1JKHA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
553
structure length
550
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 146
structure length 550
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jkhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jkhA05
5CYMA 4DSLA 2B6AB 3CDWA 4FVMA 4DG1B 4LY7A 1BHLA 4WFXA 1KVCA 4FBTA 1WSIA 3DLGA 4CFCA 2X6SA 5KT5A 3BSNA 5KT3A 3MXIA 3OSPA 3RR8A 4IFVA 3OYBA 4DQIA 1HPZB 1OS5A 4O4RA 2VG6B 4TY9A 3M8RA 4BDYA 3SYZA 2WONB 1REVB 3DLEB 4FS2A 3ZSZA 2VG7B 1QSSA 2ZD1A 1BCOA 4E0DA 3RB0A 3VQ9A 4N5SA 2JEIA 4ZTFA 4FJKA 2E6MA 5KT6A 4ZPDA 3NBPB 2WCXA 4KBIA 4K8XA 3OYFA 5HRNA 2JC0A 2Z1HA 3Q8PB 2RDJA 4IG0A 3RAQA 4O4GB 3OVNA 1TL1B 5KFZA 3QEXA 1DLOB 5KFXA 2XGPA 1GOCA 3VQ6A 3SV4A 1KFDA 3DOLB 2I5JB 3OLAA 4WYWA 3MR3A 4HYKA 4W5QA 4DTXA 4DQRA 1HYSB 3VA3A 5FDLA 4DU4A 3H4BA 5D3GA 2IAJB 4J9LA 4KO0A 1Q8IA 3HVTB 4GVMA 1JLEB 3DRPA 2Y1IA 4KB0A 5KFAA 4N41A 1FKPA 4YR0A 3MECA 2W9BA 3CFOA 4KPYA 3KLEA 2D3ZA 3CYMA 4O3NA 1LWCA 4IG3B 1RDCA 4CJKA 3KIOA 5DLGA 4IH5A 1SH3A 2UVRA 4KHNA 4ECSA 4KHUA 4CEQA 2JLEA 3OYJA 3AO3A 4FW2A 4DL4A 3EPIA 3KHLA 1CXUA 4Z0UA 3OHBA 1T7PA 1VRUB 2FVRA 5CYQB 4YR3A 3MAQA 4K4TA 3M8PB 5DQHA 2X74A 4ZP9A 2RKIB 4DFJA 4ECQA 2XRIA 1Q9YA 1TKDA 1BI4A 2Z1JA 4DU1A 2ALZA 3GIIA 4M3TA 4F4WA 3H5XA 3FQKA 5KG4A 4M41A 2HHTA 1BQNA 4H54A 1RDDA 4HHTA 4F3OA 1JKHA 4Z4HA 4Q45A 4AHVA 4QWEA 5KFQA 4AHCA 5J2QB 3EYZA 4BE0A 4FBUA 2IJNA 3PR4A 3RMBA 3DI6A 3NE6A 1W25A 4IBNA 3UPFA 2R8JA 2HNYA 2R2SA 2IMWP 1KTQA 3VQCA 4I2PB 1U09A 4FJ8A 4PWDB 2QKBA 4EZ9A 1SH2A 2HNDB 4FLVA 4F4XA 4FJLA 5KT4A 4O3OA 2D3UA 3VQ8A 4E1MA 4CF1A 4IKAA 1N5YB 1LWEA 1JLCA 3H98A 1I39A 4CJSA 3T5KA 4Q8EA 3SJJA 4DTJA 1NJYA 1A5WA 1TV6B 1VSJA 4AHSA 3IRXA 1X9SA 4RW6A 3O3HA 2GIRA 5F8MA 3ICLA 5EDWA 4ICLA 3QYYA 2EC0A 4AHRA 4G1QB 3H08A 4RNHA 4IRDA 4YR2A 1S9EB 4DU3A 2FC0A 3NFAA 3LP0B 3Q8RB 2HVHA 3KK1A 2I1RA 3HVAA 5I3UA 4K4ZA 1SUQA 4F4YA 1RT5B 2EX3A 4CEAA 3DOKB 1NK9A 3MFHA 2B5JA 4Z4CA 3HPOA 3S3NA 1RYRA 4G1QA 1RTJB 1S6QA 4RW9A 4ECUA 3L2QA 4DSJA 1RILA 4URGA 4B9TA 3QERA 2HVIA 4CF8A 3GYNA 5EU7A 1EXQA 2YV0X 2O4IA 2FVCA 5DG7A 3CO9A 1TKZA 5K14B 4MKAA 1C1CB 4CERA 2HB5A 2ATLA 3ZT2A 3EPGA 3GIJA 2IS3A 3G6VA 2YHAA 3CIZA 4KV8B 1JIHA 3PW4A 4QWDA 4UQGA 3QGIA 5KG0A 4TN2A 5KFWA 1B9FA 3IAYA 3I0SB 3KTQA 1TVRA 5DGAA 3SQ4A 3MFIA 2Z1GA 3SPZA 4B9NA 2RF2B 5HP1B 3KLVA 4RW4B 3KD1E 1VSIA 4NCGB 4IFYB 2OZSA 3CQ8A 1C6VA 1JL2A 2HWHA 3C6UB 5KFCA 3DM2B 1TQLA 4AHUA 4CJUA 4FJ5A 3LP2B 2VG5A 3AV9A 5SZTA 4XIUA 2HMIA 4ECYA 2UUTA 2OPSA 1RAJA 1B92A 4HVJA 2G8HA 1IKXA 1FK9B 1S1UA 1XR6A 2FLNA 2BE2A 5KRSA 1YT3A 3QZ7A 3QZ8A 1YTAA 3AVIA 3HSTB 4CESA 4FJHA 4N56A 3HVRA 1S1XA 4LSLA 4Y1CA 4W5OA 3K5NA 4ZVGA 5KFVA 4DFMA 4FZYA 4NLPA 3GV7B 1HYZA 5FRMA 5DQIA 3TAMB 1RBRA 2E4LA 4ECTA 1JLFA 4M42A 3OHAA 2AJQA 3AVKA 2XWYA 1S5JA 5J2NB 2YKMB 1KHVA 1IKYB 1RDAA 3F73A 4F3TA 5KI6A 3K59A 5KFYA 4JV1A 2HW3A 1HNIB 1JLQA 1J54A 2GC8A 3SV3A 1VSFA 1XHXA 4J9OA 3ZSYA 2FVQA 1Q9XA 3FFIA 5KG1A 2WK4A 2D7SA 4KKOB 2YKNB 3AVJA 1IKVB 1RBUA 5EWGA 1O1WA 4Z4FA 2XI3A 2OYQA 1N48A 1NOZA 4K8ZA 2WOMB 3O3GA 3BGRB 2BANB 3SQ1A 4B9UA 3KK2B 1JLBB 1W9HA 4QW9A 5DG9A 4IH6A 4B9MA 4CHQA 1QUVA 2R8KA 1RT1B 4E1NA 1TKTB 4O3SA 3BQ1A 4ECWA 3QEWA 3JSMA 3TQ1A 3RTVA 4GW6A 3SUPA 4Q44A 4M3UA 4R5PA 4H4OB 4OGCA 3ZSWA 1RDRA 4CHPA 1QHTA 2FBYA 3AVCA 1S97A 4H4MB 2EHGA 3HPHA 4I2QB 1GX5A 3QIPB 3IGNA 1S6PA 1IKWA 4WZQA 4K4WA 5KFMA 4KTZA 1S1TB 1FKOA 3I5AA 3LP3A 4FLZA 5J1EA 2B43A 3PVXA 3KLGA 5DMRA 4I7FA 4F8RA 3SI8A 2C22A 2KZZA 4O3RA 2QKKA 3NGDA 3T5JA 1NK5A 4OKJA 1S1WA 1RTIA 1QE1B 3AVHA 2HNZA 1C1BA 3VA0A 2W8LA 4RUCA 4MFBA 4E7JA 2YNFB 3RBDA 4QCLA 5F8HA 4CFAA 3LDSA 1S9FA 4ZMMA 1YVFA 5CY4A 5I42A 1C2PA 4M94A 3PJXA 1RDBA 1LWFB 1RT6B 1SV5A 3HT3A 2G8FA 2BRKA 4DF4A 2PYLA 2FJVA 4MK9A 2G8UA 3CJ3A 1DTTA 4LSNB 4NLOA 4LQ9A 3VQ5A 4KFBA 4CEZA 4BDZA 4CIGA 3NH2A 4ZTJA 3D5MA 1RT3A 1HQUA 4IDKA 1TKXB 4EP4A 3TANA 1QSLA 3KJVB 2O4GA 5L1JA 1K1SA 4FJ9A 4EZ6A 2OPPB 5C42B 4MIAA 4CHYA 3DLKA 2VWJA 4JS4A 5F8IA 4ID5B 4KHRA 1RNHA 1RT2B 5DQGA 4C8KA 1S48A 4B9LA 4DF8A 1JLAA 2UVWA 3DRRA 4M95A 3IS9A 3TR8A 3T5HA 3HJFA 3SUQA 5CYMB 3ZCMA 3T5LA 3SFUA 2C2DA 3K5MA 4G3IA 3NAHA 3WNGA 4E7IA 3DLGB 1NJXA 2V0NA 3MEDA 2A1SA 1A5VA 4CECA 3WNEA 4EYHB 1QTMA 2PYJA 3K5LA 4GC7A 4B08A 4IFVB 4FM0A 1HNVA 3A2FA 1NKEA 2ASLA 2IM1A 2QK9A 1I6JA 3V4IA 2ZD1B 1UA0A 3CM5A 2IM0A 1WNSA 3CWJA 3V9UA 2A1RA 1TL3A 3G6XA 1SKSA 2B4JA 3V6JA 4IKFA 1NHUA 4IG0B 4Z4EA 3O4NA 3HK2A 2IM3A 4FLXA 1C0TA 5CZ2A 4M3RA 4CEFA 1HJRA 4OGEA 3TAGA 1Z26A 4CJTA 2ZKUA 5HBMA 4FLWA 2IDOA 3UIQA 2FBXA 4GMJB 4IQXA 3FSIA 5FDLB 5F9LA 4CJ5A 5KGWA 4FJ7A 1U04A 4DTPA 4F50A 5D3GB 4CFDA 3I8DA 3OYMA 4KO0B 4ED3A 3DRPB 1QQCA 4KHMA 2BR0A 1FKPB 3MECB 4CEDA 3B6PA 1RT4A 3NGYA 2W9BB 1JL1A 5KG5A 3KLEB 2E9RX 1LWCB 1ZBHA 1UOCA 1LAVA 4NYFA 4YQWA 2R8IA 2P5OA 3UDLA 1G15A 2D0BA 4AILC 3PHEA 4JRPA 4WFZA 4OKKA 1S10A 5F8JA 1SKWA 4IR9A 4JLHA 3KK3A 3H5YA 2XHBA 1BI4B 1S9GA 5KT7A 3CM6A 3VQQA 1BQNB 4W5TA 3QGHA 2YNGA 1KLNA 1TAUA 1JKHB 4FJMA 5C24A 3RRHA 4FM1A 4C8OA 3EZUA 5EWEA 1S0OA 