 5EDBA 3D95A 3NX2A 3BRNA 4YDAA 3EM0A 2JU7A 5LJBA 1CJ5A 4IMOA 2AH7X 1BJ7A 1AB0A 3FW4A 4GNYA 2QO5A 4AYHA 4ORXA 1IW2A 3APXA 1GT3A 5EDCA 5HCEC 2WQ9A 1G5WA 4UU3A 2AMMX 4GNWA 1GGLA 1RBPA 3TZSA 1BRQA 1ML7A 1KT5A 2GJ5A 1QQSA 2L67A 4ORUA 2WEWA 3BU9A 4MVKA 3RZYA 3VG3A 5FENA 4OS0A 3P6FA 1AQBA 2BLGA 3JSQA 3PECA 3APUA 3FMZA 1ZNEA 5LJHA 1CBSA 4Y0QA 3T1DA 1QABE 3FA9A 1NGLA 1EXSA 4MVLA 1QG5A 2GC9A 4KIIA 5HCDC 1EIIA 1XCAA 1HBPA 2MM3A 4A60A 1CRBA 1PM1X 1PBOA 1VYFA 4XMGA 1KZXA 4ZCBA 3KFGA 1LIDA 1ADLA 2ANSA 4N7DA 4ZH9A 1U0XA 1PEEA 2OFRX 1KGLA 1EQDA 2HYSA 3C76X 1LIFA 3C78X 2R73A 2WQAE 5BVQA 3APWA 5EEDA 1MX8A 1CBIA 1FDQA 2DM5A 5HA0A 4NLIA 1B0OA 3NR3A 4PSQA 1T68X 3NADA 1BEBA 1LIBA 4YGZA 4YFRA 2P8GA 3P6CA 4OS8A 2WWPA 4IB6A 4QGVA 1KOIA 2A2GA 1GT5A 4NNSA 3CBSA 1A3YA 2HNXA 4AZRA 1JYDA 2FR2A 3B2IA 4HPCA 1DZPA 5HTEA 2HZQA 4WFUA 5LJGA 3UEWA 4I3DA 1QY1A 2KTDA 1I06A 4YCEA 1EPAA 3NPOA 1LICA 5HCCC 1ZNLA 1LPJA 5H9KA 1IFCA 1ZNDA 3O19A 1KT6A 4QGWA 1HBQA 1E06A 2WUTA 4LZUA 4ZHDA 4IBAA 4OMXA 1HMSA 1OPBA 1RLBE 1S44A 5L8NA 1SXWA 4ALBA 1G7NA 1ZRYA 2EU7X 1YWCA 4Y0PA 2OVAA 3B2HA 3UEXA 4A8ZA 1KT4A 4IB7A 4NLJA 4I3BA 2QO4A 2CBSA 4AZPA 1ERXA 1ZNHA 3WBGA 4ZGUA 1TW4A 1YWBA 3VG6A 5H9NA 3BY0A 2Q4NA 3DTQA 3C77X 5LJDA 1ZNKA 1BRPA 3CQNA 5IO5A 3WJDA 2HLVA 5D45A 1SY3A 1JJXA 1CBQA 1O8VA 3EMMA 3FR2A 2RQ0A 4O9SA 4YKMA 4D6BA 4NYQA 2YG2A 2QM9A 1ICNA 2ACOA 2G78A 2CBRA 3FR4A 3WJFA 1T0VA 3I17A 2FWVA 1VYGA 4EFGA 1TOUA 5D47A 1N0SA 1YWDA 5H9AA 2CZTA 1NP1A 3FA7A 5F6BA 1U17A 2FRSA 1SY1A 4YGHA 4YH0A 1SXXA 3D97A 1I05A 2CM9A 1MDCA 4YBUA 3VG2A 1YUPA 2NNEA 4GH7A 3KFIA 1L6MA 2AT5X 3Q6LA 3HWGA 4TQ2A 3B2KA 1FEMA 3BSZE 4QGXA 1DV9A 3U0DA 3RSWA 4AW8A 2NP1A 1A2DA 4BVMA 1BWYA 2KT4B 2L9CA 3FR5A 5FAZA 3WXQA 3BS2A 1EUOA 1SA8A 1KT3A 1JZUA 2AKQA 1GX9A 3WVMA 4ZHFA 1PMPA 1P6PA 1ACDA 1KT7A 2LB6A 1XKIA 1S7DA 4QYNA 1U18A 2OFMX 3NQ3A 3CBCA 4A1YA 3KQ0A 2Q39A 1B4MA 3G7XA 5LJEA 2WR6A 3ZUIA 3HWFA 5F7GA 2L68A 4OMWA 2OZQA 2LFOA 1IIUA 1KQXA 1UZ2X 4YFQA 4OS3A 4WFVA 3BU1A 4QZTA 5BVTA 4BQUA 4AZNA 1BLRA 2ASNX 4ALOA 4NNTA 1OEJA 4TLJA 2OVEA 2RCQA 3BX8A 3CMPA 3ZUOA 3PH6A 3L4RA 5F6ZA 5LKEA 4GETA 1O1VA 4YBPA 2W2AA 1Z24A 3ELXA 2WEXA 5EPQA 1X8OA 4ORRA 3WJBA 4LKTA 1I04A 5HA1A 3PEDA 1FE3A 1X8QA 3QKGA 2FT9A 1DC9A 3PPTA 4TNNA 5HBSA 2RCTA 4ZR2A 2A0AA 1LKEA 4ZH6A 1EIOA 1LNMA 3SAOA 4Y0RA 5DG4A 1CBRA 4NYRA 2JOZA 1X8PA 2Q2MA 2LKKA 4I9RA 3FELA 3P6DA 5B27A 4M7MA 1X8NA 5EEEA 2LBVA 3CQRA 3NQ9A 4ZJ0A 3FA6A 1FENA 1T8VA 4HFOA 1GT4A 1S2PA 2WSJA 1GXAA 1MUPA 4XMEA 3UEVA 4BOEA 5HTDA 5HZQA 2X46A 2RD7C 3CR6A 3P6HA 3MBTA 2E4JA 1YWAA 3STMX 4RUNA 1BSQA 5HAEA 1R0UA 2MJIA 5HZ9A 4IAXA 1IFBA 3NP1A 3FEKA 5HZ5A 2CZUA 1OEKA 3AKNA 3FIQA 4HPBA 2F73A 1JJJA 1I4UA
chains in the Genus database with same CATH superfamily
1HQPA 2AT0X 3S26A 4EDEA 4K19A 1NQNA 3WZPA 3EBKA 5L8IA 1ALBA 1SWJA 1X8UA 1SY2A 4LZVA 3MX7A 3S5XA 4HPAA 4UU2A 4Z28A 4A1HA 1EPBA 5D48A 2JU3A 2GTFX 4NV7A 2QOMA 1JIWI 5LKFA 1EW3A 1TVQA 4YKOA 3RDXA 4YDBA 2W2FA 5D8JA 4IMNA 4U46A 2W2BA 1JV4A 3BDRA 4WBKA 2Q9SA 2Q2PA 5F58A 1ERBA 2ACPX 4O49A 1SXUA 1JMXA 1A18A 4ZHGA 4INNA 1SWDA 4CK4A 4O4SA 3UAQA 3RWXA 5KIDA 1YP6A 3U03A 4ZFXA 4NV8A 5KICA 1IKJA 5H8TA 1A57A 3TGAA 2JGSA 2R56A 1GX8A 4TKHA 4WHIA 3U9PC 3HK1A 4Y0SA 3D4RA 1STPA 1W5RA 4O4XA 1SWFA 3NX1A 3I0AA 3STNA 3ZWEA 2R74A 2N93A 4R0BA 2HZRA 1WUBA 2RA6A 3F8AA 1BSYA 3PH5A 4I9SA 4LKPA 4ML7B 5HZ8A 3WJCA 1SXYA 1X89A 2OFBA 5LJCA 5B11O 1NC9A 1FELA 1D3SA 1G74A 2Z4IA 5B29A 1BM5A 5HZ6A 4AZOA 2BS6A 2AL0X 4DNEA 2A8GA 1KXOA 2LBAA 4CDCA 3ELZA 3O2YA 4KC7A 4O3XB 1N9YA 2RTQB 5EZ2A 3B2LA 3OJYC 3STKA 1SWEA 1LIEA 3P6GA 4CDDA 1RXHA 2MHDA 1GM6A 2MWHA 2YMSA 3KFFA 2G79A 2OL6O 1VWFB 1SWQA 3OBLA 4EQAC 5BYPA 4GGRA 1DFVA 1MVGA 3CKGA 3TGBA 4QZUA 4HPDA 1BSOA 4YCHA 1JQPA 1YP7A 3FW5A 4IB8A 4ORYA 3LV4A 4CPHB 3KZAA 3D96A 3FLLA 1SRHA 2MO5A 1NQMA 1SWRA 3FENA 4QYPA 1OEEA 3HOLA 4TKJA 4GU8A 1NP4A 4M6SA 2ZAIA 4XMFA 4BX6B 5JR8A 2AT8X 5LJKA 1RAVA 5L8OA 1GKAB 5K68A 4OELA 4GK9A 2VDFA 1RXKA 1SWUA 2JU8A 2OF9A 3WZNA 3N91A 5L3YA 2GH7A 4EEJA 3UEUA 2NNQA 3WZOA 3K3LA 4NP1A 4YGGA 1HXZA 4FQBB 2POAA 3SZIA 1QY0A 2IZEB 4IB9A 3T2XA 3HWEA 4ORWA 5IRUA 3ZQ3A 1STSB 2FGSA 4BJ8A 5C0NA 1X71A 1ICMA 4MISA 3WOVA 2AT3X 1GKAA 3AKMA 3RKGA 2QO6A 2XKLA 2GTLO 3F6ZB 3FA8A 3FEPA 1AELA 1JJUA 2AF5A 2G8CO 1LDOA 3DSZA 4RUUA 1SY0A 2QOSC 4KH8A 5BVSA 1Y52X 4QQ1A 3MVFA 1K24A 1LFOA 1MEPA 1UYNX 4GRJA 3WYQA 1TOWA 4GDZA 4BBOA 1HY2A 1N4JA 3CKFA 3VE2A 3WJEA 4DQ4A 5KHPA 1SWBA 1DF3A 1LF7A 1G85A 3VG4A 1UYOX 4CSBA 3HWDA 2VFCA 2OY7A 1B56A 1QFTA 1TXLA 2FR3A 3SLJA 1DZJA 2O62A 1HN2A 3HPEA 4D6AA 4FBVA 2A3FX 2X55A 2F01A 5IO6A 5B2AO 3APVA 4TKBA 1OBUA 2IZIA 1IKEA 1OBQA 5FFHA 2RTLA 1H91A 4JO6A 1E02A 2HKDA 1MX7A 2FS6A 2XSTA 3IA8A 2CM4A 1OPAA 2OY5O 4ES7A 2HMBA 5F1EA 1KQWA 1NBXA 3B2JA 4Z2VA 3TGCA 5K06A 1KZWA 2X45A 4IABA 1JYJA 3BX7A 1FTPA 4O4OA 4O4UA 2RTFB 2OVSA 4I3CA 5F2BA 3TF6A 2IFBA 1EALA 1HMTA 3P6EA 4CPEA 2G5LA 1GT1A 2RTIB 4XMHA 4Z6JA 4EXZA 5D4AA 5AQ6A 4ZHHA 1E00A 4GUZA 2QMIA 4Z27A 4BGFA 3VG7A 2FS7A 2FTBA 1E5PA 1PBYA 3JS1A 3KFHA 1QWDA 4NW4A 4O3WA 3IFBA 1LCZA 1UREA 1JBHA 1B8EA 1N9MA 1O1UA 2K23A 4L3RA 2GTLM 4ARHA 4TJZA 4GE1A 1IJ8A 4ODDA 5CYBA 1MOYA 5IO7A 1OSPO 1D2UA 2A13A 4QAEA 3VG5A 3PP6A 4GKCA 