1JKHA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
553
structure length
550
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 146
structure length 550
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jkhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jkhA05
4CHYA 1YT3A 4CJEA 1Z26A 4O44A 1RBVA 4I2QA 4HUGA 4DFJA 3SNNA 4EP5A 4ED3A 2W7PA 4RNHA 4WZMA 3NF6A 2W9CA 4RW7A 2C2DA 5T7BA 5DMRA 1FKPA 3CFOA 4YQWA 4XPCA 5HP1A 4RNNA 3QINA 2Y1IA 1TKZB 4K4WA 1RTDA 4ZP8A 3NL0A 4MK8A 4E89A 5C24B 3T5KA 1S10A 3SV4A 2ATLA 1NJWA 4OJRA 2PY5A 3DOLA 1RBUA 3RRGA 4ZP7A 2Z1HA 4B9SA 1DTQB 3MECB 2JEFA 4NLRA 4IDKA 3V81B 4IFYB 3OYGA 1VSJA 3KD1E 4PQUA 1REVB 4TLRA 3SUPA 5KFXA 4JRPA 2OPPA 4URQU 3D45A 3V6DA 2GIRA 4DU4A 3RAQA 3OS0A 3BSAA 3PR4A 4Y1DA 1HYZA 2DPIA 3RB0A 4FBUA 1RT6A 1XR5A 3NGYA 2HNYB 3OSPA 2D0BA 2HVHA 3LAMA 3OHBA 1HARA 1BL3A 5KRSA 3ZT4A 2BQUA 2OPRB 1IKWA 5HBMA 2I1RA 4EP4A 3EY1A 1OS5A 1DTTB 3KKRA 3KLGA 5KFEA 4FCYA 4NLXA 4EO8A 1CZBA 1SUQA 3BGRA 1T8EA 3AVFA 1D5AA 1Q9YA 2AX1A 4F4ZA 5KFAA 4FJXA 1QAIA 4CEOA 1S1WA 1C0UB 4DG1A 4ECZA 1HNIA 4E1NA 4FJMA 3MR2A 3NGDA 4CJ3A 1JLGA 4HKQA 1T05A 1HNVB 4OKKA 1R0AB 4F2SA 5F8HA 5SWMA 1U4BA 3PW7A 1LAVA 3G6YA 3QO9B 1KVBA 4JV2A 1KRPA 1X9WA 4K4SA 4FM2A 4IG0A 3BR9A 2BQRA 4KI4A 3TI0A 3CIZA 1LWFB 3Q8SB 2FJWA 4AHCA 3U3YA 2C22A 2OYQA 3V6KA 3FRZA 5DLFA 1S1XB 3A2FA 5EWGA 2X6SA 3DLGA 3KLHB 3I0RB 4W5OA 3SUQA 2DFEA 5KFTA 5FDLB 3BGRB 1N48A 5KFUA 5DK5A 4DTXA 1WSJA 4DU1A 3QEIA 4CEQA 2RF2A 2XY6A 5KFDA 5KRTA 1KVAA 3T3FA 2ZQBA 1IKXA 1JLCA 3NAEA 3OL9A 2ILYA 4CF2A 4N47A 3MFHA 3LAKA 2JGUA 1BIUA 2O4IA 5I3UB 2Z1GA 1VSFA 1SL0A 3GILA 1KFDA 3HK2A 3HP9A 1FKPB 4PA1A 4NLWA 4B8CA 1LWCB 1TVRA 3PY8A 1ASVA 4DQIA 3KK2B 4CJUA 4IOBA 1VRTA 5F8NA 5DQIA 4CESA 4R5PB 2BQ3A 4E7LA 5KG6A 3OYMA 4M42A 2HWIA 1U48A 4KHYA 5HLFB 4Y2CA 3ZSWA 1HPZA 3UQSA 1RT2B 3SUNA 3DLKB 3QIDA 3UPFA 1GX5A 1NK4A 4J2DA 1TL3B 4K50A 2IDOA 4B9VA 4M3YA 3E01B 3PR5B 1L3VA 1SL1A 4K4UA 4CGHA 1RT3A 3H5UA 3NGZA 2F96A 3NDKA 1IKXB 2FBXA 3SPYA 3PW2A 4QWAA 4NRUA 1A5XA 1ZETA 5J2NB 3E51A 2JC0A 2WB4A 4QPXA 2HHQA 3AVHA 4CK3A 3ZSRA 3OLAA 1RAJA 3MEEA 4YNQA 4RUCA 1Y97A 3I0RA 1WNEA 4NCAA 4DTMA 1SKSA 1C1BB 3HPHA 1SKWA 3JYTB 4H4OB 1W25A 2UUWA 4Q0BB 5KFRA 3SJJA 5F8MA 3VQ6A 4Z4EA 4HCCA 4KB7A 3VQ7A 1ZBIA 3KKSA 3FQKA 2GV9A 2KQ2A 4CGIA 4EZ9A 5HRSA 4K8XA 1KLMA 3ITHA 3OY9A 4CJQA 4DQRA 4R8UA 4XO0A 4B3OA 3HT3A 1JIHA 4EBDA 4RW9A 2ZD1B 1GX6A 3AO1A 4KPYA 1QS4A 4O5BA 4JUZA 3PVXA 3AVGA 1LV5A 2YNGB 1GOBA 3JYTA 1RBRA 4C8OA 4CJFA 2VG5B 5DG7A 5J2PA 1HNIB 3TAGA 1VRTB 4DTPA 3NF8A 1J53A 4NCGB 3AO5A 4ZVHA 2FVQA 1IKYA 4TQSA 3CG7A 3N6MA 3L2RA 4KHMA 2QKBA 1XI1A 3DLKA 1QSLA 4RNFA 4RG8A 3JSMB 1XWLA 3V1OA 4KHQA 1S6PB 3SQ4A 4KB0A 2P5OA 3ICLA 3TAFA 1UA0A 4TYAA 4BACA 3SQ0A 3L3UA 3FFIB 4IR9A 1WSGA 2FBVA 5K14A 4DFKA 4OGCA 4IDKB 4KI6A 4MKAA 4DMNA 3OS2A 2KZZA 2EHGA 1IH7A 3ALYA 4UQGA 2IM0A 2OPQB 4KFBB 3MXJA 1X1PA 3KJVB 1XHXA 2W42A 4JS5A 3SUOA 4KRFA 2WTFA 2IJFA 4KTQA 4QW9A 1JLQA 3KK3B 1JLCB 1S9EB 4IKFA 4CIEA 1YTUA 4FW2A 3DRPB 4YP3A 3UIQA 3KLFB 1TKTA 2B43A 4FLTA 3IAYA 4DQPA 4I7FA 1WLJA 2Z1JA 1VSKA 3ZSQA 4QW8A 4DSIA 3VQQA 5EWFA 4KHRA 1RDBA 4R0EA 2XRIA 3V9XA 2NUBA 2YNHA 3H4DA 2FVRA 1A5WA 2YHBA 3DDKA 2FJVA 3VQCA 4HUEA 4TYBA 3VQ4A 3ISNC 1BI4B 3U3GA 3PHEA 3GQCA 1RT2A 4LSLA 2HNDA 1C0TA 1EETB 3RTVA 1NOZA 4DLEA 1HJRA 3H08A 4DTJA 5KG7A 1JLEA 2EX3A 5KFKA 1EP4B 3SYZA 4NLOA 3QETA 3SI6A 4I2QB 5KG5A 2G8FA 3QNNA 1J5OB 4FLXA 2W9BA 3SZ2A 3S3NA 4IH7A 4O4GB 4IG3A 1T05B 4FJLA 2AQ4A 5L1LA 3H5SA 1JKHB 4FZZA 1O1WA 4Q0BA 3OYAA 4RZRA 1J5OA 1ZTTA 3DRSA 1JL2A 3H5XA 4AH9A 5DG8A 2D3ZA 3HVTB 4RW8B 4MH8A 4E7KA 3MECA 3H98A 3CVKA 4ECXA 3CM6A 2JEGA 5EUHA 3RBDA 3NGIA 5KG1A 1SH2A 4DL5A 1Z25A 1NK6A 3V1QA 3G6VA 2ZKUA 3OYNA 3WNEA 2FBTA 3DLEB 1RA6A 2HAIA 4BE2A 3L2QA 3PW0A 1XR7A 3KLIB 4KO0A 4DTRA 1CLQA 2BRLA 1RNHA 1KVCA 5KFBA 4DL4A 3PJXA 2CKWA 3SCXA 4K8ZA 2W9BB 4QOZB 1CSJA 1D0EA 5I3UA 3H4BA 1DTTA 4LSLB 4CIFA 1N6QB 2ETJA 4CJKA 5KG3A 4M3RA 4Q5VA 4DSKA 4O3SA 1EP4A 4IH5A 2I5JB 3HJFA 4QWDA 2E9ZA 3BSCA 1NNDA 3C94A 3DRPA 1KHWA 2QXFA 1RT6B 3I5AA 5T14A 4U7CA 1T03B 3CJ4A 4DSEA 3MXIA 3HP6A 2HHXA 1MU2B 1TVRB 2W8KA 1BCOA 4FLVA 3M8PB 4WZQA 4DL7A 2G8HA 2YNHB 3T5JA 1S49A 3ZSYA 3BDPA 2FLPA 3KJVA 5CZ2A 1RBTA 1QAJA 2V4QA 4KHSA 1LWEA 1ZBFA 1WSHA 5KT3A 3UDLA 5J2QA 4HCBA 3MEDB 4IFVB 5JS1A 3DRRA 3V6JA 1NHVA 3NH2A 4O55A 1YTAA 4RW7B 4B8AB 3LZIA 3T1AA 4FBTA 2I5JA 1NJYA 4IKAA 3PW5A 4FYDA 2IGIA 2Q3SA 4JV1A 5DG9A 3TAQA 3IN5A 1BIZA 1RTDB 1EXQA 3I5BA 5KFNA 1TV6A 1ASUA 4ZPBA 4B9TA 3TQ1A 2XY8A 2GBZA 5FRMA 1NKCA 1C1BA 5E41A 4NZ0A 4F3OA 2UVVA 4DFMA 3VQBA 1K1SA 3AV9A 3KLHA 2XGQA 4KBIA 4W5NA 5C42B 1S0OA 2G8UA 2P51A 3DYAB 4NRTA 3NH0A 3K59A 3GV8B 1UAXA 5KFCA 1JLEB 1NJXA 5DQGA 2AGQA 2RKIA 3QGGA 4KHNA 3MR6A 2IA6A 4CEBA 2ZD1A 4M3ZA 4NLTA 2R2TA 2ASDA 2HHVA 1N5YB 1D1UA 2B5JB 4N41A 3QEWA 4CF1A 1QSSA 1EKEA 3IRXA 3NH1A 4QWCA 4Z0UA 1BCMA 4URSA 4LSNB 2HNYA 3NE6A 1S1UA 3V4IB 3CM5A 2C28A 4FZXC 4FLZA 1A5VA 2YNGA 4B08A 2E9RX 3SQ2A 4O3RA 1IG9A 5C42A 4DQSA 1LW0A 4JLHA 1G15A 2XGPA 