4WE1A 1N6QA 3WNFA 3DYAA 1ZYQA 2HHXA 3BSOA 4KHYA 4PY5A 3DI6B 4HUEA 2Q3SA 4ZVFA 3ULDA 5KFPA 4FLYA 2V9WA 4K50A 2FJWA 2HNYB 1CZ9A 1KSPA 4MK8A 1UWBA 2FBVA 2ZE2A 3GQCA 2R8HA 3KNAA 4NCAA 4KAIA 3C6TA 4O0JA 3TI0A 3GILA 3ZT3A 4RU9A 3I5CA 3PZPA 1IO2A 3D28A 1LWEB 1JLCB 3TAPA 4W5NA 1T03A 3VQ4A 3LP1A 2C28A 3NHGA 5F8NA 5J2PA 4DS4A 4QWBA 4KAZA 3IRXB 4CK1A 1ZBIA 3ALYA 4J9RA 5KRTA 4RW6B 3QEPA 4ICLB 4O0IA 1MU2A 3QIDA 3AVNA 2VWKA 3NL0A 1BCMA 4NLUA 5KFRA 4PQUA 4M3YA 3AVFA 3KK1B 3RBEA 2R7YA 2UUWA 5C25A 5I3UB 4NLSA 1SUQB 3VQBA 1F21A 1ZETA 3OYLA 4TXSA 1LV5A 4RNOA 2B5JB 4ZP6A 3QEIA 3QESA 1TK8A 2WRMA 2J6TA 3VQAA 5F9NA 1S6QB 4RW9B 1ITGA 4Y34A 1KCFA 3KHRA 2IBKA 3TAFA 5L9XA 3G10A 2BQRA 3V6HA 4R8UA 4RW8A 1C0UA 2XO7A 1UA1A 4F4KA 1S0NA 2RN2A 1ASVA 1EETA 5FRNA 4KTWA 3NDKA 3AA5X 4I9QA 4M3XA 1TKZB 4DL2A 4ECVA 1DTQA 1IG9A 1D0EA 4TSXA 5DLFA 4QWCA 1L5UA 4JRQA 3OL8A 3QNNA 1S1VA 1Y97A 1Z25A 4YNQA 4EBDA 4Z4IA 3LAMA 1KLMA 4JUZA 4QW8A 3ASMA 4E7KA 3QO9A 3UQSA 2CJQA 1TVRB 1JX4A 3K2PA 4BACA 1T05A 4L8RB 4FCYA 2AWZA 2BDPA 3FQLA 1X9WA 4J9PA 4WXOA 4OVLA 4M45A 1VRTA 4CEBA 1U48A 3NF8A 1TK5A 1ZBUA 2XI2A 3BDPA 1BQMA 2VG5B 2HMIB 1QSYA 4B9SA 2OPSB 4HCBA 4IRKA 4HUGA 2KQ2A 3V6KA 3SQ2A 1IKXB 1S1UB 2XY8A 3L2RA 4MH8A 2BE2B 4CJPA 1FXXA 4K4UA 1HMVA 2E9ZA 1TAQA 4QWAA 3OL7A 4EEYA 2IC3A 1BISA 4TY8A 1N56A 3AVLA 1T3NA 1S1XB 5KFBA 4LSLB 2OPQA 3NF7A 3NCIA 1NK8A 2VA2A 3RWUA 4DSEA 2HHSA 1D5AA 5KFUA 4DTRA 1GOBA 1NK0A 4NLDA 4O3PA 3H4DA 1EKEA 3TAQA 3HVWA 1JLFB 3ZT4A 3HXMA 4ZP8A 3I0RA 4TYAA 2ETJA 3SPYA 3HP6A 2W9CA 1XHZA 4ZHRA 1CLQA 3S3OA 4DTOA 1JLQB 3G6YA 4Y2AA 4NLYA 3HHKA 2ASDA 1B9DA 5T14A 2DFFA 3FFIB 2ATQA 3NH1A 5KT2A 4DMNA 1WSGA 2OA8A 4O44A 4R0EA 4E7LA 1WSHA 1J53A 3FDSA 3L3VA 2QE5A 4ECXA 1ZTWA 4WYLA 3K57A 5KFDA 5FROA 3NH0A 3TWHA 3OS2A 3M8QA 3P83D 4J9SA 1JLGA 3E51A 4IR1A 5JS2A 5HROA 3HKWA 1SKRA 3DLBA 4M3WA 3JSMB 1LW2A 3D0PA 4TYBA 4R5PB 4NLRA 3KLFA 3PY8A 2WB4A 2FVPA 5KFSA 3QLHA 3C94A 4FM2A 4NLTA 4TQRA 4ED2A 2P1JA 1ASWA 2OZMA 2J6SA 4B3OA 3RB6A 3CG7A 1S6PB 1IKWB 4KRFA 4CJEA 1FKOB 1K1QA 5J1EB 3ZSOA 3MR6A 1XC9A 4ZPAA 4OPKA 3KLGB 2R2TA 1J5OA 3ITHA 4I7FB 4FW1A 3QNOA 4FK4A 2UVVA 4FJXA 3KLIA 2YNHA 1S1WB 4DTNA 1RTIB 4OPJA 3PW7A 3LALA 2AU0A 3LZIA 3IGVA 3CFPA 2HNZB 1C1BB 5HLFA 4KSEB 2DTUA 3OY9A 2OPRA 4TQSA 3BREA 3IN5A 3AVBA 2KFZA 4KI6A 4MFBB 1R0AA 3S3MA 3PW0A 4KHWA 1RT7B 2F8TA 4U6PA 3QGGA 1SL0A 5I42B 4LQ3A 2D41A 1HYVA 1RCHA 3OJSA 3RRGA 3BSAA 3RR7A 3OYCA 2YNIA 1SV5B 4RW7B 5HRRA 1YVUA 1RTHA 3VQ7A 3IG1A 3DRSA 1KFSA 1DTTB 1I3AA 2F96A 4KFBB 1RBSA 4RNMA 4DWIA 3L2WA 4NLWA 1RT3B 1CXQA 1HQUB 4IDKB 1RT7A 4K4VA 5KFLA 4QPXA 3G0ZA 4NYZA 1HQEA 4J9KA 3V81A 2JEGA 3QEVA 1JXBA 3T19A 3RAXA 4RW7A 3DLKB 1LW0A 4AHTA 2XC9A 3V9ZA 3U6FA 5KFFA 3SFGA 2AQ4A 3EY1A 4HUFA 5JUMA 1JLAB 3DRRB 2NUBA 3IS9B 1BL3A 3AA4A 3JYTA 4J9QA 1EP4A 3HP9A 2P51A 3NKYA 1NKBA 1CSJA 3NF9A 4O5BA 2QV6A 1U45A 3MEDB 4NCBA 1VSEA 2W7OA 4ID1A 3BR9A 1NHVA 2HAIA 4FK0A 4PA1A 1GX6A 1HNVB 4BWMA 3SZ2A 3V6DA 1W0HA 3BQ2A 3QIOA 2KFNA 4F4ZA 3C95A 1RBTA 2G8KA 3MEEA 3DMJA 3V4IB 2W42A 3BJYA 4HCCA 1U4BA 3MEGA 1TL3B 4I9LA 4NLQA 4OKEA 3S9HA 2G8VA 4MIBA 3KHGA 3LANA 4DL5A 2XY5A 2HHWA 3DDKA 3RMDA 3TABA 3L8BA 3ISND 3KLHA 3Q8QB 1L3VA 2ILYA 1C0TB 4Q0BA 1WN7A 1WAFA 4PUOA 4FZXC 4CHZA 1VSLA 3K58A 3LAKA 3VQDA 3ISNC 3H59A 3UR0A 1UAXA 2XCPA 5HBMB 1X9MA 1RTDA 4Y2CA 1D8YA 5JXSA 4DL7A 4CK3A 4KREA 2LSNA 4CEOA 2GV9A 4ZVEA 3HL8A 4ZVHA 2WTFA 2AX0A 4CE9A 4CJ3A 3OYKA 2FJXA 3KD5E 2J6UA 4K4XA 4XPCA 1JXEA 1YTUA 2XY7A 1RT4B 1ZBLA 5J2MA 1C0MA 5KGXA 4FYDA 4LH5A 4CJLA 1BIUA 3CDUA 3VQEA 5KFNA 5SWMA 1L3TA 3ZSVA 3E01A 4E3SA 4U7CA 2DFEA 4BE2A 2B6AA 3AVMA 4DG1A 1NNDA 4FJGA 2X78A 2FBTA 3ZT1A 4ZPBA 3M9OB 3O3FA 1IM4A 3OS1A 3KK3B 3NMAA 2F8SA 1NK4A 3AVAA 1S9GB 2BGGA 2HHVA 3LPUA 4DSKA 3Q8SB 3M9NB 1HPZA 2YNGB 3K5OA 2VG6A 3GIMA 5C24B 4CGGA 4NLXA 2WONA 1REVA 3DLEA 1HRHA 2GBZA 4CF2A 2VG7A 4WE1B 1N6QB 3DYAB 1S49A 4WFYA 4C8MA 3G86A 4ED7A 4RZRA 4K4SA 4CF9A 5L1KA 3H40A 4QOZB 2QXFA 2F8EX 4BWJA 3NBPA 2IGIA 3NF6A 3P5JA 2C2RA 3LZJA 2XY6A 1UWBB 4O4GA 5T7BA 2ZE2B 4CGJA 1TL1A 1DLOA 1XR7A 3P1GA 3PW5A 3DOLA 1XWLA 3C6TB 3HYFA 2I5JA 4RNNA 5KFTA 2W7PA 2E6LA 4AH9A 5KG6A 4E89A 1HYSA 1T03B 4H8KA 3LP1B 4M3ZA 3GIKA 5J2PB 2IAJA 3MR5A 3RMAA 3HVTA 1JLEA 4Q43A 4CJVA 4DQSA 2BQ3A 4KHSA 5KG2A 3O4QA 1MU2B 3AO5A 4RG8A 4CGFA 2IM2A 3I5BA 3AVGA 4IH7A 4HTUA 4IG3A 4PQUB 2HWIA 3EZ5A 3L2UA 4CFBA 4OJRA 5C25B 4N47A 1KVBA 1T94A 4EYIB 1QAIA 3N6MA 4ED1A 3T3FA 1WSFA 1VRUA 1TGOA 5CYQA 4EP5A 4F2SA 3M8PA 2R2UA 3DLRA 2RKIA 1GOAA 3KHHA 3ZT0A 1S0MA 2ITGA 1BIZA 3VQPA 3OYIA 2AGQA 5KFIA 1N4LA 2FLLA 5HRPA 4ED8A 4YMEA 4R8UB 3ZSXA 4RW8B 3OYDA 1C0UB 3KKRA 3PJWA 4FJIA 4NLGA 1EETB 1IH7A 3PO4A 2FLPA 2BQUA 4XO0A 4OL8A 2UVUA 5J2QA 4C8LA 1DTQB 3RB3A 3SNNA 4CHNA 4ELTA 4B8AB 4DS5A 4ELUA 3CJ0A 1S1VB 3MXMA 3KMQA 1KLMB 3TVKA 4CK2A 1VSMA 4I2PA 4DTSA 4Q5VA 3QO9B 4DLGA 4PWDA 4LD0A 4KE5A 2HNDA 1Z4UA 2D0CA 5F8LA 5KFJA 4WXWA 4LH4A 1T05B 4FS1A 2GUIA 1D9DA 4EBCA 3NGIA 4KB7A 2D0AA 1N5YA 3BQ0A 3KKSA 2IA6A 1ZTTA 1VRTB 4ED6A 2JGUA 1TV6A 4MKBA 1BQMB 3D45A 4DTUA 