4MEEA 4Z2PA 1OBPA 4Y59A 2ALLX 4AZMA 1QY2A 2RTGB 3FIDA 2AT6X 4N7CA 1AVDA 1VWQB 4XMCA 2X56A 4CDFA 2OVDA 4YMYA 1HMRA 2G7BA 4XMDA 1YIVA 1DZMA 2FHNX 2K62A 3T6LA 4ORSA 4AZQA 1VPRA 1DZKA 3EYCA 4MVIA 5AEOA 5H9LA 3VHMA 3BLGA 2JN3A 2NNDA 1AVGI 3F9DA 3EBWA 3CWKA 1W6FA 3PQSA 3WJGA 1RXJA 4GDAA 5FQ6E 5HWZA 4U9CA 2FKJA 5CE4A 3GAQA 1AVEA 1QFVA 1VWOB 1BBPA 4DQ3A 4IAWA 2A2UA 4YFPA 5DPQA 1ZNGA 3O22A 2L5PA 2PY1A 4ZHCA 2FLJA 3RBYA 3EW2A 3S60A 1WBIA 5EDBA 3D95A 3NX2A 3BRNA 4YDAA 3EM0A 1SWSA 2JU7A 3P24A 4ID2A 2RTDB 5B5FA 5LJBA 1CJ5A 4IMOA 3HTYA 2AH7X 1BJ7A 2RTKA 1AB0A 3FW4A 4GNYA 2OL7A 2QO5A 4JGLA 2OYBO 4AYHA 2RTPB 4ORXA 2I5ZO 1IW2A 4U8UN 2IZKA 1KL4A 4JHQA 3APXA 3GE2A 1GT3A 3ZW0A 3PDFA 5EDCA 5HCEC 2WQ9A 3FYFA 1G5WA 4UU3A 2AMMX 4GNWA 1GGLA 4CPFA 1RBPA 1RSUB 3TZSA 1BRQA 4OEMA 3RY2A 1SWGA 1ML7A 1W4TA 1KT5A 2GJ5A 4GGTA 3WZQA 1QQSA 3PK2A 1FJ1E 2L67A 1GX3A 2WEWA 3BU9A 4MVKA 4ORUA 3H3IA 4HWMA 5AJCA 3RZYA 3VG3A 4CPIA 5FENA 4OS0A 3P6FA 1AQBA 1HQQA 5IXGA 2BLGA 3JSQA 3PECA 3SLTA 3APUA 4I6SA 1Y53X 3FMZA 3VPJE 1Y9LA 2OY1O 1SLGB 1ZNEA 5LJHA 1CBSA 2OY8A 3QQ2A 4Y0QA 5IRAA 2X8FA 3T1DA 2AVIA 1QABE 3FA9A 3P02A 1NGLA 1EXSA 2X4MA 1I78A 1QG5A 2GC9A 4KIIA 4MVLA 3RDMA 5HCDC 1EIIA 1XCAA 1HBPA 2IZAA 2MM3A 4A60A 1CRBA 1PTSA 1SMPI 1PM1X 1PBOA 1VYFA 2BS5A 4XMGA 3MM0A 2IZFB 3ZW1A 3D9WA 1KZXA 4ZCBA 3EC5A 4BX7A 3KFGA 1LIDA 2JW1A 1ADLA 3VU1A 2ANSA 4N7DA 1VWCB 1LUQA 1SRJA 2BHVA 1U0XA 5JD2A 4ZH9A 1PEEA 2OFRX 4GJVA 1KGLA 1EQDA 1SRFA 2RTRB 2RTMA 2HYSA 1VWIB 1VWNB 3C76X 1LIFA 2BSZA 2UZ2A 2R73A 3C78X 2WQAE 2LA7A 5BVQA 3APWA 4IRWA 5EEDA 1MX8A 1SREA 1CBIA 1SRIA 2RTAA 4KT5A 1FDQA 2DM5A 5B3MO 5HA0A 1LCVA 3RDUA 4NLIA 1B0OA 3RE6A 3VE1A 3NR3A 4BX5A 4PSQA 5K67A 1HXLA 4FBRA 1T68X 3NADA 1BEBA 1LIBA 4YGZA 3ZW2A 2P8GA 3P6CA 4JNJA 4OS8A 2WPUA 2KW1A 4YFRA 2WWPA 4IB6A 4ON1A 4QGVA 1KOIA 2A2GA 2A5BA 2RN4A 1GT5A 4NNSA 3CBSA 1A3YA 4Y5DA 2HNXA 4AZRA 4ZGFA 1JYDA 2FR2A 3B2IA 4HPCA 4I60A 4MVEA 1DZPA 5HTEA 3E3CA 2DJFA 1KL3A 2HZQA 4WFUA 5LJGA 3UEWA 4I3DA 1QY1A 2KTDA 1I06A 4YCEA 1EI5A 1STRB 2C1SA 1EPAA 3NPOA 1LICA 5HCCC 3SOTA 1VWHB 1ZNLA 1KFFA 1LPJA 1NDJA 3WYPA 1JMZA 5H9KA 1IFCA 1SWHA 1ZNDA 2BC3A 3O19A 3EW1A 1E2TA 1KT6A 4QGWA 1HBQA 5B10O 1E06A 2WUTA 1SWCA 2Y32A 4LZUA 3OD9A 2RTEB 4IBAA 3ZZVA 2RTHB 1HMSA 1OPBA 1RLBE 1S44A 4OMXA 2X8SA 4L1NA 5L8NA 2KD2A 1SXWA 4ALBA 1G7NA 1ZRYA 2EU7X 2I5VO 1YWCA 4Y0PA 2OVAA 3B2HA 3HOEA 3UEXA 4O3YA 4A8ZA 1KT4A 5AJBA 1SLEB 4IB7A 4NLJA 3RDSA 4I3BA 2QO4A 2CBSA 4AZPA 1ERXA 1ZNHA 1LDQA 3FDCA 1SWTA 5B5GA 3WBGA 4YVBA 1TW4A 1YWBA 3VG6A 4ZGUA 5H9NA 3BY0A 2Q4NA 5IRWA 3SZJA 3DTQA 3C77X 5LJDA 4I95A 1ZNKA 1BRPA 3CQNA 5IO5A 2X32A 3LHNA 2HLVA 3WJDA 5D45A 4MIRA 1SY3A 2X8TA 3T6FA 1JJXA 1CBQA 2BT9A 1O8VA 3EMMA 2MF6A 3FR2A 2RQ0A 4O9SA 2UYWA 4YKMA 4D6BA 2CAMA 4NYQA 2YG2A 1ICNA 2ACOA 2FKGA 1VWGB 2G78A 2QM9A 2CBRA 2A5CA 3FR4A 3WJFA 3PQUA 1T0VA 3I17A 2FWVA 1VYGA 3ZW0B 1SWAA 1Y0GA 1TOUA 4EFGA 5D47A 1N0SA 1YWDA 4FBOA 5H9AA 4B55A 2CZTA 2FHLA 4GGZA 4LQZA 1NP1A 3FA7A 5F6BA 1U17A 2FRSA 1SY1A 4YGHA 4YH0A 2JMBA 1SXXA 3D97A 1I05A 4ZHDA 2CM9A 2ZSCA 1MDCA 4YBUA 3VG2A 1YUPA 2NNEA 3RDOA 1VWLB 2Y3EA 4GH7A 3KFIA 1L6MA 2AT5X 3Q6LA 3HWGA 3ZI8A 4TQ2A 3B2KA 1FEMA 3BSZE 4QGXA 1DV9A 1SWNA 3U0DA 1Y9TA 3V8UA 3RSWA 4U8UO 4AW8A 2NP1A 1A2DA 1MK5A 4BVMA 1BWYA 2KT4B 2L9CA 3FR5A 5FAZA 1RSTB 1SWLA 3BS2A 1VWRB 3WXQA 2IZDB 2ZAGA 1EUOA 4OKAA 3VHHA 1SA8A 3X00A 1SWOA 1KT3A 1JZUA 2RTJA 4FGIB 4O3ZA 2AKQA 3ZW1B 1GX9A 3WVMA 4BX7B 4ZHFA 3Q34A 1PMPA 1P6PA 2OF8A 3MG5A 1ACDA 1KT7A 2KTSA 1SLDB 2LB6A 1XKIA 1S7DA 1SWPA 4QYNA 5CSEA 2M4LA 1U18A 2OFMX 2IZLB 3NQ3A 1VWBB 3CBCA 3LTWA 4A1YA 3KQ0A 2C4IA 2Q39A 2Z4HA 1B4MA 3G7XA 1VWKB 1SRGA 3KVNA 5LJEA 2WR6A 3ZUIA 3HWFA 5F7GA 2L68A 4OMWA 4BX5B 1VWDB 1VWJB 3AEHA 1DF8A 2OZQA 2LFOA 1IIUA 1KQXA 1UZ2X 4YFQA 4GJSA 4OS3A 1VWPB 4WFVA 2IZGB 3RDQA 3BU1A 4QZTA 2RTBB 4QRLA 4BQUA 4CDEA 3AUMO 2GTLN 4AZNA 5BVTA 2ASNX 1BLRA 4ALOA 1Y55X 4NNTA 3VHIA 1OEJA 4CPHA 4TLJA 2OVEA 2RCQA 3BX8A 3CMPA 3ZUOA 4PJ2A 3PH6A 3L4RA 5F6ZA 3T2WA 4GETA 4BX6A 5LKEA 1O1VA 2OL8O 4KCAA 4YBPA 4Z2OA 2QCBA 1Z24A 2W2AA 2WEXA 3ELXA 4GZVA 1X8OA 4QNIA 2F09A 5EPQA 3SZHA 4BCSA 4ORRA 3WJBA 4U8UM 2IZHB 1I04A 4LKTA 4U3QA 5HA1A 3PEDA 1FE3A 1X8QA 3QKGA 2FT9A 2OFAA 2PI3O 1DC9A 5FQ7E 3S5VA 3PPTA 3JQOA 4DCBA 4TNNA 4C5PA 5HBSA 2RCTA 4ZR2A 2A0AA 1LKEA 1LCWA 1MM9A 4ZH6A 4CV7A 1EIOA 1LNMA 3NBXX 3SAOA 4Y0RA 2IZCB 5DG4A 1CBRA 4NYRA 4KC8A 1SWKA 1X8PA 2JOZA 1VWMB 2Q2MA 2LKKA 4I9RA 3FELA 1VWAB 3P6DA 5B27A 4M7MA 1K3BA 1X8NA 1N7YA 3SLOA 5EEEA 2LBVA 3CQRA 3NQ9A 1LELA 4EKVA 4ZJ0A 3FA6A 1FENA 1T8VA 1KL5A 2Y3FA 4HFOA 1GT4A 1S2PA 3NQKA 1VWEB 2WSJA 1GXAA 1MUPA 4XMEA 3UEVA 2DJGA 2X34A 4BOEA 5HTDA 5HZQA 3VGWA 2X46A 2RD7C 3CR6A 3OE3A 2IZBA 3P6HA 1N43A 3MBTA 2E4JA 2IZJA 1YWAA 3STMX 1I9HA 4RUNA 5CHKA 2RTNB 1BSQA 2VFBA 4GD9A 4COTA 1R0UA 5HAEA 2MJIA 5HZ9A 2RTCB 4IAXA 3RY1A 1IFBA 2RTOB 3NP1A 3FEKA 5HZ5A 2CZUA 1OEKA 3AKNA 1VYOA 3FIQA 4HPBA 2F73A 5FQ8E 1I4UA 3RE5A 1JJJA 1SLFB 2C1QA
chains in the Genus database with same CATH topology