4FLUA 5HRRA 3M8SA 2VG6B 1RT3B 4FJIA 4O0IA 3LDSA 2R8KA 3DLRA 3RR7A 3QNOA 4KB1A 2YNFB 4ZPCA 3NCIA 1S9FA 4NLUA 4J9LA 1S9EA 3RR8A 4J9NA 2V0NA 3VQ5A 4CGDA 1QHTA 3OJSA 3RMDA 4WE1A 3RWUA 4EYHB 4MK7A 2HHUA 3MEEB 1I39A 1JL1A 3OYCA 1C0MA 1W0HA 4IBNA 5KFQA 1JLBB 3DLHA 4ZHRB 4IFYA 3DOKB 4J9RA 1NJZA 1NKEA 1N6QA 4CJ4A 4L8RB 2GIQA 1KSPA 3DOLB 4MFBB 4WYWA 3DMJA 4CFAA 1KFSA 1VSLA 4NCGA 1TAUA 1RTIA 5KFHA 3AO3A 4KE5A 5F8IA 1XR6A 1IO2A 4HTUA 2HMIA 4KREA 1JXEA 3K5NA 4KHWA 4CEDA 3LP3A 3CJ0A 1REVA 2QE5A 4OKEA 4Q8FA 1N56A 4NLVA 3AO4A 1BQNB 4WXWA 4Z4FA 2IC3B 3KNAA 1MMLA 4PWDB 4OVLA 4NCBA 3MR3A 3BQ2A 1LWEB 4ED1A 4PUOA 2R8HA 2R7YA 4MQ3A 4O3OA 3EPGA 2PYJA 2XY5A 2AJQA 4Y3CA 4FXDA 2VG6A 1N4LA 1VSIA 5JUMA 1HQEB 3TAEA 1RDRA 4LH5A 4B3OB 1JLBA 5DGAA 3MEGB 1I6JA 2HNZB 1S5JA 4C8NA 4IG3B 4KKOA 1J9AA 4Z4HA 3AVJA 2VG7B 4E7JA 3ZT1A 3V6HA 1J54A 2FLNA 2XI3A 1BISA 2AU0A 3HVTA 4KV8B 3KHGA 2QV6A 3OYBA 4FJ7A 5K14B 4F4KA 2GUIA 2AWZA 1S6QB 2OPSA 3SFGA 2OZMA 3T5HA 2YKMA 4CFCA 4HVJA 3NBPA 1VRUB 3OVNA 3CJ2A 1TL3A 2R8JA 4CFDA 3V1RA 4DF4A 4I9LA 3L2WA 3EZ5A 2JEJA 3OL7A 4IRDA 3H59A 4RUAA 3WNGA 4ICLA 4CJ5A 3HM9A 1SUQB 3K5LA 3IRXB 5DGBA 4CJVA 1RT7A 4FLWA 3E01A 3VQ8A 1YVFA 3LP0A 2R8IA 1FK9A 4DL6A 4DS4A 4J2EA 3L3VA 1SH3A 1B9DA 3AVNA 1S1UB 5FRNA 3N6NA 3ZCMA 4KHUA 2BE2B 3QIPB 4FVMA 2IC3A 4OKJA 3T5LA 3H5YA 4DL3A 3PX6A 3LP1A 3D0PA 1LW2B 2IMWP 3RB4A 3OSNA 4DU3A 3KLIA 4M3XA 4ED8A 4CGFA 4FJHA 5F8LA 1JLAA 1NK9A 4DTSA 3D5MA 1BHLA 1RBSA 2IAJA 3GIJA 4Y34A 3K5MA 2RF2B 5J2MB 4O3QA 2IS3A 1RT5A 1EX4A 2XC9A 3QGHA 3I5CA 3FDSA 1WAFA 5CYQB 1S0NA 3EZUA 5KT6A 4CCHA 1RT4A 1IM4A 4OGEA 3TWHA 4TN2A 4Q44A 3M9NB 4CF9A 4FJ8A 1B9FA 3V9UA 4BDPA 3RB3A 4WFYA 3ZT3A 3S3MA 3BSNA 5J2QB 1WN7A 3L2UA 5EWEA 4G1QA 3TANA 3CFRA 5FDLA 4ZVFA 3GV7B 3NHGA 4XIUA 3DOKA 2D0CA 2R8GA 3HL8A 4FJKA 4ID1A 3L8BA 4ZPAA 2F8EX 4FK4A 2YNFA 4MFBA 3NBPB 2O5DA 1HMVB 3HHKA 4ECSA 4NLGA 5KFWA 5I42A 4J9KA 1SKRA 4KO0B 4F4WA 3NKYA 2G8KA 3KLEA 2CJQA 1LAWA 2C2EA 2D41A 4FS1A 2VWKA 3IGVA 4PY5A 1JX4A 4N76A 1RYSA 3DI6A 4Y1CA 3DRSB 2OH2A 3CFPA 5HLFA 4E3SA 4ED7A 4NLQA 3EYZA 4FS2A 2KTQA 4CEAA 3TAPA 4WYLA 1ZYQA 1U47A 2EC0A 1KHVA 4IRCA 1L3SA 4O3NA 4ZTFA 3OYKA 2ASLA 4AILC 3P1GA 2RKIB 4K4VA 2XO7A 4DLGA 4DTUA 2JEIA 4FK0A 3LP1B 2W9CB 3L2VA 4KFBA 1RCHA 5HRNA 3RMAA 3OYJA 3S3OA 4EEYA 2KFNA 4RU9A 2YKMB 4BE0A 4F4XA 1L3UA 2BRKA 3G6XA 5KT2A 1S48A 2BANB 3FQLA 3QO9A 4LSNA 5KT7A 4DSJA 4TXSA 1S1VB 4YR3A 4FW1A 4ED6A 1TK8A 4KKOB 4CF8A 4F4YA 2JLEA 1LWFA 4MKBA 3AVLA 3KK1A 1N5YA 4IFVA 3AA2A 2Z1IA 4LH4A 1VSEA 3KK3A 5KFOA 1S1XA 4CJSA 3KLEB 2WOMB 4G1QB 2A1SA 5KFZA 2D5RA 2Y1JA 3U6FA 1RT1B 2V9WA 4BWMA 4FJGA 3CO9A 2B6AA 4CJTA 2E6MA 1D9FA 4F50A 2WONB 3ZSZA 3I0SB 3BSOA 3QERA 3GYNA 1QQCA 3V9ZA 1MU2A 1TK0A 3KD5E 1Q9XA 4B9MA 2PYLA 4O0JA 3KK1B 3LP2A 2WK4A 3Q8RB 2DFHA 5D3GA 2QKKA 5F9NA 4NLPA 3DRRB 3V9SA 3OJUA 2IJNA 4GC7A 4ELUA 2HMIB 4IRKA 2VWJA 1GOCA 5L1JA 4NLYA 3ASMA 2IM3A 1EETA 2OPRA 5HBMB 4MIBA 4F3TA 3OYIA 4CEFA 4M45A 4OLBA 4B9UA 3CDWA 5KFYA 4DTNA 4ZPDA 2OA8A 5HRPA 4KSEB 3OL8A 1FXXA 4JRQA 1UA1A 3MEDA 3TAMA 4R5PA 3TARA 1K1QA 2XI2A 4C8KA 4K4YA 2BGGA 4LQ3A 3QGIA 4DS5A 4LY7A 2DY4A 4M94A 1ZBUA 5J2MA 5J1EA 1TKXA 4BWJA 5KTQA 4ELTA 3DYAA 4DEZA 1C2PA 3F73A 2ITGA 4J2AA 1KTQA 3MAQA 1QUVA 4CE9A 3AVAA 3LWLA 2HW3A 3LANA 2RN2A 5SZTA 1JXLA 3SV3A 3TAMB 1D8YA 3G0ZA 2DTUA 2YKNB 2QK9A 3OHAA 2HHWA 3CWJA 4Q8EA 4CJRA 4W5TA 3SPZA 2RDJA 3F9KA 4ECWA 1D9DA 1RT1A 4JV0A 3VQAA 4Q45A 2UVRA 2IOCA 3Q8PB 4C8MA 4FJJA 4DF8A 4TQRA 2B4JA 2ZE2B 1VK0A 1S9GA 3VQSA 4AHRA 2VA3A 1NK0A 3LP2B 2GC8A 3RMBA 1R0AA 2YV0X 4ID5A 4QWBA 2HNZA 3AVMA 3P5JA 1JLFA 3B6PA 3Q8QB 1VSHA 4WFXA 2G8IA 2D3UA 3LP0B 2FVPA 5KFFA 4H4OA 2OZSA 1S6QA 5KFLA 4N56A 1JKHA 3BQ1A 4TY8A 1GOAA 4OLAA 4B9LA 5J2PB 3RB6A 5KG2A 3BJYA 4CGGA 1C1AA 1BI4A 4YFUA 3OYHA 3GV5B 4RW9B 4M3UA 5F8GA 1ITGA 4I2PA 5JS2A 1WSEA 1BQNA 1RDCA 3OLBA 3AO2A 4IQXA 1QSYA 5KFSA 1T7PA 4CERA 3HKWA 3PX0A 2LSNA 1TV6B 4ED0A 1U09A 3AA3A 4CHPA 3GIMA 1S0MA 1TGOA 1RTIB 4EZ6A 3M9OB 3CQ8A 2XHBA 3MTKA 3K58A 4O4GA 4TY9A 1CZ9A 3O4NA 1T3NA 3LWMA 2ATQA 4BE1A 2ILZA 3H2LA 3ZT2A 4KTWA 5EU7A 3NMAA 1RT4B 4PWDA 2FVCA 2A1RA 4ID5B 1HYVA 4J2BA 1CXQA 3DMJB 1BQMB 4ECVA 1S9GB 4DFPA 3FSIA 1SV5B 1NK5A 4CJPA 3G10A 1L3TA 3MEGA 3OS1A 1JLFB 4LD0A 4IH6A 4CJWA 5C24A 3RRHA 1QTMA 4E19A 4EO6A 4CJLA 2E6LA 2RPIA 2R2RA 4ZTJA 1RTHA 4DTOA 3KIOA 2W7OA 2AGOA 3M8QB 4RW4A 3BREA 1S97A 4ZP9A 2KW4A 4CF0A 1BQMA 4HYKA 1TQLA 2BR0A 3CJ3A 4I9QA 3KLVA 1WSFA 3O3FA 1TAQA 4Y2AA 3MF5A 4ECYA 4BDYA 5J1EB 5C25B 4F8RA 4K4ZA 4EBEA 4FJ5A 4Z4IA 4KAIA 3C6TA 4J9MA 4ICLB 4IG0B 1KCFA 4OL8A 1VSDA 2J6TA 4FJ9A 3QYYA 3QESA 1IKYB 4NLDA 2VA2A 2FC0A 4CIGA 4E7IA 3AVKA 4W5QA 3C95A 4F2RA 4E7HA 3O4QA 4QWEA 3PW4A 4FM1A 4O3PA 3ZSVA 2UVWA 4W5RA 3HPOA 1RDAA 2JC1A 3LPTA 4HHTA 1XHZA 1ZTWA 3HXMA 4DWIA 3I8DA 4QAGA 4RW6A 5CYMB 1S1TB 5KFVA 1JLAB 4RW8A 3GIKA 2E4LA 5L1IA 5KGWA 3ZT0A 3IGNA 2X74A 4R8UB 1ASWA 2KFZA 3QZ8A 1UOCA 4M3WA 4ECQA 2DFFA 5C25A 1IKVA 4X2BA 3H40A 4AHVA 3PX4A 3IG1B 3IS9B 2UUTA 4AHUA 4CHNA 5EDWA 1S1TA 1RYRA 3I0SA 5CYQA 2BDPA 4MIAA 3CJ5A 