1JKHB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with dmp-266(efavirenz)
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
424
structure length
398
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT, A-CHAIN
total genus 110
structure length 398
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jkhB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jkhB03
2YKMA 3QO9A 2ILYA 3TVKA 4ED8A 3HVTA 2WCXA 4YR3A 4GC7A 2GC8A 2WONB 2ALZA 2F8EX 1N48A 2XGPA 3QLHA 2QV6A 4ICLA 5CYQB 4GC6A 2C2DA 1C1BA 1JKHB 4XO0A 1LWCB 4IG3A 1R0AA 3G6XA 5DG8A 5DQGA 5KFYA 1S1TB 3DRRB 2IM0A 1MU2A 1T05B 1C2PA 1SH2A 3CO9A 4YR0A 3PR5B 3DLGA 4YQWA 1RTDA 4ZMMA 2W9CB 2D41A 3MTKA 4B3OA 3MEGB 2E9RX 2ASLA 5F8NA 4KV8A 1UWBB 4TQRA 3GIIA 4NLUA 3DLKA 4RW6A 1FKPA 1RT7A 1TL3A 4RW9A 2FJXA 1C0TB 1S1UB 3NAIA 3MR2A 2UVRA 2JLEA 4IDKB 3QIPB 1IKXA 4YMEA 4H4MA 4ZVFA 3H5XA 3NMAA 3PHEA 1REVB 3N6NA 5DQIA 1TKZA 4ID5B 4K4WA 3PW5A 2VG7A 4O4RA 2HAIA 5D3GB 4ICLB 5CYQA 1S1XB 3HVTB 3TAMB 4IKAA 5C5JA 3LP1A 3PJWA 4QWCA 2XI3A 5KFDA 4JV2A 1S48A 2RKIB 1T03B 1RT2B 2IAJA 3NKYA 1VRUA 4IH5A 4X2BA 3KJVA 2HNZA 4O3PA 1QE1A 1GX6A 3H40A 1S1VB 3V81B 4NLGA 2JC0A 3PW4A 4H4OB 1RT5B 2FJWA 4MFBB 4R5PB 5F8MA 4XPCA 4MIAA 3IS9A 4LSNA 1IKVA 2YNGB 1C0TA 3CVKA 3N6LA 4NLRA 5KFPA 3DOLB 4LQ3A 1TL3B 4I7FA 2I5JB 3I5CA 3HHKA 1JLQA 4ED6A 2VG6B 1UWBA 1JLCA 4WFXA 4Y34A 2VA3A 1KLMB 1S4FA 2W8KA 1S49A 1LWEB 4RU9A 4PWDB 4RW8B 2CKWA 1LW0B 4RZRA 4EBEA 2WTFA 3HKWA 5KT5A 4Q0BA 1XR5A 3M9MB 3FDSA 2W7PA 3KK1B 5J2PA 4WXWA 3CDEA 1JLGA 2YNHB 5F9NA 5KG3A 3RB4A 2FLLA 3JSMB 3Q8QB 5FDLA 3CJ2A 1S10A 1S9EB 3UQSA 4J9QA 3KJVB 5I3UA 2HNDB 3H4BA 3KLIA 4NYZA 1T03A 2VG5A 3M9NB 2D7SA 3KLGB 4F4WA 4R0EA 4TY8B 5HP1B 