1JK3A

Crystal structure of human mmp-12 (macrophage elastase) at true atomic resolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MACROPHAGE METALLOELASTASE
publication title Substrate specificity determinants of human macrophage elastase (MMP-12) based on the 1.1 A crystal structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2001-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1jk3A00
3LUMA 4H49A 2TCLA 1A86A 1MMQA 1KBCA 4L6TA 2OW9A 3GBOA 3N2UA 3EWJA 4ILWD 3I7GA 4J4MA 4IUWA 1BIWA 2JSDA 2QPJA 2USNA 1FLSA 3LKAA 3USNA 1D7XA 3NX7A 1HV5A 1SU3A 2OXWA 1BQOA 4G9LA 1USNA 3LJTA 1ATLA 4ZR5A 3B2ZA 3DSLA 4GQLA 3RTSA 1OM8A 1C7KA 1HFCA 3DPFA 4JPAA 3EDZA 1MMRA 1XUCA 3HDAP 1YOUA 3LQBA 2K9CA 2DDYA 3CKIA 1O0TA 3AYKA 3P24A 1BUVM 1YQYA 2E3XA 1AF0A 3EDGA 3TSKA 2JIHA 1L6JA 3LE9A 3LUNA 1BKCE 2J83A 1PWUA 5I0LA 4DF9A 2DW1A 1JH1A 1YCMA 1EAKA 1I73A 1XFZA 3G5CA 5I12A 1SLNA 2DW2A 2CKIA 2CLTA 2WO9A 4JIJA 3LEAA 1KUKA 3HYGA 1RM8A 1BQQM 3OHLA 4PKRA 3UVCA 4GWMA 1OO9A 3V96B 4XM8A 456CA 1BZSA 5L7FA 2L0RA 3Q2HA 4L63A 1GKDA 4R3VA 1QIBA 3KEKA 5I3MA 4H3XA 1K7QA 4PKTA 1IAGA 1GE5A 2W12A 1G05A 1UMTA 2O36A 4GR8A 3HY9A 4IJOA 2W15A 5I2ZA 2OI0A 1MNCA 3O2XA 1C3IA 1QJJA 3OHOA 1Y8JA 2PJTA 4PKUA 1JIZA 1JIWP 1O0QA 1KUIA 3LJZA 2JT5A 1UTZA 3EHXA 2ERQA 3O64A 2RJQA 1C8TA 3WV2A 2YIGA 3LIRA 1R1IA 1HTDA 4GUYA 1G12A 1QJIA 1H71P 4ON1A 4I35A 2YB9A 1JKYA 4XM6A 1OS9A 1PWWA 1IADA 3MA2A 3KMCA 1JANA 1ND1A 1KUFA 2V4BA 2OW1A 2X3AA 1PWVA 2RJPA 2W14A 1SMPA 4AUOA 1EB6A 4WKEA 2N8RA 1EUBA 5D1TA 2X3BA 1KUHA 1DMTA 2AIGP 3LMCA 3HDBA 3HY7A 5B5PA 1RMZA 1SATA 5B5OA 1HOVA 3U1RA 4GF1A 2OZRA 4AIGA 1AYKA 1JJ9A 4DPEA 2KRJA 4QKZA 2D1NA 3LILA 4WKIA 1UEAA 4JQGA 2X3CA 1CK7A 3HBUP 3LJGA 4XM7A 966CA 5D1SA 2POJA 2XS3A 2MLSA 2OXUA 3LQ0A 2HU6A 1ZP5A 1YP1A 2MZHA 3KMEA 4AYKA 5H8XA 2JT6A 1QUAA 5I4OA 3WV1A 1GKCA 3HB2P 1MMPA 1ZTQA 1XURA 2EROA 4H82A 1GXDA 4AXQA 1BM6A 1Y0VA 1SLMA 4XCTA 1J7NA 2A8HA 5CXAA 1B3DA 3ZXHA 3B8ZA 2MZIA 1ZS0A 1IAEA 1JAOA 3B92A 4FVLA 1GE6A 3F15A 3KWVC 3F18A 4FU4A 1OM6A 1ZXVA 4PKWA 3AIGA 4FXQA 1BSWA 3K7NA 1G9KA 1KAPP 1GO8P 1QIAA 1BKCI 2I47A 5D7WA 3SHIA 5D3CA 1CGLA 3KRYA 1D5JA 3WV3A 5CUHA 1S4BP 2D1OA 2FV9A 3DNGA 5BPAA 4G0DA 5D1UA 1QICA 1DTHA 1R1HA 1A85A 2WO8A 2ERPA 5CZMA 1R54A 2W13A 1IAAA 2MZEA 3VI1A 1G4KA 3P1VA 1Q3AA 2E2DA 5LABA 4IN9A 1OMJA 1KUGA 3EDIA 4PKQA 4PKSA 1UTTA 1FM1A 2XS4A 4H84A 4WZVA 2OW2A 1XFXA 3KHIA 2X7MA 1SRPA 3E8RA 4DV8A 1XUDA 3ZVSA 4HMAA 3DPEA 1R1JA 3L0VA 3LGPA 5BOYA 1D8FA 1XFUA 4GR0A 3TS4A 1CXVA 2AYKA 3EDHA 1PWQA 3ELMA 1K7IA 1OM7A 3KEJA 4H1QA 1ASTA 830CA 1JAPA 3EHYA 4A7BA 1JAQA 1HY7A 2OVZA 1ROSA 3DL1A 3I7IA 2DW0A 1IABA 2WOAA 5BOTA 1CIZA 1CQRA 3LIKA 4CTHA 3DWBA 4H76A 3RTTA 3TT4A 1Z3JA 1CGEA 4JP4A 1I1IP 5JMYA 4Q1LA 3VTGA 1G49A 2FV5A 1I76A 2MLRA 