3GIIA 3NAHA 4NYZA 3KHLA 3BQ0A 1HNVA 1QE1A 3CDEA 3OYEA 2O4GA 3AVCA 2P1JA 3DM2B 4FJNA 4J9PA 4DSFA 3PZPA 4CHQA 2KZMA 2FLLA 1HQEA 1TKZA 2WHOA 1T94A 4HUFA 4K4TA 5L1KA 3QZ7A 3PV8A 4H54A 4CEEA 1ZBHA 4H4MA 3QEPA 4ECTA 1WNSA 4BDZA 4PUOB 2IM2A 4ZP6A 1TP7A 4Z4GA 1I3AA 4KV8A 1DLOA 2R2UA 3VQ9A 1CXUA 1L5UA 2IM1A 1NKBA 3HVAA 1TKTB 3UR0A 5KT5A 1RTHB 3AVIA 1HQUA 1S4FA 3O3HA 5KG0A 4CGJA 5KGXA 2OPPB 5KFPA 1DTQA 3V6DB 5I42B 4H4MB 4YR0A 1ZBLA 3OYFA 2WCXA 3K2PA 3MXMA 3KLFA 4CEZA 4JS4A 3RAXA 3LZJA 3DI6B 2J6UA 4ELVA 1RTJA 3VQDA 2FJXA 5C5JA 4FZYA 3T19A 2ASJA 2D0AA 3MR5A 3V81A 3DM2A 3NAIA 3M9MB 4FLYA 3M8QA 5DLGA 3HVRA 1TK5A 4KAZA 4RNMA 1S1VA 3ZSOA 4FK2A 3N6LA 3HPGA 4ECRA 4K4XA 4WXOA 3JSMA 2YNIB 1BGXT 1HRHA 2W8LA 3CDUA 4URGA 2WONA 4CK2A 1LWCA 2OPQA 1RT7B 2IAJB 2DPJA 2WOMA 4ED2A 2HVIA 2XCPA 4TSXA 1NK8A 1RDDA 3AA4A 5F9LA 3S9HA 4I2PB 3QLHA 2E9TA 2FBYA 3QIOA 2HB5A 3TR8A 4GW6A 2XY7A 3PO5A 1DLOB 2D7SA 4E0DA 2FVSA 3QEXA 5KG4A 1TKDA 3TABA 4MK9A 1C1CB 1C0UA 4DG1B 4G3IA 3HSTB 4J9OA 3EPIA 4AHTA 4J9QA 1YVUA 2VG7A 2B6AB 3NF9A 4LQ9A 3SFUA 4NLSA 3LPUA 2B5JA 3KLGB 1WAJA 1NOYA 2P5GA 2W9AA 4DSLA 1LW0B 2HWHA 1JXBA 1SH0A 1HPZB 2YNIA 5KFGA 5KFMA 3KHHA 4CK1A 4EBCA 1RA7A 2G8VA 4I7FB 5D3GB 4H8KA 1C6VA 3PO4A 3AA5X 4O4RA 3SI8A 1KLNA 1X9SA 5KT4A 5KFJA 4CHOA 2XCAA 3THVA 1B92A 4GC6A 1HMVA 2G8WA 1SV5A 2YKNA 3VN5A 4ZMMA 5J2NA 1HYSA 3PUFA 3C6UB 5FROA 5CZ1A 3RBEA 4N5SA 2AX0A 4M3TA 2HNDB 1IKWB 4NYNA 4ZHRA 3WNHA 1RT5B 4PQUB 2ALZA 4RW4B 1LW2A 3M8PA 3ULDA 1TKXB 1WSIA 2C2RA 4WE1B 4FM0A 1S6PA 5L9XA 1TL1A 4GVMA 3PJWA 2AGPA 3QLHB 4CHZA 2HHSA 3ISND 1RTJB 5F8JA 4Z4CA 2UVUA 2PZSA 1FKOA 3V9WA 3CYMA 2F8TA 4YR2A 4YMEA 1FK9B 3P83D 4XPEA 2J6SA 4OPJA 3AVBA 5HROA 2X6NA 1U49A 2BE2A 3QIPA 1JLQB 1HQUB 3KK2A 4M95A 3DLEA 3MFIA 4DL2A 3G86A 3K57A 3OYLA 3RMCA 2VG5A 1HYSB 1TL1B 1F21A 4NYFA 3TVKA 2IBKA 3D28A 4GMJB 1Z4UA 4J9SA 3LALA 4KTZA 1FKOB 2F8SA 4Q43A 3HVWA 3KTQA 3OL6A 4CECA 4OPKA 4RNOA 1K6YA 5KI6A 3KMSA 4E1MA 3ZSXA 2R2SA 3M8RA 1IKVB 3VA3A 1S1WB 1XC9A 5CY4A 1U45A 1RILA 4DQQA 4ZVGA 2V4RA 1T03A 3DLGB 3QEVA 4TY8B 1W9HA 3KHRA 3C6UA 3FFIA 5KFIA 4O44B 2X78A 4RW6B 4C8LA 4EYIB 1VRUA 5HP1B 4CFBA 4WFZA 1Q8IA 1SL2A 4QCLA 3K5OA 3NF7A 3HYFA 4M41A 3DLBA 1U04A 3VQPA 3VQEA 4IR1A 3NFAA 3VA0A 1UWBB 2OPSB 2YHAA 3IG1A 3IS9A 5JXSA 2BANA 3V4IA 3KOAA 2RDIA 3WNFA 1NHUA 5CYMA 2XWYA 2HHTA 5DQHA 3B6OA 3OYDA 1NK7A 4AHSA 1JLGB 1C0TB 3SQ1A 3O3GA 3HO1A 1C1CA 1KLMB 3ITHB 4B9NA 4ZVEA 3KMQA 2WRMA 1UWBA 1VSMA 5HROB 1QE1B 4ECUA 3C6TB 4U6PA 1X9MA 2ZE2A
chains in the Genus database with same CATH superfamily
4CHYA 1YT3A 2JFKA 3OTOJ 4PKIA 1SC4B 5GAGP 3W1YC 4HUGA 4DFJA 2V34A 4ED3A 4LBHA 1UVKA 4CLUA 2W9CA 3K0JA 4OYBA 4RW7A 3I6PA 1FKPA 1GT8A 4M5IA 3QINA 4AQYJ 2Y1IA 1RTDA 4WBFA 4PKHA 3OFHA 4C2MA 3CCJS 4MK8A 4PR6A 4LF5K 2YWEA 2ZNZA 3SV4A 2DD8S 2ATLA 2MB0B 2CH5A 3RRGA 4ANDA 2CFXA 2Z1HA 1NPKA 3I32A 2NXEA 3MUMP 3IWXA 4EIAA 4IDKA 2DEIA 3UW1A 2MKIA 2CPXA 2P9KA 1GLBG 3N0VA 5E3AA 4OJ3A 4GV3A 3SUPA 1NJIO 5FPNA 2OPPA 5KOWA 3BSAA 4LFAF 4H4KC 4L6V3 3RB0A 4FBUA 1RT6A 1LOTB 3OSPA 2HIQA 1BLUA 2DB1A 1YK9A 1HARA 3CI5A 3QRPA 4A8KA 2DNRA 1CJTB 1VQ4S 4DR6F 2OPRB 4EP4A 4RX6A 2XZWA 2XLKA 3S1TA 3PFEA 4M5MA 1RHQB 1HNWJ 5EX3A 4GO7X 4TU9A 1CZBA 4Y65A 5JLHA 2XMVA 3CF5Q 3QT7A 4RTFD 4V19S 1GLJO 3EZWA 3T1HF 2J76E 4HDHA 5KFAA 3D6TB 2ZM6F 1YWXA 1S1WA 2HG4A 3GCXP 2B56A 1VK8A 1Q81O 3MR2A 1JLGA 3JXOA 2CNKB 3HZ6A 1IBLF 3M05A 1XNRF 3VENA 3N28A 5F8HA 5SWMA 4P73A 5D4NA 3VAHA 1LAVA 3QO9B 1TTHB 3QBXA 4K4SA 3BH7B 1YG0A 1JJ4A 1N5VA 1LK5A 2A2CA 2BQRA 3CIZA 1KOHA 1IR2A 5CHCB 3CUNA 4BGBA 1VQYA 2OYQA 3QT5A 2A3JA 2GTDA 4JI6K 2WVCA 5D78A 2HFZA 5DLFA 3G4SN 1U25A 2UXBF 3OXLA 2DFEA 2VCPA 5CXTA 3ZETB 1BO5O 3Q8UA 4DQ8A 1WSJA 3B4DA 2YHXA 4CEQA 4R79A 3MAAA 4JI0F 5B08A 2XY6A 5KFDA 1V4SA 2NSCA 3PYFA 3EVWA 2ZQBA 1JLCA 3OL9A 4CF2A 3U8XA 4JI0J 3FZ2A 3LAKA 4KGZB 4KR0B 1VSFA 3GILA 4ETXA 4OX6A 2ABYA 1LWCB 1ASVA 2IJRA 1VRTA 3P4UB 1LNQA 2ZKTA 1CLFA 5JJBA 4CESA 2VDIA 4BR0A 1D8ZA 4E7LA 5KG6A 4C3MA 2HWIA 2EG2A 1U48A 1NGEA 3WQTA 3THXA 3G8SA 1LFPA 2QEXS 4GKJK 3EN9A 5HLFB 2FJBB 4I6AA 2HVEA 3ZETA 3M30B 1XMQF 3SUNA 3DLKB 4CWBA 2CQ0A 5HO4A 2WBNA 2VBWA 4LT6A 3E01B 3PR5B 3FZHA 3U4LA 4K4UA 2BYCA 4CGHA 5GAEU 4FXVA 1RABB 3H5UA 4X66J 3NGZA 3ZO7A 3NDKA 3Q23A 4FL9A 1Q53A 1IKXB 1QD1A 3BO4A 3SPYA 4BRIA 2GQQA 4QWAA 2D3OR 4CIOA 3E51A 2JC0A 3J7YP 3T1YK 3CJSA 2WB4A 1UFKA 3GMGA 3AVHA 2GX9A 3ZSRA 2JVOA 1M5VC 4ZDNA 1RAJA 1PAUB 4JHDB 2FHMA 3MEEA 3VAMA 5CE3A 5EOYA 4H4OB 4Q0BB 1N36J 4M63A 2DVIA 4HCCA 4KB7A 3MMAA 3CPWM 3J7ZO 1NM2A 3FQKA 4I6MB 5DM7Q 2R7WA 4OZ0A 4FDFA 5BYSA 1DEJA 1MMDA 3QT6A 1JIHA 4YB5A 2ZD1B 1JJHA 4B3RJ 1RZMA 4O5BA 1X5TA 3PVXA 1B7FA 1LV5A 2YNGB 3OVBA 3JYTA 4CJFA 2CQ2A 1WWHA 1MWYA 4DTPA 4M5KA 3AO5A 3IRWP 3FVYA 3LH2S 1NPRA 3N6MA 1T9XA 2APOA 4KHMA 3FBFA 4DB3A 3TW0A 3MM8A 2JDJA 4RNFA 1VQOS 4UQTA 4DKWA 1XWLA 3RUBL 4DUYK 2LECA 5EN1A 2XHWA 2F4FA 4KB0A 1IVZA 2P5OA 3GG0A 4BACA 2O66A 1SJQA 3L3UA 3BYRA 4IR9A 4CZGA 3EUNA 3GWCA 4IDKB 3OS2A 2KZZA 2AKWB 5C7PA 5L9NA 3GLJA 1NG9A 2N82B 2YX4A 4I68A 