2DPJA 1U49A 5KTQA 1BGXT 2ILZA 1A5XA 1S9EA 3CJ2A 4KI4A 3LP0A 4DQQA 2G8WA 3HM9A 3V1QA 1HMVB 3PX0A 4FK2A 3PUFA 1RT5A 4DL6A 2IC3B 4TY8B 1RA6A 5EUHA 3DOKA 4NLVA 3VN5A 4CEEA 3LWLA 1RYSA 2OPQB 4ZPCA 4RUAA 2ZQBA 1RTJA 3AA2A 5L1LA 4MQ3A 4TLRA 2JC1A 3AO4A 3AO1A 2PZSA 3AO2A 4NYNA 4CHOA 3I0RB 1HARA 4EO6A 4RNFA 2W9CB 4ZHRB 3N6LA 3PR5B 1WNEA 4URQU 1X1PA 4DEZA 3OYNA 4ECZA 3RB4A 5K14A 1C1CA 4E19A 3CVKA 3V9WA 2P5GA 3N6NA 3HO1A 3LWMA 3L2VA 4KV8A 2Z1IA 4O44B 1S4FA 4XPEA 2AX1A 3ZSRA 1ASUA 1VSDA 1TK0A 1D9FA 5DG8A 4JV2A 3I0SA 1JXLA 3CJ5A 3PX4A 4KTQA 1KRPA 4EBEA 4CJRA 2RF2A 5HP1A 3M8SA 4RW4A 3M8QB 4J9NA 4NCGA 4IFYA 4QAGA 1VSHA 3OYAA 4Q8FA 3SCXA 1JLGB 3C6UA 5HROB 3DM2A 3OYHA 3DLHA 1LW2B 3PV8A 3SUOA 2DFHA 3V1OA 5KG3A 3LP2A 3KLFB 4J2EA 3MXJA 3MF5A 4C8NA 3QLHB 3LPTA 1NJZA 3VQSA 1LAWA 2HHUA 4CCHA 3U3YA 3PX6A 1L3SA 4ELVA 4ECRA 4B3OB 1FK9A 3H5SA 4WZMA 1RBVA 3OSNA 1VSKA 3RMCA 1SL1A 1J5OB 1SH0A 4OLBA 4F2RA 3ITHB 3V9XA 3GV5B 1NOYA 3KLIB 2YNHB 5HRSA 3SQ0A 4CGIA 3PW2A 2V4RA 4CJWA 2DPIA 5HLFB 3OS0A 3NAEA 4FZZA 1XI1A 4N76A 2OPRB 1ZBFA 4J9MA 3OYEA 2R8GA 4Z4GA 3TAMA 5L1IA 2WHOA 2KZMA 2KTQA 1KHWA 1R0AB 4DTMA 4FXDA 4W5RA 4O3QA 2W9AA 4EO8A 1KVAA 5J2NA 2YKMA 2XCAA 1IKYA 2FVSA 4NZ0A 1HNIA 3KOAA 1K6YA 2YNIB 4CJ4A 4OLAA 3OLBA 3QETA 2DY4A 2CKWA 1WSEA 2HHQA 1RTHB 3ZSQA 4KKOA 2YKNA 3IG1B 3CFRA 3DRSB 2BRLA 1IKVA 1MMLA 4JV0A 3H5UA 4CJFA 3WNHA 3SI6A 4DL3A 4B8CA 3HPGA 1QS4A 2E9TA 2GIQA 4DLEA 2WOMA 3BGRA 1D1UA 2PY5A 2BANA 4CF0A 1HQEB 3KK2A 3V81B 1JLBA 4IOBA 4FJJA 4YP3A 2RPIA 1WAJA 2JEJA 1C1AA 1LW0B 4FLUA 4Y3CA 1RT1A 1SL2A 1TKTA 4FLTA 3FRZA 3AA3A 4CIEA 3BSCA 1NK7A 1RA7A 3MR2A 1WSJA 5DGBA 4H4OA 2Y1JA 3L3UA 2OH2A 4ZP7A 2V4QA 3JYTB 4MK7A 3TAEA 3QINA 1EP4B 4O55A 4H4MA 4I2QA 3NGZA 3QIPA 2AGOA 1S1TA 1NJWA 4J2AA 5KFEA 2ASJA 1CZBA 3M9MB 2KW4A 3B6OA 3NAIA 5KFGA 3OJUA 2VA3A 3GV8B 5KFKA 3F9KA 1L3UA 3V6DB 4CGHA 5C5JA 2IJFA 1QE1A 5KG7A 4X2BA 4DSFA 5CZ1A 3MEEB 3DMJB 4DFKA 2R2RA 3OL6A 2RDIA 4FJNA 3T1AA 4J2BA 3OL9A 2XGQA 4DSIA 3MEGB 1EX4A 1NK6A 5KFOA 2YNFA 1NKCA 4E7HA 3TARA 4BDPA 4GC6A 1J9AA 3CJ4A 2YHBA 3KLHB 3V9SA 3KMSA 2IOCA 1LWFA 4Q0BB 4YFUA 1RT6A 4PUOB 2W8KA 4CJQA 2X6NA 1QAJA 1XR5A 3CDEA 1RTDB 2AGPA 2D5RA 4LSNA 4CGDA 3PO5A 1WLJA 4NRUA 4NRTA 5E41A 3SUNA 4KB1A 1TKXA 1VK0A 4J2DA 4ED0A 1TP7A 3MTKA 5JS1A 3KJVA 4JS5A 1T8EA 5EWFA 4CIFA 1U47A 4DQPA 2JEFA 2OPPA 5C42A 3THVA 4B9VA 2C2EA 2G8IA 5DK5A 4KHQA 5F8GA 3U3GA 4ID5A 5J2MB 2O5DA 1RT2A 3OYGA 4BE1A 4HKQA 4DFPA 4Y1DA 3V1RA 4K4YA 3H2LA 5KFHA 4IRCA 4URSA 3E01B
chains in the Genus database with same CATH superfamily
2MHNA 2P6TA 1FI4A 3CDWA 3HJVA 2QL9B 3LDNA 1BHLA 1PC4A 4W90B 1FE4A 4AM7A 4WFAL 3HM8A 3BSNA 2HSTA 4CT8A 5KT3A 4A5BA 1J6ZA 3PSIA 5BRDA 1ATRA 3HSGA 1HPZB 1OS5A 2KT3A 3D6FB 5IC6B 2W25A 4WQ5C 3PFEA 3DXMB 3EICA 1N8RT 2HIYA 3OFFA 4DR2J 3BF3A 1RTZA 2E88A 3ZSZA 3EO3A 1BCOA 3K7RA 1N32K 5MAOA 4N5SA 4HLBA 1MMNA 2E6MA 5KT6A 3CMAS 2BUPA 1HBOB 4KBIA 2KYXA 2JC0A 2Z1HA 3CCES 1UZDA 3I33A 3FEXB 5KFZA 1DLOB 3MXHP 2YWWA 3M6XA 3O6WA 3W66A 3QICA 3SV4A 1KFDA 4DU8A 2ZH7A 1QQOA 4KBOA 3OLAA 2AEMA 4W5QA 5ETRA 3ENAA 3GSIA 2DVIA 2CPEA 1ZXOA 3H4BA 3KVGA 1SI9A 1HR0K 4LF7K 2Y1IA 5KFAA 2JWNA 3MECA 3FEZA 1WBDA 3CFOA 2H4WB 1EAYC 3UVJB 1DHMA 2D3ZA 4O3NA 3R97A 4CJKA 1GLCG 5DLGA 2YVSA 3NOGA 1VQ8N 4CEQA 4WIIA 2W40A 3HHLC 2OUGA 4LUBA 3AO3A 1VRUB 1DAXA 4DPWA 4WFBQ 4YR3A 2V2KA 4K4TA 4ZP9A 4DFJA 3FUYA 2ZM6F 5GAEU 3AXKA 1FEEA 3AAWB 3DDIA 3SCKE 1RDDA 3W65A 4P73A 4HHTA 4DV0F 1ZA2B 3OTOK 2FYXA 4QIEA 3FCWA 4CLPA 1YIJS 3TUIC 3VMFB 5AQZA 2J4RA 1N54B 1NSKL 4AHCA 3WXIA 2IJNA 2C3OA 2DXFA 1S7IA 1W25A 3MR7A 1K9MT 3IAS9 4OIXA 5J1NA 3L9ZA 2HNYA 3PRBA 3T1HJ 3VHQA 4C9DA 1X4DA 4OPAA 4PWDB 2VFTA 3UD5A 4EZ9A 1SH2A 4P10A 1NBEB 2V7YA 1DY3A 3I9V9 3WC2A 3CSKA 4RBTA 2WVBA 3VEWA 4M63C 4E1MA 2LXFA 1N5YB 2KO1A 4DPXA 4CJSA 3T5KA 3Q23A 4JBCA 1FWPA 3TUZC 4OZ1A 2KXHA 1HBNA 2F8HA 4LBHA 2J0SD 4DV1J 3ZC4A 2Q43A 1IM6A 1T11A 1PYOB 3MPWA 1FFGB 3O3HA 3VCDA 1X5TA 2E2PA 2E5IA 4PQAA 3J80Y 2EC0A 3WIUA 4IRDA 4JI8K 4DU3A 1AZSB 4B3TK 3KK1A 1NB2A 2MZRA 2M7SA 5F41A 4K4ZA 4F4YA 2EX3A 1WORA 5G0RA 3HOTA 3MFHA 2DXEA 2V50A 1Q82O 1Q7YT 4EFAC 3HPOA 1VQ4S 1W2BR 1RYRA 3NS7B 5E3QA 1S6QA 2RH3A 2CG8A 4RW9A 1RQ0A 4PAAA 4DV5K 2HVIA 4B02A 2FHKA 3ETMA 2YV0X 2HURA 3CF5Q 4ZN3A 2DNHA 4IO1A 4LRDA 1BWFO 2FVCA 5DG7A 2KYZA 4BRNA 2P9UA 4CERA 3MAAA 4IYQA 3CJ1A 2ASOA 1N52B 4KGKA 1BU6O 3GIJA 3G6VA 3HKZD 1CJTA 2DHXA 3CIZA 1YBTA 5D78A 3HCXA 3QGIA 2V2VA 1WHXA 1WI6A 4TN2A 3PKMA 2CZ4A 5KFWA 1B9FA 1XNRJ 4PYDA 3MUMP 5DGAA 4QR0A 3SQ4A 5IC4B 4BG9A 4ZIWA 4J90A 4ES3A 3KLVA 4RW4B 4B3RF 5F1XA 3KD1E 1J5EK 2CJAA 3FE1A 4DX5A 4PZVA 5SUHA 1VRQC 3DM2B 4LFAF 2OLWA 5M2RA 2R42A 1URRA 1RGVA 2GJ2A 3M2RB 5SZTA 4XIUA 3FZMA 3HZGA 3KHYA 2QJ3A 4USTA 2UUTA 1GXLA 1RAJA 3H8YA 5BR8K 4PG8A 5KRSA 4EI2A 3C7NA 1YTAA 1TUWA 3P4IA 4USVA 4KC5A 4FJHA 1ZH5A 1S1XA 5AQGA 3HF5A 1X5OA 2QMUB 4NLPA 4QU7A 1ATSA 3W5XA 3BGLA 1YI2S 1BA0A 4P2MA 4M42A 4TNOA 4YB1P 4X84A 2AYGA 4GV6A 1RDAA 5KI6A 2HW3A 1HNIB 1VQ9N 2LQ9A 2CZVC 5B0CA 1VJQA 3R2CJ 3G8TA 3MCNA 1XK8A 3A8JA 