1JKHA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
553
structure length
550
Chain Sequence
b'ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT, A-CHAIN
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 146
structure length 550
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jkhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jkhA05
3VQQA 3Q8SB 2G8KA 3JYTA 1D1UA 1WSGA 1REVB 2IM2A 1CXQA 4M45A 3C6TA 3CG7A 3MXIA 3VA0A 2YNIB 1BISA 1QS4A 1JLAB 1NJWA 2HNZA 2Z1IA 4ECUA 1QUVA 1D8YA 3FQKA 1BI4A 1O1WA 1N48A 1I6JA 4TYAA 1LW0B 5CYQA 3OYHA 3RRGA 1YTUA 2OPQB 2AGQA 3L3UA 4E7HA 4QWBA 2R2TA 4IH5A 4F3TA 2OZSA 3HPOA 2HVHA 3O3FA 2HNZB 4W5QA 1J54A 1SH3A 5KFIA 1S1XA 1BI4B 4N76A 1G15A 2B5JA 3DRSA 3HXMA 4DS5A 2D7SA 1BHLA 4ZPDA 4EZ6A 4IFVA 3OLBA 3JSMA 3AVKA 1CXUA 4EBDA 4OL8A 3D0PA 2RPIA 2FJWA 4IKFA 1ITGA 5CZ1A 3D5MA 1JKHA 5DMRA 1RDCA 3QIPA 2B5JB 4I2PB 3DRSB 3L3VA 4ZTFA 1N6QA 4ED1A 3K59A 1XHZA 3VQCA 4R8UA 2FVSA 5KFVA 4IFVB 1KLMA 4GC6A 1L3VA 3EPIA 3F9KA 4RNHA 4O0JA 4E19A 3UPFA 2X74A 3V6KA 1RTDB 3QIPB 3MEGA 4PA1A 4IG3A 4DSFA 3NBPB 3HVTB 1N6QB 4RNNA 4J9PA 5KFPA 3SUPA 4R8UB 1KLMB 4DFMA 1TL1A 4QWEA 3DRRB 1XHXA 1IG9A 2DPIA 3P83D 5JS1A 1TKXB 1C1CA 1L3UA 2V9WA 2O4GA 4RUAA 2FLNA 2V0NA 4KREA 3BQ2A 2ATQA 2FBTA 5KFNA 4FK0A 3TARA 3L2WA 2G8FA 3THVA 2DTUA 2R2RA 1ASVA 4M94A 1S97A 4FLZA 2G8UA 4FW2A 4PQUA 2ILYA 3VQEA 2E6LA 4F4YA 2ASJA 2XI2A 2HMIA 1FKPA 4Q45A 3KLIA 1TL3A 3AO4A 4NLTA 2VG5A 4EO8A 2W7PA 4CJFA 3RWUA 3S9HA 4PQUB 4JS4A 4QPXA 4IOBA 2E6MA 5KFUA 3BSCA 2E4LA 3KLIB 2WRMA 1S1UB 1TL3B 3AVNA 3AV9A 1RCHA 2VG5B 3TAMA 3ULDA 1S6PA 5L1KA 1FXXA 4DTXA 3SQ2A 2HNDA 4CJRA 3IAYA 4U6PA 1LV5A 3BJYA 1CLQA 1GX6A 4KFBA 1LWCA 3H4BA 2AU0A 1YVFA 3RMBA 1RT3A 4IH6A 4ECSA 3TAMB 4Q8EA 3ZSVA 1YT3A 4MK8A 3GV8B 4FJJA 1RBSA 4DS4A 2HNDB 1K1SA 4M3WA 5KG4A 4DTPA 4B9MA 3QLHA 4LQ3A 3WNHA 1IO2A 1LWCB 1U49A 1RT3B 3VQSA 4B9NA 3RAXA 3TWHA 4XO0A 4KO0A 4AHRA 4DU4A 1NKBA 5L1JA 1VRUA 3RB3A 5FRNA 2V4QA 3PR5B 4Z0UA 3QLHB 4FJNA 1U45A 2WHOA 4F4KA 1KTQA 4OKEA 2E9TA 1NKCA 2HAIA 3IS9A 3HVWA 3C95A 4ZHRA 4KHSA 4OKKA 4KO0B 3TAEA 3OYAA 3VQBA 1TVRB 4LSLA 1KVAA 3QEIA 4K8ZA 3RB0A 5J2MA 3PR4A 1KHWA 4ZP9A 4JV2A 1SH0A 5L1IA 4NLRA 1VSDA 2GIRA 4FBUA 1WN7A 2X6SA 2RN2A 3NL0A 2FJVA 1EX4A 4ICLA 1B9DA 4ELVA 1T05A 2FJXA 1L5UA 2ATLA 4HCBA 4CF8A 3SUQA 4NZ0A 5KRSA 3DYAA 3TI0A 5HRRA 3M9MB 2YNFA 3AVCA 2WOMA 1RT1A 4OGCA 4ELTA 4GVMA 2E9RX 3WNEA 4ICLB 1T05B 4O3SA 1RNHA 4MFBA 5KTQA 1J53A 3LAMA 4ECRA 4IKAA 1RYSA 3OYBA 3DYAB 4Y34A 2YNFB 3G6YA 2WOMB 4H54A 4LH5A 1RT1B 4CIGA 1D9FA 4DSEA 4J2DA 4RW6A 1HQUA 4MFBB 3HO1A 1RBVA 4ECTA 5KT3A 2YKNA 3CJ5A 3K57A 4NLPA 4DTUA 3IG1B 4RW8A 1HYZA 3NGZA 1W25A 4RW6B 3FQLA 1HQUB 3N6NA 2F8EX 5KG7A 4KHNA 3MR6A 4PY5A 2DFEA 4RW8B 4Q43A 4ECVA 3MEDB 4CGIA 4Q44A 5C42A 5KT2A 4O55A 5DLGA 1WAJA 4K4SA 4O3QA 4DFKA 1X9SA 1SL0A 2XRIA 1LWEA 3BGRA 1GX5A 4F4XA 5CZ2A 3PX4A 4IG0A 4Q5VA 1R0AB 4CJSA 2KZMA 5C42B 1RT7B 1JXLA 3NAEA 1JLBA 5KFDA 4Z4EA 3CJ4A 2QKKA 5DG7A 2XGPA 4FXDA 2XI3A 1LWEB 3BGRB 2XGQA 2ETJA 1U4BA 4IG0B 5F8JA 3SCXA 1WSJA 1S1WA 4O3OA 1JLBB 4K4UA 3PW4A 1ASUA 3NF9A 3VQ7A 2E9ZA 3LP0A 4M3YA 4IFYA 4XPEA 1RT2A 1KLNA 1NOZA 5J2NA 4KBIA 4YQWA 1VK0A 3ICLA 3KHRA 1SKRA 4R5PA 5EU7A 4Y2CA 3CM5A 1JLGA 2VG7A 5F8HA 1GOAA 4YP3A 4J9MA 1W0HA 1VRTB 3LP0B 3QESA 4IFYB 3GILA 3DOKB 2EX3A 4Z4CA 1EP4B 4RW9A 5J2NB 3NE6A 1DTQB 5KGWA 4B08A 4CF1A 2IBKA 3O3GA 4I9QA 1S1VA 2OPRB 1HPZA 3OLAA 2JLEA 1QE1A 1KRPA 5KT7A 2IAJA 5EDWA 4ZP6A 1T7PA 3I0SB 3NMAA 4IRDA 1UA0A 4NLSA 4WE1A 4Y2AA 2HHWA 2BRLA 3KK1A 3H98A 3NHGA 3Q8RB 2CJQA 2IM0A 5F8IA 1S1VB 4BE2A 1HPZB 1QE1B 2IMWP 4DSJA 5J2QB 2IAJB 5DG8A 4NLUA 4CJPA 3V9UA 4WE1B 3MFHA 3AA4A 3KK1B 3AVMA 4DL6A 3DMJA 4H4MB 3VA3A 2HNYA 3VQ6A 5F8NA 1HYSB 1S6QA 4H4OB 3TAPA 2IS3A 1A5XA 5KFXA 3Q8QB 4I2QA 4M3ZA 4PUOA 3BQ0A 3PZPA 3LDSA 4FBTA 3KHLA 2HNYB 3MFIA 3SI6A 4KPYA 3K5MA 1HNIA 3NF8A 1VSEA 5KRTA 1ZBIA 1VSJA 2AGPA 3RBEA 1WSHA 2BQ3A 3CJ3A 4CK1A 4FM0A 4HHTA 4FLYA 4RNFA 1HQEA 3KLGB 4ZVEA 2QE5A 4K4XA 2KQ2A 3LPUA 2O4IA 3FFIB 4KSEB 2GV9A 4N56A 1XC9A 3G0ZA 5I42A 3OS1A 4BDYA 3EYZA 2OPPA 4CJWA 1N5YA 4CHOA 4FZZA 4RG8A 3T5LA 3AO3A 4JRPA 3BSNA 3V6JA 3OL7A 4FJ7A 1HQEB 3SQ0A 3KTQA 5JUMA 5EUHA 4DG1A 1IKXA 1SL1A 2GUIA 4ECYA 4FLVA 4R0EA 2OPPB 3HK2A 4CERA 2Z1GA 3MTKA 3PUFA 3AA2A 2BGGA 2QKBA 3V9ZA 3HPGA 1Z4UA 4FS1A 1S0OA 3AVJA 2RF2A 3ZT2A 4EZ9A 4CHZA 1IKXB 3PO4A 4M95A 2OYQA 4W5OA 2PZSA 4GC7A 4C8KA 2P1JA 4O3PA 2D0BA 2C2EA 4E7KA 4IH7A 1RTIA 2PYJA 4DMNA 3QEWA 3OYFA 2G8WA 2OZMA 3VQ4A 2HHVA 5F8LA 3DLEB 1BCOA 1S49A 1BQMA 2QXFA 1WSEA 3ALYA 5KG5A 4J2AA 2FVQA 3JYTB 3UDLA 2ILZA 3MF5A 1RTIB 3SJJA 3EPGA 3C6TB 3KNAA 1K6YA 1KFSA 2P5OA 4N5SA 5EWGA 4CIFA 5FROA 4F8RA 4M3UA 2WB4A 4CK3A 1NHVA 1HARA 3K2PA 4KB7A 4FJIA 4EBCA 4C8OA 4TSXA 5CYQB 1RDAA 5HRPA 2PYLA 3KMSA 4DFPA 4BDPA 3OJUA 1S1XB 2DY4A 1NK7A 4NYZA 3G6XA 1RTHA 5L1LA 3S3OA 4ZP7A 4CCHA 5KFAA 3SNNA 3KLHA 3OYNA 1B9FA 3DDKA 1RBUA 2G8IA 3SFGA 3VQ8A 1EETA 4FLUA 3JSMB 4J9OA 4CF2A 1T8EA 2ZKUA 3KK2A 4M41A 4CESA 1J5OA 4Y1DA 3E51A 4E3SA 1JKHB 1TP7A 4ZPBA 5DQHA 