1HQPA 2AT0X 3S26A 4EDEA 4K19A 3EBKA 5L8IA 1ALBA 1X8UA 1SY2A 4LZVA 3MX7A 3S5XA 4HPAA 4UU2A 4A1HA 1EPBA 5D48A 2JU3A 2GTFX 1JIWI 5LKFA 1EW3A 1TVQA 4YKOA 4YDBA 2W2FA 5D8JA 4IMNA 2W2BA 1JV4A 3BDRA 4WBKA 2Q9SA 2Q2PA 5F58A 1ERBA 2ACPX 4O49A 1SXUA 1A18A 4ZHGA 4INNA 4CK4A 4O4SA 3UAQA 3RWXA 5KIDA 1YP6A 3U03A 4ZFXA 5KICA 1IKJA 5H8TA 1A57A 3TGAA 2R56A 1GX8A 4TKHA 4WHIA 3U9PC 3HK1A 4Y0SA 3D4RA 4O4XA 3NX1A 3STNA 3I0AA 3ZWEA 2R74A 2N93A 4R0BA 2HZRA 3F8AA 2RA6A 3PH5A 1BSYA 4I9SA 5HZ8A 4LKPA 4ML7B 3WJCA 1SXYA 1X89A 5LJCA 2Z4IA 1FELA 1D3SA 1G74A 5B29A 1BM5A 5HZ6A 4AZOA 2BS6A 2AL0X 1KXOA 2LBAA 3ELZA 3O2YA 4KC7A 4O3XB 5EZ2A 3B2LA 3OJYC 3STKA 3P6GA 1LIEA 2MHDA 1GM6A 2MWHA 2YMSA 3KFFA 2G79A 4EQAC 3OBLA 5BYPA 1DFVA 1MVGA 3TGBA 4QZUA 4HPDA 1BSOA 4YCHA 3FW5A 1YP7A 4ORYA 4IB8A 3LV4A 3KZAA 3D96A 3FLLA 2MO5A 4QYPA 3FENA 1OEEA 3HOLA 4TKJA 4GU8A 1NP4A 4M6SA 2ZAIA 4XMFA 5JR8A 2AT8X 5LJKA 5L8OA 1GKAB 4GK9A 2JU8A 3N91A 4EEJA 3UEUA 2NNQA 3K3LA 4NP1A 4YGGA 4FQBB 2POAA 1QY0A 4IB9A 3ZQ3A 3HWEA 4ORWA 5C0NA 1X71A 1ICMA 4MISA 3WOVA 2AT3X 1GKAA 3AKMA 3RKGA 2QO6A 2XKLA 2GTLO 3F6ZB 3FA8A 3FEPA 1AELA 4RUUA 3DSZA 1SY0A 2QOSC 4KH8A 5BVSA 4QQ1A 3MVFA 1LFOA 4GRJA 1TOWA 4GDZA 3WJEA 3VE2A 4DQ4A 5KHPA 1DF3A 1LF7A 1G85A 3VG4A 4CSBA 3HWDA 1B56A 1QFTA 1TXLA 2FR3A 1DZJA 2O62A 1HN2A 4D6AA 4FBVA 2A3FX 5IO6A 3APVA 4TKBA 1OBUA 1IKEA 1OBQA 5FFHA 1H91A 1E02A 2XSTA 1MX7A 2FS6A 3IA8A 4ES7A 2CM4A 1OPAA 2HMBA 5F1EA 1KQWA 3B2JA 3TGCA 1KZWA 5K06A 2X45A 4IABA 1JYJA 3BX7A 1FTPA 4O4OA 4O4UA 4I3CA 2OVSA 3TF6A 2IFBA 1EALA 1HMTA 3P6EA 1GT1A 4XMHA 4EXZA 5D4AA 5AQ6A 4ZHHA 1E00A 2QMIA 3VG7A 2FS7A 2FTBA 1E5PA 3JS1A 3KFHA 1QWDA 4NW4A 4O3WA 3IFBA 1UREA 1JBHA 1B8EA 2K23A 1O1UA 4L3RA 2GTLM 4ARHA 4TJZA 4GE1A 4ODDA 5CYBA 5IO7A 3VG5A 1D2UA 2A13A 4QAEA 3PP6A 4GKCA 1OBPA 2ALLX 4AZMA 1QY2A 2AT6X 4N7CA 4XMCA 2OVDA 4YMYA 1HMRA 2G7BA 4XMDA 1YIVA 1DZMA 4AZQA 2K62A 4ORSA 1VPRA 1DZKA 3EYCA 4MVIA 5AEOA 5H9LA 3BLGA 2JN3A 2NNDA 1AVGI 3F9DA 3EBWA 3CWKA 3PQSA 3WJGA 5FQ6E 5HWZA 4U9CA 5CE4A 3GAQA 1QFVA 1BBPA 4DQ3A 4IAWA 2A2UA 4YFPA 5DPQA 1ZNGA 3O22A 2L5PA 2PY1A 4ZHCA 2FLJA 3RBYA 5EDBA 3D95A 3NX2A 3BRNA 4YDAA 3EM0A 2JU7A 4ID2A 3P24A 5LJBA 1CJ5A 4IMOA 3HTYA 2AH7X 1BJ7A 1AB0A 3FW4A 4GNYA 4JGLA 2QO5A 4AYHA 4ORXA 1IW2A 4U8UN 3APXA 3GE2A 1GT3A 3ZW0A 5EDCA 5HCEC 2WQ9A 3FYFA 1G5WA 4UU3A 2AMMX 4GNWA 1GGLA 1RBPA 3TZSA 1BRQA 1ML7A 1KT5A 2GJ5A 1QQSA 2L67A 4ORUA 2WEWA 3BU9A 4MVKA 5AJCA 3H3IA 4HWMA 3RZYA 3VG3A 5FENA 4OS0A 3P6FA 1AQBA 2BLGA 3JSQA 3PECA 3APUA 4I6SA 3FMZA 3VPJE 1Y9LA 1ZNEA 5LJHA 1CBSA 4Y0QA 2X8FA 3T1DA 1QABE 3FA9A 3P02A 1NGLA 1EXSA 4MVLA 1QG5A 2GC9A 4KIIA 5HCDC 1EIIA 1XCAA 1HBPA 2MM3A 4A60A 1CRBA 1SMPI 1PM1X 1PBOA 1VYFA 2BS5A 4XMGA 1KZXA 3ZW1A 4ZCBA 3KFGA 1LIDA 2JW1A 1ADLA 3VU1A 2ANSA 4N7DA 2BHVA 4ZH9A 1U0XA 1PEEA 2OFRX 1KGLA 1EQDA 2HYSA 3C76X 1LIFA 3C78X 2R73A 2WQAE 2LA7A 5BVQA 3APWA 5EEDA 1MX8A 4KT5A 1CBIA 1FDQA 2DM5A 3VE1A 5HA0A 4NLIA 1B0OA 3NR3A 4PSQA 4FBRA 1T68X 3NADA 1BEBA 1LIBA 4YGZA 3ZW2A 2P8GA 3P6CA 4OS8A 4YFRA 2KW1A 2WWPA 4IB6A 4ON1A 4QGVA 1KOIA 2A2GA 2RN4A 1GT5A 4NNSA 3CBSA 1A3YA 4ZGFA 2HNXA 4AZRA 1JYDA 2FR2A 3B2IA 4HPCA 4MVEA 1DZPA 5HTEA 3E3CA 2HZQA 4WFUA 5LJGA 3UEWA 4I3DA 1QY1A 2KTDA 1I06A 4YCEA 1EI5A 1EPAA 3NPOA 1LICA 5HCCC 3SOTA 1ZNLA 1LPJA 5H9KA 1IFCA 1ZNDA 3O19A 1KT6A 4QGWA 1HBQA 1E06A 2WUTA 4LZUA 3ZZVA 3OD9A 4IBAA 4ZHDA 4OMXA 1HMSA 1OPBA 1RLBE 1S44A 2X8SA 4L1NA 5L8NA 2KD2A 1SXWA 4ALBA 1G7NA 1ZRYA 2EU7X 1YWCA 4Y0PA 2OVAA 3B2HA 3HOEA 3UEXA 4O3YA 4A8ZA 1KT4A 5AJBA 4IB7A 4NLJA 4I3BA 2QO4A 2CBSA 4AZPA 1ERXA 1ZNHA 3WBGA 4ZGUA 1TW4A 1YWBA 3VG6A 5H9NA 3BY0A 2Q4NA 3DTQA 3C77X 5LJDA 4I95A 1ZNKA 1BRPA 3CQNA 5IO5A 3LHNA 3WJDA 2HLVA 5D45A 4MIRA 1SY3A 2X8TA 1JJXA 1CBQA 2BT9A 1O8VA 3EMMA 3FR2A 2RQ0A 4O9SA 4YKMA 4D6BA 4NYQA 2YG2A 1ICNA 2ACOA 2G78A 2QM9A 2CBRA 3FR4A 3WJFA 3PQUA 1T0VA 3I17A 2FWVA 1VYGA 3ZW0B 4EFGA 1TOUA 5D47A 1N0SA 1YWDA 4FBOA 5H9AA 2CZTA 4LQZA 1NP1A 3FA7A 5F6BA 1U17A 2FRSA 1SY1A 4YGHA 4YH0A 2JMBA 1SXXA 3D97A 1I05A 2CM9A 1MDCA 4YBUA 3VG2A 1YUPA 2NNEA 4GH7A 3KFIA 1L6MA 2AT5X 3Q6LA 3HWGA 3ZI8A 4TQ2A 3B2KA 1FEMA 3BSZE 4QGXA 1DV9A 3U0DA 1Y9TA 3V8UA 3RSWA 4U8UO 4AW8A 2NP1A 1A2DA 4BVMA 1BWYA 2KT4B 2L9CA 3FR5A 5FAZA 3WXQA 3BS2A 2ZAGA 1EUOA 1SA8A 1KT3A 1JZUA 4FGIB 4O3ZA 2AKQA 3ZW1B 1GX9A 3WVMA 4ZHFA 1PMPA 1P6PA 1ACDA 1KT7A 2KTSA 2LB6A 1XKIA 1S7DA 4QYNA 2M4LA 1U18A 2OFMX 3NQ3A 3CBCA 4A1YA 3KQ0A 2Q39A 2Z4HA 1B4MA 3G7XA 5LJEA 2WR6A 3ZUIA 3HWFA 5F7GA 2L68A 4OMWA 2OZQA 2LFOA 1IIUA 1KQXA 1UZ2X 4YFQA 4OS3A 4WFVA 3BU1A 4QZTA 4QRLA 4BQUA 5BVTA 2GTLN 4AZNA 1BLRA 2ASNX 4ALOA 4NNTA 1OEJA 4TLJA 2OVEA 2RCQA 3BX8A 3CMPA 3ZUOA 4PJ2A 3PH6A 3L4RA 5F6ZA 5LKEA 4GETA 1O1VA 4KCAA 4YBPA 2W2AA 1Z24A 3ELXA 2WEXA 4QNIA 4GZVA 1X8OA 5EPQA 2F09A 4ORRA 3WJBA 4U8UM 4LKTA 1I04A 4U3QA 5HA1A 3PEDA 1FE3A 1X8QA 3QKGA 2FT9A 1DC9A 5FQ7E 3S5VA 3PPTA 3JQOA 4TNNA 5HBSA 2RCTA 4ZR2A 2A0AA 1LKEA 4ZH6A 4CV7A 1EIOA 1LNMA 3NBXX 3SAOA 4Y0RA 5DG4A 1CBRA 4NYRA 4KC8A 2JOZA 1X8PA 2Q2MA 2LKKA 4I9RA 3FELA 3P6DA 5B27A 4M7MA 1X8NA 5EEEA 2LBVA 3CQRA 3NQ9A 4ZJ0A 3FA6A 1FENA 1T8VA 4HFOA 1GT4A 1S2PA 3NQKA 2WSJA 1GXAA 1MUPA 4XMEA 3UEVA 4BOEA 5HTDA 5HZQA 2X46A 2RD7C 3CR6A 3OE3A 3P6HA 3MBTA 2E4JA 1YWAA 3STMX 4RUNA 1BSQA 4COTA 5HAEA 1R0UA 2MJIA 5HZ9A 4IAXA 1IFBA 3NP1A 3FEKA 5HZ5A 2CZUA 1OEKA 3AKNA 3FIQA 4HPBA 2F73A 5FQ8E 1I4UA 1JJJA 3S60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQP A;  2AT0 X;  3S26 A;  4EDE A;  4K19 A;  3EBK A;  5L8I A;  1ALB A;  1X8U A;  1SY2 A;  4LZV A;  4HPA A;  4UU2 A;  4A1H A;  1EPB A;  5D48 A;  2JU3 A;  2GTF X;  5LKF A;  1EW3 A;  1TVQ A;  4YKO A;  4YDB A;  2W2F A;  5D8J A;  4IMN A;  2W2B A;  1JV4 A;  3BDR A;  4WBK A;  2Q9S A;  2Q2P A;  5F58 A;  1ERB A;  2ACP X;  1SXU A;  1A18 A;  4ZHG A;  4CK4 A;  5KID A;  1YP6 A;  3U03 A;  4ZFX A;  5KIC A;  1IKJ A;  5H8T A;  1A57 A;  3TGA A;  2R56 A;  1GX8 A;  4TKH A;  3U9P C;  3HK1 A;  4Y0S A;  3NX1 A;  3STN A;  3I0A A;  2R74 A;  2N93 A;  4R0B A;  2HZR A;  3F8A A;  2RA6 A;  3PH5 A;  1BSY A;  4I9S A;  5HZ8 A;  4LKP A;  3WJC A;  1SXY A;  1X89 A;  5LJC A;  5B29 A;  1FEL A;  1D3S A;  1G74 A;  1BM5 A;  5HZ6 A;  4AZO A;  2AL0 X;  1KXO A;  2LBA A;  3ELZ A;  3O2Y A;  5EZ2 A;  3B2L A;  3OJY C;  3STK A;  3P6G A;  1LIE A;  1GM6 A;  3KFF A;  2G79 A;  1DFV A;  1MVG A;  3TGB A;  4QZU A;  4HPD A;  1BSO A;  4YCH A;  3FW5 A;  1YP7 A;  4ORY A;  4IB8 A;  3KZA A;  3D96 A;  3FLL A;  2MO5 A;  4QYP A;  3FEN A;  1OEE A;  4TKJ A;  1NP4 A;  4M6S A;  4XMF A;  5JR8 A;  2AT8 X;  5LJK A;  5L8O A;  1GKA B;  2JU8 A;  4EEJ A;  3UEU A;  2NNQ A;  3K3L A;  4NP1 A;  4YGG A;  2POA A;  1QY0 A;  4IB9 A;  3ZQ3 A;  3HWE A;  4ORW A;  5C0N A;  1X71 A;  1ICM A;  2AT3 X;  1GKA A;  3AKM A;  2QO6 A;  2XKL A;  3FA8 A;  3FEP A;  1AEL A;  4RUU A;  3DSZ A;  1SY0 A;  2QOS C;  5BVS A;  3MVF A;  1LFO A;  4GRJ A;  1TOW A;  3WJE A;  4DQ4 A;  5KHP A;  1DF3 A;  1LF7 A;  1G85 A;  3VG4 A;  3HWD A;  1B56 A;  1QFT A;  1TXL A;  2FR3 A;  1DZJ A;  2O62 A;  1HN2 A;  4D6A A;  2A3F X;  5IO6 A;  3APV A;  4TKB A;  1OBU A;  1IKE A;  1OBQ A;  5FFH A;  1H91 A;  1E02 A;  2XST A;  1MX7 A;  2FS6 A;  3IA8 A;  4ES7 A;  2CM4 A;  1OPA A;  2HMB A;  5F1E A;  1KQW A;  3B2J A;  3TGC A;  1KZW A;  5K06 A;  2X45 A;  1JYJ A;  3BX7 A;  1FTP A;  4I3C A;  3TF6 A;  2IFB A;  1EAL A;  1HMT A;  3P6E A;  1GT1 A;  4XMH A;  4EXZ A;  5D4A A;  5AQ6 A;  4ZHH A;  1E00 A;  3VG7 A;  2FS7 A;  2FTB A;  1E5P A;  3JS1 A;  3KFH A;  1QWD A;  3IFB A;  1URE A;  1JBH A;  1B8E A;  2K23 A;  1O1U A;  4ARH A;  4TJZ A;  4GE1 A;  4ODD A;  5IO7 A;  3VG5 A;  1D2U A;  2A13 A;  4QAE A;  3PP6 A;  4GKC A;  1OBP A;  2ALL X;  4AZM A;  1QY2 A;  2AT6 X;  4N7C A;  4XMC A;  2OVD A;  4YMY A;  1HMR A;  2G7B A;  4XMD A;  1YIV A;  1DZM A;  4AZQ A;  2K62 A;  4ORS A;  1VPR A;  1DZK A;  3EYC A;  4MVI A;  5H9L A;  3BLG A;  2JN3 A;  2NND A;  1AVG I;  3F9D A;  3EBW A;  3CWK A;  3WJG A;  5HWZ A;  5CE4 A;  3GAQ A;  1QFV A;  1BBP A;  4DQ3 A;  4IAW A;  2A2U A;  4YFP A;  5DPQ A;  1ZNG A;  3O22 A;  2L5P A;  2PY1 A;  4ZHC A;  2FLJ A;  5EDB A;  3D95 A;  3NX2 A;  3BRN A;  4YDA A;  3EM0 A;  2JU7 A;  5LJB A;  1CJ5 A;  4IMO A;  2AH7 X;  1BJ7 A;  1AB0 A;  3FW4 A;  4GNY A;  2QO5 A;  4AYH A;  4ORX A;  1IW2 A;  3APX A;  1GT3 A;  5EDC A;  5HCE C;  2WQ9 A;  1G5W A;  4UU3 A;  2AMM X;  4GNW A;  1GGL A;  1RBP A;  3TZS A;  1BRQ A;  1ML7 A;  1KT5 A;  2GJ5 A;  1QQS A;  2L67 A;  4ORU A;  2WEW A;  3BU9 A;  4MVK A;  3RZY A;  3VG3 A;  5FEN A;  4OS0 A;  3P6F A;  1AQB A;  2BLG A;  3JSQ A;  3PEC A;  3APU A;  3FMZ A;  1ZNE A;  5LJH A;  1CBS A;  4Y0Q A;  3T1D A;  1QAB E;  3FA9 A;  1NGL A;  1EXS A;  4MVL A;  1QG5 A;  2GC9 A;  4KII A;  5HCD C;  1EII A;  1XCA A;  1HBP A;  2MM3 A;  4A60 A;  1CRB A;  1PM1 X;  1PBO A;  1VYF A;  4XMG A;  1KZX A;  4ZCB A;  3KFG A;  1LID A;  1ADL A;  2ANS A;  4N7D A;  4ZH9 A;  1U0X A;  1PEE A;  2OFR X;  1KGL A;  1EQD A;  2HYS A;  3C76 X;  1LIF A;  3C78 X;  2R73 A;  2WQA E;  5BVQ A;  3APW A;  5EED A;  1MX8 A;  1CBI A;  1FDQ A;  2DM5 A;  5HA0 A;  4NLI A;  1B0O A;  3NR3 A;  4PSQ A;  1T68 X;  3NAD A;  1BEB A;  1LIB A;  4YGZ A;  4YFR A;  2P8G A;  3P6C A;  4OS8 A;  2WWP A;  4IB6 A;  4QGV A;  1KOI A;  2A2G A;  1GT5 A;  4NNS A;  3CBS A;  1A3Y A;  2HNX A;  4AZR A;  1JYD A;  2FR2 A;  3B2I A;  4HPC A;  1DZP A;  5HTE A;  2HZQ A;  4WFU A;  5LJG A;  3UEW A;  4I3D A;  1QY1 A;  2KTD A;  1I06 A;  4YCE A;  1EPA A;  3NPO A;  1LIC A;  5HCC C;  1ZNL A;  1LPJ A;  5H9K A;  1IFC A;  1ZND A;  3O19 A;  1KT6 A;  4QGW A;  1HBQ A;  1E06 A;  2WUT A;  4LZU A;  4ZHD A;  4IBA A;  4OMX A;  1HMS A;  1OPB A;  1RLB E;  1S44 A;  5L8N A;  1SXW A;  4ALB A;  1G7N A;  1ZRY A;  2EU7 X;  1YWC A;  4Y0P A;  2OVA A;  3B2H A;  3UEX A;  4A8Z A;  1KT4 A;  4IB7 A;  4NLJ A;  4I3B A;  2QO4 A;  2CBS A;  4AZP A;  1ERX A;  1ZNH A;  3WBG A;  4ZGU A;  1TW4 A;  1YWB A;  3VG6 A;  5H9N A;  3BY0 A;  2Q4N A;  3DTQ A;  3C77 X;  5LJD A;  1ZNK A;  1BRP A;  3CQN A;  5IO5 A;  3WJD A;  2HLV A;  5D45 A;  1SY3 A;  1JJX A;  1CBQ A;  1O8V A;  3EMM A;  3FR2 A;  2RQ0 A;  4O9S A;  4YKM A;  4D6B A;  4NYQ A;  2YG2 A;  2QM9 A;  1ICN A;  2ACO A;  2G78 A;  2CBR A;  3FR4 A;  3WJF A;  1T0V A;  3I17 A;  2FWV A;  1VYG A;  4EFG A;  1TOU A;  5D47 A;  1N0S A;  1YWD A;  5H9A A;  2CZT A;  1NP1 A;  3FA7 A;  5F6B A;  1U17 A;  2FRS A;  1SY1 A;  4YGH A;  4YH0 A;  1SXX A;  3D97 A;  1I05 A;  2CM9 A;  1MDC A;  4YBU A;  3VG2 A;  1YUP A;  2NNE A;  4GH7 A;  3KFI A;  1L6M A;  2AT5 X;  3Q6L A;  3HWG A;  4TQ2 A;  3B2K A;  1FEM A;  3BSZ E;  4QGX A;  1DV9 A;  3U0D A;  3RSW A;  4AW8 A;  2NP1 A;  