1BUDA 3BA0A 1PWPA 1GE7A 3F1AA 3F17A 1B8YA 4WK7A 1ZXCA 2OY4A 1XFVA 1FBLA 1BKCA 2OY2A 1CGFA 3G42A 2O3EA 1JK3A 3Q2GA 2OVXA 1XFWA 3F16A 4XBHA 5I43A 4H2EA 2K2GA 4WF6A 3K7LA 1R55A 3N2VA 4PKVA 4I03A 1ZVXA 3F19A 1Y93A 1K7GA 1IACA 5L79A 2W0DA 1HFSA 2Y6CA 1WNIA 3AYUA 3HBVP 4JA1A 4GWNA 3L0TA 2J0TA 4L19A 2Z2DA 4DD8A 1MMBA 1OS2A 2DDFA 4EFSA 4HX3A 2SRTA 1D8MA 1CAQA 3LK8A 1UMSA 1GO7P 4H30A 2JNPA 3KECA 1AKLA 4FXYP 2OXZA 3TVCA 4A3WA 3ZUKA 4GR3A 2OW0A 1XFYA 2Y6DA 5D2BA
chains in the Genus database with same CATH superfamily
3LUMA 4H49A 2TCLA 1A86A 1MMQA 1KBCA 4L6TA 2OW9A 3GBOA 3N2UA 3EWJA 4ILWD 3I7GA 4J4MA 4IUWA 1BIWA 3DTKA 2JSDA 2QPJA 2USNA 1FLSA 3LKAA 3USNA 1D7XA 3NX7A 1HV5A 1SU3A 2OXWA 1BQOA 4G9LA 1USNA 3LJTA 1ATLA 3DTEA 4ZR5A 3B2ZA 3DSLA 4GQLA 3RTSA 1OM8A 1C7KA 1HFCA 3DPFA 4JPAA 3EDZA 1MMRA 1XUCA 3HDAP 1YOUA 3LQBA 2K9CA 1TVIA 2DDYA 3CKIA 1O0TA 3AYKA 3P24A 1BUVM 1YQYA 2E3XA 1AF0A 3EDGA 3TSKA 2JIHA 1L6JA 4L7AA 3LE9A 3LUNA 1BKCE 2J83A 1PWUA 5I0LA 4DF9A 2DW1A 1JH1A 1YCMA 1EAKA 1I73A 1XFZA 3G5CA 5I12A 1SLNA 2DW2A 2CKIA 2CLTA 2WO9A 4JIJA 3LEAA 1KUKA 3HYGA 1RM8A 1BQQM 3OHLA 4PKRA 3UVCA 4GWMA 1OO9A 3V96B 4XM8A 456CA 1BZSA 5L7FA 2L0RA 3Q2HA 4L63A 1GKDA 4R3VA 1QIBA 3KEKA 5I3MA 4H3XA 1K7QA 4PKTA 1IAGA 1GE5A 2YUFA 2W12A 1G05A 1UMTA 2O36A 4GR8A 3HY9A 4IJOA 2W15A 5I2ZA 2OI0A 1MNCA 3O2XA 1C3IA 1QJJA 3OHOA 1Y8JA 2PJTA 4PKUA 1JIZA 1JIWP 1O0QA 1KUIA 3LJZA 2JT5A 1UTZA 3EHXA 2ERQA 3O64A 2RJQA 1C8TA 3WV2A 2YIGA 3LIRA 1R1IA 1HTDA 4GUYA 1G12A 1QJIA 1H71P 4ON1A 4I35A 2YB9A 1JKYA 4XM6A 1OS9A 1PWWA 1IADA 3MA2A 3KMCA 1JANA 1ND1A 1KUFA 2V4BA 2OW1A 2X3AA 1PWVA 2RJPA 2W14A 1SMPA 4AUOA 1EB6A 4WKEA 2N8RA 1EUBA 5D1TA 2X3BA 1KUHA 1DMTA 2AIGP 3LMCA 3HDBA 3HY7A 5B5PA 1RMZA 1SATA 5B5OA 1HOVA 3U1RA 4GF1A 2OZRA 4AIGA 1AYKA 1JJ9A 4DPEA 2KRJA 4QKZA 2D1NA 3LILA 4WKIA 1UEAA 4JQGA 2X3CA 1CK7A 3HBUP 3LJGA 4XM7A 966CA 5D1SA 2POJA 2XS3A 2MLSA 2OXUA 3LQ0A 2HU6A 1ZP5A 1YP1A 2MZHA 3KMEA 4AYKA 5H8XA 2JT6A 1QUAA 5I4OA 3WV1A 1GKCA 3HB2P 1MMPA 1ZTQA 1XURA 2EROA 4H82A 1GXDA 4AXQA 1BM6A 1Y0VA 1SLMA 4XCTA 1J7NA 1OZ9A 2A8HA 5CXAA 1B3DA 3ZXHA 3B8ZA 2MZIA 1ZS0A 1IAEA 1JAOA 3B92A 4FVLA 1GE6A 3F15A 3KWVC 3F18A 4FU4A 1OM6A 1ZXVA 4PKWA 3AIGA 4FXQA 1BSWA 3K7NA 1G9KA 1KAPP 1GO8P 1QIAA 1BKCI 2I47A 5D7WA 3SHIA 5D3CA 1CGLA 3KRYA 1D5JA 3WV3A 5CUHA 1S4BP 2D1OA 2FV9A 3DNGA 1XM5A 5BPAA 4G0DA 5D1UA 1QICA 1DTHA 1R1HA 1A85A 2WO8A 2ERPA 5CZMA 1R54A 2W13A 1IAAA 2MZEA 3VI1A 1G4KA 3P1VA 1Q3AA 2E2DA 5LABA 4IN9A 1OMJA 1KUGA 3EDIA 4PKQA 4PKSA 1UTTA 1FM1A 2XS4A 4H84A 4WZVA 2OW2A 1XFXA 3KHIA 2X7MA 1SRPA 3E8RA 4DV8A 1XUDA 3ZVSA 4HMAA 3DPEA 1R1JA 3L0VA 3LGPA 5BOYA 1D8FA 1XFUA 4GR0A 3TS4A 1CXVA 2AYKA 3EDHA 1PWQA 1XAXA 3ELMA 1K7IA 1OM7A 3KEJA 4H1QA 1ASTA 830CA 1JAPA 3EHYA 4A7BA 1JAQA 1HY7A 2OVZA 