1ZBHA 1RTHB 1Z25A 3NCIA 4O4GA 4ZPCA 3QEXA 4B3OA 3VN5A 1ZBLA 3KLHB 2FLLA 4DQRA 1TQLA 4MIBA 1EETB 3RR8A 3KK2B 1J5OB 1ASWA 3SV3A 3FSIA 2J6UA 3OY9A 1JXEA 3AVGA 4O4GB 3MEGB 4LD0A 4IG3B 3KHHA 4B3OB 1SV5A 4WFXA 4FZXC 4DTOA 1TL1B 4B8AB 1U47A 4K4VA 3OS2A 4O3NA 3V6DA 2O5DA 3VQAA 3U6FA 1C1CB 3DLKA 5D3GA 4K50A 3DLBA 2ZE2A 3G10A 3OYKA 4BE1A 4U7CA 1LWFA 1SV5B 3MEEA 4DQQA 3P1GA 4CEOA 4DSLA 1Y97A 4OGEA 2VA2A 1NOYA 2QK9A 2R2UA 4EYHB 3QGIA 3IGNA 3KMQA 4B9VA 3OYMA 3V6DB 2J6TA 4DSKA 4J9SA 4CE9A 4N47A 1LWFB 3H4DA 1NHUA 2X78A 2HHXA 3TAGA 3OL6A 3V4IA 2HMIB 1FKPB 2DFHA 4LQ9A 3QNOA 2JEGA 3MR3A 5KFFA 2XY5A 1WAFA 3TANA 2BRKA 2D3ZA 2YHAA 2HHQA 4Q8FA 4LSNA 3V4IB 4KKOA 1BL3A 4XPCA 4J9LA 3LP1A 1XR5A 5KFMA 4DL2A 3V1QA 4FJ9A 3QO9A 4J2EA 4EBEA 1S6PB 3V81A 2V4RA 3SI8A 3HP6A 1QTMA 4KTWA 3MECA 3LWLA 4LSNB 3RTVA 3VQ9A 4CEZA 2W42A 4GMJB 4KFBB 4JV1A 3QO9B 3TVKA 3RB4A 3I5BA 5EWEA 3BQ1A 4ED8A 3V81B 3OYCA 3FRZA 3K5LA 1WNEA 3MECB 2CKWA 2IOCA 4DF8A 1IKWA 2R8KA 4ZPAA 3S3NA 2RKIA 3M9NB 4URQU 3CWJA 4OJRA 3H08A 4CJUA 3ISNC 1OS5A 2OA8A 4RUCA 2KFNA 2FVPA 1RTJA 2Z1JA 1VRUB 1HMVA 3I5AA 3NGYA 1U48A 4FJHA 1RT6A 4CFAA 4K4YA 2Y1JA 2RKIB 1QAJA 1VSHA 1IKVA 5DQIA 3L2UA 2I1RA 3IS9B 3SPZA 4ZHRB 4E1MA 1RTJB 4BACA 1RT6B 4LSLB 4CF0A 2VG6A 5J2MB 3OSPA 4CJTA 4ED3A 3CDEA 5EWFA 4KHMA 4URGA 2JC1A 3NGIA 3NGDA 1NK8A 4O44A 2ASLA 4DU3A 4MIAA 3RMDA 1XWLA 3HM9A 5KG6A 1JL1A 1MMLA 3U3GA 2C2DA 4E7LA 5HBMA 5KGXA 2WONA 2JEFA 3N6MA 2FLPA 2D0AA 2P51A 3O3HA 3MR5A 3LP3A 4FJ8A 1D0EA 3H2LA 5KFLA 4FJLA 1JLFA 4HUGA 1K1QA 1JL2A 3F73A 2W8KA 1JLCA 3CJ2A 4CJQA 2OH2A 5F8MA 1C6VA 4FLWA 2WONB 4NRTA 2B6AA 3OSNA 3NF7A 5KG1A 4DQSA 4NLWA 3MAQA 5KFBA 4KB1A 4ZVHA 4RW7A 1C0UA 1T94A 4HVJA 3TAFA 4WFZA 4B9UA 3PW5A 2B6AB 2FBVA 3SV4A 2YKNB 1A5WA 3VQPA 2FVRA 4YNQA 4TXSA 3LALA 3QNNA 4RW7B 3DLGA 1C0UB 2XCAA 1CSJA 3VQDA 5KFCA 3A2FA 5J2PA 3V1RA 1DLOA 1LW2A 2B4JA 3RMAA 1XR6A 3ITHA 3LPTA 1S4FA 3SZ2A 4J9QA 3QGHA 4DWIA 2A1RA 4CEBA 3KLFA 2BANA 3CDUA 4JUZA 4EEYA 3V9XA 4EP5A 1S0NA 1VSIA 1EKEA 4KV8A 3ZT0A 5J2PB 1DLOB 2XY6A 3HPHA 4M3XA 1GOCA 2YV0X 1NK6A 4CGFA 2XY7A 5I3UA 3TABA 1N4LA 2IA6A 5HP1A 4MQ3A 2BANB 1QSLA 1JX4A 3HVRA 4TQSA 3HYFA 3ZSRA 3C6UA 5C24A 3OYJA 3RBDA 1S9GA 1IH7A 3Q8PB 5HP1B 4ID1A 1UOCA 4ZP8A 3QETA 1JLQA 4FLXA 4WXOA 3PW0A 3PX0A 4WFYA 5C24B 4J2BA 1GOBA 4KTQA 1S1WB 1FKOA 4YMEA 2YNGA 3CM6A 4CGHA 3T5KA 5C5JA 4QWDA 4HUEA 4FM2A 5K14A 2BDPA 1RT2B 2HWHA 4CJ3A 4RNOA 1C1BA 1C0MA 3LANA 1C1AA 1Q9XA 4R5PB 1JLGB 4IRCA 4WZMA 4KRFA 2R8GA 4Z4HA 4B9TA 2VG7B 2D41A 5KG0A 3EZ5A 1S9EA 4KHRA 1S0MA 4KE5A 2ZD1A 4RW9B 1C1BB 5DGBA 3LP2A 2W7OA 1NJYA 2IDOA 4TY8A 3QEVA 3OYDA 3GIMA 1S9EB 4AHVA 4E0DA 1TKZA 4PWDA 2HWIA 4E7JA 3LP2B 4F4WA 3K58A 2EC0A 2XCPA 4IBNA 2BE2A 2WK4A 4KI6A 1KVBA 2F96A 3HP9A 4MH8A 4YR2A 3T5JA 4QAGA 1SUQA 3OHBA 4PWDB 4DSIA 1NK5A 4CEFA 2FC0A 4K4WA 4FM1A 3DMJB 4ED0A 5L9XA 3M8PA 1QSYA 1S6QB 3WNFA 4HYKA 1W9HA 3I0RA 3T3FA 2FVCA 4I2QB 4PUOB 3KIOA 3H5XA 4C8NA 3M8PB 2AX0A 4AHUA 4M3RA 1HNIB 4CFBA 2X6NA 2HHUA 2GC8A 2UUWA 4KAZA 4Z4IA 2DPJA 2YNHA 4FZYA 3I0RB 5C25A 1TK8A 1L3SA 4NLDA 4NCGA 5KFWA 3V9SA 1QHTA 3KKSA 5I42B 4F2RA 4CGGA 1N5YB 1L3TA 3SQ4A 1RBTA 4CIEA 2KW4A 1I3AA 4JRQA 2AJQA 4CHQA 4NRUA 2XY8A 4ED7A 3NH0A 3NH2A 5SWMA 2KZZA 4DG1B 3M9OB 5CY4A 3V1OA 2ZQBA 4WYWA 4DTNA 1S1TA 4FCYA 2Y1IA 4FW1A 1REVA 3CVKA 2UUTA 3GQCA 2RF2B 3OL9A 3H59A 1ZTTA 2DFFA 5F9LA 1JLAA 1HJRA 2IGIA 4KI4A 4O4RA 2VWKA 3S3MA 5KG2A 1MU2A 4K8XA 1S1TB 2UVUA 3K5NA 1X1PA 4EP4A 1TKTA 1KHVA 1CZ9A 1LW0A 3HVAA 3TR8A 2OPQA 5KFTA 1XI1A 3AVBA 1BQMB 4FJKA 3D45A 1NKEA 3N6LA 1A5VA 4KHYA 1MU2B 4TY9A 3G86A 3OL8A 3PW2A 1TKTB 3OYEA 3PJWA 4JLHA 2WCXA 3AVIA 3RB6A 2EHGA 4CJKA 1NJZA 1TKDA 3HT3A 4X2BA 3RAQA 1WSFA 4E89A 4KHUA 3IGVA 4Y1CA 4DL4A 3AVAA 4NYFA 3HL8A 1X9MA 2W9CA 2W8LA 2ALZA 4I2PA 4RZRA 2P5GA 1ZBFA 1TV6A 4DTRA 3SUNA 5KT4A 3QIOA 5JXSA 4IRKA 4O0IA 1TK0A 3PJXA 2HHSA 4H8KA 1VSLA 5FRMA 5HRNA 3ZT3A 2W9CB 5KFGA 3HSTB 1RTDA 2FBXA 2GBZA 3NBPA 3HVTA 2R8JA 4CGJA 4O3RA 1TV6B 4EO6A 4F50A 1UA1A 3OYGA 4QCLA 3DRPA 3DRRA 3G6VA 1D5AA 5DQGA 1TAQA 1TKXA 4F2SA 2LSNA 3AVHA 2IC3A 1Z26A 4HTUA 1RA6A 3ZSWA 4NYNA 4O5BA 5KG3A 4DTMA 3DRPB 4ELUA 3AO2A 2XWYA 4W5TA 4GW6A 5HLFA 2XC9A 3TQ1A 1Q8IA 4MKBA 2IC3B 1N56A 4DF4A 2IM3A 3B6PA 4KB0A 1QAIA 3PHEA 3KLEA 5JS2A 2J6SA 1RBRA 3GIKA 3KD5E 3IN5A 1ZTWA 4ED6A 1QQCA 2VA3A 1SKSA 4F3OA 3DLHA 3LZIA 3EY1A 3LZJA 1TK5A 4BWJA 5HLFB 3DLKB 5D3GB 3PVXA 2ZE2B 4CGDA 3KOAA 4FJGA 3MEEB 4WYLA 1RILA 3KLEB 1J9AA 3FDSA 5F9NA 4B8CA 1S1UA 3QYYA 1KCFA 3OYLA 3SFUA 4NCBA 3KD1E 5F8GA 3PV8A 2NUBA 4YFUA 1X9WA 3DOLA 3O4QA 3CDWA 1S48A 4BDZA 4OPKA 4ID5A 3M8QA 2AQ4A 4CJ4A 1RA7A 1NJXA 1IM4A 3NAIA 1B92A 3AVLA 2YHBA 4ECQA 4CFCA 4FJMA 3DOLB 2JGUA 3L8BA 2RDJA 2R8IA 4BE0A 2W9BA 3RRHA 4ID5B 4KKOB 3M8QB 2UVWA 4RW4A 3LP1B 5KFKA 3BREA 4OPJA 3ZCMA 5HRSA 1ZBUA 2AWZA 4Z4FA 3RMCA 1T03A 2YKMA 2KFZA 2A1SA 1RT4A 4URSA 4NLYA 3NF6A 3P5JA 4UQGA 2C22A 4TLRA 5DG9A 2W9BB 2JEJA 4RW4B 3AO5A 5KI6A 1KFDA 3D28A 3SQ1A 2JC0A 1HNVA 2ITGA 1D9DA 2BQRA 1TGOA 3T19A 5KFSA 1T03B 2YKMB 2BQUA 3MXMA 1I39A 1RT4B 5KT5A 4KAIA 4ECZA 