1A2D A;  4BVM A;  1BWY A;  2KT4 B;  2L9C A;  3FR5 A;  5FAZ A;  3WXQ A;  3BS2 A;  1EUO A;  1SA8 A;  1KT3 A;  1JZU A;  2AKQ A;  1GX9 A;  3WVM A;  4ZHF A;  1PMP A;  1P6P A;  1ACD A;  1KT7 A;  2LB6 A;  1XKI A;  1S7D A;  4QYN A;  1U18 A;  2OFM X;  3NQ3 A;  3CBC A;  4A1Y A;  3KQ0 A;  2Q39 A;  1B4M A;  3G7X A;  5LJE A;  2WR6 A;  3ZUI A;  3HWF A;  5F7G A;  2L68 A;  4OMW A;  2OZQ A;  2LFO A;  1IIU A;  1KQX A;  1UZ2 X;  4YFQ A;  4OS3 A;  4WFV A;  3BU1 A;  4QZT A;  5BVT A;  4BQU A;  4AZN A;  1BLR A;  2ASN X;  4ALO A;  4NNT A;  1OEJ A;  4TLJ A;  2OVE A;  2RCQ A;  3BX8 A;  3CMP A;  3ZUO A;  3PH6 A;  3L4R A;  5F6Z A;  5LKE A;  4GET A;  1O1V A;  4YBP A;  2W2A A;  1Z24 A;  3ELX A;  2WEX A;  5EPQ A;  1X8O A;  4ORR A;  3WJB A;  4LKT A;  1I04 A;  5HA1 A;  3PED A;  1FE3 A;  1X8Q A;  3QKG A;  2FT9 A;  1DC9 A;  3PPT A;  4TNN A;  5HBS A;  2RCT A;  4ZR2 A;  2A0A A;  1LKE A;  4ZH6 A;  1EIO A;  1LNM A;  3SAO A;  4Y0R A;  5DG4 A;  1CBR A;  4NYR A;  2JOZ A;  1X8P A;  2Q2M A;  2LKK A;  4I9R A;  3FEL A;  3P6D A;  5B27 A;  4M7M A;  1X8N A;  5EEE A;  2LBV A;  3CQR A;  3NQ9 A;  4ZJ0 A;  3FA6 A;  1FEN A;  1T8V A;  4HFO A;  1GT4 A;  1S2P A;  2WSJ A;  1GXA A;  1MUP A;  4XME A;  3UEV A;  4BOE A;  5HTD A;  5HZQ A;  2X46 A;  2RD7 C;  3CR6 A;  3P6H A;  3MBT A;  2E4J A;  1YWA A;  3STM X;  4RUN A;  1BSQ A;  5HAE A;  1R0U A;  2MJI A;  5HZ9 A;  4IAX A;  1IFB A;  3NP1 A;  3FEK A;  5HZ5 A;  2CZU A;  1OEK A;  3AKN A;  3FIQ A;  4HPB A;  2F73 A;  1JJJ A;  1I4U A; 
#chains in the Genus database with same CATH topology
 1HQP A;  2AT0 X;  3S26 A;  4EDE A;  4K19 A;  1NQN A;  3WZP A;  3EBK A;  5L8I A;  1ALB A;  1SWJ A;  1X8U A;  1SY2 A;  4LZV A;  3MX7 A;  3S5X A;  4HPA A;  4UU2 A;  4Z28 A;  4A1H A;  1EPB A;  5D48 A;  2JU3 A;  2GTF X;  4NV7 A;  2QOM A;  1JIW I;  5LKF A;  1EW3 A;  1TVQ A;  4YKO A;  3RDX A;  4YDB A;  2W2F A;  5D8J A;  4IMN A;  4U46 A;  2W2B A;  1JV4 A;  3BDR A;  4WBK A;  2Q9S A;  2Q2P A;  5F58 A;  1ERB A;  2ACP X;  4O49 A;  1SXU A;  1JMX A;  1A18 A;  4ZHG A;  4INN A;  1SWD A;  4CK4 A;  4O4S A;  3UAQ A;  3RWX A;  5KID A;  1YP6 A;  3U03 A;  4ZFX A;  4NV8 A;  5KIC A;  1IKJ A;  5H8T A;  1A57 A;  3TGA A;  2JGS A;  2R56 A;  1GX8 A;  4TKH A;  4WHI A;  3U9P C;  3HK1 A;  4Y0S A;  3D4R A;  1STP A;  1W5R A;  4O4X A;  1SWF A;  3NX1 A;  3I0A A;  3STN A;  3ZWE A;  2R74 A;  2N93 A;  4R0B A;  2HZR A;  1WUB A;  2RA6 A;  3F8A A;  1BSY A;  3PH5 A;  4I9S A;  4LKP A;  4ML7 B;  5HZ8 A;  3WJC A;  1SXY A;  1X89 A;  2OFB A;  5LJC A;  5B11 O;  1NC9 A;  1FEL A;  1D3S A;  1G74 A;  2Z4I A;  5B29 A;  1BM5 A;  5HZ6 A;  4AZO A;  2BS6 A;  2AL0 X;  4DNE A;  2A8G A;  1KXO A;  2LBA A;  4CDC A;  3ELZ A;  3O2Y A;  4KC7 A;  4O3X B;  1N9Y A;  2RTQ B;  5EZ2 A;  3B2L A;  3OJY C;  3STK A;  1SWE A;  1LIE A;  3P6G A;  4CDD A;  1RXH A;  2MHD A;  1GM6 A;  2MWH A;  2YMS A;  3KFF A;  2G79 A;  2OL6 O;  1VWF B;  1SWQ A;  3OBL A;  4EQA C;  5BYP A;  4GGR A;  1DFV A;  1MVG A;  3CKG A;  3TGB A;  4QZU A;  4HPD A;  1BSO A;  4YCH A;  1JQP A;  1YP7 A;  3FW5 A;  4IB8 A;  4ORY A;  3LV4 A;  4CPH B;  3KZA A;  3D96 A;  3FLL A;  1SRH A;  2MO5 A;  1NQM A;  1SWR A;  3FEN A;  4QYP A;  1OEE A;  3HOL A;  4TKJ A;  4GU8 A;  1NP4 A;  4M6S A;  2ZAI A;  4XMF A;  4BX6 B;  5JR8 A;  2AT8 X;  5LJK A;  1RAV A;  5L8O A;  1GKA B;  5K68 A;  4OEL A;  4GK9 A;  2VDF A;  1RXK A;  1SWU A;  2JU8 A;  2OF9 A;  3WZN A;  3N91 A;  5L3Y A;  2GH7 A;  4EEJ A;  3UEU A;  2NNQ A;  3WZO A;  3K3L A;  4NP1 A;  4YGG A;  1HXZ A;  4FQB B;  2POA A;  3SZI A;  1QY0 A;  2IZE B;  4IB9 A;  3T2X A;  3HWE A;  4ORW A;  5IRU A;  3ZQ3 A;  1STS B;  2FGS A;  4BJ8 A;  5C0N A;  1X71 A;  1ICM A;  4MIS A;  3WOV A;  2AT3 X;  1GKA A;  3AKM A;  3RKG A;  2QO6 A;  2XKL A;  2GTL O;  3F6Z B;  3FA8 A;  3FEP A;  1AEL A;  1JJU A;  2AF5 A;  2G8C O;  1LDO A;  3DSZ A;  4RUU A;  1SY0 A;  2QOS C;  4KH8 A;  5BVS A;  1Y52 X;  4QQ1 A;  3MVF A;  1K24 A;  1LFO A;  1MEP A;  1UYN X;  4GRJ A;  3WYQ A;  1TOW A;  4GDZ A;  4BBO A;  1HY2 A;  1N4J A;  3CKF A;  3VE2 A;  3WJE A;  4DQ4 A;  5KHP A;  1SWB A;  1DF3 A;  1LF7 A;  1G85 A;  3VG4 A;  1UYO X;  4CSB A;  3HWD A;  2VFC A;  2OY7 A;  1B56 A;  1QFT A;  1TXL A;  2FR3 A;  3SLJ A;  1DZJ A;  2O62 A;  1HN2 A;  3HPE A;  4D6A A;  4FBV A;  2A3F X;  2X55 A;  2F01 A;  5IO6 A;  5B2A O;  3APV A;  4TKB A;  1OBU A;  2IZI A;  1IKE A;  1OBQ A;  5FFH A;  2RTL A;  1H91 A;  4JO6 A;  1E02 A;  2HKD A;  1MX7 A;  2FS6 A;  2XST A;  3IA8 A;  2CM4 A;  1OPA A;  2OY5 O;  4ES7 A;  2HMB A;  5F1E A;  1KQW A;  1NBX A;  3B2J A;  4Z2V A;  3TGC A;  5K06 A;  1KZW A;  2X45 A;  4IAB A;  1JYJ A;  3BX7 A;  1FTP A;  4O4O A;  4O4U A;  2RTF B;  2OVS A;  4I3C A;  5F2B A;  3TF6 A;  2IFB A;  1EAL A;  1HMT A;  3P6E A;  4CPE A;  2G5L A;  1GT1 A;  2RTI B;  4XMH A;  4Z6J A;  4EXZ A;  5D4A A;  5AQ6 A;  4ZHH A;  1E00 A;  4GUZ A;  2QMI A;  4Z27 A;  4BGF A;  3VG7 A;  2FS7 A;  2FTB A;  1E5P A;  1PBY A;  3JS1 A;  3KFH A;  1QWD A;  4NW4 A;  4O3W A;  3IFB A;  1LCZ A;  1URE A;  1JBH A;  1B8E A;  1N9M A;  1O1U A;  2K23 A;  4L3R A;  2GTL M;  4ARH A;  4TJZ A;  4GE1 A;  1IJ8 A;  4ODD A;  5CYB A;  1MOY A;  5IO7 A;  1OSP O;  1D2U A;  2A13 A;  4QAE