3DLKB 4RW6B 3ISNC 5KFKA 4J9OA 4J9LA 5KFHA 1FK9A 4FBTA 3QZ7A 2I5JA 4I7FB 4MH8A 1IKYB 1TL1B 1CSJA 3H5UA 2XC9A 2RDJA 1K1SA 3PJXA 4Y3CA 3T5JA 4EBDA 1BQNA 4Y2CA 3T5HA 4DL3A 3GIKA 2I1RA 4ECVA 1RT4A 4G1QA 1IKVB 5DQHA 5DLGA 1N4LA 2R2SA 3GV8B 3RB3A 1SUQB 4JUZA 2OPQB 3CDWA 5EWFA 5D3GA 4KBIA 3KHGA 1HNVA 1TVRA 4O44B 3RB0A 1JLAB 3H5YA 4NLWA 2JEJA 3I0SA 2JEIA 2BANA 1JLBA 1RT6B 5CYMA 2IA6A 2BE2B 4K4ZA 3KK3B 1RT2A 3QO9B 2FVCA 1IKWB 4QWDA 1HYSB 2BQRA 4LQ9A 4PQUB 2ZE2A 1RT3A 4DL4A 3GILA 3JYTA 4KKOB 1MU2B 4DL7A 5I3UB 2OPRB 4TY9A 4RNOA 2YKNA 2R8JA 4KB7A 3BSNA 4XPEA 4Q43A 4IRCA 4EYHB 4RNMA 4YP3A 3KNAA 3NBPA 3KLEB 1KHVA 2YNGA 5KFIA 4QWBA 4KSEB 4RNNA 2C2EA 5J2NB 1S0MA 3PVXA 1D0EA 2UUTA 4NLQA 4JV1A 4RW9B 1IKYA 1BQNB 1WNEA 1LWEA 3E51A 1FK9B 3EZUA 3PW7A 1SV5B 1S6QB 2OPSB 3QGHA 4U7CA 1HMVB 2B5JA 1ZETA 4QPXA 1HNVB 4F4YA 5DLFA 4FS2A 4ZPCA 4NCGA 3GIJA 3IG1B 1HARA 1HNIB 4NLXA 1S1XA 3TAMA 3KK3A 5CYMB 2VG7B 1C1BB 1JKHA 3MR5A 5FDLB 2HWHA 1C1CB 4RW7B 4HKQA 1QAIA 2W9BA 2R8HA 1NNDA 2OPRA 2IJFA 3UPFA 5KFFA 2AWZA 2AGQA 3V6KA 2JEGA 2B43A 1TKTB 4URQU 4ED7A 1K1QA 2XCPA 4J9NA 1TL1A 3HVAA 5HROA 1S97A 4KV8B 1U09A 4DL6A 3KLHA 2W7OA 1QUVA 1C0UA 4M95A 2WK4A 3G6VA 3DOLA 5F9LA 4TXSA 3CJ5A 3MEDA 4NLOA 3QIPA 4IH6A 5EWGA 1SH3A 3CIZA 3M9OB 2RF2A 4RNFA 3V4IB 3BSAA 3Q8PB 2FVQA 1IM4A 4F4ZA 3LP2B 2WOMA 2WRMA 4ECXA 5HBMA 3M8QA 1FKOB 5J2MB 3V6DA 3PZPA 2B5JB 5KFRA 4EEYA 4ED3A 1LW2B 4FS1A 4M94A 1RAJA 3MFIA 4EYIB 4DL2A 1DLOB 4IFVA 2IAJB 3CJ4A 2R2UA 5EWEA 2AGOA 1DTTB 2V0NA 4NLDA 1RDRA 2E9TA 1RTJB 2FVRA 4RW7A 5KFVA 4K4SA 3IGVA 2XCAA 3C6TA 5K14A 3QGIA 3EPGA 3CJ0A 4IRDA 1I6JA 4EO8A 1JIHA 4WFZA 3I0RA 5KFTA 3BGRB 2QE5A 1NHUA 2ZD1B 5F8IA 1S1UA 3OLBA 4YR2A 1RA7A 3Q8RB 1S6QA 2OPSA 