1IKWB 1HRHA 1TVRA 1NK4A 5KFZA 1BQNA 3UIQA 4HCCA 4QWAA 1C0TA 3OVNA 3QIDA 1HNVB 4CJ5A 3LAKA 3HHKA 1HMVB 3SYZA 1BQNB 4K4ZA 4DEZA 3ZSQA 1U09A 1NNDA 1IKVB 2PY5A 4TYBA 1C0TB 2B43A 4I9LA 2D5RA 4OVLA 4QWCA 2QV6A 1VSFA 4DU1A 2G8VA 4AH9A 4LY7A 4IQXA 1WLJA 4NLGA 1RDDA 3OJSA 3LWMA 3M8SA 2UVRA 1LAWA 4ECXA 3KJVA 2VG6B 3KLVA 4KHQA 4CJLA 4CEEA 1HYVA 1WSIA 5KFQA 3CO9A 1JXBA 2XHBA 1SH2A 4ED2A 4B9SA 4O44B 4Q0BA 3ZSOA 4CFDA 4G3IA 3CJ0A 3PY8A 1JLEA 4QOZB 1SKWA 4G1QA 5HBMB 4C8MA 3KJVB 3H5SA 3AA5X 4HKQA 4WXWA 1T3NA 3ZSYA 3ASMA 1S9FA 3KHGA 3AVFA 3QEPA 5KFOA 5T7BA 4Q0BB 1JIHA 1JLFB 4ECWA 1RYRA 3IG1A 3CYMA 4E7IA 1JLCB 4CEAA 4DFJA 4WZQA 1JLEB 4ZVGA 4CK2A 4G1QB 4NLQA 1KVCA 1RDBA 4EYIB 3CFRA 4CJEA 2ASDA 4YR0A 1NK9A 4JS5A 4JV0A 3H40A 2W9AA 5J1EA 3RR7A 3EZUA 4NLOA 1BIZA 4CHPA 3ISND 4L8RB 3NAHA 2Z1HA 3QINA 3MEDA 3GYNA 3ZSXA 3KKRA 3CQ8A 3M8RA 1SL2A 3I5CA 4MK9A 3DLGB 1VSMA 3L2VA 4QW8A 5J1EB 2HW3A 1YTAA 1R0AA 5KFHA 3T5HA 1LW2B 3QZ7A 3ITHB 5SZTA 1RT7A 4AHSA 2D0CA 1UAXA 4DTJA 1YVUA 4BWMA 2VWJA 3DI6A 3KLFB 3I8DA 2I5JA 3IRXA 5T14A 3V6HA 1VSKA 1WNSA 4KV8B 3MXJA 4CECA 1EXQA 3DM2A 4RU9A 5FDLA 3L2RA 1S5JA 5CYMA 1CZBA 4M42A 5I3UB 2Q3SA 1NK0A 2GIQA 3AO1A 3DI6B 3SUOA 3GIJA 2OPSA 4MKAA 2I5JB 3IRXB 3H5UA 3UR0A 2HHTA 3T1AA 3C6UB 4K4TA 1BCMA 1S9GB 3DM2B 5FDLB 4DQIA 4IR9A 5CYMB 4CHNA 3DLRA 2XO7A 2HVIA 1VRTA 3SPYA 2OPSB 3DOKA 5HROA 4Z4GA 2R2SA 1JLQB 1EP4A 3C94A 2AGOA 4DL5A 1DTQA 4J9NA 4AHTA 1IKYA 2WTFA 2C28A 4ZVFA 4ZMMA 2OPRA 3PX6A 1FKOB 2YNGB 3QERA 3OS0A 2UVVA 5E41A 3KK3A 4N41A 5K14B 3GV5B 3I0SA 5HROB 2AX1A 4DLGA 1U04A 4J9RA 3VQ5A 4FK2A 1DTTA 3NDKA 3MR2A 1IKYB 1FK9A 4M3TA 2HB5A 3TAQA 4OLAA 4W5NA 4CF9A 4FK4A 4DQPA 2F8TA 1QSSA 4FS2A 5J2QA 3ZT1A 2F8SA 3KK3B 2ZD1B 3BR9A 4FVMA 4IDKA 1DTTB 4KTZA 5KFRA 1FK9B 2FBYA 3ZT4A 1BIUA 3ZSZA 4MK7A 4H4MA 1S10A 3BSAA 4TY8B 2C2RA 5DLFA 4AHCA 4DL7A 1HYSA 4H4OA 4AILC 3U3YA 1TKZB 4IDKB 3QZ8A 3NFAA 4HUFA 2RDIA 4B9LA 4TQRA 2D3UA 4XIUA 4J9KA 3UQSA 4ZTJA 4OLBA 4OKJA 4FYDA 1ZETA 3CFOA 4CEQA 2BE2B 4DL3A 4C8LA 3GV7B 1RT5A 1F21A 1SUQB 1UWBA 4CHYA 3K5OA 5KFJA 4DLEA 3KLGA 4QW9A 3OHAA 2KTQA 4CEDA 4TN2A 3FFIA 3O4NA 3WNGA 1BGXT 4I7FA 3GIIA 1Q9YA 1RAJA 5DGAA 1RT5B 1UWBB 4IR1A 2R7YA 1ZYQA 3B6OA 3OYIA 4LH4A 3CIZA 4RNMA 4FJ5A 4W5RA 5KFEA 5DK5A 5KFYA 2IJNA 3BDPA 3AA3A 4DTSA 2G8HA 3PO5A 3H5YA 4I7FB 2JEIA 4FLTA 2IJFA 4Y3CA 4NLVA 4KHWA 1C2PA 4CJVA 2YNHB 2BR0A 4F4ZA 3E01A 5C25B 2R8HA 5KT6A 3L2QA 4NLXA 4NCAA 4NCGB 1KSPA 3HJFA 3BSOA 3NKYA 3NH1A 1TAUA 1RDRA 3HKWA 2IM1A 1LAVA 4YR3A 3E01B 4FJXA 3CFPA 4E1NA 3PW7A 3DLEA 2YNIA 3QGGA 1XR7A 3V9WA
chains in the Genus database with same CATH superfamily
2ZJRQ 4HEA9 3TSQA 2HGLA 3FZBA 3MM5A 4BBYA 4Q2MA 3C6TA 2D4WA 3H6EA 2B8QA 1VQPS 3I56N 3VA0A 1BUPA 4C11A 1EZZB 1JLAB 1NJWA 3CULA 3UNGC 2DITA 4ECUA 1D8YA 5AQMA 1DBDA 3MM5B 1IXKA 5IT9Y 3OYHA 3LPYA 1YTUA 4RO0A 3WQUA 2HK2A 5ETPA 3CCLS 4F3TA 5M1FA 3O3FA 3ZZPA 1WOPA 5KFIA 4CTAA 1S1XA 4HH1A 1GTHA 3K0SA 3HD1A 2KRRA 3D3CJ 4FWOA 3MGJA 4DS5A 1NGAA 4WK3A 3CCWA 2XHCA 3A5LC 4IFVA 3OLBA 3AVKA 1KN6A 4ILJA 2JJ4D 4JYAK 4HL9A 4EBDA 1YJNN 2QA4S 4CTAB 5CZ1A 2ZUGA 1B3TA 5DMRA 2UUBK 1QVGM 2DH8A 1NU4A 3E9LA 2NRWA 1N6QA 4B3SJ 3VQCA 4R8UA 4IFVB 1R59O 1EX8A 4O0JA 4E19A 3UPFA 3NGUA 2E1RA 1U25A 1XNQJ 1RTDB 1JJCB 3T9NA 4PA1A 1N6QB 4FWNA 3F44A 4RNNA 2WSCC 3CJAA 3SUPA 4R8UB 4CD1A 1AT1B 1KQSR 3CC7S 4QWEA 2DPIA 5FD1A 3DXKA 4NA3A 5JS1A 3GMGA 2P5VA 1C1CA 1ZPWX 1L3UA 2V9WA 5CABA 4RUAA 2FLNA 2EKNA 1OSDA 4KREA 4JI5F 2M52A 3OXFA 2PDAA 4FK0A 4UF4A 3O9TA 3L2WA 3DXKB 3THVA 3UCZP 2MQMA 3QQCD 4M94A 4HACA 4FW2A 4PQUA 5AFUA 2E6LA 4OPHA 2QWOA 4XEIA 2AEFA 2HMIA 1WI8A 3KLIA 2FC8A 2HGMA 2YWKA 4BRCA 1YJWN 2VOOA 5A0YB 1IBLK 2L9DA 2W7PA 1V3RA 1SJ1A 4HACB 4DZ6A 3LGNA 1RQ0A 3KK7A 4PQUB 1ZAVA 3THPA 2JH3A 4QPXA 2VONA 1BU6O 2OMLA 3AGRA 3KLIB 2WRMA 1S1UB 2XM3A 2ZWHA 3TAMA 2J9DA 5THWA 1X0FA 1IVZA 1FXXA 1MDUB 2HYIB 3PG9A 5BPMA 4DTXA 4DU8A 3SQ2A 2HWTA 4U6PA 4DR3F 2QM1A 1RACB 5ETVA 2NR0A 4CP5A 3G6ES 4WIIA 3E1YA 1Q1KA 3H4BA 1ESVA 2O8EA 3TAMB 2Q66A 4OZ1A 3ZSVA 3CCJS 2I8EA 4FJJA 5KG4A 4DTPA 2LCWA 2VWBA 4P74A 2DXFA 3HHLD 3WHIA 3ET6B 1VQ8S 1IQTA 4YHHJ 4CM0A 2O8EB 2DNNA 3WX8A 4B9NA 3TWHA 3ENVA 4DR2F 3NEKA 3GR1A 1NKBA 5L1JA 1OPZA 3L7PA 3RB3A 2V4QA 5GAGP 4MIWA 1BWFO 2UU9J 1N36J 1EARA 4Z0UA 4J37A 4USTA 3ZTRA 3ZZYA 4JHDA 2CPZA 1KTQA 1WG5A 1NKCA 3CDAA 4DV2J 2FXUA 1RB0A 4XDCA 5GAEU 3KFWX 3DJCA 1GMVA 1NGFA 1TVRB 4JI3J 1UKUA 2DNGA 5TKWA 2VASA 3VVTA 3QEIA 4K8ZA 3L4QA 3T1HF 1SH0A 3CCQN 3VEVA 4DR4K 4FBUA 2WC9A 2FJEB 4X66F 4QIVA 2VQEK 3NL0A 4C0HA 1XMOJ 1WOQA 5C0YA 1OWXA 1T05A 2MZTA 3OTEA 2ZH4A 2FJXA 2ATLA 4KH0B 2I7NA 2OTJN 1RCOB 5KRSA 2E2PA 3TI0A 1FD8A 4E8UA 2DR5A 2FZKB 1BY9A 3VWSA 1RT1A 2H9ZA 1PO6A 1XNRF 2XBPA 1T05B 4HHUA 2MHNA 2PI5A 4YOUA 4UZBA 3W60A 2CPJA 2V6AA 3CJQA 3RYLA 3G6YA 4LH5A 2R7OA 1RT1B 1D9FA 4RUBA 3O8WA 1RBVA 4V1Ak 5D0EA 2DNLA 1EQ0A 4NLPA 4YOXA 4X62F 4RW8A 4DV5F 3NGZA 1NAQA 4HT7A 3M30B 5I3QA 4ZLNA 5BPLA 5KG7A 2YH1A 2C3YA 3MR6A 1C4CA 2O8BB 3MM6A 2QO3A 4RW8B 4Q43A 4M63A 3MEDB 4CGIA 3G2XA 1PSDA 2YHWA 4JV5K 3SMZA 