A;  3VG5 A;  3PP6 A;  4GKC A;  4MEE A;  4Z2P A;  1OBP A;  4Y59 A;  2ALL X;  4AZM A;  1QY2 A;  2RTG B;  3FID A;  2AT6 X;  4N7C A;  1AVD A;  1VWQ B;  4XMC A;  2X56 A;  4CDF A;  2OVD A;  4YMY A;  1HMR A;  2G7B A;  4XMD A;  1YIV A;  1DZM A;  2FHN X;  2K62 A;  3T6L A;  4ORS A;  4AZQ A;  1VPR A;  1DZK A;  3EYC A;  4MVI A;  5AEO A;  5H9L A;  3VHM A;  3BLG A;  2JN3 A;  2NND A;  1AVG I;  3F9D A;  3EBW A;  3CWK A;  1W6F A;  3PQS A;  3WJG A;  1RXJ A;  4GDA A;  5FQ6 E;  5HWZ A;  4U9C A;  2FKJ A;  5CE4 A;  3GAQ A;  1AVE A;  1QFV A;  1VWO B;  1BBP A;  4DQ3 A;  4IAW A;  2A2U A;  4YFP A;  5DPQ A;  1ZNG A;  3O22 A;  2L5P A;  2PY1 A;  4ZHC A;  2FLJ A;  3RBY A;  3EW2 A;  3S60 A;  1WBI A;  5EDB A;  3D95 A;  3NX2 A;  3BRN A;  4YDA A;  3EM0 A;  1SWS A;  2JU7 A;  3P24 A;  4ID2 A;  2RTD B;  5B5F A;  5LJB A;  1CJ5 A;  4IMO A;  3HTY A;  2AH7 X;  1BJ7 A;  2RTK A;  1AB0 A;  3FW4 A;  4GNY A;  2OL7 A;  2QO5 A;  4JGL A;  2OYB O;  4AYH A;  2RTP B;  4ORX A;  2I5Z O;  1IW2 A;  4U8U N;  2IZK A;  1KL4 A;  4JHQ A;  3APX A;  3GE2 A;  1GT3 A;  3ZW0 A;  3PDF A;  5EDC A;  5HCE C;  2WQ9 A;  3FYF A;  1G5W A;  4UU3 A;  2AMM X;  4GNW A;  1GGL A;  4CPF A;  1RBP A;  1RSU B;  3TZS A;  1BRQ A;  4OEM A;  3RY2 A;  1SWG A;  1ML7 A;  1W4T A;  1KT5 A;  2GJ5 A;  4GGT A;  3WZQ A;  1QQS A;  3PK2 A;  1FJ1 E;  2L67 A;  1GX3 A;  2WEW A;  3BU9 A;  4MVK A;  4ORU A;  3H3I A;  4HWM A;  5AJC A;  3RZY A;  3VG3 A;  4CPI A;  5FEN A;  4OS0 A;  3P6F A;  1AQB A;  1HQQ A;  5IXG A;  2BLG A;  3JSQ A;  3PEC A;  3SLT A;  3APU A;  4I6S A;  1Y53 X;  3FMZ A;  3VPJ E;  1Y9L A;  2OY1 O;  1SLG B;  1ZNE A;  5LJH A;  1CBS A;  2OY8 A;  3QQ2 A;  4Y0Q A;  5IRA A;  2X8F A;  3T1D A;  2AVI A;  1QAB E;  3FA9 A;  3P02 A;  1NGL A;  1EXS A;  2X4M A;  1I78 A;  1QG5 A;  2GC9 A;  4KII A;  4MVL A;  3RDM A;  5HCD C;  1EII A;  1XCA A;  1HBP A;  2IZA A;  2MM3 A;  4A60 A;  1CRB A;  1PTS A;  1SMP I;  1PM1 X;  1PBO A;  1VYF A;  2BS5 A;  4XMG A;  3MM0 A;  2IZF B;  3ZW1 A;  3D9W A;  1KZX A;  4ZCB A;  3EC5 A;  4BX7 A;  3KFG A;  1LID A;  2JW1 A;  1ADL A;  3VU1 A;  2ANS A;  4N7D A;  1VWC B;  1LUQ A;  1SRJ A;  2BHV A;  1U0X A;  5JD2 A;  4ZH9 A;  1PEE A;  2OFR X;  4GJV A;  1KGL A;  1EQD A;  1SRF A;  2RTR B;  2RTM A;  2HYS A;  1VWI B;  1VWN B;  3C76 X;  1LIF A;  2BSZ A;  2UZ2 A;  2R73 A;  3C78 X;  2WQA E;  2LA7 A;  5BVQ A;  3APW A;  4IRW A;  5EED A;  1MX8 A;  1SRE A;  1CBI A;  1SRI A;  2RTA A;  4KT5 A;  1FDQ A;  2DM5 A;  5B3M O;  5HA0 A;  1LCV A;  3RDU A;  4NLI A;  1B0O A;  3RE6 A;  3VE1 A;  3NR3 A;  4BX5 A;  4PSQ A;  5K67 A;  1HXL A;  4FBR A;  1T68 X;  3NAD A;  1BEB A;  1LIB A;  4YGZ A;  3ZW2 A;  2P8G A;  3P6C A;  4JNJ A;  4OS8 A;  2WPU A;  2KW1 A;  4YFR A;  2WWP A;  4IB6 A;  4ON1 A;  4QGV A;  1KOI A;  2A2G A;  2A5B A;  2RN4 A;  1GT5 A;  4NNS A;  3CBS A;  1A3Y A;  4Y5D A;  2HNX A;  4AZR A;  4ZGF A;  1JYD A;  2FR2 A;  3B2I A;  4HPC A;  4I60 A;  4MVE A;  1DZP A;  5HTE A;  3E3C A;  2DJF A;  1KL3 A;  2HZQ A;  4WFU A;  5LJG A;  3UEW A;  4I3D A;  1QY1 A;  2KTD A;  1I06 A;  4YCE A;  1EI5 A;  1STR B;  2C1S A;  1EPA A;  3NPO A;  1LIC A;  5HCC C;  3SOT A;  1VWH B;  1ZNL A;  1KFF A;  1LPJ A;  1NDJ A;  3WYP A;  1JMZ A;  5H9K A;  1IFC A;  1SWH A;  1ZND A;  2BC3 A;  3O19 A;  3EW1 A;  1E2T A;  1KT6 A;  4QGW A;  1HBQ A;  5B10 O;  1E06 A;  2WUT A;  1SWC A;  2Y32 A;  4LZU A;  3OD9 A;  2RTE B;  4IBA A;  3ZZV A;  2RTH B;  1HMS A;  1OPB A;  1RLB E;  1S44 A;  4OMX A;  2X8S A;  4L1N A;  5L8N A;  2KD2 A;  1SXW A;  4ALB A;  1G7N A;  1ZRY A;  2EU7 X;  2I5V O;  1YWC A;  4Y0P A;  2OVA A;  3B2H A;  3HOE A;  3UEX A;  4O3Y A;  4A8Z A;  1KT4 A;  5AJB A;  1SLE B;  4IB7 A;  4NLJ A;  3RDS A;  4I3B A;  2QO4 A;  2CBS A;  4AZP A;  1ERX A;  1ZNH A;  1LDQ A;  3FDC A;  1SWT A;  5B5G A;  3WBG A;  4YVB A;  1TW4 A;  1YWB A;  3VG6 A;  4ZGU A;  5H9N A;  3BY0 A;  2Q4N A;  5IRW A;  3SZJ A;  3DTQ A;  3C77 X;  5LJD A;  4I95 A;  1ZNK A;  1BRP A;  3CQN A;  5IO5 A;  2X32 A;  3LHN A;  2HLV A;  3WJD A;  5D45 A;  4MIR A;  1SY3 A;  2X8T A;  3T6F A;  1JJX A;  1CBQ A;  2BT9 A;  1O8V A;  3EMM A;  2MF6 A;  3FR2 A;  2RQ0 A;  4O9S A;  2UYW A;  4YKM A;  4D6B A;  2CAM A;  4NYQ A;  2YG2 A;  1ICN A;  2ACO A;  2FKG A;  1VWG B;  2G78 A;  2QM9 A;  2CBR A;  2A5C A;  3FR4 A;  3WJF A;  3PQU A;  1T0V A;  3I17 A;  2FWV A;  1VYG A;  3ZW0 B;  1SWA A;  1Y0G A;  1TOU A;  4EFG A;  5D47 A;  1N0S A;  1YWD A;  4FBO A;  5H9A A;  4B55 A;  2CZT A;  2FHL A;  4GGZ A;  4LQZ A;  1NP1 A;  3FA7 A;  5F6B A;  1U17 A;  2FRS A;  1SY1 A;  4YGH A;  4YH0 A;  2JMB A;  1SXX A;  3D97 A;  1I05 A;  4ZHD A;  2CM9 A;  2ZSC A;  1MDC A;  4YBU A;  3VG2 A;  1YUP A;  2NNE A;  3RDO A;  1VWL B;  2Y3E A;  4GH7 A;  3KFI A;  1L6M A;  2AT5 X;  3Q6L A;  3HWG A;  3ZI8 A;  4TQ2 A;  3B2K A;  1FEM A;  3BSZ E;  4QGX A;  1DV9 A;  1SWN A;  3U0D A;  1Y9T A;  3V8U A;  3RSW A;  4U8U O;  4AW8 A;  2NP1 A;  1A2D A;  1MK5 A;  4BVM A;  1BWY A;  2KT4 B;  2L9C A;  3FR5 A;  5FAZ A;  1RST B;  1SWL A;  3BS2 A;  1VWR B;  3WXQ A;  2IZD B;  2ZAG A;  1EUO A;  4OKA A;  3VHH A;  1SA8 A;  3X00 A;  1SWO A;  1KT3 A;  1JZU A;  2RTJ A;  4FGI B;  4O3Z A;  2AKQ A;  3ZW1 B;  1GX9 A;  3WVM A;  4BX7 B;  