4PUOA 4URGA 5KT7A 1JLCB 2C2RA 1RTIB 5L1JA 4ID5A 1FKOA 1TKZB 5J2MA 3V6DB 1J5OA 4ZP8A 5KFSA 2WOMB 4WE1B 2YNIA 4MK7A 1EETB 1LWFA 3DRSB 4I2QA 1BQMB 3BQ1A 4ECRA 4Q8EA 2W9BB 5I42A 4TN2A 3PW2A 3JSMA 2HNYB 4K4XA 3TQ1A 1D1UA 4DG1A 1JLGB 5KFUA 2BR0A 3DRPB 2XWYA 1TKTA 1DTQB 1RT3B 1S9GB 3MR6A 3JYTB 3MEEB 3ITHB 3NAHA 4NRUA 2C28A 2YNFA 3H59A 3LAMA 3VQSA 2ILZA 3D28A 4IFYB 2AU0A 2IMWP 4O3SA 3DLEB 2IBKA 3C6TB 5K14B 3I5AA 4ZVGA 3DMJA 4RW4B 5L9XA 3OL8A 5L1KA 1EP4B 5KG7A 2OPQA 4H54A 2IC3A 4LSLA 5KFOA 2AGPA 4ECYA 2R2RA 2BQUA 2W9AA 2R8IA 4QW8A 5J2QA 2YKMB 3KOAA 4WE1A 1RTHB 1YVFA 1RTIA 5KG6A 2IJNA 3I5BA 1HMVA 5KFNA 1J5OB 3UDLA 4Q44A 2BE2A 3RBDA 2ATLA 1TP7A 4F4XA 2D3UA 2JEFA 3E01B 4NLSA 2BANB 1N5YA 4ZP7A 1S6PB 3FFIB 4ZHRA 1VRTB 4KKOA 3GYNA 5KFGA 5J1EA 4ECQA 3T1AA 5T14A 2OPPA 3LAKA 2ZE2B 2E9ZA 3EPIA 4K50A 1HYSA 4KFBA 3BREA 1DTQA 1S9GA 4O3QA 2D3ZA 1T05A 3DRPA 1C1CA 4MFBA 4ECTA 1S0NA 1RYSA 3BSCA 2YKNB 4J9SA 4WZMA 5KFAA 3DM2B 3KLFA 4IFYA 3OL6A 2RDIA 1S0OA 4ZPAA 3IRXA 3OHBA 1RT1B 4K4YA 1TKXA 3IN5A 2BRLA 5KT3A 2R8KA 4ZVEA 1XR6A 3ICLA 4PUOB 1KLMA 3T19A 5KG1A 5KG2A 1TQLA 3RBEA 1W25A 3DOKA 3NL0A 2FVSA 5J2QB 5KT6A 3V4IA 2YNIB 4Q0BB 1HNIA 4O3RA 5F8LA 3DRSA 4I2QB 4ZPBA 3GQCA 4Q8FA 4R8UA 4IG3B 1LWCA 1R0AB 3KMSA 4TYBA 4URSA 3V81A 1N5YB 4IG0B 5C25B 2IM2A 3GIMA 2DPJA 1QE1B 2B6AA 3NGDA 3KLGA 5HROB 1JXLA 3OSNA 4MKBA 3LANA 3QGGA 2V9WA 4LSNB 4JV0A 1HQUA 3UR0A 5KFQA 3H4DA 3IRXB 3DM2A 3OLAA 3BQ2A 1MMLA 2IC3B 4LSLB 3KLFB 1HPZA 4TLRA 5KFWA 2VG6A 1XR7A 2R2TA 4WYLA 3V6JA 1HQEA 2FLNA 3KK2B 1SUQA 4RNHA 4ZP9A 5KFJA 2UUWA 3FQLA 4TYAA 4J9PA 1RT4B 3ISND 4G1QB 3N6MA 4IR9A 4PWDA 1ZTTA 5DG7A 1S6PA 3FFIA 2J6SA 5F8HA 1LW2A 3M8QB 2FVPA 2HMIB 1JLFA 1JLEA 4NLTA 5KG0A 