1ROSA 3DL1A 3I7IA 2DW0A 1IABA 2WOAA 5BOTA 1CIZA 1CQRA 3LIKA 4CTHA 3DWBA 4H76A 3RTTA 3TT4A 1Z3JA 1CGEA 4JP4A 1I1IP 5JMYA 4Q1LA 3VTGA 1G49A 2FV5A 1I76A 2MLRA 1BUDA 3BA0A 1PWPA 1GE7A 3F1AA 3F17A 1B8YA 4WK7A 1ZXCA 2OY4A 1XFVA 1FBLA 1BKCA 2OY2A 1CGFA 3G42A 2O3EA 1JK3A 3Q2GA 2OVXA 1XFWA 3F16A 4XBHA 5I43A 4H2EA 2K2GA 4WF6A 3K7LA 1R55A 3N2VA 4PKVA 4I03A 1ZVXA 3F19A 1Y93A 1K7GA 1IACA 5L79A 2W0DA 1HFSA 2Y6CA 1WNIA 3AYUA 3HBVP 4JA1A 4GWNA 3L0TA 2J0TA 4L19A 3DTIA 2Z2DA 4DD8A 1MMBA 1OS2A 2DDFA 4EFSA 4HX3A 2SRTA 1D8MA 1CAQA 3LK8A 1UMSA 1GO7P 4H30A 2JNPA 3KECA 1AKLA 4FXYP 2OXZA 3TVCA 4A3WA 3ZUKA 4GR3A 2OW0A 1XFYA 2Y6DA 5D2BA
chains in the Genus database with same CATH topology
3LUMA 4H49A 2TCLA 1A86A 1MMQA 1KBCA 4L6TA 2OW9A 3GBOA 3N2UA 3EWJA 4ILWD 3I7GA 4J4MA 4IUWA 1BIWA 3DTKA 2JSDA 2QPJA 2USNA 1FLSA 3LKAA 3USNA 1D7XA 3NX7A 1HV5A 1SU3A 2OXWA 1BQOA 4G9LA 1USNA 3LJTA 1ATLA 3DTEA 4ZR5A 3B2ZA 3DSLA 4GQLA 3RTSA 1OM8A 1C7KA 1HFCA 3DPFA 4JPAA 3EDZA 1MMRA 1XUCA 3HDAP 1YOUA 3LQBA 2K9CA 2DDYA 3CKIA 1O0TA 3AYKA 3P24A 1BUVM 1YQYA 2E3XA 1AF0A 3EDGA 3TSKA 2JIHA 1L6JA 4L7AA 3LE9A 3LUNA 1BKCE 2J83A 1PWUA 5I0LA 4DF9A 2DW1A 1JH1A 1YCMA 1EAKA 1I73A 1XFZA 3G5CA 5I12A 1SLNA 2DW2A 2CKIA 2CLTA 2WO9A 4JIJA 3LEAA 1KUKA 3HYGA 1RM8A 1BQQM 3OHLA 4PKRA 3UVCA 4GWMA 1OO9A 3V96B 4XM8A 456CA 1BZSA 5L7FA 2L0RA 3Q2HA 4L63A 1GKDA 4R3VA 1QIBA 3KEKA 5I3MA 4H3XA 1K7QA 4PKTA 1IAGA 1GE5A 2YUFA 2W12A 1G05A 1UMTA 2O36A 4GR8A 3HY9A 4IJOA 2W15A 5I2ZA 2OI0A 1MNCA 3O2XA 1C3IA 1QJJA 3OHOA 1Y8JA 2PJTA 4PKUA 1JIZA 1JIWP 1O0QA 1KUIA 3LJZA 2JT5A 1UTZA 3EHXA 2ERQA 3O64A 2RJQA 1C8TA 3WV2A 2YIGA 3LIRA 1R1IA 1HTDA 4GUYA 1G12A 1QJIA 1H71P 4ON1A 4I35A 2YB9A 1JKYA 4XM6A 1OS9A 1PWWA 1IADA 3MA2A 3KMCA 1JANA 1ND1A 1KUFA 2V4BA 2OW1A 2X3AA 1PWVA 2RJPA 2W14A 1SMPA 4AUOA 1EB6A 4WKEA 2N8RA 1EUBA 5D1TA 2X3BA 1KUHA 1DMTA 2AIGP 3LMCA 3HDBA 3HY7A 5B5PA 1RMZA 1SATA 5B5OA 1HOVA 3U1RA 4GF1A 2OZRA 4AIGA 1AYKA 1JJ9A 4DPEA 2KRJA 4QKZA 2D1NA 3LILA 4WKIA 1UEAA 4JQGA 2X3CA 1CK7A 3HBUP 3LJGA 4XM7A 966CA 5D1SA 2POJA 2XS3A 2MLSA 2OXUA 3LQ0A 2HU6A 1ZP5A 1YP1A 2MZHA 3KMEA 4AYKA 5H8XA 2JT6A 1QUAA 5I4OA 3WV1A 1GKCA 3HB2P 1MMPA 1ZTQA 1XURA 2EROA 4H82A 1GXDA 4AXQA 1BM6A 1Y0VA 1SLMA 4XCTA 1J7NA 2A8HA 5CXAA 1B3DA 3ZXHA 3B8ZA 2MZIA 1ZS0A 1IAEA 1JAOA 3B92A 4FVLA 1GE6A 3F15A 3KWVC 3F18A 4FU4A 1OM6A 1ZXVA 4PKWA 3AIGA 4FXQA 1BSWA 3K7NA 1G9KA 1KAPP 1GO8P 1QIAA 1BKCI 2I47A 5D7WA 3SHIA 5D3CA 1CGLA 3KRYA 1D5JA 3WV3A 5CUHA 1S4BP 2D1OA 2FV9A 3DNGA 5BPAA 4G0DA 5D1UA 1QICA 1DTHA 1R1HA 1A85A 2WO8A 2ERPA 5CZMA 1R54A 2W13A 1IAAA 2MZEA 3VI1A 1G4KA 3P1VA 1Q3AA 2E2DA 5LABA 4IN9A 1OMJA 1KUGA 3EDIA 4PKQA 4PKSA 1UTTA 1FM1A 2XS4A 4H84A 4WZVA 2OW2A 1XFXA 3KHIA 2X7MA 1SRPA 3E8RA 4DV8A 1XUDA 3ZVSA 4HMAA 3DPEA 1R1JA 3L0VA 