4ZHF A;  3Q34 A;  1PMP A;  1P6P A;  2OF8 A;  3MG5 A;  1ACD A;  1KT7 A;  2KTS A;  1SLD B;  2LB6 A;  1XKI A;  1S7D A;  1SWP A;  4QYN A;  5CSE A;  2M4L A;  1U18 A;  2OFM X;  2IZL B;  3NQ3 A;  1VWB B;  3CBC A;  3LTW A;  4A1Y A;  3KQ0 A;  2C4I A;  2Q39 A;  2Z4H A;  1B4M A;  3G7X A;  1VWK B;  1SRG A;  3KVN A;  5LJE A;  2WR6 A;  3ZUI A;  3HWF A;  5F7G A;  2L68 A;  4OMW A;  4BX5 B;  1VWD B;  1VWJ B;  3AEH A;  1DF8 A;  2OZQ A;  2LFO A;  1IIU A;  1KQX A;  1UZ2 X;  4YFQ A;  4GJS A;  4OS3 A;  1VWP B;  4WFV A;  2IZG B;  3RDQ A;  3BU1 A;  4QZT A;  2RTB B;  4QRL A;  4BQU A;  4CDE A;  3AUM O;  2GTL N;  4AZN A;  5BVT A;  2ASN X;  1BLR A;  4ALO A;  1Y55 X;  4NNT A;  3VHI A;  1OEJ A;  4CPH A;  4TLJ A;  2OVE A;  2RCQ A;  3BX8 A;  3CMP A;  3ZUO A;  4PJ2 A;  3PH6 A;  3L4R A;  5F6Z A;  3T2W A;  4GET A;  4BX6 A;  5LKE A;  1O1V A;  2OL8 O;  4KCA A;  4YBP A;  4Z2O A;  2QCB A;  1Z24 A;  2W2A A;  2WEX A;  3ELX A;  4GZV A;  1X8O A;  4QNI A;  2F09 A;  5EPQ A;  3SZH A;  4BCS A;  4ORR A;  3WJB A;  4U8U M;  2IZH B;  1I04 A;  4LKT A;  4U3Q A;  5HA1 A;  3PED A;  1FE3 A;  1X8Q A;  3QKG A;  2FT9 A;  2OFA A;  2PI3 O;  1DC9 A;  5FQ7 E;  3S5V A;  3PPT A;  3JQO A;  4DCB A;  4TNN A;  4C5P A;  5HBS A;  2RCT A;  4ZR2 A;  2A0A A;  1LKE A;  1LCW A;  1MM9 A;  4ZH6 A;  4CV7 A;  1EIO A;  1LNM A;  3NBX X;  3SAO A;  4Y0R A;  2IZC B;  5DG4 A;  1CBR A;  4NYR A;  4KC8 A;  1SWK A;  1X8P A;  2JOZ A;  1VWM B;  2Q2M A;  2LKK A;  4I9R A;  3FEL A;  1VWA B;  3P6D A;  5B27 A;  4M7M A;  1K3B A;  1X8N A;  1N7Y A;  3SLO A;  5EEE A;  2LBV A;  3CQR A;  3NQ9 A;  1LEL A;  4EKV A;  4ZJ0 A;  3FA6 A;  1FEN A;  1T8V A;  1KL5 A;  2Y3F A;  4HFO A;  1GT4 A;  1S2P A;  3NQK A;  1VWE B;  2WSJ A;  1GXA A;  1MUP A;  4XME A;  3UEV A;  2DJG A;  2X34 A;  4BOE A;  5HTD A;  5HZQ A;  3VGW A;  2X46 A;  2RD7 C;  3CR6 A;  3OE3 A;  2IZB A;  3P6H A;  1N43 A;  3MBT A;  2E4J A;  2IZJ A;  1YWA A;  3STM X;  1I9H A;  4RUN A;  5CHK A;  2RTN B;  1BSQ A;  2VFB A;  4GD9 A;  4COT A;  1R0U A;  5HAE A;  2MJI A;  5HZ9 A;  2RTC B;  4IAX A;  3RY1 A;  1IFB A;  2RTO B;  3NP1 A;  3FEK A;  5HZ5 A;  2CZU A;  1OEK A;  3AKN A;  1VYO A;  3FIQ A;  4HPB A;  2F73 A;  5FQ8 E;  1I4U A;  3RE5 A;  1JJJ A;  1SLF B;  2C1Q A; 
#chains in the Genus database with same CATH homology
 1HQP A;  2AT0 X;  3S26 A;  4EDE A;  4K19 A;  3EBK A;  5L8I A;  1ALB A;  1X8U A;  1SY2 A;  4LZV A;  3MX7 A;  3S5X A;  4HPA A;  4UU2 A;  4A1H A;  1EPB A;  5D48 A;  2JU3 A;  2GTF X;  1JIW I;  5LKF A;  1EW3 A;  1TVQ A;  4YKO A;  4YDB A;  2W2F A;  5D8J A;  4IMN A;  2W2B A;  1JV4 A;  3BDR A;  4WBK A;  2Q9S A;  2Q2P A;  5F58 A;  1ERB A;  2ACP X;  4O49 A;  1SXU A;  1A18 A;  4ZHG A;  4INN A;  4CK4 A;  4O4S A;  3UAQ A;  3RWX A;  5KID A;  1YP6 A;  3U03 A;  4ZFX A;  5KIC A;  1IKJ A;  5H8T A;  1A57 A;  3TGA A;  2R56 A;  1GX8 A;  4TKH A;  4WHI A;  3U9P C;  3HK1 A;  4Y0S A;  3D4R A;  4O4X A;  3NX1 A;  3STN A;  3I0A A;  3ZWE A;  2R74 A;  2N93 A;  4R0B A;  2HZR A;  3F8A A;  2RA6 A;  3PH5 A;  1BSY A;  4I9S A;  5HZ8 A;  4LKP A;  4ML7 B;  3WJC A;  1SXY A;  1X89 A;  5LJC A;  2Z4I A;  1FEL A;  1D3S A;  1G74 A;  5B29 A;  1BM5 A;  5HZ6 A;  4AZO A;  2BS6 A;  2AL0 X;  1KXO A;  2LBA A;  3ELZ A;  3O2Y A;  4KC7 A;  4O3X B;  5EZ2 A;  3B2L A;  3OJY C;  3STK A;  3P6G A;  1LIE A;  2MHD A;  1GM6 A;  2MWH A;  2YMS A;  3KFF A;  2G79 A;  4EQA C;  3OBL A;  5BYP A;  1DFV A;  1MVG A;  3TGB A;  4QZU A;  4HPD A;  1BSO A;  4YCH A;  3FW5 A;  1YP7 A;  4ORY A;  4IB8 A;  3LV4 A;  3KZA A;  3D96 A;  3FLL A;  2MO5 A;  4QYP A;  3FEN A;  1OEE A;  3HOL A;  4TKJ A;  4GU8 A;  1NP4 A;  4M6S A;  2ZAI A;  4XMF A;  5JR8 A;  2AT8 X;  5LJK A;  5L8O A;  1GKA B;  4GK9 A;  2JU8 A;  3N91 A;  4EEJ A;  3UEU A;  2NNQ A;  3K3L A;  4NP1 A;  4YGG A;  4FQB B;  2POA A;  1QY0 A;  4IB9 A;  3ZQ3 A;  3HWE A;  4ORW A;  5C0N A;  1X71 A;  1ICM A;  4MIS A;  3WOV A;  2AT3 X;  1GKA A;  3AKM A;  3RKG A;  2QO6 A;  2XKL A;  2GTL O;  3F6Z B;  3FA8 A;  3FEP A;  1AEL A;  4RUU A;  3DSZ A;  1SY0 A;  2QOS C;  4KH8 A;  5BVS A;  4QQ1 A;  3MVF A;  1LFO A;  4GRJ A;  1TOW A;  4GDZ A;  3WJE A;  3VE2 A;  4DQ4 A;  5KHP A;  1DF3 A;  1LF7 A;  1G85 A;  3VG4 A;  4CSB A;  3HWD A;  1B56 A;  1QFT A;  1TXL A;  2FR3 A;  1DZJ A;  2O62 A;  1HN2 A;  4D6A A;  4FBV A;  2A3F X;  5IO6 A;  3APV A;  4TKB A;  1OBU A;  1IKE A;  1OBQ A;  5FFH A;  1H91 A;  1E02 A;  2XST A;  1MX7 A;  2FS6 A;  3IA8 A;  4ES7 A;  2CM4 A;  1OPA A;  2HMB A;  5F1E A;  1KQW A;  3B2J A;  3TGC A;  1KZW A;  5K06 A;  2X45 A;  4IAB A;  1JYJ A;  3BX7 A;  1FTP A;  4O4O A;  4O4U A;  4I3C A;  2OVS A;  3TF6 A;  2IFB A;  1EAL A;  1HMT A;  3P6E A;  1GT1 A;  4XMH A;  4EXZ A;  5D4A A;  5AQ6 A;  4ZHH A;  1E00 A;  2QMI A;  3VG7 A;  2FS7 A;  2FTB A;  1E5P A;  3JS1 A;  3KFH A;  1QWD A;  4NW4 A;  4O3W A;  3IFB A;  1URE A;  1JBH A;  1B8E A;  2K23 A;  1O1U A;  4L3R A;  2GTL M;  4ARH A;  4TJZ A;  4GE1 A;  4ODD A;  5CYB A;  5IO7 A;  3VG5 A;  1D2U A;  2A13 A;  4QAE A;  3PP6 A;  4GKC A;  1OBP A;  2ALL X;  4AZM A;  1QY2 A;  2AT6 X;  4N7C A;  4XMC A;  2OVD A;  4YMY A;  1HMR A;  2G7B A;  4XMD A;  1YIV A;  1DZM A;  4AZQ A;  2K62 A;  4ORS A;  1VPR A;  1DZK A;  