4PG7A 2MSSA 2D7SA 2GELA 2YKNB 4WK1A 1CC7A 1O1WA 1BMQB 1G7CB 1NOZA 2EFPA 3O3GA 4B1WB 3GBTA 4IJAA 3A3OB 3BGRB 2BANB 1UWAA 2DGTA 2ZC3A 1W9HA 4BRFA 5HO4A 4CIOA 2EFOA 2YWEA 4X62J 3JSMA 3RTVA 4P2SA 3L3CA 4AFFA 4DUTA 4PCQA 4M3UA 4H4OB 3EE3A 1WF2A 2HBZB 5HI7A 1M5HA 2QA1A 3AVCA 1F0XA 1H1VA 4DR2F 4I2QB 4GV9A 1S6PA 4KTZA 3I5AA 2B43A 5AXLA 2Z30B 3KLGA 3K89A 3H7HB 4DR1J 2NPFA 3SI8A 2C22A 4EHTA 2BBEA 2Q36A 3BUZB 3T5JA 2P9LA 1YZ6A 4M5NA 2FHJA 1C1BA 1FVQA 3D3CJ 5LXRA 2QI2A 3R1HA 5L38A 1Q95G 2FJBB 2R7XA 3D2EA 2P6SA 1GEHA 4KGZB 3HD1A 2DGVA 4L3KA 4J8FA 3TW0A 3PTWA 4CFAA 3VVTA 1TUUA 2GS8A 4QYZJ 3A3PB 2YHYA 4OLPA 1C2PA 4CNYA 1WKLA 4M94A 3H2VE 3RW7A 4CLLA 1SV5A 5DETA 5LSLA 2CADA 2MKKA 2DNZA 2PYLA 1AROP 4MK9A 2G8UA 1DTTA 4LSNB 2X1GA 4Y2MA 4CEZA 1X4GA 3WC0A 1YJ9S 1RT3A 2ZVSA 1VYAA 1FDAA 4EP4A 1VLOA 3KJVB 3A8IA 2OPPB 4CHYA 2RAQA 2OHDA 5F8IA 4ID5B 1GXTA 3WBZA 1KD1O 4C8KA 2NZ4A 4B9LA 4QIVA 2FLOA 2DB1A 3CCTA 1JLAA 2UVWA 4RWXA 1Q81O 3T5HA 4ZN1A 5CYMB 3CCQN 3ZCMA 3T5LA 3SFUA 4G3IA 2HWTA 1NZ8A 4PRFA 2UU9K 2DIUA 1HW9A 3N4QA 2V0NA 2CQ3A 2A1SA 1FXLA 4PYAA 1ZBSA 4GC7A 4IFVB 2Z57B 3T1HF 1XEZA 3CCZA 1JQGA 5ELZA 4E1JA 3ZX0A 2GVZB 2QK9A 4DI6A 2R7SA 1X4EA 3V4IA 1SC6A 2DD8S 4OZ5A 2GMHA 3A8EA 2XLJA 3IR5B 3TSPA 2KG0A 4FKXA 4HT7A 3G6XA 1SKSA 2RE1A 2E1MC 2DNNA 3V6JA 1CJVB 2O66A 3CE8A 4UT4A 4B3SJ 4P9SA 1UETA 1SPBP 1Y9OA 1DARA 1NM1A 1IG8A 3NCPA 4M3RA 1LCUA 4CNZA 4CEFA 1HJRA 2OIHA 4OGEA 1YRXA 2RVJA 5HBMA 3VGSA 4F3MA 3FSIA 5A8KA 2AYBA 5FDLB 5A6WA 4DTPA 5D3GB 4CFDA 5CCMA 2Q66A 4KO0B 1V3ZA 1VQ8S 4ZVRB 1YJNN 1FWLA 1QQCA 2BR0A 5B08A 1FKPB 2EC2A 2B9WA 3B6PA 2JWLA 3FK4A 1YJUA 1ZBHA 3PNIA 4FOEA 4YQWA 1T44A 1FW6A 1TL4A 3DGVA 1BHNA 4HDGA 3OHRA 3HHLB 2V9KA 1YUWA 2NRRA 4AILC 4ZVUB 1YAGA 4X66J 3FGUA 4MYTA 4WFZA 4OKKA 1SKWA 3NCRA 3KK3A 4FXWA 3ZNUA 4X64J 4ZPWR 2XM3A 1B7FA 3CM6A 1VK3A 4OJHA 3W9IA 2VFSA 2ZM6K 3TSQA 1XNRF 4FJMA 3DXKB 3RRHA 2R7WA 3MM6A 3WNFA 3DYAA 2K3IA 2QLWA 5CHCB 4PY5A 2B7CB 4DV0K 4ERDA 2Q1LA 5KFPA 4FLYA 3M5RA 2FJWA 4C11A 3L7PA 3HHEA 2MQMA 1UWBA 3IA0A 1BWVA 1WTBA 5HSPA 2YQ1A 3C15A 3S6EA 4O0JA 4ZVTB 3WUHA 3I5CA 4OX9J 2CQ0A 2K1RA 1LWEB 1JLCB 2K7KA 3TAPA 3D6HB 1K8AO 3PYGA 3LP1A 5A8WB 4F3QA 5J2PA 3ZZUA 4KAZA 3FVYA 3H3NO 4PKHA 1ZBIA 4BROA 3N5FA 3KWMA 4O0IA 2C2NA 1MU2A 3JSRA 4PABA 2VWKA 2HYIB 2RRNA 3PIOQ 3N01A 2M9KA 3AVFA 4LR8A 1NO8A 3D1HA 5K9FA 5I3UB 3TX8A 3CC4N 3PFOA 1U0HB 3D68A 4FXVA 2B5JB 4ZP6A 3TJAA 3QEIA 1FWKA 2ZGYA 1UFKA 5ETOA 4NX9A 3O80A 4QJVA 5DM6L 4BQLA 1KCFA 5B0EA 1LKZA 4FWKA 4YOWA 2AF6A 5L9XA 2MZJA 3G10A 2DXDA 2BYCA 4F4KA 4BC4A 2NXNA 2G2YA 3NDKA 3AA5X 1TKZB 2J8AA 1OPZA 4LFBJ 2DK2A 4ECVA 4KH1B 4DCJB 4WP3A 1L5UA 1Q79A 1X8DA 3PDNA 1AT1B 4X62F 4EBDA 4Z4IA 1KLMA 3BBCA 1HNXJ 4QW8A 1KQKA 2WW4A 3ASMA 4JNEA 5AQJA 1VQON 5TKYA 4M5DA 2F7TA 3UQSA 2CJQA 1TVRB 4U7UK 2QMWA 4BACA 5ETLA 2XYPB 4L8RB 3ZNJ1 2FF3B 2AWZA 1NLKL 4K41A 3PM9A 2CYYA 4M5IA 3D66A 1H98A 4JD2A 1WDDA 4DR1F 1TK5A 2NSBA 1ZBUA 2QEXN 4K43A 1HUXA 2BXJA 4QBUA 4BR4A 3QNWB 2OPSB 4LFAK 4ZCKA 4IRKA 4HUGA 4LFCK 3LW5C 3SQ2A 1IKXB 2XY8A 1YQHA 4MH8A 2BE2B 2A2DA 5DDPC 3MMBA 1VDHA 3BGOP 4NYPA 2G0IA 4U96A 4TY8A 3N4PA 3MPDA 1DT9A 1RLDA 2PBDA 5KFBA 1OO0B 2FSKA 5GADP 4P75A 1VQ9S 2NUHA 4DSEA 2CRLA 1XIQA 1NDCA 2FJEB 3POTB 1WUUA 3MEKA 4HTLA 1KQSM 3PKYA 3H1QA 3TAQA 4DMZA 1NGIA 1Q4RA 5EHHA 1HI8A 1RHKB 4JI3K 4DTOA 1JLQB 3G6YA 3UR3C 2DO4A 1FFWB 1R89A 2LQBA 3FFIB 1M5OC 4DN9A 4DMNA 2OA8A 2ZWPA 3WXMB 1V6HA 2NR0A 1E6VA 5AQFA 2ITMA 1WSHA 2QE5A 1BD6A 4ECXA 2BOPA 1A9NB 5FPEA 3UN3A 2GUPA 2MZQA 4OHZA 5KFDA 2J7KA 3W2VA 1UPMB 5DJBA 1CLFA 1YF5L 4ILHA 1FHTA 1ILYA 1VAZA 1JLGA 5JS2A 5CH7B 2V4JA 3ENWA 4R5PB 5IT9O 2BE7D 5KPRA 3G2XA 2PMZD 3C94A 4P2XA 4NLTA 1YLXA 5EX0A 4ED2A 2J6SA 1OH6A 2IRUA 1ELOA 1IKWB 5DM7Q 3PHTA 1FKOB 2MPUA 3ZSOA 5HN0A 2GGPA 1XC9A 4PPDA 4ZPAA 2RB7A 4L74A 4FK4A 2H51B 2ZZNA 2CH6A 4LR9A 4DR2K 4NLCA 3LH2S 4AL5A 1S1WB 4DTNA 4F26A 2GX9A 3UWTA 3J7YP 4B3SF 9RUBA 2AU0A 3IGVA 2LCWA 4C23A 5HLFA 8AT1B 3GB0A 2OPRA 4TQSA 1H2TZ 4KI6A 2FHJD 4IEIA 3GFHA 4KHWA 4ED4A 2AP6A 4OI2A 1GT8A 5K8NA 2L08A 3QGGA 3QJJA 3VV2B 3OJSA 3LPYA 3RRGA 3W3SA 2XNRA 1QY7A 2LMIA 2XMUA 1YVUA 3QFUA 3IG1A 3DRSA 1FDNA 2HS3A 2MHEA 2F96A 3LM2A 4KFBB 1RBSA 4RNMA 2HK3A 4KGXB 4QU6A 1RT7A 3G0ZA 2CAJA 4J9KA 3CCQS 2UXBJ 1VQSA 4J9UE 3DLKB 1M5VC 2KH9A 1ZA1B 1LW0A 2E2QA 3H3OB 3CJAA 2XC9A 5KFFA 4X64F 2QL5B 4HUFA 5JUMA 4ED5A 2ZDPA 3OVBA 3DRRB 1BL3A 3AA4A 1EP4A 2ACYA 3NKYA 4CZGA 2XULA 4O5BA 2HQIA 1RWXB 4CI6A 2W7OA 4JI4J 4ID1A 2O67A 3IFEA 4OV1A 4PHTX 1PYSB 1Z2ZA 1GX6A 4BWMA 3SZ2A 2PI4A 4AL6A 5AXNA 2LA4A 3C95A 3WQPA 2OFHX 3AD7C 1KEKA 5MLCQ 3T1HK 2H48B 1DURA 3NVMA 3M30B 4OKEA 2G8VA 4MIBA 3KHGA 2VHGA 1NJIT 1U6FA 2DGXA 3DOMA 3VR1A 4ANEA 1L3VA 3Q8QB 1TMMA 1RAAB 5LMNJ 1YJNS 1KNZA 1WN7A 5IWAF 3B4DA 4PUOA 3T9ZA 4FZXC 4CHZA 3OTBA 2E20A 3H59A 3UR0A 3LDOA 1RTDA 2Z2LA 4DV1K 5JXSA 2W6LA 4DL7A 4OI4A 2E2NA 3AA9A 2LSNA 2GV9A 4ZVHA 2AX0A 4CE9A 3MCAB 4CJ3A 3E9LA 1WG5A 3KD5E 2J6UA 4IUFA 2YTCA 4K4XA 2V52B 4XPCA 4OPHA 4CTAB 2XY7A 4OYPA 4L72B 2NXEA 3H0PA 4CJLA 3HZEA 2FTRA 