1CC7A 4DFKA 1VQ5S 3HMJG 3BGRA 5CZ2A 3MM6B 4ZITA 1KQFB 3NCQA 4LF9K 2Q31A 4BGBA 2GFFA 1Q4RA 1FW6A 5M1PA 5ITHA 2E2OA 1JLBA 1FT8A 1NSAA 2HURA 3EE8A 4J5OA 2KT3A 1WBDA 3BGRB 1VQ4S 4DCPB 2V34A 4GKJJ 3NVMA 1I51B 1WSJA 3IC1A 4C3LA 2BEFA 4O3OA 1JLBB 1P9YA 4CM2A 2E9ZA 1NB7A 4M3YA 4XPEA 4FWKA 2R3VA 1KLNA 2Q36A 4KBIA 4CBUA 4L3NA 1SKRA 4ZCKA 4Y2CA 1JLGA 5D77A 2VHGA 4AD6A 1N88A 4YP3A 3W8GA 1VRTB 4FDFA 5M2RA 1EP4B 1S3XA 1N52B 1PAEX 1T95A 2WAQD 3ILIA 1RWUA 1S1VA 2FD2A 4BHQA 2MQNA 2Y8YA 3H90A 4Y0FA 5EDWA 3PFEA 3V5RA 4DUZK 1Q81O 3UNYA 3FCVA 3NHGA 3CPEA 1HX1A 1Y5IB 3Q8RB 1S1VB 3O1WA 2JWNA 4BE2A 3EMTA 3PM9A 4P9SA 2E66A 2YHXA 4GKKK 5J2QB 4C9DA 5DG8A 3GG0A 1T9TA 4NZ6A 3BB5A 3PYEA 3AA4A 4DV1J 3QT6A 3DN9A 2RS2A 2HNYA 5F8NA 2J76E 3R7SB 4H4OB 2YCHA 3EXYA 2ZM6K 3EM1A 4I2QA 4ED5A 4M3ZA 4PUOA 4ANEA 5B09A 3KHLA 2HNYB 1I1GA 3NF8A 2MQOA 3O44A 3CJ3A 4FM0A 4RNFA 3HFZB 4ZVEA 4A8YA 4ZLLA 3FFIB 4KSEB 3H8YA 4DL0C 2GHWA 3G0ZA 5I42A 2UUAF 3OS1A 4J9UE 2CQBA 4CJWA 4DV4F 4FZZA 3T5LA 1RDWX 3AO3A 1AXQA 3CCMS 4NEYA 5AXLA 1FTCA 4KGZB 4KHPJ 1J5EJ 5KPTA 1SL1A 4ECYA 4OZNA 2ZVIA 4FLVA 4NWBA 3HK2A 3FFKB 4DR7F 1PIEA 2BGGA 3HPGA 3S41A 4FS1A 5LL6Z 1ZAXA 2RF2A 3ZT2A 4CHZA 2RHKA 4C1NK 4M95A 2OYQA 1WC3A 1HR0F 5M1OA 4GC7A 3FK4A 1ULRA 4IOAQ 2PYJA 2BJ1A 4DMNA 3QEWA 2XULA 1A9NB 2OZMA 2K3KA 5DO2A 4Y28C 1HWUA 5F8LA 4KH4A 2PFFB 3MURP 3DXMA 1M1GA 1WSEA 3ALYA 1ILYA 3BR8A 3SJJA 4KQZA 3JAMU 3KNAA 1K6YA 1KFSA 4A61A 4N5SA 5FROA 2VFSA 3R6LB 2QZ8A 4M3UA 3DXMB 5H1SV 3UDVA 1HARA 4KB7A 4EBCA 5KPZA 4NXNF 3E9OA 4TSXA 1NM1A 1FXRA 1X3NA 5E5NA 1F1BB 2DGWA 2DR7A 1RDAA 2JFDA 2BXJA 2P9KA 2E1CA 4LMZA 4PKGA 3OJUA 4BR4A 3FBEA 4JI8F 4LFBJ 1RTHA 5L1LA 2F9TA 3WEEA 4P2SA 3R9PA 4DV0J 3S3OA 4CCHA 5KFAA 1K73T 3DDKA 2ZUAA 2G8IA 3VQ8A 1Z6RA 4LF8J 1J5OA 3QPIA 4E3SA 1H2VZ 2CQ1A 2MHEA 3A12A 3O80A 4RCHA 1RTHB 1X0PA 4ZPCA 5LOQA 1TQLA 1WHXA 3BF3A 2NXUA 1RHKB 4IO8A 3T6JA 1J5OB 3ENOA 2J6UA 2YJEA 3OY9A 1JXEA 4JKGA 2CIMA 3SDEA 4OHZA 4IG3B 2BJ3A 2B9XA 4DTOA 2WW4A 1U47A 4B8AB 4MKVA 3FEXB 3CJTA 2W40A 2O5DA 3U6FA 2HIYA 5DM7Q 3DLBA 1LKZA 4BE1A 1WKLA 2VCPA 4FN5A 4IDHA 3EUNA 2QRRA 4QZVB 4CBXA 1X5PA 1Y97A 2KXFA 2E2QA 2VA2A 2J0SD 2CPXA 4EYHB 2DNKA 4JYAJ 3AARA 1DQ8A 3P4IA 3AAQA 4CE9A 1X4AA 1U1OA 4N47A 2BVZA 1NM2A 3GE9A 1MWKA 4B02A 4IXCA 3ZNJ1 4FKYA 2JEGA 3EEQA 1B64A 3MR3A 5HQMA 3TEHB 1K73O 3T41A 3SBMA 1RWMB 5KFFA 4OMFG 2AEMA 2HHQA 4Q8FA 4CH0S 4OLPA 3T1YK 3E8OA 2UUCK 4JKFA 3LP1A 1XR5A 1QVFM 3V1QA 3KNGA 3L6QA 4J2EA 3VZIA 1S6PB 2CGLA 1QTMA 2PI4A 1SJ3P 1HLWA 2W41A 3MECA 2K7KA 4GMJB 4ZN3A 2G2YA 4JV1A 3RB4A 3BQ1A 4CJ7A 1SC4B 4QR2A 4NX9A 4IO1A 4GVBB 4C2MA 2RRBA 3MECB 4F7VA 3HF5A 5AQSA 4OJRA 2WFBA 5LMNF 2CDQA 1IQZA 2P9CA 1IBLJ 2KFNA 4LR7A 5IOLA 2FVPA 1RTJA 4WF9Q 3TYTA 1U48A 4FJHA 1RT6A 2Y1JA 5AQQA 3JSBA 3QMQA 3O6QA 4HH0A 4DJBA 5DQIA 3IS9B 4WP9A 2YH0A 1T6DA 2R7VA 4H0OA 4E1MA 1RTJB 5JVGQ 5B0BA 4IOAL 4BACA 2NZCA 2M4MA 1RT6B 5CH7B 3PXGa 3IR5B 4PXEA 5GINA 2VPWB 5J2MB 3OSPA 3E66A 4BC4A 2NSBA 3VGTA 5EWFA 4URGA 2BH1A 3R27A 3W2VA 3SBGA 1R6VA 3NGIA 2YQ3A 3NGDA 3BGLA 2ASLA 4MIAA 1WG1A 1XWLA 4FF3A 3Q0AA 3ZTOA 2C2DA 2HRUA 4E7LA 1RUSA 3I31A 2UZAA 4YB5A 2FLPA 2P51A 4ZN1A 3W2VB 3O3HA 1D0EA 3H2LA 3CD5A 3QJJA 1N32F 2NQPA 1JLCA 1M5SA 4CJQA 2OH2A 1WHYA 5F8MA 4GRSA 4LF7K 1IR1A 3NF7A 5KG1A 4DQSA 2DIUA 4NLWA 4PL8A 2O66A 4KB1A 2LXIA 5K8MA 2HQDA 2FGCA 2YQ1A 2KHDA 3VAKA 3Q8VA 4JKCA 3IRWP 1X3MA 2B9EA 2G0IA 4PG4A 3TAFA 4FWPA 4ZPWR 4IOCQ 1F60B 1ICEB 1BWVA 3VQPA 3P4UB 3LALA 3OPKA 3DLGA 2XCAA 5HVGA 3OBIA 5KFCA 3CMEN 3MHYA 3NS5A 3LPTA 1K44A 5GAHP 4HDHA 1S4FA 3SZ2A 4USWA 3CDUA 4BC2A 3OXGA 2MKIA 4QPTA 1EKEA 3KG1A 1RTZA 1G1XA 2YV0X 1VK8A 4CGFA 2XY7A 4PG7A 1EKSA 2HPUA 4FWRA 1DEJA 1JNZB 2ERRA 2ZH7A 3HYFA 3OTBA 3C6UA 5DM7L 5C24A 4PPDA 4B1UB 1S9GA 5ADZA 4BR7A 1F2GA 3Q8PB 2IMOA 5KAKA 2QLXA 1HKAA 2E1PA 2KDOA 4WXOA 3PW0A 4A8FA 1W2BM 1WACA 3CCSN 5C24B 1FTRA 3EVMA 4YDUA 3CW2C 4A8QA 3MD1A 5M1NA 4YMEA 4CGHA 4QWDA 2BA9A 4B1YB 5GAGI 2PD1A 1PJ7A 1C1AA 2RE2A 1Y00A 4Z4HA 4JV5J 4BC5A 1L3KA 1S9EA 3PSFA 2ZC4A 4X64F 5B08A 4G65A 3UN2A 3LP2A 4LF9J 3IAS9 4LFCF 4HHHA 5HMZA 1FNOA 4FNHA 1S9EB 1YJRA 3MCAB 4JKAA 3OTOJ 2H48B 2GAGC 3LP2B 2HBQB 3K58A 5FPEA 4IBNA 3E3XA 4NA2A 1BOTO 2FY8A 2YTCA 3GJQB 2JLFA 4JI1K 2W1BA 3U1LA 1SUQA 1NK5A 2AV5A 4K4WA 5HAOA 3DMJB 4CYUA 3K9KA 4ED0A 3MD3A 3TO8A 3JTOA 2HFSA 1QSYA 1S6QB 3WNFA 1O6XA 4ID8A 2FVCA 2C3MA 2PIIA 3FRYA 4CYUB 3JSRA 2FC9A 1YI2S 3OBYA 1HNIB 2UUWA 2OCEA 3UKRA 1SC3B 2OEKA 3U8XA 1M0SA 1F9HA 4DUZJ 4ZVPB 1WEZA 1J27A 4FP9A 4NLDA 2P9SA 1UWAA 2OHDA 3CCUS 2HK3A 4CGGA 1VQYA 3UKRB 4GKKJ 3SQ4A 5AQGA 4CIEA 2KW4A 2AIRB 3PIOQ 1LCUA 4JRQA 1ZM4A 3LW5C 3JB9k 4LBHA 3S1TA 2EG2A 3M9OB 1OY6A 5CY4A 1NZAA 3O1BA 3V1OA 2ZQBA 4DTNA 4FKXA 2E20A 4FW1A 1WJ9A 2EG1A 1O51A 2EI5A 2XSJA 3CVKA 2ZM6J 2MTLA 1OPIA 3GSIA 1ZM2A 3OL9A 3H59A 1HJRA 1M90T 3S3MA 5KG2A 1MU2A 4AL5A 4AYBD 3AGKA 2XS2A 1KHVA 4RLEA 3HVAA 2XSJB 4CLPA 3TR8A 1X60A 1BQMB 4BG8A 2DEJA 2DHGA 3THWA 4LIRA 3N6LA 2KB2A 1MU2B 5GMEA 1XBWA 3G86A 2EFVA 2DGQA 1FJCA 2WCXA 4CH1A 1T9UA 3RB6A 4A57A 1NJZA 4ILLA 1HPMA 1Q8BA 