1JKHA

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
553
structure length
550
Chain Sequence
ISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 146
structure length 550
sequence length 553
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jkhA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jkhA05
4M94A 4OLBA 2YNHA 3KHRA 4O44A 3HP6A 3EPIA 2W9AA 4KI4A 4LH4A 3KLFB 4KHUA 3PUFA 3I0SB 3FFIB 1HNIB 5HP1B 4ED1A 4NLXA 2OPSA 4ED6A 3TANA 5KTQA 1RTJB 4URGA 3RB6A 1HYSA 4LSLB 3FRZA 3TAMB 4IQXA 2FLLA 4YR3A 3TR8A 1IG9A 3M8SA 1Z26A 1BQMB 1S9GB 3WNEA 4CJUA 5KG5A 4K4ZA 3DI6B 1JLAB 3KHLA 1NHVA 3OYIA 3CYMA 3ZT1A 1RT5A 4OVLA 2BANB 4HVJA 2Q3SA 2FVRA 5KFIA 1JLFB 4OGCA 1C1BA 2ALZA 3B6OA 4JV1A 1Y97A 3V4IB 3NAHA 1C0UA 3OYNA 2G8VA 4CJ4A 2BE2B 4F8RA 3LP2B 5DQGA 3UQSA 1R0AA 2IGIA 2ASJA 4J9KA 3QINA 4ID1A 3G0ZA 1IO2A 4BE2A 2GIRA 5I42B 5DG7A 1QQCA 2KQ2A 2GV9A 3NAEA 4MK8A 4ZMMA 1N5YA 4HHTA 4J9LA 4ZPDA 5I3UA 4PUOA 1NJXA 1C2PA 4Q8EA 1VSJA 5FRMA 1WLJA 2KFNA 1HPZA 1CZBA 3DRSA 3QGHA 2FJXA 1A5VA 3HVRA 4JS4A 1S1WA 4IFYA 1RT3B 3KMSA 3DMJB 4MQ3A 3ZT2A 3NGZA 1JXBA 1RTHB 1BL3A 3G10A 2RF2A 3C6UA 4C8MA 4WZMA 1JLGB 3LAKA 3TWHA 2Z1HA 3H5UA 2VG7A 3MR3A 1VSDA 1X9MA 4IKFA 3NFAA 4KB1A 1HYVA 1S1WB 4NCBA 2DFFA 3KOAA 4FBUA 4J9PA 4FW2A 2XRIA 4WYLA 1RCHA 5KT7A 2UVRA 3PX0A 4XPEA 3SV4A 4QW8A 1K1QA 2OA8A 2RPIA 1ZBLA 1S6PA 4KFBB 1FK9B 4RW9A 2OPQB 2WB4A 2OYQA 5I42A 3RAQA 4FJKA 3KTQA 1XC9A 4TLRA 2UVVA 3CFRA 3NGDA 2XWYA 3ASMA 1R0AB 3QO9B 3LP2A 2HVHA 4H8KA 5DMRA 2BE2A 5J2PA 4R5PB 2EX3A 4X2BA 3PW5A 1C0UB 3P83D 2R2RA 5D3GB 4CFBA 4TQSA 3PY8A 3V6HA 3V1QA 3OYGA 5F9LA 4K8ZA 1VSLA 3OL8A 4CF8A 3SI6A 3NH2A 4Q0BB 1WNEA 3T5LA 3OJSA 2WHOA 1NJZA 4DWIA 3QO9A 1S1VB 3OYAA 3KK3B 3KLHB 1RT5B 2C2RA 3P5JA 4FK2A 5J2NB 3AO1A 4B8CA 3H5YA 3UPFA 1L3UA 2OPQA 1FK9A 4RW9B 1S6PB 3VQSA 1S9GA 1BQMA 4NYZA 4MH8A 1S0NA 4F3TA 4QWAA 4E7IA 5KFAA 4B8AB 3TAMA 1TVRB 5KFQA 2HHVA 1RDRA 3AVHA 3ZT3A 3A2FA 1HARA 3FFIA 3KLFA 1JL2A 3OS2A 4ED7A 5KI6A 2VG7B 1TKXA 2YNHB 1U04A 4F4YA 3P1GA 3TAPA 2BQ3A 3C6UB 4KTZA 1RT2A 1OS5A 4GVMA 4CGDA 2G8HA 3NHGA 3TABA 1B9FA 1RTIA 3OL6A 4CGJA 4ECUA 3DMJA 4MK9A 2IMWP 1KTQA 4RW4A 2HNZB 2AWZA 3DRSB 1HPZB 1I3AA 4K4TA 4OKJA 1QSLA 5KT3A 3M9OB 5I3UB 1XR5A 4IBNA 4KB0A 4CEDA 1O1WA 4J9RA 3V9WA 2AJQA 4DSEA 3CJ5A 3PW0A 4FJ7A 1VK0A 2B43A 4PA1A 4ZVGA 3AVJA 4KHYA 4CF0A 3L8BA 5F8IA 1T94A 4OGEA 1VSFA 3MEDB 4PWDB 2D5RA 1EKEA 3CG7A 3VQAA 3NCIA 3I0RA 4QPXA 4EYHB 4Z4EA 3ZSOA 3V4IA 5F8JA 5KFJA 5KG6A 5KRTA 2RKIA 4I7FB 5C24A 1SUQA 4YNQA 3IAYA 1FXXA 4B08A 3QEVA 1QE1A 5C25B 3H2LA 3KLGA 2BANA 5KFDA 3LWMA 5CZ2A 1JKHB 4FJHA 1ZBHA 2BRKA 1WSEA 1RBVA 3U6FA 3DLEA 1JX4A 3IN5A 3KHHA 3SPYA 4IH7A 5DLGA 1IKYA 3JYTA 3OYKA 3MEEA 5KFPA 2HNDA 4IDKB 4OPKA 1QTMA 3RAXA 1SKSA 5F8HA 5HP1A 3K57A 5KFWA 1W9HA 4CEBA 1RBSA 1S1TB 4B9NA 3HJFA 5DQIA 4KBIA 1N48A 2YV0X 3HVTB 2HHTA 4ZPBA 1HQEB 1T03A 3KKRA 4DG1B 1JXLA 3E01B 5EU7A 4DLGA 4DL2A 1S10A 3DOLA 3PJXA 1TKTA 4KHMA 4JRPA 1GOBA 4CHOA 5KT6A 4Q44A 3RR7A 3HK2A 1ITGA 2KZZA 4NLOA 4MIAA 3HL8A 3HT3A 1WSFA 4ZPCA 1TAUA 3KLEB 1A5XA 3L3VA 2HMIB 4ECRA 3TAFA 2FVPA 4CJ3A 4BWMA 4LQ3A 1NK8A 4HUEA 1RT6A 1RT1A 1GX5A 4I2QB 1JLCB 1J54A 4IR9A 3M8RA 3LWLA 4HUFA 4IFVA 1MU2B 3PVXA 4LH5A 3ISND 1K1SA 5K14A 1Z25A 1TL3B 1X9WA 2XCAA 1Z4UA 2E9ZA 2OZSA 4YR2A 2W42A 1EP4A 2AU0A 4DSJA 4CJFA 4LY7A 3QLHA 5KFHA 2OH2A 1LAWA 3BQ2A 4ED2A 1C0TA 1BCOA 2HNYB 3ZCMA 3I5AA 2FVQA 3MFHA 2QKBA 1REVA 1DTTB 4K4VA 2IM1A 2KTQA 3BSAA 1JXEA 1WAFA 4CCHA 5KFUA 1DTTA 4JUZA 3DOKB 2HNYA 4TY9A 4FJXA 3IG1A 2GIQA 2ASLA 1NOYA 1EXQA 1TL1A 3OL7A 4G1QB 3OJUA 1GX6A 2RN2A 1KVBA 3F9KA 1UWBA 3AA2A 3FQKA 4TY8B 3H4BA 1J53A 1D1UA 5KFXA 4BE1A 3AO3A 1QHTA 2XHBA 4NRTA 3NL0A 3JSMA 5K14B 4E7HA 4J2EA 4KV8B 1LAVA 1MU2A 4DTSA 1C1CA 3NF8A 4QAGA 5DGAA 3CJ4A 1UOCA 1KFDA 3VQ9A 3LP0B 2OPPA 3H40A 2R7YA 3OYJA 4F2RA 4M3TA 3WNGA 2DY4A 3DYAA 2HMIA 2JEGA 3AO2A 1IKVA 4DLEA 3QEXA 3N6LA 2DTUA 1JLQB 3V6KA 2AQ4A 2W9CB 3M8PB 1CZ9A 2W7OA 3KK2A 4QOZB 4CFAA 4IH5A 4WFZA 1HRHA 4KSEB 2GUIA 1D8YA 4KTQA 5KFMA 1KCFA 5KFLA 2NUBA 4I2PB 4RUCA 2ATQA 1BI4A 4BDZA 1GOAA 4FK0A 1NKCA 3HVTA 1W25A 4QWEA 3VQEA 3EZ5A 4O0IA 3KJVB 3QIPB 3HPHA 2YNIA 3ITHA 1LW0A 4E1MA 4RNFA 1SL0A 4ED8A 2IC3B 3C6TA 4Y3CA 1J9AA 4DQQA 3DLGB 4JLHA 1TV6B 1ZTWA 3TQ1A 1S0MA 3B6PA 2HHXA 4DMNA 2D0CA 3PW7A 5EWEA 2B6AB 1NJYA 1JKHA 3RB0A 5J1EA 4F50A 4TSXA 4TYBA 4CJEA 2AX1A 5C25A 3AVGA 4O55A 3V81B 5HLFA 4B9SA 4CFDA 1TKZA 4O3PA 1SUQB 4I7FA 1LWEB 3K58A 4AILC 4ZP7A 3HYFA 5KG1A 3VQBA 4ECSA 4K50A 3V9UA 4N41A 1VSEA 1RYSA 1KVCA 2ATLA 3M8QA 2BDPA 2XY8A 2G8WA 4PWDA 4CJKA 5KFRA 2HW3A 1RTDA 5KT5A 1FKOB 5DG9A 3QYYA 1RAJA 3NMAA 3RMCA 1LW2B 3VQPA 4Y34A 3UDLA 4MKBA 3MECA 3LZIA 2ZD1B 4AHRA 1I39A 2IAJA 1KLNA 5KFCA 1SH3A 2HHQA 5F8NA 5E41A 2FJVA 4DFMA 1RTIB 4CEFA 1HQUA 2V9WA 5KG3A 4BDPA 4XPCA 4IR1A 3SUPA 5CYMA 1JL1A 2X6NA 4E7JA 1DTQA 4ZPAA 1VSIA 4EO6A 5KGWA 3I8DA 1T05B 3NF9A 3KLIA 4ECVA 3N6NA 1CXQA 1ZBIA 2XY6A 4FK4A 4GW6A 1NNDA 4I9QA 4FLVA 4WZQA 3HP9A 1EX4A 4GMJB 4IG3B 3PV8A 4KRFA 4RG8A 4RU9A 2FVCA 3CWJA 2WRMA 3OSPA 