3LGPA 5BOYA 1D8FA 1XFUA 4GR0A 3TS4A 1CXVA 2AYKA 3EDHA 1PWQA 3ELMA 1K7IA 1OM7A 3KEJA 4H1QA 1ASTA 830CA 1JAPA 3EHYA 4A7BA 1JAQA 1HY7A 2OVZA 1ROSA 3DL1A 3I7IA 2DW0A 1IABA 2WOAA 5BOTA 1CIZA 1CQRA 3LIKA 4CTHA 3DWBA 4H76A 3RTTA 3TT4A 1Z3JA 1CGEA 4JP4A 1I1IP 5JMYA 4Q1LA 3VTGA 1G49A 2FV5A 1I76A 2MLRA 1BUDA 3BA0A 1PWPA 1GE7A 3F1AA 3F17A 1B8YA 4WK7A 1ZXCA 2OY4A 1XFVA 1FBLA 1BKCA 2OY2A 1CGFA 3G42A 2O3EA 1JK3A 3Q2GA 2OVXA 1XFWA 3F16A 4XBHA 5I43A 4H2EA 2K2GA 4WF6A 3K7LA 1R55A 3N2VA 4PKVA 4I03A 1ZVXA 3F19A 1Y93A 1K7GA 1IACA 5L79A 2W0DA 1HFSA 2Y6CA 1WNIA 3AYUA 3HBVP 4JA1A 4GWNA 3L0TA 2J0TA 4L19A 3DTIA 2Z2DA 4DD8A 1MMBA 1OS2A 2DDFA 4EFSA 4HX3A 2SRTA 1D8MA 1CAQA 3LK8A 1UMSA 1GO7P 4H30A 2JNPA 3KECA 1AKLA 4FXYP 2OXZA 3TVCA 4A3WA 3ZUKA 4GR3A 2OW0A 1XFYA 2Y6DA 5D2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUM A;  4H49 A;  2TCL A;  1A86 A;  1MMQ A;  1KBC A;  4L6T A;  2OW9 A;  3GBO A;  3N2U A;  3EWJ A;  4ILW D;  3I7G A;  4J4M A;  4IUW A;  1BIW A;  2JSD A;  2QPJ A;  2USN A;  1FLS A;  3LKA A;  3USN A;  1D7X A;  3NX7 A;  1HV5 A;  1SU3 A;  2OXW A;  1BQO A;  4G9L A;  1USN A;  3LJT A;  1ATL A;  4ZR5 A;  3B2Z A;  3DSL A;  4GQL A;  3RTS A;  1OM8 A;  1C7K A;  1HFC A;  3DPF A;  4JPA A;  3EDZ A;  1MMR A;  1XUC A;  3HDA P;  1YOU A;  3LQB A;  2K9C A;  2DDY A;  3CKI A;  1O0T A;  3AYK A;  3P24 A;  1BUV M;  1YQY A;  2E3X A;  1AF0 A;  3EDG A;  3TSK A;  2JIH A;  1L6J A;  3LE9 A;  3LUN A;  1BKC E;  2J83 A;  1PWU A;  5I0L A;  4DF9 A;  2DW1 A;  1JH1 A;  1YCM A;  1EAK A;  1I73 A;  1XFZ A;  3G5C A;  5I12 A;  1SLN A;  2DW2 A;  2CKI A;  2CLT A;  2WO9 A;  4JIJ A;  3LEA A;  1KUK A;  3HYG A;  1RM8 A;  1BQQ M;  3OHL A;  4PKR A;  3UVC A;  4GWM A;  1OO9 A;  3V96 B;  4XM8 A;  456C A;  1BZS A;  5L7F A;  2L0R A;  3Q2H A;  4L63 A;  1GKD A;  4R3V A;  1QIB A;  3KEK A;  5I3M A;  4H3X A;  1K7Q A;  4PKT A;  1IAG A;  1GE5 A;  2W12 A;  1G05 A;  1UMT A;  2O36 A;  4GR8 A;  3HY9 A;  4IJO A;  2W15 A;  5I2Z A;  2OI0 A;  1MNC A;  3O2X A;  1C3I A;  1QJJ A;  3OHO A;  1Y8J A;  2PJT A;  4PKU A;  1JIZ A;  1JIW P;  1O0Q A;  1KUI A;  3LJZ A;  2JT5 A;  1UTZ A;  3EHX A;  2ERQ A;  3O64 A;  2RJQ A;  1C8T A;  3WV2 A;  2YIG A;  3LIR A;  1R1I A;  1HTD A;  4GUY A;  1G12 A;  1QJI A;  1H71 P;  4ON1 A;  4I35 A;  2YB9 A;  1JKY A;  4XM6 A;  1OS9 A;  1PWW A;  1IAD A;  3MA2 A;  3KMC A;  1JAN A;  1ND1 A;  1KUF A;  2V4B A;  2OW1 A;  2X3A A;  1PWV A;  2RJP A;  2W14 A;  1SMP A;  4AUO A;  1EB6 A;  4WKE A;  2N8R A;  1EUB A;  5D1T A;  2X3B A;  1KUH A;  1DMT A;  2AIG P;  3LMC A;  3HDB A;  3HY7 A;  5B5P A;  1RMZ A;  1SAT A;  5B5O A;  1HOV A;  3U1R A;  4GF1 A;  2OZR A;  4AIG A;  1AYK A;  1JJ9 A;  4DPE A;  2KRJ A;  4QKZ A;  2D1N A;  3LIL A;  4WKI A;  1UEA A;  4JQG A;  2X3C A;  1CK7 A;  3HBU