4BRDA 3VAIA 3THWB 2ZHAA 3JTNA 4Y1CA 3GFYA 1VQOS 1DY3A 4NYFA 3HL8A 3BY5A 2W9CA 3MEKA 2G1HA 4ES2A 2ALZA 4I2PA 1C4AA 1FDAA 4LIWA 4OHYA 2ZH2A 5AE3A 1Q82O 2HFZA 2MZQA 3VEXA 4NPOA 4O0IA 4E2FB 2FHJA 2Z2YB 4HWIA 2C2NA 2IY5B 2W9CB 4ZVRB 4JKHA 1VR6A 2DISA 5KFGA 3HSTB 2GBZA 3SJHA 2DXEA 1JWWA 4CGJA 4JI7K 4WTOB 2FHMA 2RU9A 2ZGZA 1R8PA 3W65A 4DR6F 2EW9A 1TKXA 4F2SA 2LSNA 2XLIA 3AVHA 4PKDB 4L74A 3P6YC 5ADXH 1YHQN 3ZSWA 1M90O 3KVGA 3FZMA 5IT9O 1FXDA 4O5BA 3B82A 2W25A 2XWYA 4W5TA 3TQ1A 1N56A 2R7RA 4WQ5A 5GADU 5CD4H 2KG1A 1QAIA 3CEDA 3PHEA 5JS2A 3KD5E 4ED6A 1ZTWA 1SVDA 1QQCA 2FLOA 3DLHA 3LZIA 4DCJB 3LZJA 1TK5A 3DLKB 3AAWB 4ZA1A 3PVXA 4CGDA 2A3JA 1SIZA 3ZZOA 4ZLPA 2LLZA 3MEEB 2G0CA 5E3AA 3HSCA 3X3UA 3IP0A 1J9AA 2QWLA 1KCFA 3CD0A 5C2FA 3ATVA 3KD1E 2XMWA 1P1TA 5AQHA 4LR8A 3DOLA 4WJBA 3WBZA 2QFJA 4BDZA 1XJWB 4OPKA 1NO8A 3RRKA 2AQ4A 1HHSA 1JJ2R 2Y1RI 4UQTA 1RA7A 1RWNB 3NAIA 3VAMA 1FRIA 3J7ZT 2YHBA 4CFCA 1FEHA 3DOLB 2R8IA 2CNKB 3N4QA 3M6GA 3RRHA 4KKOB 3OXLA 5LL6d 5KFKA 4I6YA 1FJGK 2FIUA 1E4FT 5HRSA 2AWZA 2G2OA 4CT8A 4Z4FA 2G9OA 2YKMA 2KFZA 1AROP 1LXJA 4URSA 4UQGA 3NF6A 4A8WA 1RU1A 3AO5A 5KI6A 1KFDA 2W7AA 2F7TA 1ZZNA 2RMLA 1HNVA 2MKSA 1D9DA 5AQXA 1TGOA 2YKMB 4ILHA 2EWSA 4K0KK 1IKWB 3PIOL 1BQNA 2WVBA 2J0WA 1N33J 4QWAA 2GMHA 5ADXA 1HNVB 5HMWA 3HDSA 4CQ1A 1HMVB 2E5JA 1BQNB 3T1YJ 4F36A 3ZSQA 2UUCJ 4I9LA 3HI0A 2V8VA 3E9PA 3EGNA 1WKJA 1OO0B 1VSFA 5CD4A 1F0XA 3GJTB 4DU1A 1D9AA 1WLJA 4NLGA 3OJSA 4YS2A 5HJYA 1GLBG 1WDDA 2UVRA 4ECXA 3KJVA 2NREA 4V19J 1V6HA 3J7ZO 5KFQA 3TA1A 5D6GA 1SH2A 4EMDA 4ED2A 4B9SA 2XZTB 2AHOB 3CHWA 5HBMB 3KJVB 3AA5X 4HKQA 3ZSYA 2ZH5A 1S9FA 4L73A 4USHA 1IBMK 4ECWA 3R5CA 4Y65A 4UY8T 1YRTA 1RAGB 4ED4A 4LRDA 4QJVA 5HMXA 1RDBA 3EGWB 4F4AA 3LGMA 4C98A 3G4SN 3L4IA 3UB5A 3I32A 3A3OB 2W9AA 3RR7A 4L8RB 3NAHA 4U9RA 1HNWK 3PSIA 3K8VA 3M8RA 3K17A 1H72C 3S01A 4KY3A 2ZZTA 4AM7A 4MK9A 3HTVA 2HAFA 2MQ8A 4U7BA 1U6ZA 4H4KC 2C2OB 5LJWA 3T5HA 3J81j 3KG0A 1KAZA 1RT7A 4AHSA 4DTJA 4C7QA 3TEGA 1YVUA 1KC8T 1P9QC 3CMAS 1IV0A 1KQKA 1YXQA 2VC1A 5IC6B 3GWCA 3LQVA 4CECA 5BJRA 2P9LA 1HNZF 1EXQA 2AYEA 3DM2A 4RU9A 3L2RA 1S5JA 4LF7J 5I3UB 1KQSM 4Z37A 2Q3SA 1S6OA 4WYBA 1NK0A 1FWKA 2PEHA 1Y7PA 3SUOA 3GIJA 4X65F 1UCNA 2XTJP 3CJKA 3T1AA 4K4TA 2P9LB 3DM2B 2R4FA 3FZKA 4P6QA 1SBRA 2KRBA 5C2GA 2HVIA 2AP6A 4UY8O 3DOKA 4Z4GA 3CJKB 3CD6S 4DL5A 4J9NA 3JAMY 3QGPA 2Y0BB 2W4CA 1S59A 3VENA 2EFOA 2YNGB 3OS0A 1NU0A 2ZOFA 1XUPO 1J6ZA 3GLJA 4FK2A 3JSYA 2OTLS 2WBNA 1WBBA 2VUGA 3TAQA 4M5GA 4PR6A 5EXWA 4W5NA 2IYGA 3FCHA 2GZOA 4FS2A 5CXTA 3ZT1A 5AE1A 2F8SA 2CG8A 4I64A 3U1NA 1RAAB 3TVYA 3IBCB 1U1PA 2H51B 3UKUB 2FBYA 1BIUA 2JHEA 3BSAA 1KC8O 4FVUA 5FIIA 4OO1J 4DL7A 1O0PA 3B8AX 1I94F 4I68A 1TKZB 2Z58B 3SCIE 3NFAA 2KJWA 4JEPA 2D3UA 2PMZD 3UQSA 2JWLA 2KYXA 4OKJA 2ZJQL 3LDOA 2IVOA 4CEQA 4D3HA 5C2CA 2J0QD 1CZAN 4DL3A 4BR9A 1RT5A 1UWBA 3WIVA 4ZIWA 4PKHA 5D4NA 5KFJA 4DLEA 2G1DA 4JP8A 3BKFA 8AT1B 1FESA 2BJ9A 1QTNB 3TW0A 1JB0C 3CCVS 1HL6A 5IWAK 1FRMA 4ZVQB 3HJVA 2W2OP 2YKOA 3TX8A 1RT5B 1UWBB 1HWJA 2BX6A 1ZYQA 3B6OA 4F26A 3PKYA 1RHRB 2Q3PA 2W2PP 2YWGA 5D0HA 2HSTA 4X4QA 4YOYA 2HZAA 3MPWA 2XMUA 2LQBA 4DR5K 1C2PA 2YNHB 4F4ZA 3E01A 5C25B 2Z57B 1OYDA 4NCAA 3DHXA 1UJ6A 1R0BG 2AYGA 2WZ1A 3FVYA 2MMYA 4I56A 1X4BA 4JNEA 3HKWA 3P39A 1PYSB 5ELZA 3HZGA 2VDHA 2A10A 4YR3A 4JI1J 3E01B 4FJXA 3A8EA 2NPIA 2V2VA 1UZHA 3FUYA 3M32B 3LPEA 2IFXA 1V4TA 3DAWA 2G8KA 2QSFA 1TZ0A 1D1UA 1QY7A 2O01C 4H5TA 2IM2A 1CXQA 2M0GB 2ZVSA 2J7UA 1VRQC 2B7BB 2UXDJ 1BISA 2MY8A 2LU1A 2QMXA 3VV2B 2P8IA 2Z1IA 1CJUA 3ZTQA 3EDRB 4TYAA 3RRGA 3PFOA 1AZSB 2OPQB 2AGQA 2B9YA 3L3UA 3J8AA 5F41A 4IH5A 2VGNA 2V67A 2HF3A 4YY3K 3HPOA 4PWWA 1N34K 1CJUB 2XMAA 2BV3A 2O67A 4CLWA 3M2VA 3C14B 5ETTA 2BM0A 2A6AA 1WUUA 3J7YU 4C8ZA 3MI7X 4BRPA 2AKWB 4OX9K 1S77D 5A6PA 3D0PA 2RPIA 1JKHA 4OZ2A 1RDCA 2DEIA 2RQCA 5T41A 3L3VA 1U1NA 4GC6A 5AXMA 1L3VA 3RG6A 3F9KA 2KXHA 4RNHA 2J9DE 4BR2A 2OEJA 1YJNS 3D7EO 2L9WA 2SXLA 3V6KA 3EWGA 4C48A 3MEGA 4DSFA 3NBPB 3HVTB 5KFPA 2CQ2A 1TL1A 3M6XA 1VQKN 3DRRB 4WQ5C 2OKQA 1IG9A 3P83D 1VCTA 1BHNA 1DHMA 3WUHA 1RABB 3KWIA 4LF6J 2HS3A 2YWWA 1TMJA 4B3SF 1G7CB 2ATQA 3TUIC 2Q43A 5KFNA 3TARA 4M8LA 1EKRA 3TUPA 1MROA 1ASVA 1S7HA 3A5NC 1XNQF 3R7NB 4BGAA 2V69A 5EOYA 3BEGB 4KJIA 1SJRA 1FKPA 1OY9A 3A8JA 4NLCA 1TL3A 4AL7A 4NLTA 1MROB 4CJFA 4U67Q 4BC9A 3S9HA 1N5SA 1RWOB 4QIFA 4JS4A 2BKPA 4IOBA 1M1KT 1XN9A 2DNRA 1TL3B 1AW0A 5BR8K 3IMXA 2W4PA 3R5BA 2WBRA 5L1KA 1QLNA 1VQLS 2HNDA 3BJYA 4C23A 2Q2RA 1GX6A 1N54B 1VQ7S 4RTFD 2AU0A 5DJBA 2HEKA 1HFEL 3HHDA 1KEKA 2BKOA 3GV8B 1RBSA 2HNDB 1GT8A 3QLHA 3IWXA 3U4LA 5IT9U 1IO2A 5A2QU 2IVFB 1HBOB 4ZCIA 2V8HA 1ZZFA 4KO0A 4P73A 3B78A 2CNOB 2RH3A 1VBYA 5C12A 3QLHB 2ZNZA 1U45A 4BY9C 2E7WA 2WHOA 4LVNP 2E9TA 5C7PA 4M5DA 3HVWA 4X4NA 5AQKA 4ZHRA 4KO0B 1TL5A 2YVSA 3P96A 2VF3A 1R8AA 3OYAA 4LSLA 3CSKA 3WC0A 3MM9A 3OFFA 4O8UA 3PR4A 1KHWA 4ZP9A 4YHHF 4M5JA 4QIWD 4NLRA 1M1KO 3T9ZA 1EX4A 2GUPA 4B3TK 3AAPA 2UU9F 3MM9B 1N36F 4JI0K 1GTEA 2GVDA 2MZSA 1FJGJ 2DNPA 3BP8A 3GFXA 5HRRA 1TUVA 4DV2F 2YNFA 2F9JA 2A6OA 3DXSX 