1OQ3A 3ENQA 4L75A 3WXKA 3VAMA 3W3DA 5KFNA 5SWMA 4NWBA 1L3TA 5E0OA 2V69A 2I7NA 2OP5A 2GEMA 1MN7A 5E3CA 3NNAA 3ZZ0A 2X78A 3ZT1A 2PFDA 2O8CB 4LFBF 1T9TA 2ROEA 4OJ3A 1VQPN 4DPTA 2F8SA 1NK4A 3W8PA 3AVAA 2BGGA 3LPUA 3VF0B 4NXMF 2J0WA 1HPZA 1WOSA 1HNXF 2MKHA 4LF9F 2WTUA 3DXMA 4CGGA 4NLXA 4OX8A 4MIWA 2LDIA 2GHVC 1XNRK 4KHPJ 2FC8A 2RHQB 3SK3A 2A6OA 3D6TB 3BN7A 4LF6F 1HBOA 2QXFA 2HBKA 3NG8A 4B1YB 4C4WA 1RU2A 3UFCX 1FERA 2ZE2B 1DLOA 3BKTA 4DR5F 1XWLA 3C6TB 2CQCA 5JVGQ 3ZTRA 4RNNA 2W7PA 3RGIA 4AH9A 5KG6A 4JKAA 3C0BA 5LMUJ 1ZZFA 3L95X 1T03B 4H8KA 2C2OB 3GIKA 2K06A 3CC4S 3FGVA 1VQKN 2KT2A 4HH0A 3CERA 5KG2A 4BRGA 2MQ8A 3AO5A 2CVEA 4CGFA 3UVJA 1XMQJ 3BO2A 1T9UA 4IH7A 4HTUA 3TYTA 3UE2A 4IOAQ 2NXUA 3J80O 4IFEA 2V63A 1CC8A 4BC3A 1T94A 3HHNB 4ED1A 2W2MP 1VRUA 2GTDA 1TGOA 4F2SA 2NXJA 1NM2A 2HKEA 5D0GA 4MO5A 1QAXA 3G6EN 4DOZA 3KHHA 1EKSA 2ASMA 5H1SQ 3CPWM 4LRCA 2A3ZA 4GVEA 3OYIA 1K0VA 2AGQA 5CE3A 5HRPA 4DB3A 2MJNA 1SQGA 3O3LA 4R8UB 3ZSXA 3KKRA 2OI2A 3BF4A 4FJIA 2WVEA 1VQOS 2DEIA 2BQUA 1SC1B 4FWPA 6FD1A 5HMZA 5AE1A 1F2HA 1G4CA 4ELTA 4ELUA 4TU7A 1S1VB 3MXMA 1VSMA 4P52A 5AE3A 4ER8A 1N34F 3GFYA 2QEXS 4PWDA 1FJGF 1NGJA 4KE5A 4EWTA 1Z4UA 4X62K 4WXWA 4LH4A 4X4NA 1D9DA 1W7AA 4CZKA 1R43A 1MWMA 4EBCA 2NRTA 5E3RA 4KB7A 1N5YA 2KXNB 1RWOB 2CXEA 1NZAA 1ZTTA 3A5NC 4V1Ak 2NNWA 4H4KC 1NDLA 4MKBA 2VC0A 3M6WA 3D45A 3C6AA 3SIPB 3MURP 4IOCQ 2DPJA 2PEBA 1BGXT 2ZH6A 4DR1K 1X5SA 3O2IA 3R2DJ 3CJ2A 4KI4A 1S6UA 1AZSA 1SAZA 4C48A 2RRBA 5KQ8A 4FK2A 4DL6A 2KN4A 5EUHA 3KFWX 3VN5A 3CHWA 2X1AA 3MMVA 3LWLA 3WQUA 4ZPCA 5H1SV 4BRQA 5AXKA 4U7BA 4WF9Q 4C3KA 3AA2A 5ADXH 4QYZK 3WDOA 2E29A 2BKNA 4NYNA 3I0RB 4J91A 3P39A 3MZIA 3DHXA 2J9DA 4ZHRB 1X1PA 1CVJA 2EI5A 4HI1A 4QPTA 3RB4A 4JI1J 2BJ3A 1VBKA 2UXBF 2JFKA 1W2IA 1Z05A 3I96A 3MN5A 4B1UB 2BW2A 2G13A 3P5BP 4XDDA 1DKGD 3FJ2A 1B3TA 1UPPA 4A8YA 3D54A 4OI3A 5C7PA 3M8SA 4RW4A 3LQVA 5AZIB 3EXCX 4B1XB 3DM2A 4JI4F 3PV8A 2G1DA 3MCMA 3Q22A 5B8HA 4DN0A 4CD1A 3M2RA 3UN2A 3QLHB 4V19X 2IIHA 2BM1A 4QYRA 3TNVA 1RHJB 4B3OB 5GAGI 3MHYA 4IWVA 2ZBQA 4Y6IA 1JMTA 2RQ4A 4OLBA 1RBAA 1WOQA 2HSEB 2YKQA 4WFNQ 5CXTA 1ROFA 1R0BG 3IM8A 2YNHB 3DLLQ 1RHMB 3L4BC 4F36A 1T02A 4L73A 3OS0A 3NAEA 4FZZA 2PN6A 2XYGB 2R8GA 3CI5A 4Z7YA 2QLBB 1KHWA 3MUTP 4B3SK 4FXDA 5ETVA 4O3QA 2W9AA 3T1YJ 4EO8A 2E5HA 2MYFA 2FVSA 2PDAA 1N8RO 1JCEA 3ADAC 4NZ0A 3FFKB 1HNIA 3AQPA 3FZLA 3CJQA 5HMWA 3KG1A 4CJ4A 2HEKA 2HHQA 3ZSQA 2R7QA 2I6WA 2YKNA 2BRLA 5F3ZA 1BQXA 1MMLA 3UKUB 1Y3JA 3AHPA 3H5UA 3SI6A 1IBKJ 3P6YC 1QS4A 5IFMA 4DLEA 3BGRA 3MX5A 2BANA 2GJIA 1HQEB 2VF3A 3V81B 3A5MC 4DR6F 1Y5LB 4FJJA 4E8UA 1Q82T 1D09B 4ZVSB 3TZXA 2JEJA 1C1AA 3CMEN 3HFKA 3BEGB 5ADXA 3CCUN 1RA7A 2Y9HA 2IVMA 5DGBA 3BGFA 3PXGa 4H4OA 2Y1JA 4KGVB 2DRAA 3K0SA 2OH2A 4X64K 4G1PA 4F04B 4I2QA 2D9PA 3DNCA 2AGOA 2VYPA 2XZDB 4J2AA 2BM0A 4KHPF 4IO9L 1RWUA 3EDRB 4CGHA 4OYAA 2Q79A 5KG7A 2VC1A 1MMDA 2JX2A 4X2BA 2FPHX 2APOA 5CZ1A 3B78A 2R2RA 3F44A 4JK8A 3OL9A 3CJTA 4DSIA 5E5NA 2VICA 3MEGB 3O6QA 4BRLA 5LMUF 3DWLA 4E7HA 3TARA 4Y00A 1QVFR 1J9AA 3CJ4A 2YHBA 3C65A 4CJ7A 4Q0BB 2ZH5A 2VGNA 3UKRB 2W8KA 4CJQA 2HFZA 1K9MO 2X6NA 3WIVA 3L09A 4RBUA 4LSNA 4CGDA 4ZK7M 2CIMA 4NRUA 1WLJA 2D0OA 3E9PA 4NRTA 1N0VC 1LQ9A 3MMAB 3DJCA 4J2DA 4H0VB 4YB7A 3MTKA 3KJVA 3CTRA 3DHWC 5EWFA 1U47A 3W0LA 4CIFA 3T69A 2JEFA 2OPPA 3THVA 2N7CA 1JJHA 3U3GA 4ZJLA 4ID5A 5J2MB 4RCHA 2DEJA 5KQDA 3SAGA 2WBRA 1VQPS 4DFPA 1IBMF 3H42A 1AW0A 1OMSA 3G25A 5KFHA 5CYMA 5C15A 2BEFA 5ETSA 2DKOB 2B6AB 3W63A 1M5SA 4DG1B 3OR1B 4K59A 4FWQA 4WFXA 3ILIA 2ABYA 4M5JA 4X4PA 2ZITA 2O3DA 5KT5A 1K44A 3BYRA 1WHYA 3OSPA 3CCMN 4IFVA 3OYBA 5JLFA 4KRWA 4LFBK 1Q7YO 4O4RA 2OMLA 4U9RA 2DNRA 2VPYB 3M8RA 4BDYA 2WONB 1REVB 2GVZA 1WUAA 2VG7B 2E1CA 1HNXK 2XMMA 2OJ3A 2D1KA 3RB0A 4DV7J 3NOCA 3KKFA 3NBPB 3OYFA 5HRNA 4NYOA 4HTJA 2RDJA 9ATCB 1CJVA 1QVGM 3ATUA 3CPEA 2JSXA 1VR6A 3T7ZA 1C4CA 2CGJA 1TL1B 1BXNA 3QEXA 5KFXA 4F25A 3VQ6A 1MW7A 4LF6K 1VQKS 2IVOA 3DOLB 3U1MA 3R1LA 4F02A 2B8PA 3NMUA 2QFJA 4HYKA 1GLLO 2YX7A 4DTXA 4DQRA 4UZCA 5FDLA 4DU4A 3GOIA 5D3GA 4KO0A 4KB0A 1FKPA 4YR0A 4JV5F 4WTOB 3D3BJ 4DHVA 4KPYA 3G6ES 1U26A 2B4OA 3CYMA 3H6EA 4IG3B 3R8YA 1RDCA 5AR0A 5E3PA 3KIOA 2K3KA 1MWKA 4ZPVR 5AZJB 1MWZA 3UDCA 4M8LA 1P1LA 2FB0A 3QWUA 3Q2SC 2JLEA 3HHLA 4FW2A 1YK9A 2FZCB 2POKA 1ZS6A 1CXUA 4Z0UA 3OHBA 1T7PA 2RT3A 2FVRA 3MAQA 4JI1F 3CDAA 3M8PB 2LA6A 5F0XA 5L39A 2X74A 1N5QA 2WSFC 1HKCA 3GIIA 3IO1A 4M3TA 3QT5A 1OSCA 4F4WA 3H5XA 2OTLN 3FQKA 5KG4A 2HHTA 4M41A 4NA1A 4H54A 4UTGA 4F3OA 4JI2F 2MB0B 1HKBA 3U8XA 3M1VB 4Z4HA 3DXKA 1WEXA 5JVHQ 3M2UA 2EFGA 4NLBA 1NGBA 4FZVA 3FKBA 3EYZA 5CZXA 1TUGB 1VIOA 1W7WA 2E1RA 2B9YA 3RMBA 2XTJP 3I9ZA 3F0NA 4AXIA 2R8JA 2VODA 1ACMB 1O51A 2LQJA 4CLUA 1XNQF 4O23A 4FJ8A 1U2CA 4HHHA 1UAWA 4O3OA 5HL7Q 2UYTA 2D3UA 3VQ8A 4A5AA 2UUAF 4WQ4A 1XUPO 2N4DA 1FJGK 1LWEA 1JLCA 2HBLA 2UUBJ 2GO9A 4Q8EA 3SJJA 5A8WA 3MM5B 3C46A 1NJYA 2YX4A 4AHSA 2PMWA 1X9SA 5BPMA 4PG6A 1Q8KA 3QYYA 4AHRA 2ZFHA 1NB7A 1Q5YA 1R31A 3MN9A 2D0PA 2VFVA 4K8RA 1TL5A 3DFEA 2I1RA 4FDFA 3HVAA 4WKRA 1WTFA 2KJWA 5I3UA 