3EYC A;  4MVI A;  5AEO A;  5H9L A;  3BLG A;  2JN3 A;  2NND A;  1AVG I;  3F9D A;  3EBW A;  3CWK A;  3PQS A;  3WJG A;  5FQ6 E;  5HWZ A;  4U9C A;  5CE4 A;  3GAQ A;  1QFV A;  1BBP A;  4DQ3 A;  4IAW A;  2A2U A;  4YFP A;  5DPQ A;  1ZNG A;  3O22 A;  2L5P A;  2PY1 A;  4ZHC A;  2FLJ A;  3RBY A;  5EDB A;  3D95 A;  3NX2 A;  3BRN A;  4YDA A;  3EM0 A;  2JU7 A;  4ID2 A;  3P24 A;  5LJB A;  1CJ5 A;  4IMO A;  3HTY A;  2AH7 X;  1BJ7 A;  1AB0 A;  3FW4 A;  4GNY A;  4JGL A;  2QO5 A;  4AYH A;  4ORX A;  1IW2 A;  4U8U N;  3APX A;  3GE2 A;  1GT3 A;  3ZW0 A;  5EDC A;  5HCE C;  2WQ9 A;  3FYF A;  1G5W A;  4UU3 A;  2AMM X;  4GNW A;  1GGL A;  1RBP A;  3TZS A;  1BRQ A;  1ML7 A;  1KT5 A;  2GJ5 A;  1QQS A;  2L67 A;  4ORU A;  2WEW A;  3BU9 A;  4MVK A;  5AJC A;  3H3I A;  4HWM A;  3RZY A;  3VG3 A;  5FEN A;  4OS0 A;  3P6F A;  1AQB A;  2BLG A;  3JSQ A;  3PEC A;  3APU A;  4I6S A;  3FMZ A;  3VPJ E;  1Y9L A;  1ZNE A;  5LJH A;  1CBS A;  4Y0Q A;  2X8F A;  3T1D A;  1QAB E;  3FA9 A;  3P02 A;  1NGL A;  1EXS A;  4MVL A;  1QG5 A;  2GC9 A;  4KII A;  5HCD C;  1EII A;  1XCA A;  1HBP A;  2MM3 A;  4A60 A;  1CRB A;  1SMP I;  1PM1 X;  1PBO A;  1VYF A;  2BS5 A;  4XMG A;  1KZX A;  3ZW1 A;  4ZCB A;  3KFG A;  1LID A;  2JW1 A;  1ADL A;  3VU1 A;  2ANS A;  4N7D A;  2BHV A;  4ZH9 A;  1U0X A;  1PEE A;  2OFR X;  1KGL A;  1EQD A;  2HYS A;  3C76 X;  1LIF A;  3C78 X;  2R73 A;  2WQA E;  2LA7 A;  5BVQ A;  3APW A;  5EED A;  1MX8 A;  4KT5 A;  1CBI A;  1FDQ A;  2DM5 A;  3VE1 A;  5HA0 A;  4NLI A;  1B0O A;  3NR3 A;  4PSQ A;  4FBR A;  1T68 X;  3NAD A;  1BEB A;  1LIB A;  4YGZ A;  3ZW2 A;  2P8G A;  3P6C A;  4OS8 A;  4YFR A;  2KW1 A;  2WWP A;  4IB6 A;  4ON1 A;  4QGV A;  1KOI A;  2A2G A;  2RN4 A;  1GT5 A;  4NNS A;  3CBS A;  1A3Y A;  4ZGF A;  2HNX A;  4AZR A;  1JYD A;  2FR2 A;  3B2I A;  4HPC A;  4MVE A;  1DZP A;  5HTE A;  3E3C A;  2HZQ A;  4WFU A;  5LJG A;  3UEW A;  4I3D A;  1QY1 A;  2KTD A;  1I06 A;  4YCE A;  1EI5 A;  1EPA A;  3NPO A;  1LIC A;  5HCC C;  3SOT A;  1ZNL A;  1LPJ A;  5H9K A;  1IFC A;  1ZND A;  3O19 A;  1KT6 A;  4QGW A;  1HBQ A;  1E06 A;  2WUT A;  4LZU A;  3ZZV A;  3OD9 A;  4IBA A;  4ZHD A;  4OMX A;  1HMS A;  1OPB A;  1RLB E;  1S44 A;  2X8S A;  4L1N A;  5L8N A;  2KD2 A;  1SXW A;  4ALB A;  1G7N A;  1ZRY A;  2EU7 X;  1YWC A;  4Y0P A;  2OVA A;  3B2H A;  3HOE A;  3UEX A;  4O3Y A;  4A8Z A;  1KT4 A;  5AJB A;  4IB7 A;  4NLJ A;  4I3B A;  2QO4 A;  2CBS A;  4AZP A;  1ERX A;  1ZNH A;  3WBG A;  4ZGU A;  1TW4 A;  1YWB A;  3VG6 A;  5H9N A;  3BY0 A;  2Q4N A;  3DTQ A;  3C77 X;  5LJD A;  4I95 A;  1ZNK A;  1BRP A;  3CQN A;  5IO5 A;  3LHN A;  3WJD A;  2HLV A;  5D45 A;  4MIR A;  1SY3 A;  2X8T A;  1JJX A;  1CBQ A;  2BT9 A;  1O8V A;  3EMM A;  3FR2 A;  2RQ0 A;  4O9S A;  4YKM A;  4D6B A;  4NYQ A;  2YG2 A;  1ICN A;  2ACO A;  2G78 A;  2QM9 A;  2CBR A;  3FR4 A;  3WJF A;  3PQU A;  1T0V A;  3I17 A;  2FWV A;  1VYG A;  3ZW0 B;  4EFG A;  1TOU A;  5D47 A;  1N0S A;  1YWD A;  4FBO A;  5H9A A;  2CZT A;  4LQZ A;  1NP1 A;  3FA7 A;  5F6B A;  1U17 A;  2FRS A;  1SY1 A;  4YGH A;  4YH0 A;  2JMB A;  1SXX A;  3D97 A;  1I05 A;  2CM9 A;  1MDC A;  4YBU A;  3VG2 A;  1YUP A;  2NNE A;  4GH7 A;  3KFI A;  1L6M A;  2AT5 X;  3Q6L A;  3HWG A;  3ZI8 A;  4TQ2 A;  3B2K A;  1FEM A;  3BSZ E;  4QGX A;  1DV9 A;  3U0D A;  1Y9T A;  3V8U A;  3RSW A;  4U8U O;  4AW8 A;  2NP1 A;  1A2D A;  4BVM A;  1BWY A;  2KT4 B;  2L9C A;  3FR5 A;  5FAZ A;  3WXQ A;  3BS2 A;  2ZAG A;  1EUO A;  1SA8 A;  1KT3 A;  1JZU A;  4FGI B;  4O3Z A;  2AKQ A;  3ZW1 B;  1GX9 A;  3WVM A;  4ZHF A;  1PMP A;  1P6P A;  1ACD A;  1KT7 A;  2KTS A;  2LB6 A;  1XKI A;  1S7D A;  4QYN A;  2M4L A;  1U18 A;  2OFM X;  3NQ3 A;  3CBC A;  4A1Y A;  3KQ0 A;  2Q39 A;  2Z4H A;  1B4M A;  3G7X A;  5LJE A;  2WR6 A;  3ZUI A;  3HWF A;  5F7G A;  2L68 A;  4OMW A;  2OZQ A;  2LFO A;  1IIU A;  1KQX A;  1UZ2 X;  4YFQ A;  4OS3 A;  4WFV A;  3BU1 A;  4QZT A;  4QRL A;  4BQU A;  5BVT A;  2GTL N;  4AZN A;  1BLR A;  2ASN X;  4ALO A;  4NNT A;  1OEJ A;  4TLJ A;  2OVE A;  2RCQ A;  3BX8 A;  3CMP A;  3ZUO A;  4PJ2 A;  3PH6 A;  3L4R A;  5F6Z A;  5LKE A;  4GET A;  1O1V A;  4KCA A;  4YBP A;  2W2A A;  1Z24 A;  3ELX A;  2WEX A;  4QNI A;  4GZV A;  1X8O A;  5EPQ A;  2F09 A;  4ORR A;  3WJB A;  4U8U M;  4LKT A;  1I04 A;  4U3Q A;  5HA1 A;  3PED A;  1FE3 A;  1X8Q A;  3QKG A;  2FT9 A;  1DC9 A;  5FQ7 E;  3S5V A;  3PPT A;  3JQO A;  4TNN A;  5HBS A;  2RCT A;  4ZR2 A;  2A0A A;  1LKE A;  4ZH6 A;  4CV7 A;  1EIO A;  1LNM A;  3NBX X;  3SAO A;  4Y0R A;  5DG4 A;  1CBR A;  4NYR A;  4KC8 A;  2JOZ A;  1X8P A;  2Q2M A;  2LKK A;  4I9R A;  3FEL A;  3P6D A;  5B27 A;  4M7M A;  1X8N A;  5EEE A;  2LBV A;  3CQR A;  3NQ9 A;  4ZJ0 A;  3FA6 A;  1FEN A;  1T8V A;  4HFO A;  1GT4 A;  1S2P A;  3NQK A;  2WSJ A;  1GXA A;  1MUP A;  4XME A;  3UEV A;  4BOE A;  5HTD A;  5HZQ A;  2X46 A;  2RD7 C;  3CR6 A;  3OE3 A;  3P6H A;  3MBT A;  2E4J A;  1YWA A;  3STM X;  4RUN A;  1BSQ A;  4COT A;  5HAE A;  1R0U A;  2MJI A;  5HZ9 A;  4IAX A;  1IFB A;  3NP1 A;  3FEK A;  5HZ5 A;  2CZU A;  1OEK A;  3AKN A;  3FIQ A;  4HPB A;  2F73 A;  5FQ8 E;  1I4U A;  1JJJ A;  3S60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...