4ELVA 4NLYA 4W5OA 2F8TA 5J2NA 1TQLA 5JUMA 2ETJA 2R8GA 3PO4A 3KLHA 4KO0A 2ILZA 3NGYA 4URSA 4DS4A 1U09A 3LALA 2VG6B 3K5MA 3FDSA 1XR6A 4CEQA 1BQNA 2UVWA 2FBYA 4FLTA 5KFFA 2XC9A 4MFBA 5J2MA 4CJLA 5D3GA 3GV7B 3EYZA 4R5PA 5J2PB 1L5UA 1KLMB 3AO5A 4MFBB 5C42B 4DFPA 1SH0A 1S0OA 3GIKA 3IGNA 4KFBA 2JEFA 4HTUA 2WCXA 1U47A 3HKWA 2HHUA 2R8KA 3VQDA 4DSIA 1VRTB 2KFZA 3QEPA 3PHEA 4F4ZA 4F4KA 4KO0B 4CHQA 4L8RB 4CF1A 4FJGA 5KFEA 3IS9A 4DL4A 4JV0A 4AHSA 4DTNA 2FBVA 5KFNA 4YP3A 3NBPA 1N4LA 1WSJA 3SUQA 3FQLA 4H4MB 3CIZA 3NKYA 3PX6A 3VN5A 2Y1JA 2E6LA 4CEOA 3KNAA 5DGBA 3RR8A 1D9DA 4EZ6A 1S4FA 3MEGA 5CZ1A 1FKPB 1C6VA 1U49A 3OYMA 4CF2A 3HO1A 1D5AA 1T05A 3OYDA 3PZPA 1RT4A 2J6UA 1NKBA 3T5KA 3GYNA 2HVIA 1VSKA 5CYMB 4DSLA 1G15A 1KHVA 5HRPA 4IKAA 2E9TA 2P1JA 3AV9A 4ZHRA 4PUOB 2D3ZA 3AVNA 4CGFA 4ELTA 5T7BA 1RDCA 1HQUB 4JV2A 5EUHA 1S1UA 2CJQA 2UUWA 4LQ9A 4C8KA 1ZTTA 4B9LA 4EBEA 4FM1A 4FZZA 3OYHA 4NZ0A 5KRSA 4DFKA 2IBKA 1HMVA 4NLVA 2X78A 1NK9A 2F8EX 2A1SA 1WSHA 1NK5A 4DF4A 4M45A 2ZD1A 3PW2A 4CJWA 3D28A 3RRHA 1BIUA 3DM2A 4ZP9A 2I5JB 2P51A 4WYWA 4Q43A 1SV5B 1S9EB 5FDLA 3QETA 3SZ2A 3OS1A 3SCXA 4K8XA 3HVWA 3BREA 5DLFA 4B9TA 3G6VA 4ELUA 2VG5A 4Z4CA 1JLFA 1WN7A 1F21A 4CERA 2FLPA 3QEIA 4DQPA 3UR0A 1C1AA 5F8LA 1NHUA 4W5QA 2WONB 3H98A 1LWEA 1JLAA 4CJ5A 4MK7A 4E1NA 1CSJA 4EZ9A 1I6JA 2F8SA 3V81A 5HLFB 3AVCA 3KHGA 2PY5A 3O4NA 3CQ8A 3QNNA 4Z4HA 4NLWA 4CEAA 3VQQA 4KAZA 4HCBA 3ISNC 3AA4A 3PW4A 1CLQA 3QEWA 2IS3A 3THVA 1HNIA 4KHQA 5J2QA 4NCGB 4K4SA 4OL8A 1S6QA 3D45A 1TAQA 5KGXA 1RDBA 4O44B 3V1RA 3CDWA 3DLKA 5EWGA 4FJ9A 4K4UA 4H4OA 4B9MA 1QAJA 4TXSA 2WOMB 4KKOB 1QUVA 1RDDA 3DLRA 4O4GA 4EP4A 2YKMA 4ED3A 3KJVA 3DRRB 4RNMA 3CDEA 2C28A 2WK4A 4CIEA 4K4YA 3SQ1A 1BI4B 3KD1E 4I2PA 4RW6A 3AVBA 4J9OA 5KFBA 4Y1CA 3OYLA 3RMAA 4J9MA 4B9UA 1S1XB 4DU4A 5JS1A 4RNOA 4EBDA 5L1KA 2ZE2B 4U6PA 3ZSWA 4IOBA 2B5JB 5HBMB 5DQHA 3LP3A 4NLGA 1IKXA 3SFGA 3OHBA 4Z4FA 1RT7B 2FBXA 2YHAA 3AO4A 3LP0A 1XWLA 4TN2A 4DEZA 4ID5B 4IRDA 3V6DB 3DRPA 4CHYA 2R8JA 2W9BA 4RW8A 1UAXA 2JC0A 2JEJA 3OLAA 2HAIA 4ECTA 3KK1B 4IG0B 4KHRA 3JSMB 4HKQA 1JLBA 4CJVA 2FVSA 4AHCA 3RMBA 3QERA 4ECQA 1B9DA 2C2DA 1L3TA 4LSNB 1BCMA 4MKAA 4NYFA 4Q45A 4G1QA 4ICLB 1HNVA 3HPOA 3KKSA 3QZ7A 4QWBA 3IG1B 4WE1B 2BGGA 4NLDA 4IRCA 4FXDA 1XR7A 4CE9A 1RBTA 5CYQA 3DOKA 1RDAA 1IH7A 5CYQB 4CEZA 3HM9A 4FLWA 1ASUA 4Z0UA 2D0AA 3Q8RB 1YVFA 3L2WA 2F96A 3EY1A 2HHSA 4NYNA 4DL5A 4CGHA 4M3UA 3OYBA 3AA3A 1REVB 1JLEB 4YQWA 1C0TB 3AVLA 4C8OA 4NLPA 3O3FA 2V4QA 4DTRA 3QLHB 4J9NA 3QIOA 2FBTA 3TAEA 4FVMA 4NCAA 3VA0A 3VQ4A 3V6DA 2QK9A 1CXUA 4N47A 3SPZA 4ZTJA 3MTKA 5KG2A 1IKXB 4OLAA 3HPGA 1N6QA 4TQRA 5HBMA 1RBRA 4O3SA 1A5WA 4XIUA 2Z1IA 5HROB 3PO5A 4I2QA 4FLUA 1RT1B 5KFGA 3SI8A 3LAMA 4CF9A 5HROA 3V9ZA 3RMDA 4CIGA 3S3MA 4QW9A 1N6QB 4RW6B 4EBCA 1Q9XA 2J6TA 3KLEA 4QCLA 4Z4GA 4ZVEA 4FLXA 4FLYA 4U7CA 3CO9A 4M3ZA 1T8EA 1J5OA 3ZT4A 5HRSA 4CJRA 4DTXA 2E4LA 4EEYA 2ZKUA 4O4RA 4DTUA 3CM6A 3AVIA 3NH1A 4O3NA 2YKMB 1D9FA 4RNHA 3BJYA 4UQGA 2GC8A 2QV6A 1ZYQA 1HQEA 1LWCA 2YNFA 1T03B 2D41A 5KG0A 4NLTA 4ECZA 4DF8A 3OLBA 2AX0A 3GIMA 3CM5A 4DQSA 4DTMA 4DL3A 3DLKB 1VRUA 2EHGA 4M3RA 1S1TA 4FM2A 1Q9YA 4NCGA 4OKKA 4Q5VA 4FS1A 4FJ5A 1SL2A 4WXOA 4RNNA 1LV5A 3BGRA 1WSGA 4J2AA 4ZVHA 3WNFA 4DTOA 4M41A 4AHUA 4IDKA 2W7PA 2R8HA 1HJRA 4FW1A 1SKRA 3NF6A 1TK5A 4HUGA 3G6YA 2DFHA 1HNVB 3MEEB 1TKDA 3TI0A 5F8GA 2R8IA 2OZMA 1NJWA 3ZSYA 2I1RA 4ICLA 3U3YA 4CK2A 3BQ0A 5KFTA 4DU3A 3LPUA 4ZP8A 2B4JA 2WONA 2V4RA 4J2DA 2XI2A 4AH9A 3SQ4A 3KK1A 2J6SA 4DFJA 1XHXA 4N56A 3DDKA 4RW8B 3V1OA 2W9BB 2W8LA 3DRPB 3FSIA 4ID5A 3MFIA 2RKIB 3LP1A 1QSYA 4FCYA 1SV5A 2R2TA 3I0RB 3QESA 3DM2B 2IOCA 4DS5A 3PR5B 2B5JA 3LANA 5KT4A 1YTUA 4CJTA 3MEDA 2ZE2A 1S9FA 3Q8SB 1RA6A 5F9NA 1KVAA 1QS4A 1S1XA 3TARA 1HMVB 1ZBUA 4B3OA 2P5GA 1IKWA 4M3XA 2YNGB 1WAJA 4KTWA 4N5SA 3SUOA 2YKNA 2ITGA 4FJIA 4ZHRB 3O4QA 2Z1JA 2VA2A 4HCCA 1TP7A 1RBUA 4FJJA 2LSNA 4NLSA 2QXFA 4BE0A 1EETB 4CJPA 4DL6A 4O4GB 2JC1A 4J9SA 5SWMA 3KD5E 3S3NA 3HVAA 4GC6A 4W5RA 4H4OB 4E19A 3L3UA 1T3NA 4BACA 2FJWA 1TKXB 3LPTA 5KT2A 1S6QB 2E9RX 3MXIA 1U48A 4M95A 4DTPA 5J2QB 3LZJA 4O3OA 1S49A 2BQUA 5FROA 4J9QA 1LWFB 1ZETA 3IS9B 3T1AA 4YR0A 2O4GA 5FRNA 4KHNA 2JGUA 4CJQA 5CY4A 1KHWA 4FJ8A 2D7SA 2D0BA 3I5CA 1DLOB 2IJNA 1BHLA 4RW7B 2KZMA 3KK3A 1S1VA 1L3VA 2RDIA 3NH0A 4ZP6A 3ALYA 3CFPA 3NGIA 2XI3A 4Q0BA 2VG5B 1RILA 5KFSA 2DPIA 1KFSA 1BGXT 2FC0A 2IA6A 4Y2AA 3MF5A 3RBDA 2O5DA 3ZSZA 3RRGA 1S9EA 5FDLB 1BQNB 5L9XA 4ZTFA 2I5JA 3UIQA 4JS5A 2VG6A 4KI6A 5C5JA 2R2UA 1N56A 3MXMA 4ZVFA 3K5OA 3Q8PB 3QNOA 2XO7A 3HHKA 4IG3A 2FLNA 2IM0A 1ASWA 1S1UB 4AHTA 4FLZA 2WTFA 3GQCA 2YHBA 4O3RA 4WXWA 3OVNA 3CDUA 4CK1A 1DTQB 4M3WA 5DG8A 3AVAA 4DL7A 3GIIA 1C0MA 4C8NA 4XO0A 1RT4B 3M9MB 1UA0A 2RDJA 2EC0A 3WNHA 3V9XA 1JLGA 3G6XA 1FKPA 3MEGB 2RF2B 4M3YA 3QGIA 1RTHA 3AVKA 4F4XA 4H4MA 3SFUA 4H54A 1RT3A 5HRRA 4IFYB 3NBPB 2HHWA 4EYIB 1MMLA 3VQ8A 3BQ1A 4BWJA 2IAJB 3CJ0A 3V9SA 1NK7A 3PX4A 3MECB 1KRPA 5L1JA 5F8MA 1N5YB 3EPGA 4Q8FA 1VRTA 4QWCA 3NAIA 5KFZA 4FJMA 3VQ5A 3KIOA 3H59A 1FKOA 3GILA 3OSNA 3L2RA 4K4WA 