5D0HA 3T1YF 1RT5B 2B0GA 5EOYA 1U0HA 1DGKN 5A8RB 2B5JA 3JTNA 3BZCA 3P31A 4Z4CA 3J81U 1X60A 4CLKA 2X7IA 4G1QA 1RTJB 2F4VF 3L6QA 1NAQA 4LF8F 2V2QA 1ICEB 1HNZF 2FQQB 1VC6A 1EXQA 4OYBA 1IBKF 2Y8WA 4DPUA 1NGGA 1UVJA 1SXLA 1S6OA 1TKZA 5K14B 3IWNC 1X3MA 4IEEA 3ZT2A 2Z2YB 2V8GA 5C0YA 1QLNA 3A5LC 3U7JA 1JIHA 3NLCA 4KH4A 1RGIA 4UQGA 5KG0A 2UXBK 5EGYA 3IAYA 4NXNJ 3KTQA 2JVRA 1RKJA 1TVRA 1FF2A 4BQZA 4YOEA 3O08A 2YBVA 3SPZA 3OV7A 3AOBA 4RWTA 4NCGB 3CQ8A 2ASPA 1CQMA 4YY3J 4BRMA 1FDBA 3C6UB 1KQFB 3HI9A 4AHUA 2CG4A 1E4GT 3THWB 2OPSA 2JJ4D 4JI4K 2GAGC 4NMLA 4HVJA 4HWIA 3AJDA 1IKXA 1K73O 1RFQA 2BE2A 1WG4A 4Y2KA 3QZ7A 3LL3A 3QZ8A 2XMJA 3SBMA 4CESA 2Q2RA 1NG9A 1VHIA 4ZCMA 4P74A 4WWSA 3K5NA 5F0UA 1IR0A 3W1YC 3GV7B 3D1QA 3POTA 5DQIA 1HFEL 5CAAA 2E4LA 5LMNK 2DHSA 1PILA 3AVKA 1HBUB 1S5JA 2YKMB 1KHVA 5K8OA 1IKYB 2RDDA 2QM1A 4F3TA 5IXUA 2VCPA 2XS5A 1JLQA 1RWNB 2GC8A 3SV3A 2WFBA 3ENHA 4L3QA 3FFIA 2IHR1 4P2FA 3TZZA 1IKVB 1NGCA 1PBUA 3CMES 2OANA 3TWZA 3DCAA 2XI3A 2OYQA 2DGSA 3CCUS 1N48A 1S72N 3SBTA 4YHHJ 2WOMB 3JQMA 2MGZB 4UUWA 3AGKA 1JLBB 3CC7N 2RNEA 4IH6A 4LF4J 4KPCA 4B9MA 1X31C 2F9DA 3UDEA 4IZ9A 1RT1B 5FPDA 3LGHA 4ZITA 5DDOC 1N5SA 1FD8A 4FVUA 3RBXA 4R5PA 5J1PA 4OGCA 4CHPA 5M1FA 1EWQA 2FBYA 4G9ZA 4H4MB 2GW8A 3HPHA 3QIPB 3IGNA 1IKWA 4K4WA 5KFMA 3TZWA 1FKOA 3LP3A 4OZ3A 4FLZA 2CQIA 4DV7F 3UW1A 3PVXA 2DGUA 3NGDA 4F0KA 1NK5A 4OKJA 1S1WA 1QE1B 2QL7B 1SIZA 4KHPK 3BO3A 2J9EA 3OQ2A 2ZEJA 3PCOB 4FF3A 2YNFB 4QCLA 3IFRA 4JI5J 4ZMMA 2E66A 5CY4A 3IBWA 3PJXA 1RDBA 1LWFB 3G82B 5LMUK 4NZ6A 5KAKA 1RLCL 4DF4A 2D3OR 1UJ6A 3ZX2A 4WPAA 4NLOA 4LQ9A 4KFBA 4OYMA 4BDZA 5A2QU 4CIGA 4ZTJA 2ZBCA 1TKXB 1W2BM 3MOZA 2O4GA 3T41A 5JLHA 1IJEB 2RIJA 4EZ6A 5C42B 2CUYA 3DLKA 3GE1A 1RT2B 3LGMA 2H9ZA 3I87A 2E5LJ 3L4IA 3TA2A 4X65J 4DF8A 4I0WA 2XZTB 4WP9A 3DRRA 3CCMS 3HJFA 4X4OA 3K5MA 1N36F 1V3SA 3S1TA 1UW4A 4CECA 1H2UX 1V5IB 2EWHA 4BS2A 4M7XA 2W4CA 3J7AN 3RYLA 2IM1A 2F4FA 5IM0B 1H38A 1FRMA 1I6JA 3GYGA 3ET6B 3IRWP 1UA0A 1UVMA 1WNSA 3LTOA 3CWJA 1F5AA 3FNNA 2F8MA 4NI2B 4AQYJ 3M30A 4OZJA 1BA1A 3BKUA 2UUBF 3R5CA 3VEOA 2JOQA 2MKJA 4FYWB 4USWA 4Z4EA 3AAQA 1RAEB 3RG6A 4FLXA 3QGPA 2XQCA 3JS9A 1IWGA 1SBRA 2GAHC 4BR7A 4CJTA 2ZKUA 1PO6A 3UIQA 2NRXA 2FBXA 4GMJB 2B7BB 2YKAA 4GRSA 3Q7CA 4CJ5A 4ETXA 5KGWA 4FJ7A 4F50A 2FUG9 1KN6A 4DBQA 3OYMA 2KT5A 4ED3A 3DRPB 1NGHA 3QJLA 4YUDA 3GJSB 1T3VA 4CTAA 4X4TA 5KG5A 3KLEB 2E9RX 3W60A 1IBLF 1NH7A 1QTNB 3PYDA 1Y00A 4JV5K 1W26A 4UY8T 1N32F 2OTLS 4CH0S 2ZH3A 1G15A 2D0BA 1VLYA 1YRUA 3PHEA 2ERRA 2LYVA 4JRPA 1KKHA 3MM6B 2O8CA 3TUJC 1BY9A 4ES2A 3GLJA 3H5YA 1I51B 4WYBA 5KT7A 4YN3B 4PR6A 4JYAF 1WC0A 4JI1K 1BQNB 3JXOA 3WXLA 3QRQA 1R59O 2A2CA 1RI7A 4YEAA 2DH8A 4NXNF 1S12A 4C8OA 3R6MA 2R7OA 4J37A 1CZAN 1HR0F 2C3PA 4LF7F 4ILMA 5BREA 4CH1A 2Q3SA 4H5TA 4EIAA 2V9WA 4CO4A 4RR5A 2WW8A 1KP6A 3H25A 4MYUA 2W2OP 5DDQC 2ZE2A 2HMPA 5T41A 4M5KA 3DRXA 3EL2A 1FX4A 3C6TA 1X0PA 2Z56B 3FCHA 1TZ0A 3K5PA 2IVPA 2CPYA 3PZPA 3TVYA 3TJ8A 3JTOA 3WZ0A 4ZKAA 3CCSN 1T03A 2KVQE 3NHGA 3MM7B 1U6BA 2ROGA 3IRXB 2UUAK 4CK1A 2GMLA 3ALYA 4A8SA 4J9RA 1FKAF 4ICLB 5FJ4A 2KDOA 3OTOF 4C3MA 3FSYA 2HBMA 2KL8A 4M3YA 2QYCA 2VOPA 2UUWA 4NLSA 1SUQB 1OVYA 3MD1A 1YXQA 1LV5A 4RNOA 4JKEA 2ZJRL 4C97A 1JK9B 1P6TA 2J6TA 2G0CA 2FHOB 1LNQA 3OXLA 2OD6A 4ZVQB 3T1YK 3TPQA 2H65B 3KHRA 3TAFA 2D74B 2GVDB 1CPZA 4R8UA 3CD0A 1FTCA 2XO7A 1NNEA 2E5GA 1NSAA 2GFFA 4YHHF 1NU0A 5FRNA 3OR2B 4M3XA 2MKYA 4M5LA 1TL7B 3CQXA 1UCNA 3HOSA 1IBKK 1D0EA 5DS7A 4TSXA 4QWCA 4JRQA 1UW9A 1S1VA 3GIRA 4YNQA 3LAMA 4M5GA 3LDLA 4JUZA 3NP5A 3OTEA 5FD1A 3TU5A 1YG0A 2UXDJ 4DV4J 4JKGB 3C6HA 3Q0AA 2QG9B 1JX4A 3K2PA 1FNXH 1M5PC 3G87A 3I32A 5EN1A 3H46O 2XG8A 2F5GA 4ID8A 4DZ6A 1WHVA 4P6QA 4M45A 4WFAQ 2BKPA 2XI2A 3BDPA 4DV5F 1NLVA 1E6YB 4BRPA 1O5JA 1WC4A 2ZH4A 4B9SA 4DV6F 4M5HA 3L2RA 2GNKA 3EM1A 3PRDA 1HQ2A 3U1LA 4OYIA 4HACB 2L3MA 1TAQA 4H5NA 3ULHA 1C0GA 1Z1ZA 3AVLA 5ETKA 4H0XB 3KG4A 2KLAA 1RWWB 2H5JB 4LSLB 2AIRB 3NF7A 3PYFA 4DPYA 2QLFB 3UCUP 3QB0A 5KFUA 4DTRA 3NEKA 4NLDA 2AV5A 3QSIA 4B3MJ 1EKEA 5DZ7A 1VGYA 4ZP8A 3I0RA 2AT1B 2ETJA 3QAEA 3HP6A 1XHZA 1J5EF 4ZHRA 4A8QA 1S72S 2LP4A 5LL6Z 2ASDA 1B9DA 5AQMA 3CC7S 2HOEA 1SZ2A 3DDNA 4LSZB 1KAXA 1NJIO 4PL8A 5FPNA 1XMOJ 2E5LF 3W2WB 4A8KA 5LJWA 1Q0NA 4ZJQA 3K57A 4GKKJ 3TWHA 4CBXA 4HVZA 5AQYA 1F9EB 4EK2A 2QLJB 4QS7A 3GR0A 3E51A 3PSFA 5AZIA 1SKRA 3DLBA 1MLAA 5GAHI 2DO0A 3IBFB 3PY8A 5KFSA 3NMRA 3QLHA 3MCSA 3U27A 1GQEA 1HI0P 3VAHA 4B3OA 3CG7A 1DQAA 5HMXA 3LM9A 2QSWA 1K1QA 2N3LA 1N0UA 3UCGA 1ZZNA 1CQNA 1YJRA 1XBWA 4CO2A 1FA0A 2UVVA 4FJXA 3N0VA 2YNHA 4DR3J 1RTIB 4OPJA 2XYHB 4DV7K 3PW7A 3LALA 2NLWA 3CFPA 4O8KA 1PAUB 3OY9A 2K8GA 3AVBA 3H1VX 1ZM9A 1KAZA 4MFBB 1MN9A 2ZNZA 1ZPVA 1RT7B 3CQYA 4NO7A 5I42B 4LQ3A 2D41A 1HYVA 2MQLA 4PKDB 4XH1A 3BSAA 1R27B 3MTJA 3J7Z5 5HRRA 4ZPTR 1UVKA 2CNKB 5GIOA 3M8WA 2VONA 1OQ6A 4IQMA 3EDQB 1KFSA 4OI6A 5CQGA 3UKUA 5D4NA 5LSOA 3SXLA 2J76E 3L2WA 1CXQA 4IDKB 4EUVA 1SIWB 4QPXA 1PSDA 5LM7E 1HQEA 3V81A 2UV8A 2JEGA 3QEVA 4LR7A 5AQKA 3EN9A 3OVAA 1HWKA 4RW7A 1NDPA 4WTYA 2QN6B 3U6FA 4MAKA 