3W9HA 3A8EA 5AQNA 2W6LA 4I69A 2IJFA 4YOXA 1JLCB 3R97A 1S9EB 4IKFA 1S99A 3NWRA 4BROA 5LMNK 1TKTA 5AE1A 4V1Ak 2Z1JA 1R8CA 2LDYA 4ZCMA 5EWFA 4KHRA 4DV3J 1RDBA 2DR7A 4RBTA 2QLFB 3DLLQ 2YNHA 3QB0A 2F1FA 2FJVA 4L76A 4DV5J 3VQ4A 4FYYB 3MUTP 3U3GA 3PHEA 1X4GA 4DJBA 4IUFA 3WIUA 2LU2A 2HNDA 2DHAA 3MN7A 4ILJA 2M88A 4OQJA 4N8NA 1AZSB 1ICEB 1EO1A 3JTPA 2YKOA 4G1PA 2EX3A 4ZJOA 5IT9O 2GMLA 4LR8A 3SYZA 1UJ5A 4NLOA 3TA1A 4DR1J 3HLUA 3NS6A 5KG5A 3QNNA 2NRZA 1J5OB 4I0WA 2KVQE 3SZ2A 2PA8D 2CH6A 2QJ3A 3AAPA 5AE3A 2ZM6K 1KKHA 2ASYA 2IRYA 4UY8O 2PC6A 4WTYA 5L1LA 3B78A 3GP9A 2NNWA 1RDUA 2P9SA 1JKHB 1E4FT 2PFUA 2E1YA 5E33A 5GMKa 4Q0BA 4B3MJ 3L7UA 2R7XA 1QTNB 1WBBA 5FIIA 3VF2A 2R7TA 2QLWA 2CQHA 4DHVA 1WF0A 2DHGA 4EUVA 3DOMA 4GVBA 4MH8A 4E7KA 3CVKA 2QWRA 2CDQA 3NGIA 1MG7A 4FP9A 2BXJA 1Z25A 5HL7Q 3V1QA 2ZKUA 4U7BA 3WNEA 2HAIA 3ENAA 5EX0A 3OBIA 3TTFA 3L2QA 4NI2A 2HVZA 2ZZNA 2DEJA 3CGIA 2BRLA 3F2KA 1AW0A 1ATSA 1X0PA 1VHXA 4K8ZA 2L9NA 1D0EA 1BUXA 5I3UA 3N79A 3KZBA 2WW8A 4DR2J 2I5JB 3EKSA 5IWAF 2RS2A 2QMXA 4QWDA 4H0PA 3WDOA 3MDQA 2FC9A 2ZWPA 3LO3A 1HBMA 1WTFA 3TSPA 1P90A 1T03B 1XNRJ 1FE0A 1O13A 2QEXN 3CPEA 1RKIA 1N0VC 3CCUS 1MU2B 1TVRB 4CYUB 3M8PB 4WZQA 3DDNA 3ZSYA 5GADU 2M7SA 2V4QA 2QA2A 1WSHA 5KT3A 5FLXO 5J2QA 3DRRA 1FTRA 1NHVA 3NH2A 4CLLA 4FPIA 1FFGB 2MGZA 2KM8C 3IMQJ 4FBTA 2I5JA 4IKAA 1PYOB 4ZA1A 3MOJB 1WF1A 2IGIA 4YB6A 1SVDA 3TAQA 3HMJG 3IN5A 1A6LA 2RQ4A 4ISGA 3B8HA 5AR0A 1EXQA 3I5BA 5KFNA 1TV6A 4ZPBA 3FZBA 1HR0J 3G6EN 3VTHA 2B8QA 1VQ8N 2B7BB 1C1BA 1N5QA 2CGJA 1RAIB 2E5IA 3VQBA 4W5NA 2P51A 3ZYYX 2RD5C 3BY5A 3NH0A 1UAXA 4G6VB 2N3OA 4LFAJ 2Q1NA 1RHKB 4YN3B 3MR6A 2IA6A 3LM9A 2OEKA 4RUBA 1P9QC 3DXSX 2DRBA 3QEWA 4CF1A 5DDOC 1QSSA 1EKEA 3NH1A 3BEGB 1H72C 1PJ6A 1FJGJ 4BQLA 2P9EA 2DY9A 1UEKA 3D2WA 1NGCA 3CM5A 3PXGa 5D4PA 3P38A 3EGZA 1N8RO 2X7IA 3H2UB 1NNEA 2Z2MA 3VEZA 5CYJA 5FLXY 2VOOA 1Y3KA 2DY1A 1IG9A 3VV2B 2BVZA 1QUPA 2DISA 2JJ4D 2M3DA 4C1NK 2XQCA 2VG6B 5D0RA 2R8KA 3DLRA 1V9OA 1JCEA 4KB1A 3K8VA 4ZPCA 1EAYC 4JI1K 2KRRA 1T02A 4K8RA 2NQPA 4J9NA 3GJTB 2YX6A 3VQ5A 2DHSA 2NZ4A 1R6YA 3AD9C 2DR6A 1XBWA 4X65F 2HHUA 3C6AA 4X4QA 5KPTA 1HNXK 1UPMB 1I39A 5M1KA 3K17A 1C4CA 3OYCA 1FDBA 4IBNA 1AT1B 3DLHA 4WKYA 3DOKB 4J9RA 3QRRA 3M5RA 1NJZA 1NKEA 2CRLA 1KSPA 3AOCA 3F56A 4MFBB 5DETA 4NCGA 2MKCA 3R5GA 5KFHA 2ZJPL 1JXEA 4RCHA 4CEDA 4EAHD 4LF6F 4QPTA 2R7UA 3ZTQA 1REVA 4DHYA 4IYQA 5ETSA 4WXWA 2IC3B 3KNAA 4PWDB 4OVLA 4NCBA 3MR3A 1BC6A 3L0QA 1CQNA 2FJAB 3NVMA 1OY8A 4CD1A 1XK8A 1TUUA 3EPGA 3CD7A 4CZHA 5AXKA 2CJKA 1VSIA 2GZOA 3V4MA 2R7OA 4LH5A 2ATCB 1HBUB 5HL7L 2F9TA 1J9AA 4X62J 2VG7B 1U8WA 4MT1A 3LGNA 4KGXB 2AU0A 3HVTA 4NXMF 3WEEA 2OO4A 3KHGA 4FJ7A 4DV3K 2AWZA 1I1GA 2OPSA 2I9SA 4B9QA 1WOQA 2DGTA 4FO0A 2YKMA 4CFCA 3NBPA 5IQQA 3GJRB 1T44A 4LF8K 1NPPA 3CCQS 4KGVB 2W2MP 3EZ5A 2JEJA 4BREA 3KWMA 3NGSA 2AEFA 2Q3PA 4IRDA 1ATNA 4X84A 4V19X 3J7ZT 3MM5B 1UVMA 5LOQA 3IRXB 2AA4A 3E01A 3VQ8A 2CPEA 4JKAA 4CZEA 4OYXA 3AVNA 4JKHA 5FRNA 4FYXB 4FN5A 4OI0A 3JSRA 5LM7E 2W2QP 2O8DB 1X8DA 3PCOB 3QSYB 1S76D 1VQKN 5G0RA 3PX6A 3LP1A 1TUWA 3D0PA 1LW2B 5E3PA 3OSNA 5AQJA 3D1HA 2R3VA 3NGUA 4M3XA 2MTLA 4OX9K 3H0PA 3CMES 4Y0WA 2KHDA 4Y34A 3FC9A 1U1PA 4CYUA 3J81U 2IS3A 1JNZB 1DQ8A 2UXDK 3MN6A 3I5CA 4A8YA 4IO8A 3WXIA 2VPXB 2KG1A 2HFSA 4NEYA 2RHQB 4M5JA 4Q44A 5IT9U 1B9FA 3V9UA 2V2QA 1B0TA 1WN7A 5EWEA 3CFRA 3NHGA 1YZ7A 5HQLA 2I2YA 3DOKA 2D0CA 3PSIA 1ZA2B 1WG4A 1HHQA 1SPBP 1SQKA 3L8BA 4FK4A 2YNFA 1QVFR 3LF0A 1HMVB 4J9KA 1SKRA 4JI4K 3NGTA 2CJQA 2VHGA 2YKAA 2VWKA 3IGVA 2X1BA 2UXDF 4PY5A 3MM8B 1RYSA 4L3NA 1MWZA 4KGMA 3PLAA 4ZLJA 2HPUA 1SQGA 3TAPA 2G2ZA 1Y11A 2QT7A 1RGVA 1KHVA 3N9UC 1L3SA 2OHDA 1OWXA 2FIUA 3HSDA 2ZITA 2ASLA 4AILC 4AL7A 3K89A 2XO7A 3VHQA 3IKMA 4DTUA 3MMAB 2HFUA 3L2VA 5HRNA 2UXCF 3R7NB 5DZ7A 2B9YA 4BE0A 4C97A 2HBZB 1L3UA 5KT2A 2QX0A 2VZ9A 2DNYA 4DSJA 1N36K 1S1VB 4FW1A 4ED6A 4F4YA 2JLEA 1F60B 2YBVA 1VDHA 2LEAA 3CJAA 1GMVA 4IFVA 1OVYA 5KFOA 3WEEB 3BO3A 3BV8A 4G1QB 2Y1JA 2FGOA 1WUUA 3CC4S 3U6FA 1XN9A 3POTA 4FJGA 3G82A 3SSQA 4EK2A 4F0HA 3I0SB 3BSOA 4AM7A 4NXMK 1Q9XA 1VOMA 4C0BA 2HBYB 4B9MA 5H1SV 1FWPA 3MPDA 4O0JA 3SBTA 4YS2A 1FNMA 5LMUJ 5D3GA 4NLPA 3KG0A 3KXDA 2EFNA 4OZNA 3CCVS 2HMIB 1EKSA 4DCPB 4WCEQ 3DJCA 2IM3A 1KN6A 3D4JA 3OYIA 2ZH8A 4JI8J 2U2FA 4B9UA 3VZIA 2RQCA 4CZFA 2HS3A 1O51A 3MM9B 4CLZA 4BR2A 4WFBQ 1K1QA 3THYB 1GLLO 2KH9A 2A40A 3DRXA 1HBOA 1Z1ZA 4FOIA 4M94A 2GWJA 4H0VB 4CVNE 1SQFA 1VHIA 1TKXA 5KTQA 1Y9OA 3DYAA 1NLVA 4QIFA 1C2PA 1KXPA 1KTQA 1DRZA 3NWGA 3VGSA 4R0JA 1ZH5A 3AD7C 3FRYA 3TAMB 1FJCA 4OI4A 4F0MA 1EIYB 1NH8A 4W5TA 1WTBA 4OHXA 4WFBL 3F9KA 4ECWA 1U6BA 1I51B 3D2EB 4XEIA 2UVRA 2IOCA 3S8SA 1RISA 4C8MA 4DUTA 4TQRA 2QA1A 2RAQA 1VK0A 3LW5C 3CJRA 4IOCL 3FEXB 1T9YA 1GH8A 1DHMA 3ETMA 2YV0X 4ID5A 3AVMA 5K8NA 4JI7J 3MMBB 3B6PA 3HI0A 2GELA 2G8IA 2CJ9A 3LP0B 3SAGA 2F8HA 4LF9J 2F4VF 2LP4A 2FVPA 2DNGA 2QZ8A 2A41A 2V68A 1S6QA 4WJBA 3GL1A 1JKHA 3BQ1A 4A2AA 4TY8A 1GOAA 4IO1A 3RB6A 2FQQB 3I55N 1IUJA 2HWTA 4CGGA 1C1AA 1OVQA 3CXCR 1V5VA 2VFTA 2N4DA 1YKWA 2KDOA 2XULA 4M3UA 