P;  3LJG A;  4XM7 A;  966C A;  5D1S A;  2POJ A;  2XS3 A;  2MLS A;  2OXU A;  3LQ0 A;  2HU6 A;  1ZP5 A;  1YP1 A;  2MZH A;  3KME A;  4AYK A;  5H8X A;  2JT6 A;  1QUA A;  5I4O A;  3WV1 A;  1GKC A;  3HB2 P;  1MMP A;  1ZTQ A;  1XUR A;  2ERO A;  4H82 A;  1GXD A;  4AXQ A;  1BM6 A;  1Y0V A;  1SLM A;  4XCT A;  1J7N A;  2A8H A;  5CXA A;  1B3D A;  3ZXH A;  3B8Z A;  2MZI A;  1ZS0 A;  1IAE A;  1JAO A;  3B92 A;  4FVL A;  1GE6 A;  3F15 A;  3KWV C;  3F18 A;  4FU4 A;  1OM6 A;  1ZXV A;  4PKW A;  3AIG A;  4FXQ A;  1BSW A;  3K7N A;  1G9K A;  1KAP P;  1GO8 P;  1QIA A;  1BKC I;  2I47 A;  5D7W A;  3SHI A;  5D3C A;  1CGL A;  3KRY A;  1D5J A;  3WV3 A;  5CUH A;  1S4B P;  2D1O A;  2FV9 A;  3DNG A;  5BPA A;  4G0D A;  5D1U A;  1QIC A;  1DTH A;  1R1H A;  1A85 A;  2WO8 A;  2ERP A;  5CZM A;  1R54 A;  2W13 A;  1IAA A;  2MZE A;  3VI1 A;  1G4K A;  3P1V A;  1Q3A A;  2E2D A;  5LAB A;  4IN9 A;  1OMJ A;  1KUG A;  3EDI A;  4PKQ A;  4PKS A;  1UTT A;  1FM1 A;  2XS4 A;  4H84 A;  4WZV A;  2OW2 A;  1XFX A;  3KHI A;  2X7M A;  1SRP A;  3E8R A;  4DV8 A;  1XUD A;  3ZVS A;  4HMA A;  3DPE A;  1R1J A;  3L0V A;  3LGP A;  5BOY A;  1D8F A;  1XFU A;  4GR0 A;  3TS4 A;  1CXV A;  2AYK A;  3EDH A;  1PWQ A;  3ELM A;  1K7I A;  1OM7 A;  3KEJ A;  4H1Q A;  1AST A;  830C A;  1JAP A;  3EHY A;  4A7B A;  1JAQ A;  1HY7 A;  2OVZ A;  1ROS A;  3DL1 A;  3I7I A;  2DW0 A;  1IAB A;  2WOA A;  5BOT A;  1CIZ A;  1CQR A;  3LIK A;  4CTH A;  3DWB A;  4H76 A;  3RTT A;  3TT4 A;  1Z3J A;  1CGE A;  4JP4 A;  1I1I P;  5JMY A;  4Q1L A;  3VTG A;  1G49 A;  2FV5 A;  1I76 A;  2MLR A;  1BUD A;  3BA0 A;  1PWP A;  1GE7 A;  3F1A A;  3F17 A;  1B8Y A;  4WK7 A;  1ZXC A;  2OY4 A;  1XFV A;  1FBL A;  1BKC A;  2OY2 A;  1CGF A;  3G42 A;  2O3E A;  1JK3 A;  3Q2G A;  2OVX A;  1XFW A;  3F16 A;  4XBH A;  5I43 A;  4H2E A;  2K2G A;  4WF6 A;  3K7L A;  1R55 A;  3N2V A;  4PKV A;  4I03 A;  1ZVX A;  3F19 A;  1Y93 A;  1K7G A;  1IAC A;  5L79 A;  2W0D A;  1HFS A;  2Y6C A;  1WNI A;  3AYU A;  3HBV P;  4JA1 A;  4GWN A;  3L0T A;  2J0T A;  4L19 A;  2Z2D A;  4DD8 A;  1MMB A;  1OS2 A;  2DDF A;  4EFS A;  4HX3 A;  2SRT A;  1D8M A;  1CAQ A;  3LK8 A;  1UMS A;  1GO7 P;  4H30 A;  2JNP A;  3KEC A;  1AKL A;  4FXY P;  2OXZ A;  3TVC A;  4A3W A;  3ZUK A;  4GR3 A;  2OW0 A;  1XFY A;  2Y6D A;  5D2B A; 
#chains in the Genus database with same CATH topology