2AQ4A 1AFIA 2J9DE 3VESA 1KOHA 2M5YA 4M5MA 2QRRA 2NUBA 2OSQA 1VJWA 3BV8A 1F5BA 4XTTA 4FPRA 1NKBA 1CSJA 2CJ9A 3AT1B 3MEDB 4NCBA 1S59A 4X4RA 4WKYA 2HAIA 3GR1A 3AB2B 3D6RA 4PA1A 3OW2R 4CZMA 1PJ6A 1W0HA 3GJQB 4HEA9 5IT0A 4F4ZA 4KYZA 1UMJA 2W42A 4K0KF 1GH8A 4JI6F 1VFJA 3LOUA 3MEGA 1TL3B 5CZVA 4NLQA 3LANA 2V8PA 2HHWA 2BX6A 3RMDA 1Q1KA 3JB9k 2ILYA 4Q0BA 1WAFA 3UKRA 2UUBK 2B4PA 3K58A 3THTA 3VAFA 4ISGA 4HDHA 2AJ1A 3LAKA 4KH5A 4BR9A 2XCPA 2WVFA 4I6YA 1GTHA 2UU9F 2XSFA 4LREA 2IJRA 1XC3A 2OEMA 4PXBA 3MMAA 4UY85 3QFPA 2ACMA 4NZ7A 3OYKA 4DR4J 1JXEA 5HVHA 1RT4B 2P2CB 2C2ZB 4OZLA 5J2MA 1RHUB 2A42A 1C0MA 2Q0UA 4FYDA 4LH5A 4UZBA 4LBIA 3CDUA 4CLWA 2KG1A 1V4TA 5BPNA 1NU4A 1IBLK 1Q8BA 2B6AA 2O8DB 4DG1A 3OR1A 3M9OB 4ZPBA 3VTHA 3OT9A 3UO0A 3OS1A 4BRIA 3GYXB 5EX5A 3NMAA 2ZBPA 4OX6A 1S9GB 1B0VA 1MWQA 3F41A 2QC3A 2PE8A 4CZCA 3F5TA 4FWSA 5AQOA 3Q8SB 2HFUA 3M9NB 4X4VA 1VHFA 2LEBA 1S79A 2ADCA 1RE1B 4DV4F 2V7ZA 3GIMA 1VHXA 3M3ZA 5AQPA 4A8MP 4JYAK 2WONA 1REVA 3M05A 4YB5A 2VG7A 4WE1B 5E3AA 1UVNA 4WFYA 1MROB 4C8MA 3G86A 3LDPA 4NXNK 2C1EB 2YX6A 4CF9A 2F8EX 4BWJA 3NBPA 1Q7LB 2V34A 3CCSS 2IGIA 4A57A 2C2KB 3PIPL 1X4CA 4CGJA 1WF1A 1TL1A 3R5DA 1HD0A 1WDTA 3DOLA 4CLTA 3QAUA 2AZ3A 2DJWA 1FNMA 2PO4A 3FZ2A 3GU0A 1IJJA 2PSZA 2IRYA 3DLLL 1DEJA 4P7TA 3RMAA 4CJVA 2PAVA 3TRGA 2ZZTA 3FC9A 4MO4A 3AOAA 4ZLPA 1NCLA 1XJWB 3CULA 2O8FB 4DPOA 4IG3A 1FDDA 3L2UA 4CFBA 5AZJA 5GIPA 5C25B 3EE8A 4N47A 4GO7X 2QW9A 4R25A 2CJXB 3RZAA 3M8PA 3HBTA 4AM6A 2NYIA 3ENVA 1O8BA 1HNWJ 4DQ8A 2EVZA 1N4LA 2FLLA 3K8WA 3I55N 1XMOF 3E8OA 4ED8A 2YPZA 4UUXA 4RW8B 1C0UB 2MDAA 3HFVA 3M1VA 4GKKF 1IH7A 1H2VZ 3SMPA 4XO0A 2ZBIA 4NB4A 1R8HA 4OL8A 2UVUA 1FJ7A 3ZEUB 2JZ5A 2CDQA 4CHNA 5GAEI 4DS5A 4YHHK 3IDHA 3TVKA 2RILA 3FBFA 2OELA 5GINA 2Q0RA 4XK8C 4KT0C 4DLGA 4LD0A 3J7A1 3RU0A 4WBFA 2KRRA 2D0CA 5KFJA 1FRJA 1T05B 4FS1A 3TTDA 2D0AA 3BQ0A 4YDUC 3THXB 2IA6A 1P8ZA 4UOCA 8ATCB 3BPSP 1QAYA 1XQIA 4ED6A 3MM5A 1NBWA 5AQWA 4H4KA 4FWOA 5BPLA 1UJ5A 1BQMB 4PWUA 1ZM2A 4DR3F 1S5ZA 5M1NA 2CPFA 1P27B 5KTQA 2ILZA 1HBMB 1IXKA 2IA0A 3Q8VA 2DIVA 2G8WA 2MEWA 1UKUA 3HM9A 3T9NA 3PX0A 4DV6K 4GVLA 3PUFA 1RT5A 1GLDG 1EKRA 1RA6A 4NLVA 3ZZRA 5A8RA 2OGUA 1NPPA 1WC5A 2OPQB 3P38A 4RUAA 2EK1A 2LDYA 1RTJA 2I8EA 1OH8A 3JQJA 4MQ3A 3MPYA 2JC1A 1S57A 3AO4A 3FR0A 4IO8A 2IDEA 3GCXP 3KUGA 3AO2A 4CHOA 3HFZB 3CXCR 5AQSA 3S7RA 2JFDA 3FLCO 2I0XA 4EO6A 4RNFA 3N6LA 2VDIA 3PR5B 3OYNA 2RU9A 3VZIA 5K14A 2GQQA 4E19A 3CVKA 3V9WA 1KXPA 3N6NA 1PC5A 2AHOB 1L3KA 4OZNA 3L2VA 1RWKB 4LFCF 1Q16B 4ENOA 2CPHA 1RACB 4GV3A 3O44A 1D9FA 5DG8A 4DZDA 1BUPA 4XH4A 5JMNA 1JXLA 3MM9B 4KTQA 3DKDA 5IS2A 2E5LK 4EBEA 2YWFA 1RAOA 3ZTQA 4K25A 2ZHOA 1S0VA 1VIXA 4J9NA 3N79A 4NCGA 1VSHA 3SCXA 3C6UA 3VF4A 2KM8B 1S7HA 3SUOA 4A59A 1JWWA 5CD4H 3K9JA 3KLFB 2FJDB 3THWA 4C8NA 5ITHA 2HAFA 2HQ3A 2Y3YA 1NJZA 3VQSA 4CCHA 1L3SA 1EB0A 4JI3F 2GQCA 1VQYA 2E7WA 1RABB 2UUCJ 2HZCA 1RBVA 4ZDNA 1F3FA 3RMCA 1J5OB 4LVOP 3ITHB 4FF2A 3GV5B 1NOYA 1VISA 3SQ0A 4CGIA 4AQYK 4YOUA 3J7AP 1LK5A 2DPIA 2I9SA 2X1FA 5E33A 5K20B 3CDBA 1GMWA 4J9MA 3OYEA 4Z4GA 2KZMA 2KTQA 1UTAA 1HBUA 3D6MB 1KVAA 2YKMA 1IKYA 2FSJA 4HL9A 1WELA 1YX2A 2MLZA 3HULA 2DNQA 3UD3P 4DV2J 4Y2IA 3CCRN 1WSEA 4H0YB 3O9RA 3CFRA 1IKVA 3MGJA 4I6MB 4BGAA 3WNHA 2VASA 4DL3A 4B8CA 3HPGA 2E9TA 1TR0A 2GIQA 2A10A 2WOMA 4H0PA 2PY5A 2MGZA 4OZ2A 5GVQA 2PFFB 4L76A 1JLBA 4IOBA 2ZJPL 3H90A 3CCVN 1TU0B 3Q24A 1F2GA 4Y0FA 1RT1A 2NYHA 4FLTA 2G0JA 3AA3A 4CIEA 1VQMN 1R0CB 1LOUA 1NK7A 5IOLA 2HFNA 1NWKA 4O0NA 2HBJA 3E66A 4KGMA 1H0HB 5DM6Q 3R9LA 1RCXB 4PG4A 3JYTB 4MK7A 1M1GA 3TAEA 2ZZMA 6AT1B 4D3HA 4H4MA 2JLFA 1SC3B 1JNRB 2COLA 4KQZA 3QIPA 5AQUA 1GLEG 1AB8A 1NJWA 2MZTA 1UEVA 5HATA 5KFEA 2P9NA 5KFGA 5KFKA 3F9KA 3MCPA 3QSYB 1KQGB 1I3OB 5THWA 5C5JA 2IJFA 1ZM4A 1QE1A 1N5VA 3MEEB 4ZVOB 3DMJB 3KYLA 4CZJA 2ZH9A 4FJNA 5D8HB 2MSTA 2VZ9A 2YNFA 5CYJA 4A8OA 4ZVPB 5BR8J 4K0KK 3CC2N 4JI6K 4G1IA 3KLHB 4BRCA 4B17A 3KMSA 2IOCA 3I56N 1LWFA 5F2RA 3G82A 3ILJA 5CD4A 1B99A 3JSBA 4X4SA 2HS0A 1VQLN 3VGMA 1K73T 2AGPA 2IMOA 5HVGA 2Z2ZA 3QBWA 2J7UA 1TKXA 5ETNA 4ED0A 4K5SA 3HSCA 3ZXWA 5C42A 3WX8A 2C2EA 4KHQA 3EGWB 2FSNA 2UXCJ 5F8GA 1B64A 2WSEC 1RT2A 4ILRA 4HKQA 3B54A 5M1PA 2ZVIA 4IRCA 4DSLA 2VQFJ 1UVIA 1NMDA 1Z2LA 4LY7A 3BN4A 2C42A 1KVCA 2LEPA 2H3EB 4AL7A 1XTZA 3S41A 4N8OA 4CFCA 3HD2A 2KB2A 4HT5A 4C7QA 2HGLA 2VB6A 2VG6B 2OD4A 4DV1F 4YB6A 4TY9A 1KC8O 1RWPB 2HVDA 5IM0A 1U2RA 1NGFA 3ET6A 1QSSA 2EWSA 3CETA 5JICA 4CLYA 3VQ9A 2UXDK 4NI2A 4DV4K 4U8YA 4FJKA 5GMKa 2PC6A 1YRTA 4K8XA 2WCXA 4ZCIA 2DY9A 1NSPA 2D4WA 4H0TB 2BKOA 2XGPA 5DZ6A 1GNKA 2I5JB 3D9BA 2ROPA 4JHDB 3MR3A 3IC1A 2WZ1A 4HR2A 1GK8A 2ADBA 2IAJB 1BWEA 4H0OA 4J9LA 1Q8IA 4F4AA 1JLEB 3DRPA 2V8DA 4LVNP 4ISEA 3FZBA 4PL7A 1NEEA 3KLEA 3QPIA 1UEKA 4R79A 3KUEA 1CJUB 1BDGA 3BGUA 2UVRA 3VALA 1YZ7A 3I55S 4C0HA 4DL4A 2P9KB 3KHLA 4GKJJ 3M2UB 2L9WA 4AD6A 2FHMA 4JKFA 3KUHA 4B3MK 5CYQB 3SDEB 3J8AA 1K47A 5AQRA 5DQHA 1JJCB 2QA2A 2RKIB 4U67L 4OYZA 3HI0A 1TKDA 2Z1JA 3IM9A 4QIFA 1BQNA 4RX6A 1LXNA 3PEJA 2FZGB 4BBYA 4ISFA 4ILLA 3VEVA 4Q45A 