2ZBCA 5F8GA 2KT3A 2NCKL 1VBXA 2P6TA 2UU9J 2HS0A 3AO2A 4H0TB 1T7PA 4CERA 2EBGA 4FVUA 2O8BA 3LM2A 4PABA 4LF7F 3AA3A 4CHPA 3Q89A 3MXHP 3GIMA 2AJ1A 1RTIB 2CPFA 2NXCA 3UDCA 3M9OB 2DHXA 4EZ6A 3MMBA 1WHXA 4YHHJ 3MTKA 4ZJQA 1VQPS 4HDGA 3O4NA 3LWMA 2ATQA 1JCFA 4K5RA 4B3TK 3GR1A 1EHWA 2QLBB 3H2LA 3FCVA 4H5TA 4HLBA 2UUCJ 2VV5A 5ELZA 2BMBA 2ZBPA 2A1RA 5A8KB 2M4MA 1CXQA 3DMJB 3W2VA 1HKBA 4N8OA 3AFGA 4DFPA 1NK5A 3FSIA 3M2RB 6AT1B 3D6MB 1L3TA 3OS1A 4F3QA 5HQMA 4USKA 2E5LK 4LD0A 5C24A 3RRHA 3QJPA 3TZZA 2BABA 4CLSA 4DTOA 4J5OA 4JYAK 1WKKA 3M8QB 3I87A 4RW4A 1UW4A 2Z4PA 3SQOP 3FK4A 1S4EA 5TKYA 3MDFA 1BQMA 2BR0A 3Q8VA 2RIJA 3CJ3A 4DV7F 2AD9A 1VBZA 3FBCA 4NYPA 3KLVA 3O3FA 4JI2J 2BOPA 1QQMA 3QPIA 4LVNP 4HWIA 5AJ3J 3NP5A 3ZNUA 1UW9A 5B7WA 2C1EB 4KAIA 4J9MA 2ZOMA 3I4HX 5ETTA 3ULHA 4X4TA 4OL8A 1VSDA 2J6TA 1IKYB 4W5QA 3O4QA 4QWEA 3JQJA 3D1OA 3AY0A 4O3PA 4W5RA 1NGDA 1CG2A 2JC1A 1HIYA 4LFBJ 2P5VA 5LMNJ 1K0TA 3N4QA 1PYTA 1HNZF 4RW8A 1VQNS 4UF4A 4ZIWA 5KGWA 3ZT0A 3IGNA 3JB9k 2Q36A 3N5FA 3VALA 3R6LB 4YORA 4BR4A 1YGYA 4DL0C 3UCGA 2DFFA 5B0FA 2MGZB 2AYGA 2QM1A 2UV8A 1IBMF 4AHVA 3PX4A 1LOUA 3H7HB 4J37A 3IG1B 3M2VA 3UN5A 3KJNB 3C6HA 3VZHA 2ALYB 1RADB 3L3CA 3KHLA 1I94J 3BQ0A 4DR6K 2O4GA 2P1JA 3DM2B 3ENHA 4WTOB 4J9PA 1U2VA 3CIPA 4XH4A 4DSFA 4CHQA 1HQEA 1CJTA 1TUGB 3C16B 3CJQA 2D0PA 3FGVA 1TU0B 1RWVB 3PV8A 1IR1A 4H54A 4CLTA 1ZBHA 3TUIC 4BR7A 3QEPA 4ECTA 4BDZA 1FD8A 2IM2A 2QA4N 5EY4A 1I3AA 2BM1A 1KR4A 2R2UA 3IBFB 3DHWC 4I6YA 1K8AT 1IN0A 1RTHB 3AVIA 2VBYA 1HQUA 1S4FA 4ZCLA 4PXEA 3KDOA 1D3WA 2OPPB 3NEKA 1GK8A 1URRA 3PKYA 1FNXH 4DR4F 4YR0A 1ZM9A 3OYFA 3TWZA 1RWPB 3JSBA 3LZJA 5ETQA 3WHIA 2IDLA 4KH0B 3VQDA 2FJXA 1O6XA 4FZYA 3T19A 5F0UA 2YPZA 1FKAF 2D0AA 3MR5A 3DM2A 2YQ3A 3NAIA 5HQ8A 3M9MB 3HX9A 1X9JA 1ZOTA 3CULA 3HSJA 3P5TL 4ECRA 3IBWA 3DXKB 4WXOA 4X66K 1NGAA 2YVSA 2BJEA 2IY5B 1O8BA 4C7QA 5T7LA 1VQ4N 2OPQA 1Y7PA 1W97L 1VBYA 2XCPA 1NK8A 3CCLN 3QLHA 2E9TA 2CG4A 1SIZA 1R0CB 2K3IA 2KM8B 1NGIA 4GW6A 4OYIA 1LEOA 2XMTA 2XY7A 3O80A 2EKYA 4CJ7A 1DLOB 2D7SA 3QEXA 1NMEB 5KG4A 2NXJA 4DG1B 3RU0A 3HSTB 4FWMA 4QYRA 4CO5A 4J9OA 2WC9A 3EPIA 2DXFA 2G1HA 2Q66A 3NF9A 2PEHA 3SFUA 1NGHA 2B5JA 3R1XA 2OP5A 1VQ9N 2W9AA 1FT8A 3DXKA 3N01A 5EX5A 3T1HK 1SH0A 2D1CA 3CIMA 1FF2A 3ID8A 2G8VA 1WOSA 4OHYA 5D3GB 4LRFA 5JVHQ 2NLWA 2E1ZA 2GCFA 3VTIA 3CCJN 3ZTRA 3OVAA 5D15A 1X9SA 2ZH2A 5DM6Q 1WC6A 2I8EA 4A8OA 4CHOA 1BWEA 4DR5J 1WI8A 1HMVA 1S12A 3VN5A 2GNKA 4CO1A 3THPA 3OTOF 1NZAA 5AXNA 4LSZB 3RBEA 1FX4A 4RWTA 4NYNA 4ZPTR 3JQKA 2E1PA 3ILLA 3WNHA 2MQOA 4CH0S 4RW4B 4WP3A 1JB0C 3G9CA 4WFAQ 1TKXB 1J2VA 1XNQK 4WE1B 3U27A 3AA8A 1MA9B 2BJ1A 3PJWA 5AQWA 1TMMA 2XNQA 3M30A 1HX1A 2QC3A 1Q0NA 4YR2A 2ZF5O 3AVBA 5AZIB 4PWWA 4ZVPB 2FB0A 1DAXA 4RUHA 4BC4A 4DV0F 2VF3A 2OTJN 1HQUB 4J9UE 5TKWA 3J8AA 3OYLA 3A12A 1Q8LA 2EK6A 1TL1B 1VQ9S 1F21A 4NYFA 3QMQA 3NGKA 2ZOGA 2XYGB 3VMFB 3QFWA 3LALA 3TUZC 1XIQA 4Q43A 2GWKA 3KTQA 2LCWA 4CECA 3BPSP 1KTVA 3QQCD 5KI6A 4YHHK 3EDQB 4TLQA 3IFRA 3M8RA 2A18A 3VA3A 4Z7YA 4M5HA 1UWAA 1KNZA 3L7PA 2DYAA 2UP1A 5AQGA 2V4RA 3BBCA 5F1XA 3QEVA 4P72A 4TY8B 4DR2K 3C6UA 5KFIA 4O44B 2PI5A 1BXNA 4QCLA 4ISEA 3FSYA 3I9ZA 3HYFA 3ENWA 4P2XA 5MLCQ 4U7UD 3VA0A 3CXCM 1UWBB 3A0IX 3IG1A 4USVA 4FVCA 3W5XA 3WNFA 2XWYA 1BQXA 4ZN1A 3U02A 1OPIA 4CLYA 2F63A 1VC0A 3SQ1A 2YQ1A 3HO1A 3ITHB 2W4DA 4B9NA 2MLXA 3UE2A 1QLNA 1QE1B 4ECUA 2VJUA 3C6TB 4O8KA 4U6PA 1Y5NB 5AQXA 4JI6J 2NS1B 2AZ1A 2ZE2A 3H42A 3C8YA 2Z30B 4O44A 1RBVA 4I2QA 5ETVA 4WZMA 4MLEA 1M1KO 3NF6A 2XEXA 3U1NA 1ZBSA 1NGBA 1VI7A 2HZVA 2C2DA 3ZZRA 4XPCA 4PXDA 2V51B 4RNNA 4DR3F 5AQRA 4OPHA 1TKZB 2QW9A 5C24B 2YWKA 1X5OA 4ED4A 1S6OA 3U9ZA 5A2QO 4B9SA 4DV4J 4JI7K 1H73A 1DTQB 2QMUB 5A6WA 2F3JA 2LA4A 3V81B 4IFYB 3EKUA 1TUYA 1RBOB 3OYGA 1GXTA 1DQAA 4Q2LA 4A2BA 2C3YA 4YOWA 5KFXA 3CQXA 1N5TA 1KQGB 4URQU 3SEOA 1MSWD 3HRGA 5GINA 3V6DA 3GU0A 3PR4A 2RUSA 2YKPA 2ZBQA 2DPIA 3CCQN 1QY7A 2HNYB 3LAMA 5KRSA 4ERDA 2DGQA 2W4PA 1FRMA 2BQUA 2I1RA 2RILA 3UDEA 2GIFA 1DTTB 3KKRA 3CMAS 3KLGA 5KFEA 1YJ7A 4FCYA 4NLXA 1HI1A 1GMWA 2GV1A 2PBDA 3BGRA 5CR4A 3CCEN 3NMUA 1OQ6A 5GMEA 1D5AA 4U96A 4LREA 2XTJP 1Q9YA 4GKKK 2A6OA 1K47A 2B51A 4OYAA 4EFHA 3CHWA 4HHHA 3U1MA 1QAIA 4CEOA 1EX8A 4FPRA 1LQ9A 2V50A 4DR7K 5DM6L 4JI4J 1BG3A 4CO4A 1T05A 4X64F 1Q78A 3G96A 1QVGM 2XB2D 1HKCA 1R0AB 4QR2A 2CYYA 1DFDA 3S01A 1XEZA 4ZOSA 2EFQA 3AAQA 5FPMA 1X9WA 2UUAF 4IG0A 1FD2A 3TI0A 2P6SA 2D4WA 4RU2A 4DPUA 2MZTA 3J7AN 5GMDA 2QXLA 2NZCA 4XK8C 3V6KA 2G9OA 3FRZA 2YX7A 3WXKA 2NPIA 3A2FA 3VESA 1L3KA 3SUQA 3SLCA 1VQKS 3BGRB 4XDDA 1N48A 5CQGA 3T41A 2QA4G 5AXLA 4DU1A 1NDCA 3A8JA 2RF2A 2D0OA 2GAGC 3Q7BA 3HOSA 1P8ZA 2DGWA 4E98A 2UYTA 2ERRA 3T3FA 1YJ9N 2ILYA 5IQ6A 4GKKF 3CMEN 2OFGX 2JGUA 4RBVA 5B0DA 3E9LA 1JQGA 3HK2A 1FKPB 4B8CA 1TVRA 3VEWA 3PEHA 3KK2B 2SXLA 3J80Y 3BKTA 3ELHA 4ILMA 4JKGB 4NMXA 4M42A 2E5LF 4FOEA 2V7YA 4BG9A 2NRXA 4KHYA 1HPZA 3UQSA 2BW2A 1JJ2M 1XNQJ 1RT2B 2DHHA 3SDEA 1FEEA 3UPFA 1NK4A 3VGLA 1TL3B 4K50A 5GAHU 1K8KA 2E8AA 1RT3A 2EI5A 2EVZA 2VDHA 5A8KA 4O0NA 3DHXA 2FBXA 2RE1A 1A5XA 3SMPA 