5C42A 3KLVA 3QGGA 2IM3A 2AGOA 2UVUA 1HYZA 4R0EA 3AVFA 3LDSA 4GC7A 1KLMA 4FJLA 4E7KA 4Y2CA 4IRKA 1S5JA 3DLBA 4RW7A 5J2MB 4E0DA 2C22A 3T5JA 1YT3A 3VQ6A 1DLOA 4NLUA 1JIHA 1UA1A 1C1BB 4O3QA 1TKZB 2XY5A 3H08A 4URQU 1RNHA 2BQRA 3N6MA 4KB7A 3H5XA 1W0HA 3K5NA 3U3GA 4FBTA 3I5BA 3PR4A 1VSHA 3NF7A 4KREA 3KMQA 1LWFA 3RWUA 2VWKA 4EP5A 4CEEA 3OYFA 3DI6A 3CVKA 2HB5A 1NK4A 3SJJA 3H5SA 1WNSA 4WFXA 4JRQA 1TV6A 4DSKA 4E7LA 3GIJA 3MR6A 3C6TB 3Q8QB 4LSLA 1HYSB 1RTJA 2ZQBA 5SZTA 3KLIB 2ILYA 1LW0B 2OPSB 4I9LA 2YNIB 3ITHB 3BR9A 3QIPA 3ZSRA 3I0SA 3D5MA 4CESA 4DTJA 1EETA 3G86A 3GV8B 3ICLA 5KG4A 4K4XA 1TK8A 1TVRA 2OPRA 3OL9A 1NOZA 2YKNB 4PQUB 2QE5A 3S3OA 4CFCA 3MAQA 2YNGA 1TK0A 1IKWB 4RUAA 3TAGA 4B3OB 3ZT0A 3OY9A 3KK2B 2G8IA 5KG7A 4CIFA 3M8PA 1ASVA 4CHNA 4R8UA 4ECXA 4FYDA 3F73A 1U45A 1LW2A 5HRNA 2ASDA 4FZXC 2OPPB 3T3FA 2DPJA 3O3HA 3LP1B 4DU1A 3ZSQA 1RTDB 3K59A 4RZRA 1B92A 3OYEA 3IRXB 3M8QB 3RBEA 2VA3A 1S48A 1RYRA 4NLRA 3D0PA 1D0EA 3O3GA 3VA3A 3ZSVA 2XY7A 1UWBB 4F2SA 1VSMA 2HWHA 4QWDA 3SQ0A 1ZBFA 3T19A 3MR2A 2AGQA 3C94A 4CECA 5J1EB 5JXSA 1IM4A 3OHAA 2G8KA 2B6AA 3BGRB 2G8UA 4MIBA 2O4IA 3GV5B 1TGOA 4F4WA 3DLGA 1VRUB 1XHZA 4AHVA 1RA7A 2IC3A 2PYLA 2XCPA 4F3OA 4O0JA 1U4BA 1LWCB 2YNFB 3OS0A 3OYCA 4ED0A 3NDKA 1L3SA 1K6YA 5KFYA 2PYJA 5T14A 4O5BA 1J5OB 4E89A 3BSOA 2PZSA 3RTVA 3VQCA 1TL3A 4DSFA 4CJSA 1QAIA 5L1LA 1NK6A 2DFEA 1SKWA 4OKEA 5EWFA 4CGGA 3SQ2A 2Y1IA 1JLCA 4NRUA 3SNNA 4OJRA 2W9CA 4DQIA 1RT6B 2JEIA 1S97A 1JLQA 1IKVB 3V6JA 1YTAA 3DYAB 3BSCA 5EDWA 2XGQA 3K2PA 3IGVA 3L2QA 3QZ8A 3K5LA 3CJ3A 4OPJA 5DK5A 4KPYA 3T5HA 4KHSA 1C1CB 2BR0A 4W5TA 4KV8A 1TKTB 3DOLB 4WFYA 3ULDA 4DG1A 1YVUA 4KHWA 4TY8A 1JLEA 2KW4A 2D3UA 2QKKA 2IM2A 3HSTB 3ZSXA 2X6SA 1TL1B 2A1RA 4KAIA 4CHPA 3TVKA 3L2VA 4YFUA 4FM0A 2XGPA 4Y1DA 4CGIA 2HNDB 4WE1A 3DLHA 4G3IA 3MR5A 4E3SA 1KSPA 3MXJA 1SL1A 4M42A 1X9SA 1IKYB 3JYTB 3AVMA 4DQRA 5KFVA 3DLEB 3BSNA 4LSNA 3RB4A 4CHZA 3VQ7A 5KFOA 2W8KA 1JLBB 3CJ2A 3KLGB 5L1IA 4IG0A 3E51A 3SUNA 1QE1B 2VWJA 4KE5A 3RB3A 1BISA 4J2BA 3SYZA 3S9HA 2CKWA 2IJFA 1EP4B 4HYKA 3NE6A 5C24B 3BDPA 4Z4IA 4LD0A 2HWIA 3C95A 2JLEA 2G8FA 1T7PA 1RT7A 3HXMA 4C8LA 2C2EA 3IRXA 3SV3A 2UUTA 4IFVB 1XI1A 1QSSA 2Z1GA 2E6MA 4PY5A 2BRLA 1GOCA 2AGPA 4EO8A 1WSIA 4FJNA 4ECWA 4YMEA 2V0NA 3EZUA 4W5NA 2GBZA 1SH2A 4FS2A 3PJWA 4R8UB 2IDOA 3AA5X 1X1PA 4N76A 1NK0A 3CFOA 2X74A 4NLQA 3H4DA 4CK3A 1NKEA 3QIDA 2HNZA 4RW4B 2R2SA 3DRRA 4BDYA 3TAQA 2P5OA 3L2UA 4KKOA 3E01A 4PQUA 2WOMA 1RT2B 5JS2A 1Q8IA 5KFKA 4IH6A 4FZYA 4TYAA 2OPRB 4B9VA 3M9NB 4ECYA 1BIZA
chains in the Genus database with same CATH superfamily
2QLWA 2VF3A 4LVNP 4DV3J 2DGVA 3KLFB 1BU6O 3PUFA 1URRA 3I0SB 3WIVA 5ETTA 1HNIB 3CDBA 2OPSA 7FD1A 5ITHA 4URGA 2Q6BA 1IWGA 3TAMB 4DHVA 3TZZA 4LF9K 1IG9A 4JI1F 1WHXA 3IBCB 2WTUA 2OFHX 3WNEA 3WC0A 2E44A 2V2QA 1RZMA 2FPHX 3O5BA 1RT5A 1FA0A 2CH6A 2H4YB 3TRGA 2DEIA 3UN2A 1MNEA 1OKJA 3U1NA 2J0SD 4OX8A 3FC9A 4JV1A 1JMTA 4OZJA 4ZCKA 3OYNA 5HQMA 3KVGA 4CJ4A 2PBDA 3G8QA 2AJFE 2U1AA 5A8KB 3QINA 2HHHJ 1RAOA 1H2UX 1JJ4A 4X65F 5DG7A 4CBXA 4GKKK 3QAEA 1AYEA 2VBYA 5HL7Q 5KPTA 4MK8A 1HBUA 1IV0A 4YDXA 3TQEA 5FPNA 5A76A 4J9LA 2CG4A 2GS8A 4PUOA 1C2PA 5FRMA 3BO2A 1S77D 2VDHA 4ILHA 3ID6A 1CEZA 5C12A 1OVQA 2KFNA 1HPZA 4JS4A 3DRSA 3CCRN 2HRUA 3MMAB 1S1WA 2EW9A 4IFYA 3R2DJ 1N33J 3A5NC 5HVFA 1CG2A 2OSRA 5GADU 2YH0A 3C6UA 2N82B 3J81j 2FQQB 2NLWA 4MJKA 1JLGB 4JD2A 4WFNL 4AQYF 4LF9J 3H5UA 3MR3A 5AQZA 2N3LA 4LF6J 1IBLF 1XNRF 4YDUA 4NCBA 2O67A 4LRCA 1PILA 3VHQA 4EMDA 4KGKA 2XRIA 2MGZB 2M2BA 4X66F 1CS4B 1WD6A 2UVRA 2LA6A 1K1QA 4LFBF 3O6QA 4CO2A 1FK9B 4RW9A 2WB4A 2OYQA 5I42A 1KP6A 1JXVA 5E3PA 5A0YB 1XMQJ 4H4KC 3EL2A 3O3LA 3PW5A 3P83D 2R2RA 2KVQE 4DR2J 4C1NK 3V6HA 2H65B 3D6MB 2J9DE 2WSFC 3GU0A 3OL8A 3Q8VA 2UUBJ 3RVCA 3T5LA 1ATSA 4DWIA 2ZF5O 3P5JA 1RWNB 2MTLA 4JI5K 3GSIA 3W9HA 2L3MA 6FD1A 1VQYA 1E4FT 5M1KA 1T44A 2DGXA 5C7PA 5E26A 4LRDA 1JQGA 3D1OA 2VJUA 1S9GA 1BQMA 4MH8A 2ZEJA 1MWMA 5AQYA 4F3TA 2C42A 4B8AB 1FJGK 9ATCB 4LBIA 4OX9F 1T11A 1YG0A 2GVZA 1TL5A 1HARA 1JL2A 4ED7A 5KI6A 2VG7B 1IBLJ 1NM2A 2HS3A 3ENHA 1XERA 4JD2B 1U04A 3P1GA 3AB4B 1OS5A 4K8RA 3NHGA 3TABA 1B9FA 1RTIA 1RSCA 2MZQA 3AOCA 3KUHA 3DMJA 4RW4A 2HNZB 2F9JA 4DV5F 1HNXJ 3DRSB 1HPZB 1I3AA 1N8RT 3O9RA 4NYPA 3B8AX 1VGYA 3D2FB 1NJIT 2C3MA 2CPZA 2HGLA 4DSEA 2ITMA 1S6OA 3CJ5A 4FJ7A 2H1YA 2KVIA 4ZVGA 3AVJA 1ZM2A 4KHYA 4CF0A 2BKPA 4BQLA 1BE4A 3THPA 4UOGA 2O8BB 2NS1B 4FYWB 4EYHB 3ZSOA 1Q5VA 5BYSA 3QFHA 1U1PA 1SUQA 2QSFA 4B08A 3BKFA 3QEVA 1YWXA 4EAHD 4OYXA 3X1LB 2CQ0A 2BANA 5B0GA 2KXFA 2VPWB 3ZTQA 1H2TZ 3N01A 2DNGA 3CJKB 4K0KK 1ZBHA 1TUVA 2BYCA 1H6KX 3IN5A 3KHHA 5B0DA 1BUXA 3MR7A 5KFPA 3O9SA 4FPRA 1SKSA 1U8SA 2IRYA 2QL7B 5GAGI 4I56A 4DV4F 4WP8A 2CNKB 4M1KA 1W9HA 4OIXA 5DDPC 2XS7A 2P9KA 4CEBA 1S1TB 2DRDA 3OXFA 3F44A 3HVTB 3SCKE 4JI2F 4ZPBA 2A41A 4USHA 1YLXA 3E01B 5EU7A 1JK9B 1XNRJ 1HHTP 2HAFA 2PMZD 4JRPA 3NGUA 1XMQK 1DARA 1OSCA 1SJRA 1QVGM 4GKJK 4FDFA 3T9NA 1BWFO 1ITGA 2MKCA 2EFNA 4MIAA 2KHDA 4ZPCA 3KLEB 2QMUB 4QR1A 1A5XA 2HMIB 3U4LA 3UD5A 1YJUA 2NRVA 1FO1A 