3Q8YA 4JB8B 1XMOK 5KFQA 2CWKA 4BE0A 5EXWA 4ZS6A 3PR4A 3EMTA 2ZF5O 3NE6A 4GKKK 4IBNA 4LRFA 3UPFA 3CW2C 3K9KA 2R2SA 1KTQA 2IMWP 3CJSA 4I2PB 1OVQA 1U09A 4K7QA 2YJEA 2HNDB 4ETZA 2QWPA 4F4XA 4FJLA 5KT4A 2MKSA 4RKUC 1Q5VA 3L7OA 4RPFA 4CF1A 2QFIA 4IKAA 5AJ3J 3H98A 3A4TA 3M32B 4DTJA 4MMOA 3MM7A 1A5WA 2NS1B 1QUPA 3TR5A 4OO1J 3IRXA 1CEZA 5KOWA 5F8MA 5DDRC 4ICLA 4G1QB 3QT7A 4BVPA 3H08A 4A46A 4RNHA 1NGEA 1S9EB 1RSCA 2FC0A 3Q8RB 2HVHA 4DR3K 1QVFM 2CQPA 4CBUA 2M0GB 5KPZA 1SUQA 1RBLA 4JI0J 2WBNA 3O8MA 3I31A 1NK9A 1HKGA 1ZBTA 2DNPA 4P7VA 2Q3PA 3S3NA 2YWGA 2O8BB 4C2MA 4I68A 4B9TA 2QLXA 3QERA 2CPIA 3GYNA 2GVDA 5EU7A 6FDRA 3P4UB 3MN7A 2LU1A 1LFWA 3OR2A 1TL7A 4WIQA 1HA1A 2IS3A 3WHIA 1MA9B 2YHAA 4F0HA 3PW4A 4QWDA 4FOIA 4JKGA 4HTIA 3I82A 1KTVA 3I0SB 3W62A 2CQ2A 1GMUA 4N77A 2DH7A 4B9NA 2RF2B 2VUGA 4QS8A 3GL1A 3SLCA 1TQLA 5LY3A 1R3NA 4DU7A 3J7ZO 4DV0J 3DGPB 4K5RA 3PRVA 3LP2B 5GAHU 2GX8A 3AV9A 3KK7A 1E6YA 2EFNA 1QHAA 1Y10A 1XR6A 2FLNA 4CYUB 2R7UA 4AF1A 1YT3A 1PYTA 3CCWA 2KVIA 1SCJB 2BUNA 1WEZA 4HACA 1P8GA 1M90T 3HSTB 4HH1A 1EQMA 2EG2A 4N56A 2WVCA 4CLFA 3CJ8A 3G96A 4LSLA 5AQQA 1Q78A 4W5OA 4ZVGA 3FBCA 3AY0A 2LQ8A 2CGLA 4C98A 3CCRS 3BP8A 2MXYA 3L4QA 3TAMB 4ECTA 3V2UC 2VIHA 3OHAA 4L3NA 2GCFA 2XWYA 5E2QA 5IT9U 1CG2A 3F73A 3CJRA 2VBZA 3AD9C 2M88A 1GMWD 5B0FA 3O5BA 5BRFA 3EVOA 1XHXA 4J9OA 3VENA 3NWGA 5KG1A 2WK4A 3CCVS 5D4LA 3AOCA 4I64A 2SXLA 3L7UA 3AVJA 1JJ4A 2EFQA 1VQMS 3W2WA 4Z4FA 4FWNA 1R6YA 1D8ZA 4DR4K 3O4WA 3TP2A 3ETOA 1T9WA 4CVNE 2XMKA 5DG9A 3PYEA 5AFUA 3WQTA 1QUVA 2KHCA 2R8KA 2VKZG 1TKTB 4O3SA 3HMJG 3QATA 2W6KA 3EKSA 3SUPA 3ZSWA 1HI1A 2E7XA 1IUJA 1RDRA 2F40A 1QHTA 4BG8A 3BZQA 4K42A 3R5GA 4MTPA 3I8BA 2VPZB 2YKPA 2BE9B 2KFYA 3MUVP 4UY8O 2AJ2A 2DRBA 1VBXA 3ZTSA 5GAGP 4J5OA 1VQNN 4O3RA 4Q2MA 3CC2S 4MLEA 1RTIA 3AVHA 2MQOA 1H3DA 4EU0A 4I67A 1M1HA 3I56S 2P9SB 1F60B 4B3RJ 2X1BA 4RUCA 2VU5A 1VQLS 4MFBA 4E7JA 4NEYA 1Y11A 3LDSA 1R8AA 1N5TA 5I42A 2Z0GA 4X66F 4HHUA 1RT6B 1HW8A 2IIRA 3U1NA 1WSVA 1TTHB 4Y28C 5A6PA 3CJ3A 2IY5B 3MK6A 1A0OB 5LJVA 4U7UD 4BR0A 4IDKA 3SAFA 2M8HA 3TANA 5H9FJ 4WP8A 1K1SA 1VI7A 4GKJF 8RUCA 3O9UA 3GG0A 3C16B 4MIAA 3P96A 2VBYA 2FY1A 2GIFA 1YJTA 4XAKA 4B9QA 1VOMA 3TEHB 1UFLA 4JP8A 3I4PA 5BN9A 4M95A 3SSSA 3W5YA 3SUQA 4RUBA 3GPAA 2EKYA 1HNWK 5BR9A 2QWQA 1YKWA 5K8MA 3B8HA 3NAHA 2OEKA 3DLGB 3LGNA 4C8ZA 1NJXA 3MEDA 2P5VA 4ZCLA 2V8HA 4OX9F 4UOFA 2PYJA 3OBWA 2MY7A 4JAXA 4B08A 3SQGB 4X4QA 5C10A 2HRYA 3TA0A 1NKEA 2ASLA 1JXVA 4DR7J 2ZD1B 3CM5A 4FPBA 5IT4A 3V9UA 4OYOA 4OI1A 2A1RA 1TL3A 5AJ3F 1HHSA 2R7VA 4NMXA 3TO8A 4QS9A 1NHUA 4IG0B 1CS4B 2IM3A 4CDIA 5CZ2A 3G9CA 4UW2A 4DX6A 1FEHA 1TELA 4FLWA 1LFPA 3OUYB 4IQXA 2IYGA 1R8CA 2QIFA 5F9LA 1U04A 3GJTB 4JI0F 3I8DA 3UI3A 1JJ2R 2YH1A 1OSDA 4CEDA 3IUCA 1RT4A 2W9BB 1JL1A 2OKQA 1S77D 5C2GA 1LWCB 4NYFA 2R8IA 3Q7BA 2PIIA 1IQZA 3G71N 3M8YA 5I3QA 4PEOA 4BC9A 5MLCV 2O8DA 5E84A 1S10A 4ITSA 4JLHA 1T6DA 1KS2A 3DAWA 4YOYA 1BI4B 1S9GA 2J8SA 1KLNA 1TAUA 1JKHB 2DNKA 2V2ZA 3TVZA 2H54B 2X3GA 3MPVA 2CWXA 5EWEA 1S0OA 3NVKA 4KIAA 1EIYB 4WE1A 2HHXA 1ZYQA 1MROA 1GLBG 4KHYA 2WUSA 4A62A 3DI6B 1CZ9A 1HHQA 1Z6RA 4MK8A 3J80U 3OXFA 2DY1A 3TTFA 4DUZJ 3ILLA 4LF5J 3GQCA 3GSDA 2GMJA 3KNAA 4NCAA 7FD1A 3O9TA 3TI0A 3GILA 3ZT3A 3R7NB 4RU9A 4J7CA 4B1ZA 4RJVA 1IO2A 3D28A 3BBFA 2NXCA 2EXUA 3VQ4A 3WEEB 4YORA 2C28A 1U2VB 5F8NA 4DS4A 3VF2A 4QWBA 1E3MA 1RCOB 2UUCK 4RW6B 2YX1A 3QEPA 4JI7J 1PIEA 3MI7X 3AVNA 4FVCA 2AJ4A 4OFZA 4IO9Q 2O8FA 2ZKTA 4WQ4C 5AQTA 3IXQA 1P9YA 2NREA 3IR6B 5AQXA 2R7YA 5C25A 2ZUGA 2LECA 3VQBA 4FSVA 1ZETA 4TXSA 5F0WA 4I6AA 1FFSB 2WRMA 1XERA 2CDRB 4CD3A 4WCEL 2HZVA 3CIMA 1MWYA 3RW6A 4BRKA 5LOQA 2HF4A 2RJZA 1MG7A 3JXUA 3MMCB 3AA8A 2BQRA 3NRBA 2BJ1A 4RW8A 1C0UA 5LT5A 3HSJA 4DV2K 1MNEA 2ZH2A 2RN2A 1ASVA 2ZJQL 2EW9A 2Z2MA 3C14B 1VBYA 3ZEUA 1IG9A 2DISA 2VWBA 3BS9A 5DLFA 4C0BA 1Y97A 3UCZP 1RWMB 3CCJN 4H5WA 5HQMA 2HIQA 2BJDA 2OEJA 1OPIA 3EVWA 2WBMA 1T05A 4FO0A 1VQ6N 2DTJA 3QWPA 2BDPA 3FQLA 1X9WA 4WXOA 4OVLA 3THXA 2CGKA 4CO3A 4BGBA 3QFWA 4CEBA 2JL9A 3ULEB 3VEYA 2P9GA 1SJ3P 1BQMA 2VG5B 2HMIB 1QSYA 4D3GA 3P3DA 1OWXA 4HCBA 5LJ5Y 3Q89A 2KQ2A 1HBMA 1S1UB 1SB6A 4NL5A 3E3XA 5I9EB 1RWVB 3LO3A 4CJPA 3C8YA 1FXXA 3ZTOA 2ZWHA 3N4WA 4QWAA 3OL7A 1IV0A 1FO1A 1KOOA 2DYAA 5B7WA 3Q83A 4NE9C 1QZ5A 3EGNA 2N7YA 4L6V3 2OPQA 1NK8A 3NCIA 3THYB 2LVWA 2HHSA 1D5AA 1Y0HA 4CZEA 4O3PA 1QQMA 3HVWA 4DJBA 2HBQB 4QZVB 1JLFB 3HXMA 3ZT4A 1I94J 3SPYA 2DNOA 1MDUB 1PBAA 1CLQA 5RUBA 3Q8UA 3QMQA 1PJ7A 2NUUG 1RAFB 3S3OA 4YOVA 2CNOB 1V9OA 2N3OA 3D67A 4NLYA 3HHKA 2DFFA 3CJCA 2ATQA 3W5ZA 3CIPA 5E7OB 4CO5A 1ITPA 1RUSA 4E7LA 4DCOB 3VWSA 1X4FA 1HWIA 2UXCK 3MM9A 3GP9A 2GJFA 4K2JA 2LXIA 3IR7B 3P83D 4J9SA 4IR1A 5EY4A 2VQFK 2WC9A 1VQNS 4NLRA 4M7YA 3KLFA 2WB4A 5LMNF 2P9IB 1QD1A 4TQRA 4AXJA 4CW7B 2NPIA 2P1JA 1ASWA 2OZMA 3ISZA 2GV1A 4DR7F 4CJEA 5J1EB 4CZLA 4BR5A 2PEHA 1U1OA 1J5OA 3B6BA 3ITHA 4I7FB 3QNOA 5GMEA 3ZZYA 2AMCB 3LZIA 4CLSA 2LFVA 2HNZB 1WSRA 2JDJA 4KSEB 4USIA 2W7AA 3IN5A 2OO4A 2VD3A 2KFZA 3KDOA 3S3MA 2KKHA 3PW0A 4WFBL 4OX7A 2BMBA 4B1VA 5AQLA 4WU3A