4F4AA 2BE9B 1CJVB 2HHQA 3DFEA 2XBPA 4WKRA 4V19J 2KRBA 4RUCA 4QS7A 3H46O 2P9CA 1WNEA 4OI6A 1VS3A 3H6EA 4WK3A 3HPHA 4KIAA 2UUWA 4Z4EA 3SJJA 1VQ8S 2FSNA 3I8BA 1VK3A 2VKRA 4LF4K 3MCAB 1HR0K 2UXDJ 3SJHA 3VQ7A 1RDWX 4ETZA 2KQ2A 2O3DA 4K8XA 1NSQA 1KLMA 4CJQA 4XO0A 4B3OA 2H54B 3GTYX 4X62F 4EBDA 5LMUK 3PIOQ 1NWKA 2W2OP 2O67A 3AVGA 1RBRA 4C8OA 1BHNA 2VQFF 2ZH9A 3CW2C 3RJMB 3O9QA 3C19A 5ETMA 3NF8A 4DPYA 3M8YA 4NCGB 1YLXA 3NVKA 2FVQA 1IKYA 4TQSA 3B4MA 4GNIA 1YJWN 2MSSA 3TX0A 4H0YB 2BX6A 4YOVA 2W2NP 1U2VB 2QKBA 3TJ9A 1XI1A 4YHHF 4RG8A 4P74A 1WC4A 2ASMA 2FZGB 2DITA 3V1OA 2HQDA 3EEQA 3SQ4A 2MQQA 3MN5A 1U1RA 1RB0A 1X5PA 4DFKA 4ILHA 1JK9B 4DMNA 2EHGA 1IH7A 2E1AA 3ALYA 2G13A 2IM0A 2OPQB 2MZRA 4ALZA 2J9EA 3G8TA 1W2BM 3UCZP 4LBIA 3L4BC 2W25A 1H74A 4KRFA 2POKA 2WTFA 4QW9A 1TL7B 2F65A 2BJ9A 2DIUA 1KQFB 1YTUA 1WOPA 1PIEA 1UPPA 3UIQA 1HL6A 2B43A 3IAYA 1WI6A 5MAOA 1WLJA 5KPZA 2AZ3A 4QW8A 5IT4A 4DSIA 4W92B 3V9XA 5AQLA 2FVRA 3EXCX 2YHBA 3MMVA 3VF4A 3DDKA 1WEYA 4TYBA 1R6VA 4JK7A 4BS2A 1U0SA 2NRWA 4M1KA 3RTVA 3SMZA 4DXLA 2M8DB 3SXLA 1HJRA 2ADBA 1N32K 4FNIA 1FJGF 2IHR1 4OI3A 3SI6A 4OI2A 3TUJC 4CLPA 1NSPA 3ISZA 2XYHB 2G2YA 5A8WA 1FJ7A 3S3NA 3W62A 4FJLA 1KAXA 1KOOA 1P27B 1NLKL 4FWNA 4FZZA 2PE8A 1O1WA 3HFKA 4X64K 4RZRA 3O08A 5B8HA 3IA0A 1JL2A 3W5YA 5DG8A 4AH9A 2D3ZA 1VIOA 5FD1A 5AQKA 5EHHA 1VYAA 2CPYA 3R7BB 1ZM4A 4XH5A 3VAKA 4DL5A 3GDQA 4UUWA 1OJ4A 4ED5A 3VR1A 4H0XB 2C3OA 1N33K 3MPYA 4ZVRB 2FBTA 4CQ1A 3PW0A 1YBUA 4JYAJ 4DTRA 1W7AA 1KVCA 5KFBA 1Q8KA 3PJXA 1YJ9S 5H9FK 2EFOA 3H4BA 2VH7A 5KG3A 5M1QA 4DSKA 1EP4A 1HKAA 4IH5A 5AQZA 2QSWA 3UI3A 5KAKA 4IEIA 3LGHA 1HNWK 4Z2XA 3R6GB 2CJYB 3OHRA 3I4PA 1Y64A 3DRPA 1YAGA 4TNOA 3C94A 5C10A 1KHWA 4PZVA 4U7CA 1WACA 3PIPQ 3BM7A 3QFHA 2E7WA 2W8KA 3ATVA 1VJWA 4TKTA 1OY9A 3D2FB 3T5JA 1S49A 3J7YU 5CZ2A 1YF5L 3LGMA 4F36A 2HFOA 4OJGA 4KHSA 3PFOA 4HCBA 4IFVB 1SAZA 2VIHA 3T1AA 5ADXA 4FYDA 2Q3SA 3EE9A 2BZ2A 2VBZA 4FF2A 3D3BJ 3M8WA 1RTDB 1JMTA 4R25A 3D66A 2CPJA 2GA7A 3BKUA 3A5NC 3VQTA 1YJNN 3ZNJ1 1YXQA 5FRMA 4LF1A 4EMDA 4F3OA 1BE4A 1UL3A 3DGPB 2FUG9 3KLHA 3H90A 2DJWA 4KBIA 3JXUA 1X4FA 3UNYA 2VQEJ 2IBOA 3K59A 3HDSA 3KG1A 5G0RB 1MWKA 5KFCA 1T6CA 3OVSA 4KHNA 5JVHL 4CEBA 2ZD1A 4JAXA 5IZHA 2ASDA 3DLJA 2ZH6A 2HHVA 1D1UA 2UUBJ 2H51B 3L95X 3TU5A 4H5WA 3DN9A 1BCMA 3X3UA 4LSNB 1DQ9A 1H2TZ 1SIWB 3NE6A 3CT9A 3CMQA 3HHLA 2HF3A 3OFFA 3AXKA 3M3ZA 1AUDA 1DURA 1LK7A 1U02A 1Y3JA 2RRNA 2OELA 3QICA 4DQSA 3D3CJ 1LW0A 4JLHA 3J81Y 4MJKA 4X4SA 4O0IA 3LDSA 3RR7A 2YNFB 3MTJA 2GAHC 4UTGA 2QA4S 3VPZA 1S9EA 1W2IA 4OYOA 3MM7A 3MCSA 3RYLA 3RMDA 3RWUA 4MK7A 3CCLS 3MEEB 2ROEA 1C0GA 1SC3B 1C0MA 1W0HA 1ZPWX 1JLBB 2AMCB 4IFYA 4UW2A 3MM6A 3HSZA 2HHHF 4U67Q 4CJ4A 5LY3A 1VQ6N 3DOLB 1V4TA 3D0HE 1VJQA 2DGVA 4WYWA 2OD6A 1N34K 3DMJA 1VSLA 2R9LA 4OX9F 3AO3A 3SAFA 5F8IA 2MMYA 1IO2A 3H1QA 2HMIA 4OI1A 3K5NA 1IQTA 2N7YA 4WU3A 5AJ3K 4FNHA 4OKEA 1N56A 3D6HB 5HJXA 2B4VA 1SBRA 1MMLA 3IWNC 1YX2A 5LJ3Y 4U95A 4CI0B 3KNGA 4MQ3A 4C98A 4C8ZA 4PEOA 4C0HA 4X4NA 3G82B 3QRQA 4OX8A 4FXDA 3CDAA 4Y6IA 4LIRA 3TAEA 2E5LJ 4B3OB 2DNMA 1JLBA 3MEGB 1I6JA 3CJ8A 4ZVUB 4BRDA 2HNZB 4C8NA 5IWAJ 5M1PA 1QAYA 2OMLA 3LDNA 3AVJA 3V6HA 5M1FA 1J54A 4QYZK 1RU1A 5F2RA 4KV8B 1HD0A 1SKUB 2VBXA 5K14B 1VRQC 1F2GA 4DV3F 4AF1A 3CC2S 2OZMA 3T5HA 4CTAA 4H0OA 3P6YC 2DNOA 2IFXA 2V69A 1O5JA 1VRUB 3QAUA 3OVNA 3CJ2A 2R8JA 1T9TA 4CFDA 2Q1LA 2YHWA 5F41A 5BPNA 3OL7A 3SAHA 2MQPA 3WNGA 2HRUA 3HM9A 2ADCA 4CBWA 1RT7A 3A8IA 3ID6A 4FLWA 4DS4A 3LP0A 4J2EA 3CCVN 3L3VA 3TYTA 1CJUA 1B9DA 4I6WA 3D68A 3GFYA 3N6NA 1MWMA 3NS7B 2LQ8A 1FE4A 5A6PA 8ATCB 2KVIA 3O4WA 1KQSM 2H3EB 3WX4A 3KLIA 3VGVA 3WXJA 8AT1B 1WKJA 4FJHA 3DXBA 2ZJQL 4DTSA 4LRBA 2V63A 3BB5A 4UOHA 1P8GA 3GIJA 1ZC6A 1RT5A 1HNXJ 1EX4A 1S79A 4F02A 3FDSA 5CYQB 3ZZPA 1S0NA 3O8MA 3EZUA 2R7RA 1RT4A 3M9NB 3WC0A 4CF9A 2FY1A 4FJ8A 3RB3A 4WFYA 4FWRA 1YUWA 1AB8A 5J2QB 3TANA 3CMAN 1IBMK 1HWKA 5D4LA 4BRGA 4KHPK 4FJKA 4RWXA 2QFJA 2FHJA 3R5AA 4LBPA 4ZPAA 1BUPA 2HOEA 2F8EX 4HH1A 1K8KB 3A5OC 4MFBA 1UZHA 1NZ8A 3NCPA 5KFWA 1P9YA 4KO0B 1TMJA 4USUA 3K2YA 3NKYA 3OT9A 2G8KA 1LAWA 3P31A 2D41A 2KYXA 4Y00A 3D6RA 4N76A 2OH2A 4GKJF 3QFPA 1GAOA 1TELA 4USJC 3EYZA 3T6BA 4CEAA 3G25A 4ZLNA 2JWNA 4WYLA 1U47A 1R31A 2EC0A 3THYA 4P75A 4IRCA 3LDPA 3O9SA 3OYKA 2LKZA 1K44A 2UV8G 1RCHA 4ZK7M 1YJUA 1GTEA 2ZDPA 3IWLA 1ZXOA 5LL6Z 1OQ3A 4I64A 4HH0A 2BANB 2R7QA 4BC3A 4JI0K 3QGPA 2KL8A 3CQYA 3CNQP 1CC7A 1VQNN 3IBCB 4YY3F 4MIWA 4CF8A 2GGPA 1LWFA 4NX9A 3AVLA 5K9FA 3CB4A 1FXDA 3AA2A 4FSVA 1ZA1B 1VSEA 3LDOA 1YDLA 3H3OB 1M1KT 3UD4P 5DDPC 4JV5K 2O8EA 2L08A 3EE3A 3CO9A 1HR0F 3QERA 1VQ7N 1QQCA 3V9ZA 2EBEA 1MU2A 3MX5A 3KD5E 4A8FA 2PYLA 3KK1B 3LP2A 4L3QA 2KG0A 4JBCA 1WHYA 3W66A 1BU6O 3C15B 4GC7A 2DT9A 1CBKA 3A1YG 2MQNA 4IRKA 5L1JA 2VFVA 4ZIVA 4W90B 2H5JB 2KJWA 5HBMB 4MIBA 4F3TA 4CEFA 3EZOA 1RSCA 2DKOB 3ET6A 2Y0BB 5KFYA 4B3SJ 4ZPDA 2OA8A 1NMNA 3H25A 4KSEB 2K7KA 4NA3A 4JRQA 4ILRA 4R5PA 3QWUA 3TARA 1I5OB 4NXMJ 1FRIA 4K4YA 2BGGA 1T0TV 4EU0A 1M5HA 5A2QU 2V2ZA 4E1JA 2HZAA 4N77A 1FDAA 3GONA 3CCRS 2DR8A 