4I64A 2P9IB 2GZOA 4NL5A 3NGSA 3MGJA 1VRQC 1M1GA 4HT5A 3GOIA 3D7EO 2FSJA 2VFTA 3LWLA 4HHHA 2CVEA 3CF5L 2V8GA 4LH5A 3LGMA 3ISND 3OBYA 5MLCQ 3IWNC 3CCZA 1Z4UA 2E9ZA 1VJWA 3QBWA 1VMBA 5HMXA 2N3OA 2A3ZA 2Z2MA 4OHVA 2AV5A 5C2FA 1SIZA 2DT9A 1CJVB 1LAWA 3BQ2A 3LL3A 3KWGA 2F3JA 1C0TA 3ZCMA 5A8WB 5FJ4A 2MB0B 1RHQB 3H2VE 2IMOA 1NNEA 1P90A 2HS0A 3E2EA 1YF5L 1DRZA 1S79A 3M2UA 2FB0A 1KC8O 5AXKA 4P10A 1B4SA 4U95A 4ZITA 4JUZA 3DOKB 2HNYA 4TU7A 1NMNA 3K8WA 4PEOA 2ASLA 2PI5A 5GADP 3UDEA 2ASOA 1KVBA 1UWBA 2CDQA 1ILYA 3CIMA 5IWAF 4TY8B 4NA1A 2NYHA 3AO3A 4BE1A 1N33K 3PFOA 3HI0A 1SC1B 3TVYA 1U0HB 2HQGA 3JSMA 1HBNA 1V3SA 4KV8B 2KXNB 1U1LA 3VAHA 2PO4A 1MU2A 1NO8A 2YY3A 4DTSA 4LF2A 1PC5A 4QAGA 4QR0A 1HBMA 5DGAA 3HFVA 2RB7A 1KFDA 3G8SA 3H40A 2OPPA 1TL4A 3S1TA 2R7YA 3Q22A 3OYJA 5HATA 2ZJPQ 1YRXA 3CO0P 1F2GA 2JEGA 1NXIA 1KONA 4B3TK 1CZ9A 2KT5A 1XN9A 2W7OA 2HFUA 4WFZA 1Q86T 1HRHA 4KSEB 4Y0WA 4FN5A 1EKRA 2MLXA 2MZJA 4JI0F 2B3TB 3OFGA 3VVTA 4WWSA 4O0IA 4TKTA 1PIEA 2HLUA 2J7KA 3M30B 3QIPB 1YBTA 3GJTB 1JJ2M 2ZZMA 3IM8A 3I4PA 4BRFA 1WHYA 4ED8A 1J9AA 2E20A 4DQQA 1IM6A 2HFNA 1KQKA 1ZTWA 3TQ1A 1S0MA 5FLXU 1ZA2B 2HIQA 4QYZJ 3SLCA 4U96A 1ZAWA 2QSWA 4PWWA 2D0CA 2GNKA 3W2WB 3M2VA 1ZZNA 3RB0A 5J1EA 2AX1A 3BZCA 2YX6A 1T9UA 2DCLA 3AVGA 4O55A 5HLFA 4LF8J 1LWEB 3K58A 1K8AT 3HYFA 2FJDB 4JN4A 1VSEA 3BDEA 5A6WA 2PFUA 4AL7A 2XY8A 4CJKA 3N9UC 2YJFA 5AE1A 1Y5NB 1OY8A 3NMAA 5DM6Q 3OTDA 2J0WA 2Z58B 1X4EA 3UDLA 3MAHA 4YS2A 3KYLA 4LIWA 3GZ7A 2IAJA 1KLNA 2LYVA 5KFCA 1NGEA 4EI2A 2HHQA 3D6HB 1OQ6A 5E41A 2FJVA 4RJVA 2M8DB 4ILJA 4CEFA 3OVSA 2VFUA 2E2OA 1UVJA 3Q8YA 2H4WB 4BDPA 1WHVA 3SUPA 1TTHB 3R5CA 1HUXA 4NOHA 5HOOA 1YJ9S 2CZ4A 2X6NA 5LMUJ 5AZIB 4CH1A 1LFWA 4ZPAA 5AQUA 3Q89A 5KGWA 3I8DA 4JBCA 5C2CA 3AXMA 1CXQA 2Q79A 4WU2A 5F3TA 4DUYK 3IM9A 3OFHA 4WIQA 1N5SA 3MM6A 2RT3A 1BUPA 2F8TA 2ZNZA 3PO4A 1K73T 2R9LA 1RKJA 2KG0A 2IY5B 4DPWA 1XR6A 2J4RA 4MT1A 2AIRB 4CJ7A 3IAM9 2KFYA 2UVWA 4NI2A 2K8GA 3H7HB 5KFFA 1RCOB 1Y5IB 2G9OA 3K9JA 4X4TA 4X4VA 3RUBL 2PC6A 4X65K 4KR0B 1H38A 5LT5A 2J76E 1SJFA 4NI2B 2IYIA 2JVRA 2BEFA 1MSWD 2HGMA 1IUJA 4CH0S 2Q0RA 2VBZA 4CF1A 3C16A 3IS9A 4JHDB 5AQQA 4OX9K 1FTCA 2HIYA 3M2RB 4DTNA 3JAMY 5KQDA 3SUQA 1B3TA 3FQLA 4CLYA 3VF0B 3HJVA 4IO9L 3PM9A 2E6LA 1NPKA 3RR8A 1TL7A 4C8ZA 3T1HK 3OYMA 3OYDA 4JI0K 3PZPA 3X3UA 5AZIA 2J6UA 1RAHB 4JAXA 4NMXA 4WFAL 1VSKA 4M5JA 1G15A 1KHVA 2IDEA 2P1JA 4R0JA 3AV9A 3BO3A 2A5XA 4ZHRA 4EFAC 1Y4ZB 4BBYA 1S1UA 4C8KA 3EVOA 1NGIA 2RIJA 3OYHA 4CLLA 4NLVA 2F8EX 2A1SA 1WSHA 2RH3A 2XMAA 4CJWA 3D28A 4JI3K 2VCPA 3DM2A 8RUCA 3UCZP 1S9EB 4CTAB 3QETA 3O1WA 4K8XA 3HVWA 1QDUB 3WXMB 3V4MA 4CZHA 4B9TA 2M88A 5D78A 1F21A 4ZLJA 2G2ZA 2KJWA 5H1SV 4LF8F 2H51B 4E98A 1WB9A 1NDPA 5IC6B 3TNVA 2OIHA 3BF1A 3EGWB 4BVOA 4E1NA 1CSJA 2HHHF 2IRXA 4JI4K 3KHGA 4ZLLA 4NLWA 2C2MB 3NXZA 3ISNC 3AA4A 3W2WA 4YY3J 3THVA 1YKWA 2OLWA 2O8CA 4JKBA 3KWMA 1VQON 4M8LA 4LBHA 2MKHA 2QGFB 5EWGA 3L9ZA 3F2KA 4ID8A 1R0CB 3OTEA 1YIJS 4KKOB 1RDDA 2YKMA 4B3MK 2NNWA 2C2OB 2J5AA 2BOAA 4A4JA 4W90B 3IMXA 3SJHA 3N4PA 4PKGA 1BI4B 3VAFA 5D0HA 5IOLA 3UKUA 1R8HA 2B4OA 4Y1CA 5BYRA 2E5LK 5BXIA 5C2GA 2FZKB 4B9UA 1S1XB 3K5PA 3CJ7A 4DU4A 1VDHA 1UZHA 5L1KA 4G6VB 5H9EK 2ZE2B 3CJ8A 3OHBA 4QS8A 2E5HA 2P6SA 2YHAA 5LL6Z 3WT0A 3LP0A 4TN2A 3AA8A 4ID5B 3LF0A 4IRDA 2QFIA 2QN6B 4RW8A 2JC0A 3H2UB 3OLAA 4JI4J 2CQBA 4LMZA 2ZGYA 3BYRA 4KHRA 1JLBA 2DGOA 4CJVA 2RQCA 1QZ5A 1KDNA 4AHCA 2O8EB 4AD6A 3FCHA 2V8VA 3D4JA 4Q45A 1I1GA 3MOJB 1HNVA 3HPOA 1F60B 4CE9A 2YWFA 1RBTA 3DOKA 1RDAA 4F26A 5D4LA 1SBRA 4CEZA 4FLWA 4Z0UA 4BRNA 2DYAA 1YVFA 3L2WA 3BKTA 4DR3K 1M1HA 3EY1A 2HHSA 1MWYA 1RQ0A 4NYNA 1Q79A 3OBIA 3AA3A 5B8HA 3N28A 4YQWA 1TMJA 4YB6A 1RWXB 3JAMU 4NLPA 2ZOGA 2WAQD 3RW7A 2E5LJ 2V63A 3ILLA 3VA0A 4ZVRB 3G87A 1HKCA 1EAYC 2MZSA 1YITS 1CVJA 2W4CA 2OJ3A 1YK9A 4ZTJA 4GY2B 3MTKA 4OLAA 4TQRA 1EO1A 4XIUA 4W92B 4I2QA 3MI7X 4DUZJ 6AT1B 4ZN1A 2DK2A 5KFGA 2Q1NA 3LAMA 3LOUA 1UFLA 4CF9A 1UFKA 2VBXA 3GIRA 2DY9A 2QA4G 4QW9A 3CXCR 3BEXA 2J6TA 4QCLA 1WEYA 4FLXA 2Z2YB 5M2PA 1T8EA 3ZT4A 5HRSA 4CJRA 3I82A 1ZZFA 2E4LA 3W8PA 2CVIA 2ZKUA 4O4RA 1QQOA 1G4CA 3EGZA 1D9FA 2B8PA 1IQZA 1S3XA 1IN0A 4NLTA 2F8HA 1UPMB 4DQSA 4DL3A 3DLKB 1W2BR 2EHGA 1ZC6A 2P9KB 1Q9YA 2AMCB 4NCGA 4Q5VA 1WHWA 4FS1A 4FJ5A 1SL2A 4WXOA 4RNNA 1LV5A 3KWIA 2JWKA 5JMNA 4LFAF 1R0BG 4IDKA 3SQOP 1M0SA 1UVIA 3ZTSA 4HUGA 2DFHA 1RBOB 3EZOA 5F8GA 1NJWA 3ZSYA 2D9OA 4HACA 5DETA 2ZZTA 4HH1A 3HFKA 2FHJD 4ZP8A 2B4JA 2WONA 1EZZB 2V4RA 4J2DA 4AH9A 5LSOA 3KK1A 2KHOA 2J6SA 4NEZA 1S76D 4N56A 3ENWA 2PN6A 4RW8B 1WELA 4IO9Q 5I3QA 4AL6A 3QQCD 4I6MA 5ELZA 1TYQB 3FSIA 4HDGA 1HWKA 2N4CA 3T1YJ 1QSYA 4FWPA 3EE8A 5LM7E 2R2TA 3I0RB 2B5JA 3LANA 3ILJA 2LCWA 4XAKA 2ZE2A 4KHPF 1X60A 3Q8SB 3J80Y 2AW0A 4OZ3A 1KVAA 4IOAL 5LJWA 1IKWA 1UW4A 5AQMA 4N5SA 2CQHA 1OH5A 4FJIA 3D2FA 3NS5A 2FF3B 4MO4A 5D0RA 3CC7N 1IJEB 4OX6A 4FJJA 4CNZA 1R43A 3P39A 4B3SK 3R1XA 4L73A 3P4IA 2E1MC 1M5HA 1CZAN 2ATCB 2ZH7A 1FDAA 4RWWA 3KUEA 2KRBA 5IXUA 1RKIA 2FJWA 2UXCK 3MXIA 2O8CB 4M95A 4DTPA 3HHLA 4JKDA 3J80O 4MYUA 2OO4A 3E3XA 