3Q2SC 2DGSA 2OI2A 2PA3A 4RBTA 4JI3F 2RD5C 1RNHA 4MFBA 5KTQA 2M3DA 3DOMA 4CI6A 4QIGA 5DZ6A 2OTJS 1N5QA 2UXCJ 1Q18A 3SMPA 2YNFB 2H5IB 1VQNS 4K0KJ 3H3NO 1XMOF 4HR2A 1YQHA 4MFBB 2Y3YA 3DOMB 4ECTA 3T69A 4J9VA 4R0JA 5GIOA 4DTUA 3IG1B 1U0SA 1HYZA 3A5MC 2DYAA 4N8OA 2DY1A 3FQLA 3N6NA 1NSKL 1VISA 2R7TA 1MWQA 1XMQK 2CQ4A 4OZ5A 4PY5A 2C3PA 2DFEA 2KKZA 3EE3A 3OFHA 4DV7K 3KKFA 1XEZA 4RBVA 4WKRA 4K4SA 4XH4A 4O3QA 3D0GE 4LJMA 3H1QA 1OSCA 4LF4K 4HLBA 2K1RB 3N5BA 1SL0A 5LMUK 3RW6A 4Q5VA 2CAJA 4DPTA 4LF1A 3BN4A 2HMPA 3CE8A 4CZGA 3MM7A 2QKKA 1WELA 5DG7A 2XGPA 4RPFA 1CJTB 2XI3A 2XGQA 1PC5A 1IBMJ 5F8JA 1AUSL 2ZEJA 1S1WA 2M2BA 4PPZA 3MM7B 3PW4A 4BRAA 2Y9HA 3NF9A 2QT7A 3VQ7A 3LP0A 3K2YA 3TNVA 1OMSA 1HKBA 3F2KA 3ETMA 5J2NA 2R7WA 1VK0A 3WT0A 3KHRA 4R5PA 5EU7A 2QWMA 2QG9B 3KUEA 3V4MA 4U67L 2VG7A 3I82A 1GOAA 4MTPA 1W0HA 3LP0B 1ZH5A 3QESA 5BYSA 2E29A 1AUDA 2VB6A 4K2XA 4RW9A 5J2NB 1DTQB 1U1QA 4GKJF 4B08A 4NI2A 4GNIA 2AP1A 2OPRB 1WF2A 2RUSA 2PAVA 1TFYA 2CDRB 2IAJA 4LT6A 3C8YA 1UVIA 3NMAA 4IRDA 4WE1A 2HHWA 5G4DA 1T44A 3OQ2A 5D78A 3BKUA 4NI2B 2H4YB 2CJQA 5F8IA 5E3RA 3I55N 2JVOA 2IAJB 4PL7A 4I0WA 2EPIA 4NLUA 4WE1B 3MFHA 4OZ3A 2VBZA 5M1QA 4H4MB 1ELOA 1TL7A 3A8IA 2YPYA 4G1IA 1JCEA 3TAPA 2IS3A 5KFXA 3BQ0A 3PZPA 4JOUA 4KPYA 4UOGA 3K5MA 5KRTA 3KDNA 1VSEA 1RWXB 4QOTA 1RGVA 1MWYA 3DU5A 4V19X 3RBEA 3PYFA 1WSHA 2NZTA 4CK1A 2XEXA 2VQFK 4HHTA 1BC6A 5D15A 2WUSA 2EXUA 4DV1F 2GV9A 4QBUA 4FSVA 4KGKA 4CZCA 1YAGA 4RG8A 1YIJN 4HTLA 4JRPA 3FSXA 3BSNA 3VCDA 3KTQA 1WTFA 4DG1A 1IKXA 2X51A 1HKGA 2NXNA 3KJNB 3PLAA 3BKTA 2F65A 2V2KA 1T3VA 1UFKA 1VQPN 2QKBA 3JQKA 3V9ZA 4M7XA 3S8SA 4EZ9A 3OFGA 2QA1A 1IKXB 2HBRB 3OA9A 2ADCA 1MNEA 2P1JA 4OZ0A 2D0BA 4E7KA 2LFVA 3CJRA 4P2XA 5AQJA 2K7JA 1KWMA 3CIPA 5F3ZA 3HT0A 3DLEB 1NXIA 4KHPF 3G71N 2RT3A 2GELA 1J5EF 5IWAJ 3GTYX 3T6BA 3UDLA 3JYTB 3MF5A 2E1AA 3MMAA 4FVCA 1G4CA 1YDLA 2ZJPQ 5EWGA 3RU0A 4DX6A 2P9NB 1HIYA 2QA4N 3HHNB 4A4JA 1Q5YA 3K2PA 3S6EA 3B8HA 1FRXA 4DR5J 3FLCO 3MMAB 4C8OA 4JI2K 4BREA 5CYQB 1D3WA 3GPAA 4L72B 4AL6A 2KHOA 5B0DA 3CCES 2PYLA 1NJIT 3KMSA 2OSQA 3MX5A 4DFPA 5I4MA 6AT1B 2GIFA 4BDPA 4LBPA 2V94A 3TSUA 1OIAA 4WCEL 2FZCB 4ZP7A 1U24A 5E7OB 3CC7N 1HNXF 4MMOA 1TYQA 1EETA 4FLUA 4V19S 3JSMB 4J9OA 4CF2A 4M41A 3E51A 1CVJA 3PYDA 3GYXB 1TP7A 5DQHA 1ZBHA 4O4GA 3VN5A 1ZBLA 4CZKA 3POTA 4MIBA 1EETB 1ACMB 3SV3A 2A0FB 1M5PC 3M8WA 4LFBF 3AVGA 4O4GB 3ENQA 7FD1A 4DV0F 2FF3B 3POTB 1OVQA 4FZXC 1WDTA 4K4VA 3F9MA 4YY3J 3OS2A 4O3NA 4PHTX 1V3SA 1N34J 5D3GA 4K50A 1FX2A 3SBTA 3MDFA 2LXFA 4U7CA 1KOOA 2B3TB 4J91A 4DQQA 4CLFA 3P1GA 4DSLA 2EBGA 2J8SA 3ILLA 2KI2A 5CZVA 5FLXU 3BYPA 5U47A 4CO5A 2J6TA 4OX9J 7FDRA 3DXBA 3IMQJ 4DSKA 3DLLL 1NJIO 3R97A 1M5KC 2HHXA 1Z2ZA 3N9UC 3OL6A 2ROEA 4OV1A 2DFHA 1CG2A 4LQ9A 3K8WA 1B99A 2LECA 4OHVA 1RCXB 2XHWA 3CCJN 2VDIA 4U7UD 3FC9A 3OW2R 2YHAA 3GU0A 1VQ8N 2RQKA 3VZHA 4Y0WA 1BL3A 3BF4A 3QO9A 4JYAF 2V4RA 1PCAA 2GW8A 4DDFA 3SLCA 2UUBF 4OV6A 2FHKA 5HL7Q 4OYIA 3VESA 3VQ9A 4KFBB 3QO9B 1ZPVA 2RDDA 5EWEA 3ATUA 3PDNA 3VERA 3FBBA 1WNEA 1G3OA 2RKIA 4H5RA 4URQU 3CWJA 3HLUA 3H08A 3M2RA 4GVEA 2OA8A 1VRUB 5KOWA 3I5AA 3NGYA 2RKIB 1QAJA 2P6TA 3I8BA 1VSHA 4DUYK 1IKVA 2JFKA 3M2RB 3VF4A 5BR8J 3FMWA 3VTIA 2Z0GA 2QYGA 4UUWA 1E6VB 4WQ4C 3QAEA 5CZXA 4K41A 1VC5A 2HZCA 2BMBA 3I9V9 2VJVA 2JNJA 1NPRA 3LDQA 1F6TA 3GCWP 4IQMA 2MKCA 4KHMA 1LNQA 3HOTA 4A46A 4P75A 4X62J 1IBLF 2CZ4A 4HVZA 4N7TA 1R7IA 1VMBA 5KGXA 2ZJPL 3N6MA 3IM9A 4BRGA 2D0AA 1NB2A 3LP3A 2NPFA 4FJLA 2QC3A 2X3DA 1K1QA 2DHHA 3AD8C 1JL2A 2W8KA 2Y1LB 1U2VA 3CJ2A 5DDOC 2R7SA 2ASOA 1X4FA 1RFQA 4FLWA 3ZLJA 2YPZA 4NRTA 3OSNA 2VIHA 3CJSA 2Q1NA 4ZVHA 3DU6A 2XWXA 4LFAK 1F5AA 3HFVA 1T94A 3GJSB 3O5TB 3HZEA 1RKJA 2LDYA 1CS4A 1ZXOA 1NRKA 4B9UA 3O9SA 4OYWA 3WXKA 1VQ5N 2YKNB 4JI6K 1A5WA 3QNNA 2NCKL 1V5VA 1TL4A 2GGPB 2BTFA 3D6RA 1LW2A 1KXPA 3PIPL 1NGGA 3RMAA 1XR6A 4B3TJ 1NGDA 1CS4B 5AQUA 3BBBA 2BABA 3KLFA 1VQ4N 2BANA 4EEYA 3THTA 4EP5A 1PC4A 1YITN 1T02A 4KV8A 4HDGA 5EX5A 5IFMA 3CC4S 1BE4A 1GOCA 3GP9A 2WB1D 3QT8A 1NUEA 3DCAA 5HP1A 3NXZA 2BANB 3Q7CA 1JX4A 1H1VA 1V3ZA 3CI5A 2MQLA 4DR4F 3W66A 2RILA 3OYJA 2VQEF 4WFAQ 6FDRA 3RBZA 2HHHK 5HP1B 4ID1A 4ZP8A 4PXDA 3GYGA 2X1BA 2Y0SD 2COLA 2NUHA 4KTQA 2IBOA 2DB1A 1SJFA 4HUEA 4Y2KA 1RT2B 4OI4A 4CJ3A 1HWKA 1XMQJ 1C1BA 3LANA 1Q9XA 4DV7J 1Y5LB 1SS6A 3DWLA 3O08A 2R8GA 3NRBA 1F9EB 2D41A 2X1FA 3EZ5A 4KE5A 2ZD1A 3E2EA 5MLCV 5LMUJ 1RGIA 1C1BB 1UVNA 5LY3A 2W7OA 3CJCA 1NJYA 2IDOA 3R5DA 3W9IA 3BZCA 5IT4A 4QIEA 3ILOA 3OYDA 1DURA 1Y10A 3MMBB 5HL7L 2CNNB 4PWDA 2V68A 1JJ2M 4H0PA 1RWPB 3AJ1A 1U0HA 5LSOA 2ZBPA 2XCPA 2UUAJ 3AXMA 4A8OA 4MYUA 5AJ3K 3WQTA 3HP9A 4YR2A 2CZ9A 3L4BC 4H0XB 4QAGA 1NGHA 4JV5F 2HRYA 4PWDB 3ONQA 3ZC4A 1S5ZA 5HVFA 1I5OB 4DSIA 4OI6A 3D1OA 3VEOA 1FKAF 4FM1A 2F9WA 1U0HB 2HQGA 5JICA 4KR0B 4LF9F 3M8PA 2W2NP 2MLXA 1T9VA 1N0UA 3CCMN 4DR7J 1PG5B 3UWTA 2BOAA 2R42A 5IV4A 3I0RA 3HULA 4WK1A 2BUNA 4XH5A 3AQOA 3M8PB 2F4FA 4AXIA 2CPYA 4BC7A 4AHUA 4YN3B 3TZYA 2X1GA 2HFNA 2X6NA 2HHUA 4KAZA 3ZNUA 1RBOB 4Z4IA 3I0RB 2CVEA 5AQOA 2RQMA 1FVSA 4NCGA 3LDLA 2FSJA 2YKAA 