3MAQA 5I4MA 3FFKB 3OBWA 4DI6A 3LWLA 2HW3A 2BTFA 1KP6A 2RN2A 5SZTA 3SV3A 1D8YA 2DGSA 2DTUA 2W7AA 4LRCA 3OHAA 4WIQA 3SPZA 1Y00A 3KUGA 1RT1A 1VC5A 3EGVA 2ZC4A 4JV0A 3UKRA 3ILIA 4Q45A 2YCHA 1XMOF 2LQ5A 1IJJA 2LU1A 4ER8A 2NUUG 3RVCA 5ADZA 4AHRA 4ENOA 2C2OB 2VA3A 4Y2KA 1UVLA 4K0KF 1GXUA 2GC8A 2Y1LB 4L72B 2K7JA 4CRJA 2HLUA 4EHTA 1VSHA 2GS8A 4LFBK 3NNHA 4JV5F 4FKYA 4CO0A 2XLIA 4H4OA 2BACA 3NMRA 1T3OA 1N33J 2WSFC 1YI2N 2ZGYA 5AQOA 2VICA 4QIGA 5DO2A 3BJYA 1J5EK 3PYEA 3T6JA 1OKJA 2MHNA 3GV5B 4C48A 3WUHA 4GVLA 2DR5A 4PG7A 5JS2A 3MUVP 5THWA 1BQNA 1RDCA 1QSYA 2NXNA 5L46A 3D2FA 4OZ3A 1Q7LB 3HCXA 2LSNA 1TV6B 4ED0A 3BYPA 2ZWHA 1U09A 1WSRA 1QZ5A 2ASOA 1S0MA 4DR4J 3IM9A 2JL9A 1VLYA 1PJ5A 3Q24A 1CZ9A 3D6FB 3J7A1 4BE1A 2GVDB 3VAJA 1SJRA 1OIAA 2HGLA 3R27A 4LFBF 2VC0A 5EU7A 2CQ1A 1RT4B 2E1MC 2C2KB 2W41A 4J2BA 1VQLS 2BKOA 3EMTA 5AQSA 1RLDA 4J91A 5IT0A 1YZ6A 4JKBA 1VQMN 3TRGA 1Q95G 4NZ6A 1JLFB 4IH6A 4IO9Q 5AXMA 4E19A 4EO6A 4CJLA 3P3DA 3EVOA 4BHQA 1IJFB 3BZQA 3TPQA 3KIOA 1PSDA 2QL7B 2YJEA 2QL9B 3HD2A 1YI2S 2NZTA 4CF0A 3RW7A 1TQLA 1RHJB 4WQ5C 5E2QA 2DRDA 1WSFA 1YITS 1RQ0A 1TAQA 2J7KA 4QR0A 1IQZA 4Y2AA 3MF5A 4BDYA 4JI7F 1RWOB 2Y9HA 4QJVA 1NMDA 5T41A 3D7EO 2NRVA 3C6TA 2Q2RA 3L6QA 3VOVA 3T69A 4WIIA 1J5EJ 4FJ9A 2UXBK 4FZVA 3QESA 5LMUF 2BUNA 3OTBA 1UEVA 4KGKA 3BF3A 2FC0A 4CIGA 1T9WA 3W3DA 1EQMA 4RWWA 2P9KB 1JWWA 3PW4A 4FM1A 3AGKA 4BRLA 2ACYA 5CCLA 1XHZA 1ZTWA 3QT8A 4DWIA 4K43A 2PMHA 5KFVA 2HZCA 2DGXA 2YWHA 5L1IA 4R8UB 1F5BA 1WD6A 4M3WA 2FZKB 3JQMA 3QDKA 1GLEG 4XH1A 1P1LA 1GLFO 2RQMA 1VCTA 3UCUP 4AHUA 1IXKA 2PD1A 5EDWA 4CHNA 4CBXA 1S1TA 2J4RA 3I0SA 4U9RA 2CQGA 3CJ5A 2XMWA 2HSEB 2HHHJ 1WOOA 3TJAA 4DPXA 1YITN 5BR8F 4ZCKA 2ZVSA 3AVCA 2CGKA 2QGFB 3NNAA 3DAWA 2FLLA 1RAGB 1TKZA 1APSA 4B1ZA 4DUZJ 2KU7A 4K4TA 4FXWA 2CQCA 1FA0A 4Z37A 4CD3A 1VQ5N 4QQBA 1WNSA 2KO1A 4OZ1A 3IFEA 4PG6A 4ZP6A 2CGLA 1KVKA 3GFXA 1R27B 1BD6A 1HBNA 1TKTB 3UR0A 5ETKA 2HQIA 4FF1A 2OTJS 2J0XA 1NEEA 1R7IA 5KGXA 3V6DB 4H4MB 3BGOP 3MXMA 4RJVA 2M8HA 3HKZD 2F9JA 1FNOA 3TNVA 1HBMB 3GB0A 3CC7N 3J81O 2VQFJ 3M8QA 5DLGA 4KAZA 1XNQF 3FZKA 3OR2B 4RNMA 3S7RA 1WUAA 3HI9A 5IC4B 4U67L 4K4XA 3AOBA 2OEJA 3L7OA 3M7VA 1HRHA 3VF0B 3CDUA 2UUCK 2LVWA 1LWCA 1RT7B 2IAJB 2WVFA 2P2CB 1KC8T 1N36F 5HI7A 4TSXA 1ITPA 1RDDA 3IR6B 3RW6A 2XLJA 1FRJA 3I31A 3J80U 2HB5A 3BGFA 5AQYA 2EG1A 3UNGC 3UN3A 1FWKA 2NYHA 2O8CA 4CLFA 1C4AA 5K8PA 1SC1B 4KQZA 3M8ZA 3TABA 3O9TA 1C1CB 2D3O1 1C0UA 4G3IA 2O8BB 3VVUA 3FCWA 4F67A 1VBKA 5FPDA 2YWGA 4DR1F 3KLGB 4D3HA 1SJ3P 3O6WA 5ETNA 1ESVA 1LXJA 4DSLA 1OSDA 5HMZA 2HWHA 3Q8YA 4AL6A 1HPZB 4LF5J 4CK1A 2I6WA 2W4CA 1SXLA 2VASA 4EBCA 1RA7A 4H8KA 2XHCA 1R8BA 2F7TA 1KLNA 4IOAQ 4P2MA 4DN0A 4NMLA 5KFJA 3CJCA 3IAS9 5BJRA 2F40A 3UVJA 2QWPA 2LA6A 2HGMA 1RI7A 4PYDA 4AE5A 3THVA 2YPYA 2YKNA 3Q2TC 4CLKA 3LDLA 2ASPA 3PUFA 4NLCA 4DV7K 4QIEA 5GVQA 1K73O 3P4IA 2HNDB 2A0FB 1VQPN 2V8HA 3IM8A 1H98A 2B9WA 3WZ0A 1RT5B 4PQUB 3O2IA 4PKGA 2IPOB 3M8PA 1KVIA 1WSIA 5GIOA 4GVMA 3LPYA 5H1SQ 4KRWA 3ISND 1RTJB 3ZX3A 2OAUA 3OQ2A 1PAEX 3H2VE 2H48B 4KY3A 1W7WA 5A0YA 1U49A 1JLQB 4M95A 3MFIA 4DL2A 3G86A 3CJ9A 4Y2IA 1FI4A 4WF9Q 2IBKA 3D28A 1Z4UA 2BJDA 5K8OA 1T9UA 1FKOB 4YB1P 3MMCA 4B02A 3C0BA 3FCHA 3K9KA 3UR3C 4LF8J 1GMWD 3HVWA 3OL6A 3ZTOA 4OPKA 4WQ4A 4MYUA 3KMSA 3AJDA 4HTJA 4OX7A 2FLOA 3DWLA 4AM6A 2XMAA 4LF8F 1XC9A 2ZH3A 1ATRA 3CF5L 3DU5A 2M5YA 2X3GA 3ZZYA 2FY8A 2QIFA 2YX1A 3V2UC 3D9BA 2VQFK 2GHWA 1UFWA 3B8AX 4CFBA 4WFZA 2D74B 1Q8IA 1CS4A 5BR8K 3DLBA 3NF7A 4M41A 1U04A 3VQPA 3NFAA 2YHAA 4ES3A 3CO0P 4WQ4C 2BANA 4JI2F 3A5MC 4OYPA 1DT9A 2K3KA 2HHTA 1GNKA 4CH1A 1OY6A 4UOCA 3OR1A 3EJMA 1NK7A 3ILJA 1JLGB 4WQ5A 3O9UA 2V2KA 5M1NA 4ZLLA 4ZVEA 5HROB 2MQMA 1X9MA 1TR0A 1VC6A 3S6EA 2IRXA 5CZVA 3QSIA 3W2WA 4CJEA 1Z26A 4P10A 1TFWA 1PJ7A 1DGKN 1S22A 2W7PA 1NCLA 4RNHA 1SC6A 1R8HA 4K7QA 3AXMA 3R2CJ 5T7BA 1TYQB 1C0FA 2DNLA 4YQWA 4BC2A 4B3TJ 4WCEL 3ILOA 3KVGA 2YWWA 1REGX 4NEZA 4ILGB 3NL0A 1RLCL 4E89A 2XS5A 2P8IA 5AQPA 2DBBA 2PY5A 4LFCF 4JI4F 2Z58B 1RBUA 2IVYA 3MECB 4NLRA 2HFVA 1FRLA 1T95A 5HSPA 1VSJA 3KD1E 3H8YA 2MHEA 1REVB 2J8SA 2F5GA 4JRPA 1EWQA 3D45A 3ZFVA 1RKJA 3OD2A 3M6WA 2GIRA 2RH3A 4DU4A 1EB0A 3N4PA 1NXIA 1RHMB 1XR5A 3C46A 1KWMA 3NGYA 2D0BA 3VEXA 3OHBA 1BL3A 3D54A 1ZZFA 5HBMA 1IKWA 2VU5A 5GAGI 3V5RA 1Q7YT 1OYEA 5J1PA 3M6XA 3NS5A 4EO8A 3M1FA 3OFGA 2YXLA 3VF6A 2H3GX 1T8EA 2QTWA 4O8UA 2PGCA 4ZS6A 2XS2A 2A6MA 1MDUB 1Y5IB 1U2FA 4HACB 1ZM3A 4F4ZA 5GADI 4JI5F 2HF4A 2QWOA 4DG1A 3TSQA 5E3QA 2FHOB 4ECZA 1HNIA 1YJRA 3NGDA 3T1HJ 4CJ3A 4JI8K 1WC3A 3CPWR 5ETLA 2ZHBA 5H9EJ 2RB7A 1AROP 1B70B 2JWKA 4ZPWR 1X5SA 1NH7A 4YDUA 2XG8A 4JD2A 3UFCX 2MZQA 3G6YA 3AD8C 4JV2A 1KRPA 4ES1A 1KQSR 1ROFA 3BR9A 4OHVA 3P8BB 4DR2F 2OLWA 3EM1A 4FPAA 4KI4A 1LWFB 3Q8SB 4GKJJ 2FJWA 4AHCA 1XJWB 2C22A 5C2DA 3BF1A 4DU8A 3WXMB 1UFLA 2VFUA 3TA2A 5IT9Y 5FDLB 2B9EA 1M1HA 4K25A 3GFHA 4WK1A 4YOUA 3CE8A 1NHKL 2VL1A 2C3MA 5KRTA 1KVAA 1VQSA 2QYCA 2RS8A 3NAEA 3IAM9 4N47A 3MFHA 2I7PA 2AW0A 4DUYJ 2G0CA 4M7YA 4O5FA 2O4IA 1B3TA 2UXBJ 2Z1GA 1KFDA 3K7RA 2Q6BA 3HF5A 1EKRA 