 3LUM A;  4H49 A;  2TCL A;  1A86 A;  1MMQ A;  1KBC A;  4L6T A;  2OW9 A;  3GBO A;  3N2U A;  3EWJ A;  4ILW D;  3I7G A;  4J4M A;  4IUW A;  1BIW A;  3DTK A;  2JSD A;  2QPJ A;  2USN A;  1FLS A;  3LKA A;  3USN A;  1D7X A;  3NX7 A;  1HV5 A;  1SU3 A;  2OXW A;  1BQO A;  4G9L A;  1USN A;  3LJT A;  1ATL A;  3DTE A;  4ZR5 A;  3B2Z A;  3DSL A;  4GQL A;  3RTS A;  1OM8 A;  1C7K A;  1HFC A;  3DPF A;  4JPA A;  3EDZ A;  1MMR A;  1XUC A;  3HDA P;  1YOU A;  3LQB A;  2K9C A;  1TVI A;  2DDY A;  3CKI A;  1O0T A;  3AYK A;  3P24 A;  1BUV M;  1YQY A;  2E3X A;  1AF0 A;  3EDG A;  3TSK A;  2JIH A;  1L6J A;  4L7A A;  3LE9 A;  3LUN A;  1BKC E;  2J83 A;  1PWU A;  5I0L A;  4DF9 A;  2DW1 A;  1JH1 A;  1YCM A;  1EAK A;  1I73 A;  1XFZ A;  3G5C A;  5I12 A;  1SLN A;  2DW2 A;  2CKI A;  2CLT A;  2WO9 A;  4JIJ A;  3LEA A;  1KUK A;  3HYG A;  1RM8 A;  1BQQ M;  3OHL A;  4PKR A;  3UVC A;  4GWM A;  1OO9 A;  3V96 B;  4XM8 A;  456C A;  1BZS A;  5L7F A;  2L0R A;  3Q2H A;  4L63 A;  1GKD A;  4R3V A;  1QIB A;  3KEK A;  5I3M A;  4H3X A;  1K7Q A;  4PKT A;  1IAG A;  1GE5 A;  2YUF A;  2W12 A;  1G05 A;  1UMT A;  2O36 A;  4GR8 A;  3HY9 A;  4IJO A;  2W15 A;  5I2Z A;  2OI0 A;  1MNC A;  3O2X A;  1C3I A;  1QJJ A;  3OHO A;  1Y8J A;  2PJT A;  4PKU A;  1JIZ A;  1JIW P;  1O0Q A;  1KUI A;  3LJZ A;  2JT5 A;  1UTZ A;  3EHX A;  2ERQ A;  3O64 A;  2RJQ A;  1C8T A;  3WV2 A;  2YIG A;  3LIR A;  1R1I A;  1HTD A;  4GUY A;  1G12 A;  1QJI A;  1H71 P;  4ON1 A;  4I35 A;  2YB9 A;  1JKY A;  4XM6 A;  1OS9 A;  1PWW A;  1IAD A;  3MA2 A;  3KMC A;  1JAN A;  1ND1 A;  1KUF A;  2V4B A;  2OW1 A;  2X3A A;  1PWV A;  2RJP A;  2W14 A;  1SMP A;  4AUO A;  1EB6 A;  4WKE A;  2N8R A;  1EUB A;  5D1T A;  2X3B A;  1KUH A;  1DMT A;  2AIG P;  3LMC A;  3HDB A;  3HY7 A;  5B5P A;  1RMZ A;  1SAT A;  5B5O A;  1HOV A;  3U1R A;  4GF1 A;  2OZR A;  4AIG A;  1AYK A;  1JJ9 A;  4DPE A;  2KRJ A;  4QKZ A;  2D1N A;  3LIL A;  4WKI A;  1UEA A;  4JQG A;  2X3C A;  1CK7 A;  3HBU P;  3LJG A;  4XM7 A;  966C A;  5D1S A;  2POJ A;  2XS3 A;  2MLS A;  2OXU A;  3LQ0 A;  2HU6 A;  1ZP5 A;  1YP1 A;  2MZH A;  3KME A;  4AYK A;  5H8X A;  2JT6 A;  1QUA A;  5I4O A;  3WV1 A;  1GKC A;  3HB2 P;  1MMP A;  1ZTQ A;  1XUR A;  2ERO A;  4H82 A;  1GXD A;  4AXQ A;  1BM6 A;  1Y0V A;  1SLM A;  4XCT A;  1J7N A;  1OZ9 A;  2A8H A;  5CXA A;  1B3D A;  3ZXH A;  3B8Z A;  2MZI A;  1ZS0 A;  1IAE A;  1JAO A;  3B92 A;  4FVL A;  1GE6 A;  3F15 A;  3KWV C;  3F18 A;  4FU4 A;  1OM6 A;  1ZXV A;  4PKW A;  3AIG A;  4FXQ A;  1BSW A;  3K7N A;  1G9K A;  1KAP P;  1GO8 P;  1QIA A;  1BKC I;  2I47 A;  5D7W A;  3SHI A;  5D3C A;  1CGL A;  3KRY A;  1D5J A;  3WV3 A;  5CUH A;  1S4B P;  2D1O A;  2FV9 A;  3DNG A;  1XM5 A;  5BPA A;  4G0D A;  5D1U A;  1QIC A;  1DTH A;  1R1H A;  1A85 A;  2WO8 A;  2ERP A;  5CZM A;  1R54 A;  2W13 A;  1IAA A;  2MZE A;  3VI1 A;  1G4K A;  3P1V A;  1Q3A A;  2E2D A;  5LAB A;  4IN9 A;  1OMJ A;  1KUG A;  3EDI A;  4PKQ A;  4PKS A;  1UTT A;  1FM1 A;  2XS4 A;  4H84 A;  4WZV A;  2OW2 A;  1XFX A;  3KHI A;  2X7M A;  1SRP A;  3E8R A;  4DV8 A;  1XUD A;  3ZVS A;  4HMA A;  3DPE A;  1R1J A;  3L0V A;  3LGP A;  5BOY A;  1D8F A;  1XFU A;  4GR0 A;  3TS4 