3FVYA 4IO1A 3SDEB 1K8KA 1KHWA 2QJ3A 2X1BA 4BLGA 2UU9J 1DLOB 3W0LA 2IJNA 1JJ2R 3WBZA 2CFXA 4CRJA 2KZMA 1FDBA 1S1VA 3CCVS 2AF6A 3NH0A 3CD6S 2IVPA 4LRAA 3MCMA 2FC0A 2DPIA 3E66A 1I94J 1DHMA 3RBDA 3ZSZA 1NU4A 5FDLB 4DCHA 2LECA 3BGLA 2I5JA 1K47A 2AKWB 3IWXA 3JQJA 4F0HA 1WF0A 4IWVA 4KI6A 2MY8A 1RHRB 2F63A 1TUYA 2DGTA 1N32J 3Q8PB 4F4AA 4CP5A 3NGKA 2VICA 2G1DA 1UJ6A 3PIPL 2WTFA 5U47A 4PWUA 2YHBA 5LMNJ 2MGZA 4K7QA 3OVNA 3LQVA 1YBUA 1DTQB 2LFVA 2UUCK 4LF5J 1C0MA 4C8NA 4U67L 2E7WA 1UA0A 3UN3A 3FBCA 1VJQA 1JLGA 4CQ1A 2B4UA 5AQPA 1D3WA 1M5KC 4GVBA 3W9IA 4M3YA 3MN9A 4WQ4A 2GUPA 1RT3A 4C3KA 5GIOA 3UR3C 3F0NA 2BW2A 3V9SA 2HZAA 3QT7A 1J27A 2H5IB 1KRPA 4IOCQ 5F8MA 2ZUGA 2MEWA 2Z2ZA 2HEKA 3PYEA 2QWQA 3W66A 4FJMA 5GAEU 3K0JA 3GDQA 4K4WA 4RUHA 4B02A 1XMOF 2AGOA 2AYEA 1KVJA 1H73A 2YX1A 1YAGA 5AQXA 2GX8A 1S5JA 3P3DA 5IT0A 4RW7A 2ZWPA 2OFGX 3NY0A 3W65A 1UA1A 3RRKA 3H08A 4B3SJ 3AAQA 4ANEA 3H5XA 5BRHA 4FBTA 1H72C 5JLFA 4CDIA 1HNWJ 2DRAA 3NF7A 4ZIVA 2ZH5A 4C48A 3KMQA 2PEBA 4EP5A 1NHKL 1FW6A 1Z2LA 4CIOA 4NA3A 4WFXA 4JRQA 3MCPA 4E7LA 3GIJA 4K0KJ 3C6TB 3Q8QB 5F0UA 2ZQBA 1RTJA 2Z57B 3G4SS 2Q31A 1LW0B 2OPSB 3BR9A 4DCPB 1URNA 3ZSRA 5FD1A 3DLJA 4DTJA 3PLAA 3QRRA 3I56S 4AL5A 1TVRA 1HW8A 5EOYA 4FF3A 2B9XA 1KEKA 2YKNB 4CFCA 1MN7A 3MAQA 4H5RA 2YNGA 2OTLN 3G9CA 4BR0A 3GJSB 3TAGA 3PHTA 4BS2A 3ZT0A 1CQNA 5KG7A 4CIFA 3AAWB 1ASVA 2EBGA 2V69A 3WXJA 1KQSM 4WF9L 3I9ZA 4FYDA 1P8GA 3ATVA 1W7WA 5G4DA 5BR9A 3LP1B 2I2YA 4DU1A 2OMLA 1T0TV 3ENAA 2V8PA 2CJBA 1S48A 4Q2LA 1YHQS 1H2VZ 1D0EA 3VA3A 3MN6A 3ZSVA 2XY7A 2POKA 1VSMA 1VQ8S 2HWHA 1K44A 1ZBFA 3MUTP 2UXDJ 4X4RA 3C94A 1Q82O 3CCMS 3DGPA 2G8KA 1JJHA 2B6AA 4B3TF 2G8UA 3AJ1A 1AZSA 4P71A 2Q6CA 4F4WA 4BRKA 1HQ2A 1NAQA 3OTBA 2U2FA 2KG1A 4DOZA 1R8PA 3QPIA 4CZMA 3ZZPA 1D9AA 4FF1A 5T14A 1J5OB 3BSOA 3DRXA 1IBMF 2OUGA 1QAIA 5L1LA 1NK6A 4KHPJ 4DR1F 1FKAF 3EXYA 4NRUA 5JVHQ 3CJBA 5DDRC 2GHVC 1JLQA 2PI4A 1YTAA 2QC3A 2LA4A 1SXLA 1WKJA 3DYAB 3BSCA 1Q7YO 3MM9A 1VI7A 3MUMP 3CJ3A 1YZ7A 4PXDA 4OPJA 5D4PA 2FHMA 3LDQA 4WFYA 3SQGB 3GYGA 3CULA 5AQJA 3TJAA 2Q36A 4MLHA 4KHWA 1JLEA 3B4MA 1M5PC 3IR5B 4LF4K 3PKYA 3G71N 2IM2A 2F8MA 4KAIA 2DD8S 1UVLA 3TVKA 4U7UD 3SAGA 2XGPA 1RAAB 5D15A 1T95A 2HNDB 2JWLA 1QTNB 3RGIA 2DBBA 3DLHA 2QA4S 2KH9A 2APOA 3MR5A 3W64A 3TA2A 1KSPA 4XH5A 1F9EB 2QA2A 3DLEB 2F9DA 1WC3A 4CHZA 2HBJA 3I6PA 3CJ2A 2ACYA 4IG0A 4QYZK 1QE1B 3J7ZO 4KE5A 5KPZA 3RB3A 1KQSR 3N0VA 2CKWA 4BHQA 3ZEUB 4XDCA 4JI1K 5AJ3F 5BREA 4HYKA 2GJIA 5C24B 2EKYA 4LD0A 2GX9A 3C95A 1KXPA 2G8FA 5CHIA 1RT7A 3SBMA 3DU6A 1KD1O 5HMYA 3SV3A 3U9DA 4U7UK 3EE9A 4CLSA 4B3RF 3FSYA 2V52B 4ECWA 3UE2A 4C23A 4W5NA 4FWQA 2GBZA 4H0YB 4BRMA 3PJWA 1X1PA 1VHFA 2G2OA 4HT7A 3CFOA 3BH7B 2X74A 4NLQA 1DQ8A 2I38A 3QIDA 3TTCA 3FLCO 1UVMA 3OW2M 1TUUA 1SVDA 1NCLA 3MPWA 2P5OA 3L2UA 5JS2A 1RT2B 1YUWA 1VBKA 4FZYA 4ZVPB 4OLOA 1NLVA 2OPRB 4ECYA 2QTWA 3VV2B 3KHRA 4JNEA 3EPIA 4KI4A 3CD7A 1NMDA 1LFPA 2HHHK 3FFIB 2IVNA 5CQGA 3TANA 5KTQA 2AP6A 2XSJA 2FLLA 4C8YA 3M8SA 3DXKB 1RXOB 2BJ7A 3OT9A 1LQ9A 4K4ZA 1JLAB 4ZK7M 3KHLA 3BY5A 1NHVA 4GV9A 5F41A 3ZT1A 3Q86A 5JICA 1HLWA 2BANB 1NGDA 4JYAJ 3UKRB 4A46A 4BRQA 1Y97A 3VVUA 5K9FA 1C0UA 4DV1J 1KD1T 1NM1A 4X4PA 2BE2B 2FJEB 3LP2B 5IT9U 3UQSA 1R0AA 2OEJA 4LVOP 4J9KA 4FWMA 3A13A 2ZC3A 1HI0P 1RHUB 4UOHA 2GV9A 3NAEA 4XTTA 4L74A 4ZMMA 1N5YA 1NRKA 3A3PB 4ZPDA 3G6EN 3TSQA 3L95X 1WWHA 1WLJA 4DV2F 1OY6A 3H6EA 3QGHA 2FJXA 3I96A 2PAVA 3DMJB 4BR5A 3ZT2A 3NGZA 1QAXA 1WEXA 1BL3A 4B1YB 2BJ3A 1VOMA 1X7VA 4Z37A 4C8MA 1B7YB 3Q7CA 4WZMA 2FHKA 3LAKA 1R27B 4X62J 3TWHA 3WHIA 2Z1HA 3J8AA 2VG7A 2VQFF 5GVQA 1HD1A 4H0VB 1VSDA 1E4GT 4X84A 5EX5A 4ANCA 3NFAA 5LMUK 1HYVA 1IQTA 2QW9A 3KOAA 3UW1A 4FW2A 1FT8A 3HSCA 4DR6K 2ZVSA 4OO1J 3I31A 2ZBQA 1RCHA 4BRGA 5KT7A 3PX0A 2XHWA 3SV4A 4QW8A 3KKFA 1LOUA 1OH8A 2OPQB 4YOXA 4YDDB 3FZ2A 4FJKA 3JXOA 3CFRA 3FJ2A 2XWYA 3LP2A 2HVHA 3MM8A 2QWRA 4I0WA 4X2BA 1C0UB 4TQSA 2ROPA 4JI3J 2FGOA 3DOMB 3V1QA 1AXQA 5D77A 5F9LA 2EFVA 3FMWA 3R9PA 3NH2A 2P9NB 2XBPA 2WHOA 1NJZA 3EM1A 3IFEA 3OYAA 3KK3B 4USUA 5J2NB 2CZ9A 2BV3A 4LF7F 3VEOA 3C46A 1FK9A 4RW9B 3T7ZA 5GAEI 5IQQA 2YHXA 4M63C 2KT2A 4RCHA 4E7IA 5KFQA 2HHVA 4FXVA 1RDRA 3CMAN 2OD4A 3DXMA 3W7BA 2Z4PA 1RDWX 3D3CJ 5GAGU 3OS2A 4A8FA 1TKXA 2YNHB 1FNOA 4A5AA 3MPVA 3HDSA 2EFPA 3TAPA 3C6UB 3ENOA 3CCSN 4CGDA 2CPHA 1NDLA 3MD3A 3R7NB 4BRHA 2KB2A 4MK9A 1VQ8N 2IMWP 2UUBK 2QMXA 3MMAA 2Y9HA 1HIYA 4OKJA 1QSLA 3ZYYX 4JI5J 2HYIB 4CEDA 4J9RA 3DLLQ 3V9WA 1RISA 5KPRA 3TJ8A 1VK0A 2FHOB 3M6VA 5F8IA 4OGEA 1VSFA 4N8NA 2BVZA 5A8KA 4IOAQ 3VQAA 2XMTA 1NBEB 2HBYB 5THWA 3V4IA 5F8JA 3M3ZA 5KG6A 2W6LA 5C24A 2DKOB 1VS3A 2BE9B 1IBMK 5C25B 3HHNB 2WVBA 2QG9B 1GLDG 1RWVB 3HULA 1JKHB 3Q7BA 2BRKA 3DLEA 3ZZRA 3CMEN 3AXKA 2UXCF 5M1FA 2QRRA 3QSIA 4BC3A 2HNDA 5ETNA 2VKRA 5F8HA 3GR1A 5HP1A 1BA1A 5KFWA 1D4XA 3QRQA 4KGMA 1VC0A 2QWLA 5A6PA 4B9NA 4RKUC 5DQIA 2XMUA 4KBIA 1UMJA 1N48A 1U6ZA 2IHR1 2RS8A 2YV0X 1FRIA 3CC4S 3KKRA 1JXLA 3ENVA 4DLGA 1YBAA 4M5GA 5ETSA 4DL2A 1S10A 5K8MA 2VZ9A 4KHMA 4CO3A 3OR2B 4CHOA 3C3LA 5B0AA 2OCEA 4Q44A 1UTAA 