1QHTA 4B17A 1N5YB 1I3AA 4OIXA 2AJQA 1YG0A 4CHQA 4ED7A 3NH0A 3R8EA 5SWMA 3W62A 1CQMA 2OIHA 5E33A 1S1TA 5HQ8A 2GWJA 1HKCA 2HQFA 3J80Y 2BJ8A 2KN4A 4DUZF 1O13A 2DFFA 5MAOA 1JLAA 3EJMA 1PAUB 4LF8K 2IGIA 2P9EA 2VPYB 3VF2A 3EKSA 1S1TB 4W4MA 5GAEI 1QD1A 1HI1A 2IPOB 4GKKF 2E44A 1H98A 2ZH8A 1CZ9A 2QLBB 2VQFJ 3MXHP 1XI1A 3AVBA 3AY0A 2DGOA 2CQCA 2ZNYA 4CNYA 1NKEA 3D45A 2HGNA 4KHYA 4TNOA 2P6SA 3PJWA 5A2QY 1NGIA 4FF2A 1WB9A 3TRGA 2EHGA 2ZM6F 2D69A 4CJKA 4CNZA 2PFDA 2ZDOA 4LRBA 3P45B 3UI3A 4X2BA 3RAQA 4E89A 3FZ2A 2PGCA 3H42A 2IDLA 4KHUA 3IGVA 1YBAA 4FZVA 5C15A 4DL4A 5CQGA 3OV7A 5BN9A 1FCAA 4NYPA 1KDNA 5B0EA 1ZBFA 1TV6A 2CPDA 3SUNA 1WC5A 3U1MA 3DGPA 3PJXA 3SAHA 4PEOA 4H8KA 4BQLA 5HRNA 3QSIA 3JTPA 1XQIA 1RTDA 4JBCA 4WFAL 2QTDA 1Y0HA 2R8JA 1RI7A 4O3RA 1TV6B 3H7HB 2XNQA 1EAYC 1UA1A 4EO6A 5L39A 4FF4A 3OYGA 4QCLA 3DRPA 2JDJA 4U7UK 4L76A 1D5AA 1WF1A 3DGPB 5DQGA 4PZVA 2CQ3A 2VFVA 4EU0A 2POKA 4HTUA 2M5YA 1GXUA 3D0HE 4NYNA 2CJAA 2VICA 4A8KA 4P52A 5HOOA 3DRPB 4ELUA 3EXCX 4GW6A 5HLFA 2XC9A 1D8ZA 1YJ9S 2VPXB 2EKYA 4MKBA 2FGOA 4JI2J 2DJWA 1HBUA 1TELA 1U7LA 2GAHC 2KM8C 4YOWA 3IN5A 2ZC3A 2WSEC 1TTHB 3HHLB 3EY1A 5HLFB 2EWHA 2ZE2B 3FNNA 5A0YA 1HBUB 4FJGA 4WFNQ 1RILA 3BPDA 3HSGA 2F4VK 3H2UB 1S1UA 2MPUA 3IR6B 4NCBA 5LM7E 2XS7A 2NUBA 2HSEB 2ZBIA 1YX2A 1XERA 5LMNJ 3M8QA 1HBNA 2LQ5A 4WP8A 1CQNA 3AJ2A 3ILJA 2KXNB 2QWRA 2ITMA 3R3LA 3L8BA 3LH2S 3U27A 2W9BA 3VOVA 3M8QB 1HBNB 4RW4A 3ET6A 5GAHU 4OPJA 2PO4A 2LQ8A 2NLWA 4A8SA 3ZCMA 4FYWB 2OEMA 3SCLE 2ZH6A 3RMCA 3RBXA 2V2ZA 3OTCA 1UVJA 3NNAA 5E3PA 4K7QA 3ENHA 1ZBTA 4TLRA 1T9YA 2R7QA 2W9BB 1F5CA 3KUGA 2JEJA 1NWKA 3BH7B 4RW4B 4O8KA 3SQ1A 3T19A 5KFSA 1I39A 1HRHA 1TVRA 2ZH3A 3ZYYX 3QFHA 3HD2A 5KFZA 4NEZA 3UIQA 4FYXB 4HCCA 3VPZA 3P5TL 1WHWA 3CCZA 3OVNA 2LA6A 1N32J 1YGYA 2YJFA 3FSYA 3ULHA 5GIPA 4AQYK 5BYRA 1WF0A 4U95A 1U09A 1NNDA 2XYGB 4TYBA 1X5OA 2B43A 1H73A 1Y3JA 1UMJA 1O8BA 2D5RA 4OVLA 4QWCA 2QV6A 2ZJRL 4LY7A 4BROA 3CJ8A 2CADA 3LWMA 2JL9A 4KH5A 1M5HA 2VG6B 1TR0A 4OYOA 4KC5A 4CEEA 5AZIA 4O44B 4G3IA 1GLAG 4OI0A 2CPHA 1RWVB 4DZDA 3H5SA 3A8YA 3T1YF 3G82A 1T3NA 2UUCF 3ASMA 1H0HB 5AZIB 2IA0A 1JIHA 1JLFB 1RYRA 2AYBA 2J7WA 5GMDA 1MLAA 5AXNA 1VLYA 3CYMA 4E7IA 4DFJA 1CJKA 4WZQA 1R31A 4CK2A 3M30A 4NLQA 4OHWA 3G82B 4EYIB 4DUYJ 2GV1A 3B4DA 3CFRA 1KBRA 3QWUA 3VAGA 1F3FA 4OPAA 2O8BA 3TZWA 3EZUA 5A76A 1FF2A 2FYXA 1CJKB 3MEDA 3TX0A 2BM1A 1FHTA 4CLZA 4BLGA 2E1ZA 1R8HA 1FWLA 3L2VA 4QW8A 1X4EA 3BM7A 5KFHA 3ITHB 2D0CA 3O9RA 3R2DJ 2VWJA 3LDNA 3I8DA 4JI4K 3V6HA 2PMHA 4G6VB 2FJAB 1VSKA 3L7OA 1NNEA 3L95X 5FDLA 4M42A 1ZA2B 1ZBSA 4OX6A 4P7TA 2R7UA 1K47A 4X64J 1U8WA 1BUXA 2W2MP 4MKAA 2GCFA 2HHTA 4LFAJ 3RW7A 2FDNA 4IJNA 3OTOK 4A59A 2VBXA 3KWGA 1CBKA 3PRBA 2JWKA 1BCMA 1YF5L 5FDLB 1ZAWA 4IR9A 4CHNA 3KYLA 5HO4A 2BOPA 4WFNL 3MZIA 2C2MB 1VRTA 4JI6J 1YJ7A 2GMLA 2R2SA 1JLQB 2E5HA 1EP4A 4BQZA 1IKYA 4ZVTB 3ZXWA 2C28A 1B7YB 1FKOB 3QERA 4LF7F 4JD2A 5K14B 2AX1A 4DLGA 1U04A 4JK8A 1DTTA 2LMIA 1IKYB 5AQVA 4C8YA 4W90B 3A4TA 2HVDA 3FMBA 5E26A 4DQPA 2F8TA 1U8SA 2PN6A 1URRA 5J2QA 4JD2B 1GLFO 3BR9A 5A8WB 4ISGA 1DTTB 2BE7D 3QT5A 2LA4A 3CJ7A 3ZT4A 2BBEA 2DD8S 4TY8B 3CCRS 2QEXS 2I0XA 3EN9A 4H4OA 4FXWA 3U3YA 2HHHJ 3QZ8A 2CG4A 2G4BA 2JX2A 3Q89A 2M9KA 2RDIA 4B9LA 4OX7A 5I3PA 1YI2N 3GB0A 1GXTA 4PRFA 3CFOA 2FF6A 2BE2B 1H6KX 3IDHA 1Y9OA 1T3OA 2CQ0A 2JZ5A 3UE2A 1PJ5A 4CHYA 2XYHB 3D2EB 2KTQA 3GR0A 4TN2A 3FFIA 1RK8A 3NGKA 3CCUN 3M6WA 3WNGA 2GHVC 1S12A 4I7FA 5B7WA 4XH1A 3CXCR 1WHVA 3NGRA 3SK3A 1EO1A 4IR1A 1Y4ZB 3SSSA 3A5OC 5E2QA 1C0GA 4RNMA 2JLGA 5EVZA 4FJ5A 2AYMA 4W5RA 5KFEA 3VAHA 2IJNA 4DTSA 2G8HA 1REGX 4I7FB 1YBUA 1UTAA 3KJFB 2BR0A 4QU7A 2N3LA 4E1JA 5AXKA 5FLXY 1MN9A 2HKEA 1UETA 4ZKAA 5A6WA 1SQKA 1LWXA 2H3GX 3BSOA 1TAUA 5AJ3J 5EY4A 1PYTA 3HHEA 3PCOB 2MZRA 3WDOA 3U7JA 4DPUA 3PW7A 3WXLA 1R6YA 5AZJB 2YNIA 4ETZA 1RHUB 3W63A 2I2YA 3VQQA 5DS7A 1Q95G 1WSGA 1MN7A 1REVB 3CG7A 5AQLA 3MXIA 3U9ZA 2YNIB 1WWHA 4E98A 2I38A 1VQON 3BDEA 2GTDA 2HNZA 5IV3A 4B3RK 3C6AA 1BI4A 4CZFA 4FWLA 1N48A 1VBZA 1LW0B 4JI1F 2H5EA 3AOAA 1VIOA 4QWBA 1YKWA 3MMVA 1SZ2A 2OZSA 2HFVA 2HNZB 4W5QA 3D7SB 1J54A 2K3IA 1BI4B 4N76A 1G15A 1T9WA 2WSFC 3MCMA 4PWUA 3DRSA 2DNQA 2MXYA 2GEMA 2D7SA 1RZMA 4EZ6A 1Z05A 2B51A 2UV8G 1CXUA 4C0BA 2FJWA 2DRBA 2LYVA 4B3MK 1ITGA 1QJHA 3QIPA 2NUUG 3DRSB 4R79A 4ZTFA 5K20B 3ID6A 3OR1A 4KH1B 1XHZA 2B4PA 2C42A 5KFVA 2FVSA 2NNWA 3MN9A 3EPIA 5FPNA 1RU2A 3D6HB 4DHVA 3QIPB 2WW8A 1DGKN 4IG3A 3NP5A 1QHAA 3OR1B 1NLKL 4YORA 1LK7A 2Q0RA 3WIUA 4DFMA 1VQ6S 4JAXA 1IM6A 1YJTA 2ZHBA 2O4GA 2ACYA 1UPPA 1VHFA 2V0NA 2H4WB 4XTTA 1HWIA 3BQ2A 3WXMB 2VL1A 1CC8A 3MDQA 2G8FA 2VBWA 2W6KA 2DTUA 2QIFA 2G8UA 4FLZA 2DT9A 2ILYA 3VQEA 4YEAA 4B1XB 2ASJA 2XI2A 3AODA 5CAAA 3AO4A 2PMWA 2H5JB 1Q79A 4TU8A 3I87A 5AQRA 4LF6F 4K8RA 2MZJA 2E6MA 4H0VB 1N33K 4IO9Q 1IBKK 1BG3A 5A8RA 4YOTA 3BEXA 1S6PA 1S0VA 4CVNE 3WQPA 2VC0A 3VTHA 4CJRA 3IAYA 1LV5A 2UXBK 1WOSA 5L8RC 4ES3A 2F40A 2XZWA 5HANA 1LWCA 3RMBA 5A8RB 4ECSA 1DQAA 2K2PA 4Q8EA 9RUBA 2XMMA 1YT3A 4M5KA 4GVBA 3A0IX 2KKHA 3MCSA 5CCLA 4JI7F 2D1CA 1Z2LA 3C66A 4LQ3A 