A;  1CXV A;  2AYK A;  3EDH A;  1PWQ A;  1XAX A;  3ELM A;  1K7I A;  1OM7 A;  3KEJ A;  4H1Q A;  1AST A;  830C A;  1JAP A;  3EHY A;  4A7B A;  1JAQ A;  1HY7 A;  2OVZ A;  1ROS A;  3DL1 A;  3I7I A;  2DW0 A;  1IAB A;  2WOA A;  5BOT A;  1CIZ A;  1CQR A;  3LIK A;  4CTH A;  3DWB A;  4H76 A;  3RTT A;  3TT4 A;  1Z3J A;  1CGE A;  4JP4 A;  1I1I P;  5JMY A;  4Q1L A;  3VTG A;  1G49 A;  2FV5 A;  1I76 A;  2MLR A;  1BUD A;  3BA0 A;  1PWP A;  1GE7 A;  3F1A A;  3F17 A;  1B8Y A;  4WK7 A;  1ZXC A;  2OY4 A;  1XFV A;  1FBL A;  1BKC A;  2OY2 A;  1CGF A;  3G42 A;  2O3E A;  1JK3 A;  3Q2G A;  2OVX A;  1XFW A;  3F16 A;  4XBH A;  5I43 A;  4H2E A;  2K2G A;  4WF6 A;  3K7L A;  1R55 A;  3N2V A;  4PKV A;  4I03 A;  1ZVX A;  3F19 A;  1Y93 A;  1K7G A;  1IAC A;  5L79 A;  2W0D A;  1HFS A;  2Y6C A;  1WNI A;  3AYU A;  3HBV P;  4JA1 A;  4GWN A;  3L0T A;  2J0T A;  4L19 A;  3DTI A;  2Z2D A;  4DD8 A;  1MMB A;  1OS2 A;  2DDF A;  4EFS A;  4HX3 A;  2SRT A;  1D8M A;  1CAQ A;  3LK8 A;  1UMS A;  1GO7 P;  4H30 A;  2JNP A;  3KEC A;  1AKL A;  4FXY P;  2OXZ A;  3TVC A;  4A3W A;  3ZUK A;  4GR3 A;  2OW0 A;  1XFY A;  2Y6D A;  5D2B A; 
#chains in the Genus database with same CATH homology
 3LUM A;  4H49 A;  2TCL A;  1A86 A;  1MMQ A;  1KBC A;  4L6T A;  2OW9 A;  3GBO A;  3N2U A;  3EWJ A;  4ILW D;  3I7G A;  4J4M A;  4IUW A;  1BIW A;  3DTK A;  2JSD A;  2QPJ A;  2USN A;  1FLS A;  3LKA A;  3USN A;  1D7X A;  3NX7 A;  1HV5 A;  1SU3 A;  2OXW A;  1BQO A;  4G9L A;  1USN A;  3LJT A;  1ATL A;  3DTE A;  4ZR5 A;  3B2Z A;  3DSL A;  4GQL A;  3RTS A;  1OM8 A;  1C7K A;  1HFC A;  3DPF A;  4JPA A;  3EDZ A;  1MMR A;  1XUC A;  3HDA P;  1YOU A;  3LQB A;  2K9C A;  2DDY A;  3CKI A;  1O0T A;  3AYK A;  3P24 A;  1BUV M;  1YQY A;  2E3X A;  1AF0 A;  3EDG A;  3TSK A;  2JIH A;  1L6J A;  4L7A A;  3LE9 A;  3LUN A;  1BKC E;  2J83 A;  1PWU A;  5I0L A;  4DF9 A;  2DW1 A;  1JH1 A;  1YCM A;  1EAK A;  1I73 A;  1XFZ A;  3G5C A;  5I12 A;  1SLN A;  2DW2 A;  2CKI A;  2CLT A;  2WO9 A;  4JIJ A;  3LEA A;  1KUK A;  3HYG A;  1RM8 A;  1BQQ M;  3OHL A;  4PKR A;  3UVC A;  4GWM A;  1OO9 A;  3V96 B;  4XM8 A;  456C A;  1BZS A;  5L7F A;  2L0R A;  3Q2H A;  4L63 A;  1GKD A;  4R3V A;  1QIB A;  3KEK A;  5I3M A;  4H3X A;  1K7Q A;  4PKT A;  1IAG A;  1GE5 A;  2YUF A;  2W12 A;  1G05 A;  1UMT A;  2O36 A;  4GR8 A;  3HY9 A;  4IJO A;  2W15 A;  5I2Z A;  2OI0 A;  1MNC A;  3O2X A;  1C3I A;  1QJJ A;  3OHO A;  1Y8J A;  2PJT A;  4PKU A;  1JIZ A;  1JIW P;  1O0Q A;  1KUI A;  3LJZ A;  2JT5 A;  1UTZ A;  3EHX A;  2ERQ A;  3O64 A;  2RJQ A;  1C8T A;  3WV2 A;  2YIG A;  3LIR A;  1R1I A;  1HTD A;  4GUY A;  1G12 A;  1QJI A;  1H71 P;  4ON1 A;  4I35 A;  2YB9 A;  1JKY A;  4XM6 A;  1OS9 A;  1PWW A;  1IAD A;  3MA2 A;  3KMC A;  1JAN A;  1ND1 A;  