3HK2A 3M8ZA 3ETMA 1KC8T 1WSFA 3FR0A 4DMZA 2W40A 3QBXA 1Z2ZA 2XMVA 1NSQA 1GMWA 3TAFA 3GCXP 4BWMA 4HH0A 1JLCB 1J54A 4IR9A 4ZS6A 4IFVA 4HUFA 3HLUA 1K1SA 4USIA 4GRSA 2OMOA 3M1VA 1TL3B 4PG8A 4WFAQ 3C65A 3ET6B 4LY7A 2OH2A 1BHNA 1JB0C 3I55S 4OJHA 5L39A 2RD5C 4ED2A 3NWGA 2FVQA 2QKBA 1REVA 1DTTB 2IM1A 2JLFA 3NLCA 1WAFA 1P8ZA 1AZSB 2CJAA 5BR8F 1DTTA 2BJ8A 1XNQJ 4A5BA 4ZVOB 2HRYA 1ITPA 4M5IA 1ZAVA 4TY9A 4FJXA 5ETLA 1EXQA 4I69A 3DLLL 3DRYA 3R3TA 3L7PA 4DR4F 3H3OB 3QFPA 1HHQA 3FQKA 3H4BA 1J53A 5KFXA 1QHTA 4CZGA 3QWUA 1VQMN 1YI2S 1C1CA 2UZAA 2WSEC 2DR6A 4LC9B 3KZBA 1WSRA 4L3KA 4F7VA 4FF2A 3SSQA 3VQ9A 5CH7B 1RHJB 3GFHA 3LH2S 4M3TA 3DDNA 4DV7K 2DY4A 2VV5A 1F5AA 1E6YA 1ICEB 3RYLA 2DTUA 4BC2A 2QLBB 2ASYA 4QOTA 2LXFA 4QOZB 1ULRA 1Q1KA 2GUIA 1D8YA 4KTQA 5KFMA 1KCFA 1VCTA 2A18A 5KFLA 1KN6A 2ATQA 4WFBL 4BDZA 3RJMB 3DXSX 1FEHA 3EEQA 4QWEA 3VQEA 2R7QA 4QU6A 2Z8QA 3CCTA 3HZGA 3HPHA 4X64J 3HX9A 4YOUA 2OELA 2IC3B 3C6TA 1FNXH 2WFBA 5AZJA 1KWMA 4OZ1A 3DLGB 2DVIA 4FNHA 2NRWA 1TV6B 5JVHL 2JX2A 2HHXA 1B0TA 3A12A 3NOGA 2KKHA 2WVDA 5EWEA 2LQ8A 1NJYA 3GFXA 4F50A 4DI6A 5A8RA 4PKIA 5C25A 3CJ1A 5FPEA 5KAKA 4B9SA 3H1VX 4FPIA 4A61A 4CFDA 1IBCB 3K89A 2FIUA 3VQBA 3HOSA 4DPTA 4K50A 2I8EA 2V7ZA 1SPBP 3KJNB 5LXRA 2VWBA 5GIPA 1WC0A 3M8QA 3HFZB 2B8QA 1ATRA 3IP0A 4X4QA 1RAJA 3ADAC 3DU5A 3VAJA 3CXCM 3VQPA 1DAXA 3MECA 3G82A 2KKZA 1WI6A 5MAOA 1SH3A 1VQ5N 3FBFA 4DX7A 4EU0A 4LT6A 4X4UA 5AQLA 4DFMA 1J5EF 1IBKJ 1VHIA 4H0OA 4DR6F 3CCUN 2VC1A 1YRUA 2BUPA 1JL1A 4ED5A 3U27A 1TUWA 1DTQA 3BP8A 1VSIA 1B64A 5IT9Y 1IJFB 1ZBIA 4YUDA 2FJBB 2ACMA 2VD3A 1PAUB 3KDOA 4FLVA 3HP9A 4ERDA 4EFHA 3PV8A 4RG8A 4RU9A 4NLBA 4LF4J 2FVCA 3CQXA 3QFUA 3JQMA 4ELVA 4W5OA 5J2NA 1TQLA 4H4KA 4CVNE 2PT0A 4URSA 1Q82T 2HFOA 4TVAB 3LALA 4U9RA 3I56N 2E2NA 2O3DA 3FDSA 2E88A 4XEIA 5GAGP 2FBYA 1R59O 1OYDA 2GGPB 2GW8A 5J2MA 2XG8A 1N36J 4ETZA 3WZ0A 3EYZA 3GYXB 5J2PB 1Q78A 1L5UA 2DR9A 4JI3F 1R7IA 5AJ3J 5C42B 2KN4A 5CAAA 1S0OA 3GIKA 4I4BA 5J1PA 4KFBA 2K7KA 4HTUA 2V5HG 1VLYA 3HKWA 4DSIA 4XH4A 4DV5J 1HNXF 3PHEA 4F4ZA 3WX8A 4KO0B 2R7OA 4L8RB 3VWSA 4L72B 4DL4A 4C3MA 3QT6A 3T6JA 4JV0A 4DR5F 2FBVA 3NBPA 5HL7L 5HK4A 2GJFA 3UCGA 3NKYA 1VIXA 3C14B 2ZH1A 1JCFA 1DKGD 3HRGA 5DGBA 3FK4A 1HNZJ 5CZ1A 1U49A 3HO1A 2MLYA 5JLHA 2AA4A 1NDCA 1VQ9S 1RT4A 1S72N 3A8KA 3GFZA 4IKAA 4J9VA 3R5GA 4NLCA 5EY4A 1HNXK 4USMA 3THWA 3THXB 2HQCA 2NXUA 2D3ZA 3NNHA 1GLCG 3Q83A 1RWWB 1HQUB 4JV2A 1ZA1B 1WC1A 4EBEA 4FZZA 4NZ0A 1S7IA 4Y65A 4UT4A 1QHAA 2IBKA 4A48A 1NK9A 5K8NA 1T02A 1NK5A 1U24A 1DGKN 2ZD1A 2ERRA 3RRHA 1BIUA 1Q8LA 5DZ7A 4C1NI 3LGHA 3QNWB 4BG8A 4BVPA 2P51A 1SV5B 3I33A 3OS1A 1VBYA 5AQOA 2UXBK 4E8UA 3G6VA 2VG5A 1NMEB 2FD2A 1JLFA 4WYBA 4CERA 2JFDA 2VHGA 2FLPA 3QEIA 3R7SB 1S5ZA 4DQPA 1RDUA 2UV8A 3UR0A 1C1AA 1X4BA 4A47A 5F8LA 3PFEA 3MDQA 1HWUA 3DCAA 3H98A 1FJGJ 5B0BA 4MK7A 1H0HB 3G4SN 4EZ9A 2VC0A 5AFUH 1I6JA 3V81A 4OV1A 2PY5A 3ZNUA 1NG9A 1IR0A 4Z4HA 5IWAJ 4JKFA 2XZDB 3QT8A 3UNYA 5BN9A 4JI7J 4KAZA 2XSJB 4JKCA 3PW4A 3N5FA 3AQPA 2ASMA 1KAZA 4M5LA 4MAKA 4NCGB 5CD4H 1N0UA 4OL8A 2YTCA 1S6QA 4HTLA 2YQ3A 5KGXA 2WW4A 1RDBA 4O44B 5SUHA 3U1LA 2UUCF 2JWNA 4H4OA 4TXSA 4WTOB 1QAJA 2V8DA 1QUVA 3DLRA 1X3MA 1MW7A 4EP4A 1PO6A 1GTHA 1M1KT 2YJEA 1NGCA 4KQZA 3PSFA 2BJ9A 1BO5O 3CDEA 2WK4A 3TZYA 4CIEA 1FCAA 4L75A 4K4YA 3C8YA 2CWKA 2LU2A 3BZQA 5LY3A 4P73A 4LF4F 3KD1E 4JI6J 3MM7A 3MMCB 2PGCA 1ZBSA 2BKNA 3RMAA 4EBDA 5BJRA 2HSEB 2MPUA 4IOBA 5F3ZA 4ITSA 2W6KA 1RT7B 2H5EA 2F9WA 1LCUA 5HVGA 1GH8A 3AO4A 3R6GB 3HHEA 3V6DB 3DRPA 4CHYA 2HLTA 2R8JA 2W9BA 4U67Q 3ZEUA 3TEGA 1UAXA 4YOVA 5TKYA 2HAIA 2ZFHA 2W2MP 4ECTA 4D3HA 2A40A 4IG0B 1BA0A 4HKQA 2J8AA 4FNIA 1VQOS 3RMBA 4B3MF 1NJIO 1B9DA 5AT1B 1L3TA 4FZVA 2R7TA 3MMBA 3KXDA 4G1QA 4ICLB 3BO4A 3U1MA 4JI2J 3OXLA 3A8YA 2MKJA 3QZ7A 3IG1B 4NLDA 5CYQA 1IH7A 5CYQB 2Z2LA 3MWPA 4DN0A 1HW9A 3CF5Q 2ZOMA 1WUUA 2COLA 4DR4K 4DL5A 4M3UA 5HANA 1JLEB 1VIOA 3BN4A 3Q0AA 2KI2A 4C8OA 1UWAA 3VGUA 4A8MP 3SQGA 4UZCA 4FYVB 3EZWA 4JI6K 4IOCL 3QLHB 2IFXA 1IBKK 3WXLA 4OHXA 4CLFA 1VQNN 3TAEA 4FVMA 4NCAA 1Y3JA 1NGBA 3FZBA 1FESA 3V6DA 3ZTRA 1LXJA 1VQKS 3J7AN 4F67A 4PZVA 3ZETB 3SPZA 1F1BB 2CXEA 4LR8A 3HPGA 4BRIA 1RBRA 2YX7A 1A5WA 4FO0A 1M90O 2VJVA 4I67A 3PO5A 4DL0C 2K1RA 2P6TA 4FLUA 1LEOA 5HROA 1GTEA 5IM0B 4P72A 3D3BJ 2E8AA 3MMCA 1N6QB 4EBCA 2DNNA 4DR3J 2CPFA 1MG7A 4Z4GA 4C7QA 4FLYA 5IWAK 3CO9A 1J5OA 2JL9A 4EEYA 1MWKA 2OEKA 3AVIA 4RNHA 4UQGA 3BJYA 2GC8A 4WU3A 3EGVA 1HQEA 1T03B 5KG0A 4DF8A 4JK9A 1QUPA 2AX0A 3CM5A 2CQ3A 4CYUA 1VRUA 3B78A 4M3RA 4L76A 1YJ9N 5I9EB 4OKKA 4DV1F 3E9OA 4JI7F 1CJTA 1WSGA 4J2AA 4R25A 5BN8A 4F04B 3JS6A 4WK1A 4ZVQB 2C3UA 4WF9Q 1HJRA 4FW1A 4OMFG 1TK5A 2GMJA 4F3QA 1VYAA 3MEEB 4FL9A 2OZMA 4YB1P 2GHWA 4CK2A 2QMWA 3AD9C 3BQ0A 2RAQA 3O1LA 1M5OC 1MROB 5EX0A 2UXDF 4DU3A 3JS9A 3M32B 4DV0F 3VCDA 4UW2A 4KH1B 4CZIA 3HOTA 1A7GE 2P9GA 3S7RA 3CQYA 3UNGC 2DPNA 1HJOA 3DDKA 3PEJA 4P7TA 3CJSA 4EK2A 3J81U 2RKIB 2Y8YA 1U25A 2E1CA 4FCYA 5BYQA 1SV5A 3HZEA 3DM2B 2IOCA 1R8CA 4C0OC 4ILMA 3PR5B 2FGCA 1YTUA 1U6BA 3MEDA 3VZIA 4QIEA 4QJVA 3ID8A 1NPRA 