4NLWA 2U1AA 3ZZZA 3PSFA 3PY8A 1W2BR 2YH0A 5JMNA 4IOBA 2B8PA 3B6BA 4K0KJ 3AH6A 5DQIA 4NXNJ 1ZS6A 3OYMA 5BYRA 2WSCC 2QSFA 3IXQA 3ZSWA 2H4WB 3HBTA 2C2NA 2HQCA 4GRSA 3MM9A 4CT9A 3MMJA 1GX5A 4J2DA 1RWNB 2WVEA 2B0GA 4M3YA 4P2FA 1GTHA 1HLWA 5DRKA 1L3VA 3DKDA 1R89A 4JI6F 3BKFA 1IV0A 1M90T 3CETA 3KG4A 3TEHB 4DV6J 3PW2A 4NRUA 3G71N 3W8GA 1X4CA 1E6VB 4CK3A 1FERA 4K2XA 4DPWA 4YNQA 3UD5A 1A0OB 3I0RA 2CIMA 4OYMA 5D8HB 2CUYA 3B54A 4NCAA 3BN4A 4DTMA 2CNNB 1SKWA 3B82A 3JYTB 1W25A 1RWMB 1BOTO 5KFRA 5F8MA 1IBCB 3VQ6A 2HFNA 2L9WA 5BYQA 1ZBIA 3KKSA 2GV9A 4DX5A 5HRSA 4J8FA 3ITHA 4R8UA 4OLOA 3HT3A 1GX6A 3AO1A 2ZJRQ 1K8AO 1HBNB 3PNIA 4JUZA 1GOBA 2AP6A 4IXCA 4DV6K 3IP0A 1V6HA 3WIVA 5AQTA 4WPAA 5C2CA 3EXYA 3R5DA 5AT1B 4DCHA 4HEA9 3L2RA 2UUAJ 4LJMA 5D6GA 1CQMA 4MKYA 2E2OA 5LT5A 4KHQA 3KJQB 1KQKA 4JI3J 5M2RA 3TAFA 4TYAA 3ETOA 3SQ0A 3FFIB 4FWPA 1WSGA 1IM6A 3G71S 1Q79A 4OGCA 4X4VA 4KI6A 5F3TA 3MI7X 4A8WA 2RE2A 4UQGA 2NREA 4A8MP 1X1PA 2C2MB 3KJVB 2NXUA 1XHXA 1A7GE 2GVZA 1YBAA 4NB4A 3SUOA 5LSRA 4KTQA 2DRAA 2ZJRL 1JLQA 3KK3B 4JOUA 2VQEK 4FW2A 4YP3A 4WFNQ 2VQEF 3GG4A 1OYDA 4DMZA 4I7FA 1QVGR 1VSKA 3ZSQA 4F3MA 3VQQA 1BWVA 2IVNA 2E7VA 3BZKA 5M2PA 2G1DA 4R0EA 1VQON 1WG1A 2NUBA 4N7TA 3H4DA 3VQCA 4HUEA 2HQ3A 3ISNC 1BI4B 2XMKA 2JVRA 4F04B 3GQCA 3HHLC 4A8QA 1RT2A 2AYMA 1XQSC 1C0TA 1XMBA 1CULB 2QLJB 4M5DA 4DTJA 1B7YB 3EGWB 3FMBA 3QETA 4NO7A 3KUEA 4HHJA 3AARA 1H7XA 5LXRA 2G8FA 4BRKA 4NWBA 2OD4A 3MPUB 3RBZA 4FLXA 3GR0A 1FWLA 1SCJB 3WXLA 2W9BA 4L75A 2VB6A 1WELA 4QR1A 2DIVA 4B3RF 3R7SB 1F9EB 2FJDB 4IG3A 3JTNA 1T05B 1N54B 2AQ4A 5AQUA 2B9XA 2PSZA 1VMBA 3GSIA 2XZTB 3M1VA 3N4WA 2V2VA 4BCAA 3OYAA 2Z2YB 1M90O 1J5OA 3DRSA 2GFFA 3BF4A 5A8RA 2FSJA 2Z2LA 3H5XA 2GMHA 3SCKE 4RW8B 2OCEA 2Q0UA 3H98A 1RCOB 4ECXA 3QWPA 2JEGA 5EUHA 2GUPA 2QLXA 1WORA 5AZJA 2YI1A 1NK6A 4FWOA 3G6VA 1U1LA 3R9PA 3OYNA 4CO3A 3DGPA 3AHPA 1RA6A 3FEYB 1XR7A 3KLIB 1IJEB 4KO0A 2V8DA 2DPNA 1RNHA 1U2CA 1YBTA 4PWUA 4U8VA 4DL4A 2CKWA 5JVGQ 3PHTA 3SCXA 3ZX2A 2W9BB 1J27A 4JKDA 4QOZB 1U8SA 1DTTA 2KT5A 4LSLB 3TZXA 3D2EA 4DV1J 4M3RA 4HTIA 3KWGA 4O3SA 3MCPA 3O1BA 3JSYA 5MLCV 2GQCA 3PRBA 4WFAL 3G6ES 4ZVSB 4A62A 5LL6d 1NNDA 1RU2A 3PYGA 2V8PA 2G2OA 2QXFA 3ADAC 4L3KA 1GEHA 2G0IA 4EHUA 3ENQA 5T14A 5K8MA 4ITSA 3CJ4A 4A5AA 3MXIA 3HP6A 2HHXA 1WDDA 5H9EK 2G8HA 5M1OA 2YNHB 3BDPA 2FLPA 3KJVA 5BRDA 1RBTA 2Y0SD 1UKUA 1LWEA 2RT3A 1ZBFA 3WC2A 5JS1A 3V6JA 4O55A 2PEBA 1YTAA 4RW7B 3LZIA 1FVSA 2K06A 2FSKA 4JV1A 4C11B 5DG9A 1B0VA 2N3LA 4P6QA 4PG8A 2OIHA 2NLXA 4B3SK 4B9TA 4A8XA 3TQ1A 4CZMA 4K59A 3QMLA 4USIA 1RBLA 2OFHX 3AA9A 1F2HA 1FX2A 2QN6B 1UTAA 4YOTA 1K1SA 3NY0A 2G8UA 3DYAB 5AQQA 1NGJA 1TYQA 4W98A 1NJXA 4LRAA 2AGQA 2NRHA 2RKIA 2ZNYA 1K0VA 4ZPVR 4NLTA 2K1RA 3M2VB 3HZGA 4N41A 3OTEA 2HKEA 4Z0UA 2MKKA 2HK3A 4C8YA 2MLYA 2HNYA 1RWXB 2V7ZA 2LEPA 4ILLA 3V4IB 4NASA 4FZXC 2EXUA 4FLZA 3ZTPA 1A5VA 4B08A 1JJ2R 3SQ2A 3THXB 1FTCA 1F6TA 4O3RA 5CZXA 1LKZA 1AA1B 1X0FA 5A8RB 3RAMA 4DZ6A 1G15A 2XGPA 4FLUA 5HRRA 3M8SA 1Q82O 1YJWS 1E6YB 1RT3B 4Q2MA 3NCIA 5JVGL 2H9ZA 3QAEA 4J9LA 3TA0A 3RR8A 2DNHA 1S77D 1SJFA 5HANA 1QHTA 4IDHA 5GAHP 2V6AA 3KHYA 1B64A 2LQ9A 3FZLA 3BEXA 4PXBA 2QRRA 4X4RA 1JL1A 2HBLA 5KFQA 2RU3A 2DXDA 3PRDA 3ZZTA 3CCSS 1TFYA 4L8RB 2RVJA 1UMJA 4CZCA 3M2UB 3RGIA 3NCQA 4TVAB 1N88A 1KFSA 3O6QA 2CJAA 1HHSA 3MAHA 1RTIA 3PEJA 3J81j 4DV1K 4NPOA 3CC7S 2AF6A 4HTUA 4KHWA 4WP9A 3R8EA 3CERA 1Z2ZA 3GIRA 2X1AA 3VAIA 2H5IB 1PC4A 1U26A 3AO4A 1KAYA 1BQNB 2ZUGA 4Z4FA 2ROPA 5FLXU 2O8DA 2W40A 4IEEA 1UAWA 1H0HB 4DV4K 2EFVA 2W01A 1WC0A 4ED1A 4PUOA 2XSFA 4IQMA 2JNJA 2XS7A 4O3OA 3Q0AA 2VKZG 2AJQA 4Y3CA 2FPHX 3CJKA 2VG6A 5LJWA 1N4LA 3VGUA 1N5SA 2BOAA 5DGAA 4BRCA 2GVDA 2LDIA 2PMWA 1S5JA 1TZ0A 1RAOA 2MQ8A 4Z4HA 3AT1B 4E7JA 2AYBA 3S41A 4DV2J 4DV5F 4OYZA 2P9UA 2FD2A 4DBQA 7FD1A 1F5AA 3OYBA 2BE7D 2GUIA 3R2DJ 3GG1A 3TP2A 5C2FA 1RK8A 3VVTA 4NYOA 2BKNA 4OPAA 4HVJA 4DUYF 2E5JA 3W61A 1TL3A 2MY8A 2HMPA 4DF4A 4I9LA 3L2WA 2QWNA 2ZH5A 1M1GA 5CHIA 4DPTA 2RHKA 3OPKA 2IVFB 3H59A 2ACMA 4USHA 4ICLA 4CJ5A 1F9FA 3P39A 3L09A 5BPMA 3K5LA 2M9KA 2O8FA 1YVFA 2R8IA 2CVEA 1EJ7L 3HFVA 3BP8A 1M5KC 4FF4A 1Y10A 1SH3A 1RE1B 1SZ2A 2OI2A 3ZCMA 2BE2B 3QIPB 4K0KK 2IC3A 4OZ2A 2P9UB 4B3MF 4FF3A 4OKJA 3H5YA 4F0KA 4YUDA 2E5HA 3RB4A 2MY7A 4M5NA 3KDNA 2E20A 3AQOA 5BN9A 4CGFA 2WW4A 1JLAA 5E3RA 1NK9A 2XNRA 2OSQA 1BHLA 1QHAA 5J2MB 1IBLJ 3FR0A 2XC9A 3J7AP 2HRYA 3QGHA 2VWBA 2P9PA 3G87A 3T9ZA 3TWHA 4TN2A 3OTOK 3ZT3A 4ZJLA 1HW9A 3BSNA 3L2UA 4G1QA 5FDLA 4ZVFA 3GV7B 2IDEA 1F0XA 4XIUA 2JFDA 4A48A 2R8GA 3HL8A 4ID1A 5D0GA 2HVDA 2O5DA 2RRBA 1YSJA 3HHKA 2L3MA 2A3ZA 1N33F 3UE5A 4IJAA 4F4WA 3KLEA 4KHPJ 4AQYK 4IFEA 3OXGA 4Y1CA 4BRFA 4Y0FA 5HLFA 4U7UK 2FGCA 4E3SA 4ED7A 4NLQA 2KXHA 4HTLA 1N34F 4FS2A 3CCES 1ZYQA 3N5BA 1YJTA 4GMKA 4JI1F 3FMWA 4X65J 2WAQD 4O3NA 4ZTFA 3FZFA 4K4VA 1YVNA 4DLGA 5LSLA 5AE2A 3RMAA 3OYJA 4EEYA 4RU9A 2YKMB 3KJFB 4F4XA 4HACA 3CJBA 3G6XA 1S48A 4WU2A 1RGIA 4IOCQ 1ZPVA 3QO9A 4LSNA 3UB5A 4DX6A 3TJ8A 3BR8A 2WB1D 4TXSA 4ANCA 5BRFA 2JHEA 4LF2A 3FLCO 4XAKA 4ATNA 1N5YA 1BA1A 4AL5