1KUF A;  2V4B A;  2OW1 A;  2X3A A;  1PWV A;  2RJP A;  2W14 A;  1SMP A;  4AUO A;  1EB6 A;  4WKE A;  2N8R A;  1EUB A;  5D1T A;  2X3B A;  1KUH A;  1DMT A;  2AIG P;  3LMC A;  3HDB A;  3HY7 A;  5B5P A;  1RMZ A;  1SAT A;  5B5O A;  1HOV A;  3U1R A;  4GF1 A;  2OZR A;  4AIG A;  1AYK A;  1JJ9 A;  4DPE A;  2KRJ A;  4QKZ A;  2D1N A;  3LIL A;  4WKI A;  1UEA A;  4JQG A;  2X3C A;  1CK7 A;  3HBU P;  3LJG A;  4XM7 A;  966C A;  5D1S A;  2POJ A;  2XS3 A;  2MLS A;  2OXU A;  3LQ0 A;  2HU6 A;  1ZP5 A;  1YP1 A;  2MZH A;  3KME A;  4AYK A;  5H8X A;  2JT6 A;  1QUA A;  5I4O A;  3WV1 A;  1GKC A;  3HB2 P;  1MMP A;  1ZTQ A;  1XUR A;  2ERO A;  4H82 A;  1GXD A;  4AXQ A;  1BM6 A;  1Y0V A;  1SLM A;  4XCT A;  1J7N A;  2A8H A;  5CXA A;  1B3D A;  3ZXH A;  3B8Z A;  2MZI A;  1ZS0 A;  1IAE A;  1JAO A;  3B92 A;  4FVL A;  1GE6 A;  3F15 A;  3KWV C;  3F18 A;  4FU4 A;  1OM6 A;  1ZXV A;  4PKW A;  3AIG A;  4FXQ A;  1BSW A;  3K7N A;  1G9K A;  1KAP P;  1GO8 P;  1QIA A;  1BKC I;  2I47 A;  5D7W A;  3SHI A;  5D3C A;  1CGL A;  3KRY A;  1D5J A;  3WV3 A;  5CUH A;  1S4B P;  2D1O A;  2FV9 A;  3DNG A;  5BPA A;  4G0D A;  5D1U A;  1QIC A;  1DTH A;  1R1H A;  1A85 A;  2WO8 A;  2ERP A;  5CZM A;  1R54 A;  2W13 A;  1IAA A;  2MZE A;  3VI1 A;  1G4K A;  3P1V A;  1Q3A A;  2E2D A;  5LAB A;  4IN9 A;  1OMJ A;  1KUG A;  3EDI A;  4PKQ A;  4PKS A;  1UTT A;  1FM1 A;  2XS4 A;  4H84 A;  4WZV A;  2OW2 A;  1XFX A;  3KHI A;  2X7M A;  1SRP A;  3E8R A;  4DV8 A;  1XUD A;  3ZVS A;  4HMA A;  3DPE A;  1R1J A;  3L0V A;  3LGP A;  5BOY A;  1D8F A;  1XFU A;  4GR0 A;  3TS4 A;  1CXV A;  2AYK A;  3EDH A;  1PWQ A;  3ELM A;  1K7I A;  1OM7 A;  3KEJ A;  4H1Q A;  1AST A;  830C A;  1JAP A;  3EHY A;  4A7B A;  1JAQ A;  1HY7 A;  2OVZ A;  1ROS A;  3DL1 A;  3I7I A;  2DW0 A;  1IAB A;  2WOA A;  5BOT A;  1CIZ A;  1CQR A;  3LIK A;  4CTH A;  3DWB A;  4H76 A;  3RTT A;  3TT4 A;  1Z3J A;  1CGE A;  4JP4 A;  1I1I P;  5JMY A;  4Q1L A;  3VTG A;  1G49 A;  2FV5 A;  1I76 A;  2MLR A;  1BUD A;  3BA0 A;  1PWP A;  1GE7 A;  3F1A A;  3F17 A;  1B8Y A;  4WK7 A;  1ZXC A;  2OY4 A;  1XFV A;  1FBL A;  1BKC A;  2OY2 A;  1CGF A;  3G42 A;  2O3E A;  1JK3 A;  3Q2G A;  2OVX A;  1XFW A;  3F16 A;  4XBH A;  5I43 A;  4H2E A;  2K2G A;  4WF6 A;  3K7L A;  1R55 A;  3N2V A;  4PKV A;  4I03 A;  1ZVX A;  3F19 A;  1Y93 A;  1K7G A;  1IAC A;  5L79 A;  2W0D A;  1HFS A;  2Y6C A;  1WNI A;  3AYU A;  3HBV P;  4JA1 A;  4GWN A;  3L0T A;  2J0T A;  4L19 A;  3DTI A;  2Z2D A;  4DD8 A;  1MMB A;  1OS2 A;  2DDF A;  4EFS A;  4HX3 A;  2SRT A;  1D8M A;  1CAQ A;  3LK8 A;  1UMS A;  1GO7 P;  4H30 A;  2JNP A;  3KEC A;  1AKL A;  4FXY P;  2OXZ A;  3TVC A;  4A3W A;  3ZUK A;  4GR3 A;  2OW0 A;  1XFY A;  2Y6D A;  5D2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...