2D3O1 2YWEA 3TARA 1IBLK 2B56A 6FDRA 3W2VB 2YNGB 4DBQA 2MKIA 1Q4RA 2YKNA 2HF4A 4Z7YA 2Z1JA 3R97A 1TP7A 3THWB 1VQPS 4NLSA 1J5EJ 4BE0A 2M8HA 3G71S 4O4GB 2OAUA 5SWMA 3VGMA 2BZ2A 2V94A 4GC6A 4W5RA 4DV2K 3EICA 4WCEQ 4BACA 1TL7B 2JOQA 3LPTA 5KT2A 5K8OA 1RLCL 4DR5J 5J2QB 4UOFA 2HGNA 1MLAA 3GWCA 2BQUA 4OI1A 1BLUA 3WEEA 1ZETA 1FXDA 4FKXA 2O4GA 2CQ1A 4JKEA 4M63A 4OQJA 1N8RO 4FJ8A 3P38A 1C4CA 4OZ0A 2HFSA 3GSDA 3DKDA 3DFEA 4OLPA 2NQPA 1XNQK 2P8IA 2RDIA 1PGZA 3CFPA 4Q0BA 1RILA 2DNHA 1BGXT 2IA6A 3ELHA 4Y2AA 4BR9A 1YJNS 2W2OP 2L9DA 4CO1A 3A0IX 2G0JA 2GMHA 1UJ5A 3LA0A 1AFIA 1U1KA 4DV0J 3QICA 4ZCMA 3PKMA 1KBRA 2R2UA 5L46A 5C5JA 1EQ0A 1NU0A 2GV1A 1GQEA 2LKZA 2IVOA 4AXJA 4BRAA 1ZS6A 3UB5A 3MM6B 3QATA 4LF1A 4AHTA 1CC8A 3MXHP 1S59A 2V67A 2ZC4A 2DGSA 4MYTA 1EJ7L 2G4BA 4CK1A 3OUYA 1EARA 1PBAA 2OSQA 5GAEP 3AVAA 4DUYJ 1IWAA 3C2PA 1O6XA 3OUYB 1YJ7A 2E5GA 2RDJA 2EC0A 1BDGA 3V9XA 4JKAA 3CD6N 2VIHA 4U8VA 5T7LA 1I94K 2RF2B 3B6BA 3QGIA 4GKJF 4BC7A 4F4XA 4H54A 1HNZF 3TZXA 1F6TA 3AJ2A 2HHWA 4ZLPA 3CETA 3CCLS 3MECB 3G82B 2OGUA 5L1JA 3EPGA 1VRTA 2R7UA 4PL8A 2AEJA 4GNIA 1NGGA 1BMQB 4CO4A 3L2RA 1T9TA 3CEDA 2QO3A 3LDSA 4R0EA 4GC7A 1KLMA 1WTBA 4FJLA 2XNQA 2W24A 3LDPA 4Y2CA 4IRKA 4BC4A 2RHSB 4E0DA 4QS9A 3EWGA 3VQ6A 1DLOA 3QJLA 2DIUA 2ZWOA 2ZJRL 1C1BB 2FUG9 3CMAS 1T9VA 4CO5A 1RNHA 2BQRA 3N6MA 1TUGB 1W0HA 3Q23A 3O2IA 5A8RB 1Q16B 4AE5A 2Q3PA 1R3NA 3MX5A 3I8BA 4FWKA 1F2HA 2HS4A 3L7OA 4CEEA 3CVKA 1NK4A 2O01C 3SJJA 3ZTOA 4IZ9A 2GIFA 1TV6A 2RHQB 5CD4A 3MR6A 2NXNA 1HYSB 5SZTA 4A8OA 3KLIB 4I9LA 2WBRA 3QIPA 3M30A 2DXEA 4ZPVR 4B3MJ 2RHKA 2EVZA 3GV8B 3ZFVA 3G25A 1PKUA 4R79A 3AH6A 4ZKAA 4PQUB 2BM0A 3F56A 2NPIA 4MKVA 4ES2A 2MSTA 1CJKB 1HI8A 1TK0A 1HD0A 4CLUA 3QDKA 3OY9A 5D4NA 1RUSA 3VEYA 2DCUB 3AD7C 3WDOA 3CCJS 2O8DA 5I4MA 2AEFA 1E6YB 2JSXA 2Y0BB 3F73A 4RPFA 1LW2A 3CD0A 1RWKB 2OPPB 3T3FA 4S0MA 2DPJA 3O3HA 4NXMK 2JH3A 3ZSQA 2E7XA 1RTDB 4I6MB 3K59A 1B92A 3OYEA 3IRXB 3BGUA 4X62K 1TU0B 2LLZA 3VQTA 3O3GA 4YB7A 2FJAB 3GB0A 3EE3A 2DIVA 3FMBA 1TR0A 2EWHA 1UWBB 4F2SA 1XTZA 2FC9A 3RSEB 3RG6A 3FZFA 2KRRA 4JKHA 4CECA 2N4DA 2WZ1A 5JXSA 2NXCA 4A8XA 3NRBA 4OJ1A 1SC6A 4CM0A 4A59A 1EB0A 1VRUB 3POTB 1RA7A 1A9NB 3AT1B 2D1KA 1VFJA 2XCPA 1U4BA 4FKYA 3KNGA 2PD1A 4AUKA 1XUPO 4ED0A 1N34K 2VOPA 3SEOA 4GVLA 3SXLA 4BREA 1L3SA 3JSYA 3PCOB 1KR4A 4O5BA 3RTVA 1U2CA 2D1CA 1TL3A 2CPXA 1HWIA 4CJSA 1A0OB 3GTYX 4OI6A 4CGGA 3DGVA 1JLCA 4MO5A 3SNNA 2L9WA 1YTYA 2W9CA 4NXMJ 2JEIA 2CYYA 3V6JA 1CQMA 2XGQA 3K2PA 5TKWA 3L4BC 3QZ8A 4KBOA 2RRAA 1MA9B 3K5LA 2WVEA 3T5HA 4KHSA 5DRKA 4DR3F 2BTFA 3E9LA 2BR0A 4G9ZA 3KUGA 2XMMA 2MZTA 1YVUA 2OI2A 3CSKA 2QWPA 4RUBA 2E1YA 4IEIA 3MM5B 1R8BA 1TL1B 4C98A 4HHJA 3P5TL 3D9BA 4PG6A 3JTOA 1GNKA 2Y8WA 1WBBA 2R7VA 5CCMA 3LM2A 1NBWA 1YX2A 1N34J 3MXJA 5HQ8A 2IVYA 4B1XB 2QL9B 2DEJA 3BSNA 2AJ2A 2O8EA 2Y3YA 2CQDA 3FEYB 5L1IA 3SUNA 3J81O 2VWJA 1XC3A 3NCPA 1BISA 3SYZA 2IJFA 1FD2A 2GQCA 2HF3A 1EP4B 4UZBA 3NE6A 4Z4IA 2UP1A 1LK7A 3VEXA 2W4PA 3BBBA 1VQ6N 2VB6A 3BR8A 3HD2A 4C8LA 2C2EA 3IRXA 2O8BA 1QSSA 2LEPA 3H1QA 3ZX2A 2BRLA 2MJNA 4EO8A 4YOEA 1WSIA 4WJBA 1VQLS 4FJNA 4YMEA 2B9EA 3EZUA 5EXWA 1VQPN 1SH2A 4KC5A 1BWEA 3ZX0A 1K73O 2IDOA 2HBKA 4AF1A 4RLEA 3P4UB 4K0KF 3CHWA 4TU9A 4RW4B 3TAQA 3S41A 4WFBQ 5AFUA 5E7OB 3HHLD 4KKOA 2GAGC 4Z7CA 4PQUA 3OQ2A 4IH6A 3GLJA 4TYAA 3M9NB 3WIUA 3LO3A 2CZVC 2PE8A 4OLBA 2YNHA 4O44A 3HP6A 2W9AA 2RQ4A 4KHUA 1Y5LB 1ZAXA 4OZ2A 1X4GA 3RBXA 1P9YA 1WKKA 4LFCJ 1NSAA 5CABA 4ED1A 3DXMB 1K0TA 2CDRB 3RB6A 4IDHA 3TYTA 2RILA 4LSLB 2ZBCA 3FRZA 4UY85 4CI6A 3AOBA 5AQIA 4YR3A 4LF7J 3G6ES 1Z26A 4M5DB 1BQMB 4CD1A 1S9GB 2KO1A 1GAOA 1PCAA 2FSKA 5IS2A 4CJUA 1OQ3A 1UAWA 5KG5A 3DI6B 3M6UA 4OPAA 2F65A 1AUDA 4HVJA 2DGQA 3CTRA 2Q3SA 3O8WA 3H3NO 1JLFB 4DN9A 4OGCA 1QQMA 1C1BA 2ALZA 1Y10A 3B6OA 3FNNA 5M1QA 4PPZA 8ATCB 2QXLA 2GQQA 2XM3A 4DXLA 3BN7A 1PSDA 1F9FA 1ZM3A 1WOPA 5C0YA 5DQGA 5E2QA 3G0ZA 1IO2A 4BE2A 2GIRA 1T9XA 3RZAA 3BV8A 1V3RA 4PG5A 3VAMA 4NX9A 3GG0A 4HHTA 3CJCA 3D0GE 5I3UA 3IKMA 4Q8EA 1HR0K 5LJVA 4M5HA 4UY8T 4NZ6A 3HVRA 3UDVA 1A5VA 3IR6B 1VK8A 1MMNA 3VZHA 3KMSA 2QT7A 5DM6L 2I7NA 4MQ3A 4P74A 3J7ZT 1RTHB 1JXBA 3CC4N 2H9ZA 1EQMA 5DO2A 2O8FB 1H98A 4AYBD 1FWLA 1FFGB 4IKFA 1GFWB 1HNZK 4Z94A 4KB1A 3VF6A 2DFFA 4FBUA 4J9PA 3GJRB 2C2KB 2H54B 3B8HA 2XYGB 3QRPA 1KQFB 1WG5A 5IV4A 2Z0GA 1S57A 2QX0A 2RQKA 1UZDA 4XPEA 2RPIA 1ZBLA 4LFBK 1S6PA 4KFBB 1BXNA 1GLAG 2D0PA 1XQIA 2EI5A 4K5RA 2KM8B 1G1XA 2LVWA 3VGTA 3RAQA 3KTQA 1XC9A 2HKEA 3I4HX 1UKUA 4TLRA 4OI0A 1WUAA 3ASMA 1R0AB 4FOIA 2VH7A 4USWA 3QO9B 5DMRA 2BE2A 2NR0A 1W97L 5J2PA 3US5A 4NPOA 2EX3A 2DTJA 2IJRA 1SC3B 4O23A 2X1FA 3LDNA 2EFGA 5HO4A 3OYGA 4K8ZA 1G3OA 3OFFA 3SI6A 4PRFA 1S7HA 1L3KA 3QO9A 4JB8B 3J7Z5 1RT5B 5AJ3K 4FK2A 3MN7A 3T1HF 2UXBJ 2MKYA 2LU1A 3UPFA 1NPPA 5A2QU 2RE1A 4ALZA 1S6PB 3VQSA 3WUHA 1QLNA 2D3OR 4ANDA 4HTJA 2J0XA 3TAMA 2R4FA 4X4OA 4H0PA 2GTDA 3AVHA 3ZT3A 3A2FA 5T41A 4P2XA 2YWGA 3FFIA 2HFZA 4ISGA 3TA0A 4Y28C 4F4YA 4UQTA 4EWTA 2JRSA 4M5MA 4FVUA 1RT2A 4GVMA 2CQ2A 4MMOA 4Y6IA 1KAXA 5IC4B 4ECUA 2A2CA 4DUZK 2XO6A 