1BD6A 2OD4A 1LWCB 2Z30B 1H7WA 1U49A 1OQ3A 1IWGA 3VQSA 2YWFA 3RAXA 2RRNA 4XO0A 4DU4A 3AJDA 1FJ7A 2FZGB 1FFSB 3PR5B 2F4VJ 1GMWD 3CC2S 3SCJE 4F4KA 3IS9A 2W4DA 4KHSA 1MWMA 3HSDA 3PYGA 3TAEA 4PYAA 4NXMK 3VHQA 2VFUA 3ZX0A 5J2MA 3FZHA 2Z2ZA 4JV2A 4ILRA 2ZZMA 2ZDPA 3A3PB 5IZHA 1VSDA 3T7ZA 1ITPA 2GIRA 1WN7A 2X6SA 4BRHA 2RN2A 2FJVA 1WEXA 5B0CA 4ICLA 4ELVA 3R9LA 4LF2A 5D0RA 5H1SQ 4HCBA 4A5AA 1N5TA 4WU3A 3M9MB 1UW4A 2GA7A 3BZKA 2C2ZB 3AVCA 2WOMA 4I69A 2C2KB 4ELTA 2H54B 4GVMA 3WNEA 4ICLB 3TPQA 4HI1A 4ECRA 3ZEUA 1RYSA 2BACA 3MR7A 2WVFA 4Y34A 1IBCB 2A40A 2WOMB 3K7RA 5C2DA 4CIGA 1WTBA 3G87A 1YLXA 4RW6A 2GO8A 3HO1A 3ZEUB 5KT3A 4ILGB 1DKGD 1FJGF 3CJ5A 1GQEA 3M4XA 1W25A 5LXYA 3MPYA 4AQYJ 2NLXA 4RW6B 3CMAN 3GZ7A 2OJ3A 4M63C 5E3QA 4KHNA 1SXLA 4X4SA 4QYZK 2XSFA 1HBMB 2RSQA 5BPNA 2CNLB 2BYCA 2XO6A 5C42A 4K0KF 2WVDA 4DPYA 5KT2A 1YZ7A 5DLGA 4Q7AA 3ZZUA 1NBEB 5K5MA 1YSJA 4BRIA 1LEOA 2XRIA 1LWEA 2P9UB 4F4XA 3TVZA 2Q1LA 1B70B 4IG0A 1Q0NA 4JK7A 1R0AB 4CJSA 1YZ6A 2NRXA 5C42B 3O1LA 1JXLA 3NAEA 2O8CA 3CJ4A 2YKPA 3IR7B 4FXDA 2HBJA 3CD6N 4H5WA 2RE1A 1LWEB 4DR1K 4IG0B 1VQ9S 4B9QA 3SCXA 4R25A 3FBCA 1ASUA 2O8CB 1JJ4A 2OFGX 3O6WA 5CA5A 3ICLA 4CZMA 4OYAA 1NCLA 4MYTA 3OHRA 5F8HA 1P27B 4J9MA 2HFOA 3GILA 2HVZA 3BGOP 4Z4CA 4IO9L 3M5RA 1IBMF 5KGWA 2VPZB 2IBKA 3ENBA 1NEEA 1GEHA 3OLAA 2JLEA 2AZ1A 5KT7A 3M1VA 4ZP6A 4PCQA 1T7PA 3I0SB 1UA0A 3U02A 4BS2A 2FQQB 4Y2AA 4JI4J 1K9MT 3H98A 5ETRA 3US5A 3Q86A 3J7A1 3OW2M 2IM0A 4OJ1A 4EK2A 1HNWF 2IMWP 4PXBA 4DSJA 5GADI 2C1EB 3M1VB 1HWLA 3I33A 4CJPA 3EO3A 4UOCA 1QQOA 2HBKA 3DMJA 1PBAA 3VA3A 2CYYA 2MJNA 2DHSA 3D3BJ 4GV9A 1HYSB 4AXJA 1S6QA 4LF5K 4ISEA 3SQOP 4GO5X 3R5AA 3EGVA 2NXJA 3QJLA 3BO4A 1WSVA 3LF0A 1TFWA 2E5LK 3MFIA 3SI6A 2LEBA 4L3QA 4PG8A 1HNIA 3MUTP 4WF9L 2AGPA 3X1LB 4NZ7A 2KVQE 1S79A 2UXDK 3KLGB 2QE5A 2O4IA 5KQ8A 3TTCA 3ENWA 1GLDG 4USIA 1X5SA 4BDYA 5JVGL 1GFWB 3SSQA 2DNOA 1FXLA 2YWEA 2MQPA 2QWPA 3EL2A 3SQ0A 5JUMA 2IDEA 2CPEA 4PG5A 5EUHA 1B7FA 2GUIA 1IWAA 3MM8A 2YBVA 4R0EA 1R89A 1VAZA 3TTFA 1K9MO 3Q23A 2MY7A 2Z1GA 3MTKA 3AA2A 2QGFB 1S0OA 3P49B 4AF1A 3AVJA 3PRDA 3H46O 3P31A 4WWSA 2Q0UA 3PO4A 4BC3A 3MM8B 3C0BA 4O3PA 1U6FA 1VFJA 2MLZA 3MTJA 2G8WA 4I6AA 2FHOB 2HHVA 3SEOA 4CO4A 2VGMA 1BQMA 1KNZA 2QXFA 2V8DA 4HT5A 3C15A 1BQXA 1UL3A 2FVQA 1X4DA 3EPGA 3C6TB 1WORA 2ZITA 4IOCL 3LM9A 5F0XA 4F8RA 4C11B 4CK3A 3G71S 3AH6A 4BRMA 1NHVA 3DLJA 3C15B 5E84A 4S0MA 1HD1A 3MN5A 4DV3K 1CPZA 2V5HG 2I6WA 4FNIA 3ZTPA 4LF6K 1TUUA 3D1HA 2IRYA 4ZJLA 1VLOA 2DNHA 5LJ3Y 5HRPA 4FWSA 2DCUB 1FDBA 2V63A 1WD6A 5IWAF 3QICA 1S1XB 1NK7A 2PA8D 3G6XA 3N5FA 2DPNA 3MUVP 4MO5A 3SNNA 3KLHA 3OYNA 1RBUA 4M1KA 3FKBA 3J80O 1BMQB 3KK2A 1S57A 4CESA 4Y1DA 1G2EA 3ZTSA 3I9ZA 1UEKA 4CIOA 4DR5F 1Z25A 3NCIA 3QEXA 4B3OA 3KLHB 1IN0A 4DQRA 5IXUA 2M8HA 2FLLA 3HSZA 5DDPC 3KK2B 1U2RA 4B3RJ 1VC0A 4LD0A 3KHHA 4B3OB 4FF1A 1Y5NB 5A2QO 4JKDA 3V6DA 4QYRA 3VQAA 1C1CB 3DLKA 3VR1A 3EZOA 1DT9A 2ASYA 2ABYA 1LWFA 3MEEA 5BN8A 1YRXA 2RRAA 2YKQA 1LFPA 3CPWR 4OGEA 3ZZTA 2LU2A 3KMQA 3IGNA 1FEEA 4DBQA 4B9VA 3V6DB 1U1LA 3G25A 3N79A 4B3MJ 1FRHA 1FI4A 4I4BA 5ETOA 1VQLN 1LWFB 3H4DA 3BF1A 2X78A 4WIQA 1VQ7N 5IM0A 1M1HA 1UFLA 2HMIB 4X4OA 4YY3F 3QNOA 1YRUA 2FJBB 1N34F 3VGKA 3N4PA 3O9UA 4GV3A 2BRKA 2D3ZA 4A5BA 4LSNA 5IM0B 3N28A 4KKOA 4J9LA 3Q83A 3CJ9A 4FJ9A 1QDUB 4P2FA 4OX9F 5RUBA 4EBEA 3SCKE 2JRSA 3HP6A 3SI8A 1MSWD 3L9ZA 4FPBA 4KTWA 5D4LA 4LSNB 3RTVA 2ZOMA 4OFZA 1ZS6A 3EVWA 3I5BA 4AE5A 5B8HA 1VJWA 3OYCA 3O3LA 2RS8A 1BO5O 3K5LA 2HLTA 1YK9A 3TJ8A 2CKWA 2XZDB 4DF8A 3W1YC 2IOCA 1IKWA 2R8KA 4ZPAA 3AT1B 3C19A 1GLLO 3QDKA 2IJRA 1R27B 3TZZA 4CJUA 1OS5A 4JKBA 2KJVA 2UXCK 2DO4A 1ZC6A 3HCXA 1S72N 2Z1JA 1HMVA 1WC4A 2HQ3A 4L3KA 4K4YA 2GJ2A 1BXNA 4JHDB 1IBKJ 4G1PA 2ZH1A 3SPZA 3AFGA 3GFZA 3BH6B 4BRLA 1RWWB 3VALA 1XIQA 4KH6A 1DRZA 1OKJA 2UXBJ 4RX6A 4CJTA 4ED3A 2JC1A 1KS2A 3AB2B 1VQNN 3LL3A 3HM9A 4DX5A 1JL1A 2Q79A 3U3GA 2A2CA 2XNRA 5I9EB 1FDNA 2QX0A 1SPBP 5HBMA 3FGVA 4USJC 2JEFA 5JVHQ 2QLFB 1PJ6A 1NPPA 5BR8F 5EX3A 2YWHA 5AQPA 2V51B 4K42A 3F73A 2ZHOA 3PKMA 2PSZA 2AMCB 2B6AA 2RAQA 4BVOA 3CQXA 3MAQA 2DO0A 4F3MA 2B4OA 4CW7B 4ILMA 4HVJA 4NXMJ 2N82B 2B6AB 3CNQP 2FVRA 4YNQA 1DZ5A 1CSJA 4GY2B 3TUZC 3A2FA 3V1RA 1Q81T 1DLOA 3QATA 1ZOTA 1FRLA 1WEYA 2Z8QA 3QGHA 4PG6A 5HJXA 4DWIA 2A1RA 4CEBA 3H3OB 3V9XA 3W8PA 3ZT0A 2AEJA 2IVNA 1DLOB 2XY6A 4M3XA 4TVAB 2DIVA 3SMSA 5I3UA 3TABA 1UFWA 2XYPB 4ETXA 4DN0A 4WPAA 5IQQA 2LXUA 4X4PA 1YITS 1JNRB 4F02A 3RBDA 1ATSA 2ATCB 4USUA 1IH7A 4B3TF 4WP3A 4JI0F 4YDUC 4AM6A 3J7YI 2BJDA 4A8MP 4DV6K 1U2FA 2P9PA 5HN0A 3PX0A 4WFYA 5F0WA 4CBWA 1GOBA 4NLBA 1H38A 1KQGB 2VKRA 4NMXA 2YNGA 3T5KA 4MKYA 4FM2A 2HWHA 4USVA 4QYZJ 3VGVA 4QR0A 4RNOA 2P9PB 4GVLA 5D4OA 1JLGB 4FO0A 3GSDA 3OFEA 4B9TA 1GAOA 3NGTA 5KG0A 3AA9A 4KHRA 1QZ5A 4Y6IA 3QWPA 3AD7C 5DGBA 2HVEA 4C6AA 3UKUA 2LDIA 2A6MA 3QEVA 1X31C 4CLTA 3EE9A 4FOIA 4KGXB 4AHVA 1IJEB 2AF6A 3BBFA 4PKIA 1TKZA 2ADBA 4DR1J 4E7JA 1XMQF 3ADAC 3K0JA 2EC0A 2WK4A 4DV7F 1MMDA 2H65B 4NASA 4CO3A 2F96A 4MH8A 1WC1A 5L46A 5D0GA 2V9KA 1AA1B 4LF4F 3BPSP 4DUTA 5LMUF 4CEFA