1KTQA 3A8JA 4JI8K 4YB5A 3AARA 2X3DA 2AWZA 3EXCX 2UUAK 1J2VA 3M9OB 2KDOA 4IBNA 3H25A 4KB0A 3O44A 1O1WA 1SS6A 2AJQA 4DV2J 3W2VA 4WFNQ 3PW0A 1KNZA 1IG8A 5LSLA 3MX2A 2B43A 4GKJJ 4PA1A 4F25A 3MCOA 3FBEA 3FCWA 1T94A 2PDAA 2FTRA 3R6MA 3MEDB 2V50A 4ZLNA 1EKEA 2J8SA 3CG7A 3GMGA 4LR9A 5LSRA 3NCIA 2DO0A 4QPXA 3EKUA 1ZPVA 5KFJA 5LOQA 5KRTA 2RKIA 1F3VA 4OPHA 2NPFA 4YNQA 1HR0J 2CA9A 4DU8A 2DXFA 1V4TA 1JJCB 2RUGA 1QE1A 4K42A 4YDUC 4RBUA 3LWMA 4ES3A 5CZ2A 4FJHA 1U2RA 1WSEA 1RBVA 4ISFA 3WQUA 4C9DA 4CNYA 3SPYA 3O08A 4IH7A 1IKYA 3JYTA 1RU1A 3FFKB 3MEEA 5M1OA 3OYKA 2DGWA 1QTMA 3RAXA 4U8YA 3WX4A 3R8YA 3O80A 5EN1A 3ONQA 3K57A 3R8EA 1CJTB 5HVHA 1V9OA 1SQGA 3J7YP 2XZWA 1RBSA 3HJFA 4IYQA 2YKQA 4WKYA 2DB1A 1KAYA 2HHTA 2F9TA 3AGRA 1X4HA 1VAZA 5AQTA 3OVAA 4N7TA 1TKTA 2MYFA 5CE3A 5AQSA 5KT6A 3RR7A 4DJBA 4FWNA 4NLOA 4DV5K 3HL8A 2E5LF 3SCJE 4ER8A 3L3VA 4J7CA 4ECRA 1Q8KA 4NXMF 1X5TA 1RABB 4BC9A 4LQ3A 1FTRA 1Y9OA 1RT1A 1VC6A 1GX5A 2Y1RI 3ZZZA 3TOQA 3TUIC 1MU2B 2HPUA 1KTVA 1Z25A 3ZETA 5F0XA 3HHDA 1X9WA 2XCAA 2UXDK 2OZSA 2W42A 4IJAA 2AU0A 3LGNA 1O5JA 3QLHA 5KFHA 4Y2IA 3IBWA 3CCLN 2AHOB 4K4VA 2KTQA 1JXEA 3BSAA 2UU9K 1E6VB 2KT3A 1NDKA 4CCHA 1PBUA 2GVDA 1OJ4A 5KFUA 4DHYA 1FEEA 2ZKTA 1OVYA 3HHLC 2ZM6F 3CCQN 2Q2RA 2UUAJ 2R42A 2GIQA 1SQKA 3VENA 2V7YA 3F5TA 2JFKA 3OD2A 5HN0A 3J7YI 3MM5A 3OL7A 3A4TA 3E8OA 2L41A 3OJUA 1GX6A 2P9EA 3MMBB 4OYAA 3K9KA 2BMBA 3PRDA 3D68A 1K8AO 1D1UA 1U8WA 3M1VB 4NRTA 4LFCF 1FFWB 4E7HA 1LAVA 1UFWA 4KGZB 1UCNA 3PRBA 1UOCA 1VQ9N 5F2RA 2N7YA 1XMQF 1NUEA 1A6LA 2DNMA 2PFDA 5BRDA 5BPLA 3VF2A 4C97A 2VQEF 4F0KA 1IKVA 4DLEA 4AXIA 3N6LA 4HDHA 4FP9A 1OO0B 2CUYA 2G0CA 4JI6F 2AQ4A 3KG0A 3KK2A 3P31A 1UEVA 1N5VA 3OR2A 1TELA 1OYEA 4GV3A 1RK8A 1X0FA 2NUBA 4I2PB 4DB3A 4RUCA 1BC6A 1GOAA 4FK0A 4IO8A 1H7WA 5GAHP 2UXBF 3ZLJA 4A62A 1W25A 1SJ4P 3MEKA 3O5TB 3EZ5A 3FZMA 3KJVB 3FKBA 1NB2A 5IV3A 3O6WA 1Q86O 2YNIA 3ITHA 1LW0A 2FZGB 1SL0A 5HSPA 5E3QA 5CR4A 3U02A 1IVZA 3B6PA 4DMNA 4YHHK 4ED4A 3PW7A 2V51B 1EKSA 4QIWD 1HKGA 1JKHA 2HBRB 1T3OA 3LDLA 4TYBA 4P52A 3FUYA 1FJGF 3TTFA 2BUNA 3NNCA 4KGXB 4FOEA 4KH6A 3ENQA 3V81B 5K5MA 4O3PA 8AT1B 4AILC 5CZVA 3V9UA 4N41A 5EVZA 1HNWK 3W60A 1YJTA 1RAEB 1KVCA 2HHPA 1VQ7S 4YEAA 2G8WA 2G1HA 2HW3A 3B4DA 4CZLA 2V34A 3CT9A 1CPZA 5DG9A 2EBEA 4WK3A 1YVNA 4UTGA 2P9PB 1X3NA 4H5WA 1LW2B 1HKAA 3AY0A 3W61A 3DJCA 4XDDA 4MKBA 3LZIA 2X3GA 1FERA 2ZD1B 4LBPA 4AHRA 1I39A 4BR4A 3GL1A 2WUSA 3RU0A 4WPAA 2CJKA 4QYRA 2ZJPL 5HQLA 3W5XA 2V9WA 2WVCA 5KG3A 1P1TA 4GVBB 3S01A 3IR7B 3THXA 4P7VA 2HVEA 3SIPB 4IR1A 2P9LB 1PG5B 3EO3A 1CBKA 5CYMA 2ZJQQ 5AQHA 4E7JA 3BB5A 2HQDA 1XMBA 1T05B 3NF9A 3KLIA 3N6NA 2AP1A 4FK4A 4GW6A 4Q7AA 4WZQA 1EX4A 4GMKA 2XSFA 5G0RB 1T6CA 4LF8K 3NS7B 5KOXA 3PXGa 2WRMA 2CQPA 4J5OA 1Q53A 4WP9A 4NLYA 1RWOB 2C3PA 4KO0A 2ILZA 3F41A 3NGYA 2CGLA 2XQCA 4DS4A 1U09A 3THYB 1Q81O 1T6DA 3N79A 3K5MA 2GMLA 4WP3A 1ZOTA 2L08A 4DPXA 3J81Y 2ZDOA 1X9JA 3BF3A 4FLTA 3FCVA 3DOMA 2OEMA 2ZM6J 2XC9A 4MFBA 4CJLA 2UUBF 3GV7B 4V1Ak 2HOEA 3TJ9A 2YWKA 1KLMB 3W5YA 3C0BA 4OI3A 3IUCA 1V6HA 4MFBB 2EK6A 3W1YC 1FXLA 2EK1A 4ZVSB 1SH0A 1WDTA 3PTWA 2JEFA 3R7BB 1SB6A 2WCXA 2M9KA 1VQMS 3B82A 4AQYK 3GBTA 4F4KA 4CHQA 4FJGA 5KFEA 3W3DA 4BRDA 2XS5A 3E1YA 2Y0SD 1HWLA 1N4LA 1WSJA 5G0RA 1C4AA 2YKPA 3P45B 3HT0A 3ILOA 3ZZTA 4H4MB 3ZO7A 1RADB 3CIZA 3PX6A 4IOXA 3VN5A 2Y1JA 4CEOA 4PYDA 3KNAA 1H7XA 4EZ6A 1S4FA 3MEGA 1FKPB 1T05A 3H20A 3BKUA 2YQ1A 3GYNA 2HVIA 5CYMB 3VAGA 5HRPA 1RWPB 3NGTA 4ZDNA 2KYXA 3A5MC 4ELTA 1RDCA 3CC2S 2MKSA 4DZ6A 1U6FA 1HBUB 2VQEK 2DNYA 4B9LA 2UUWA 2EXUA 1ZTTA 4M7YA 2OKQA 2L48A 2IVFB 5DM7Q 1LK5A 4DF4A 4M45A 3CCWA 4X4NA 3W8GA 2CIMA 3I9V9 1N34F 3O4WA 4ZP9A 2P9CA 4WYWA 4LF7K 3SZ2A 2IIHA 3WC2A 3FRYA 4ELUA 4Z4CA 1WN7A 2VOOA 4CLPA 1Q7YT 2UXCJ 1OMSA 3G96A 3C6HA 3LPEA 2V68A 4W5QA 2F40A 3QGPA 2WONB 2OTJN 1JLAA 3SBTA 3FGVA 4CJ5A 1YJNN 1WSVA 9RUBA 4HACB 2NUUG 3O4NA 5FLXO 4K2XA 3CQ8A 4CEAA 3IMQJ 1HR0F 2A2DA 3MCNA 2KLAA 3ENBA 2QFJA 4OJGA 3QEWA 5E3RA 2IS3A 1NGHA 4WCEL 5E5NA 4KHQA 5J2QA 2WC9A 3VF4A 4K4SA 2RS2A 1HHSA 3CDWA 3DLKA 5E3CA 4K41A 4O4GA 5BPMA 1WOQA 3KJVA 1NSKL 1RGVA 3NEKA 2MQOA 2ZZNA 4GVEA 4DR7K 4Q2MA 3CIPA 3IRWP 1GXTA 5D8HB 4I2PA 2MXYA 3AVBA 1AROP 2ZBRA 4J9MA 1EIYB 2RNEA 2EKNA 5HBMB 5DQHA 3LP3A 5LXYA 2ROGA 4J9UE 3SFGA 4C0BA 4Z4FA 2CPDA 2FBXA 4USVA 1RFQA 3T1YK 4IXCA 1XWLA 3L4IA 1XNQF 2DNRA 1Y3KA 2JEJA 2G0IA 1EWRA 2QI2A 2VFSA 1W26A 1NZAA 2FVSA 3TEHB 4ECQA 1K9MO 4X4SA 1SQFA 1Q5YA 3T1HJ 1BCMA 1M5VC 3UE5A 3LTOA 2EFOA 5B7WA 3VEZA 3TUJC 4QQBA 2W41A 1CULB 3KKSA 2BGGA 4FXDA 1CLFA 4IRCA 4ZA1A 3HM9A 4WQ4C 1Y7PA 1UL3A 2KYZA 2D0AA 2GVDB 2NUHA 3HMJG 2F96A 5ETQA 2YH1A 2FF6A 4CGHA 4GO5X 2MQQA 2QIFA 3EN9A 1PC4A 1FNMA 3M6WA 4NE9C 1AFJA 1FHTA 3L3CA 2FBTA 2RSQA 4PYAA 2IPOB 2QK9A 1CXUA 4DR1K 4B1WB 5KG2A 4WKRA 1N6QA 3SCIE 4O3SA 4H0TB 2Z1IA 2BXJA 2HK3A 5IM0A 3NMUA 2WW8A 2YPYA 3MPUB 2V2KA 1RT1B 4OHWA 3SI8A 4O5FA 3RMDA 3S6EA 3S3MA 4RW6B 1F0XA 2NZCA 4ZVEA 3VGKA 1TMMA 1QM9A 4DUTA 4KT0C 3TVZA 4U7CA 3OTOJ 4DTXA 3NH1A 2YKMB 1FRMA 3FGUA 4WBFA 3HTVA 3DDIA 3OLBA 1OH6A 3GIMA 2MDA