4I2PB 2WB4A 4ZPDA 2RKIA 4R8UB 3H5SA 3DLGB 1RTDB 4KFBB 1KHWA 3Q8SB 1S1TA 3DRRA 3PW0A 5DGAA 3DYAA 1RT5A 4IOBA 1Z4UA 4IR1A 5KFLA 3BJYA 5KFEA 3T5KA 1RYRA 5F8JA 1T3NA 3T5LA 4RUAA 3ITHA 4KHMA 2YNFB 2R8GA 5KT4A 5C24A 4J9KA 3D5MA 4KE5A 4TQSA 3CJ3A 5C42B 4U6PA 5F8GA 5HLFA 3I0SB 1SV5A 4NLYA 4MIBA 3MFHA 1JLBB 1QAJA 3RAQA 2ASJA 5DG9A 3RAXA 2UVWA 4KAIA 3MECB 2AX0A 4H4MB 5I42B 1BQMA 1S9FA 2WONA 4NCGB 3FRZA 4DEZA 2CJQA 3KHLA 1EETA 4PQUA 4EO6A 5J1EB 2XGQA 1IKWA 2OPPB 3QIDA 3E01A 2B6AB 4I2PA 2HMIA 4ZVHA 2BQ3A 4ZHRB 1N56A 1JLFB 2HNZB 4DG1B 3FSIA 4NLVA 2V4RA 2JC1A 3DYAB 1VRUB 3FQKA 3C6UB 1N6QB 2W9CA 4RUCA 3MEEA 2GIQA 3H98A 4KO0B 3I0RB 1OS5A 5J2NA 2J6UA 5KFBA 2WHOA 3QYYA 2AX1A 5EUHA 1EP4A 3DLEA 1HQEB 5KFXA 4G3IA 5HLFB 4O4GA 4F50A 5C24B 4MKAA 4WXOA 1LW0A 4K4VA 4RW8A 4QW9A 1VRTA 3RB6A 3SFUA 1JLEB 2IM3A 4J9MA 1RT6A 4FBUA 2O5DA 5JXSA 2C22A 2HNYA 2YNHA 3KLVA 5JUMA 4O3OA 5J2PB 2FJVA 4DL5A 2VG5B 4ECZA 3KLIB 1TV6A 1T94A 2HNDA 4Y2AA 3V6HA 2J6TA 1S9EA 2XI2A 3KHHA 4H4OA 1S1WB 3LP0B 3NBPB 4R5PA 3C6UA 3KLEA 1N6QA 3M8PA 1NHVA 3LALA 1RTJA 4IH7A 4MK9A 3SFGA 3KLHB 5KFMA 4Q45A 4K4TA 4TY8A 4HYKA 1C0UB 2OH2A 1JLQB 1TKXB 1HQUB 4EBCA 3MR3A 4QWAA 4ED0A 3OL9A 2ZD1A 3DI6B 2RF2B 4J9RA 2FLPA 1RT1A 2BRKA 3KK2A 4NRTA 4ECWA 3MF5A 2AQ4A 3MEDB 3DOKB 2UVVA 3MECA 4O4GB 2W8LA 3CDUA 3KMQA 1JLAA 5HBMB 2DPIA 1TVRB 4O44A 4WYWA 3LP2A 4NZ0A 3HVWA 3QLHB 5KT2A 4QWEA 3IG1A 3KK1A 3QZ8A 1LWFB 3PR4A 3BQ0A 2EC0A 2V4QA 4IFVB 1DTTA 5L1IA 1ZTWA 4ECUA 2UVUA 4IQXA 3GV5B 4ECSA 4ED1A 3SI8A 5KG5A 1DLOA 3OSPA 2IM1A 2VA2A 3G6YA 1SH0A 5KFCA 4IG0A 5C25A 2GIRA 1S1VA 5HP1A 3LP0A 4B3OB 4K4UA 3M8PB 3MEGA 3DDKA 1S1WA 1JX4A 1TV6B 4MK8A 4OL8A 3BGRA 3IGNA 3OL7A 2ASDA 3H2LA 4KO0A 3IS9B 4WZQA 5EDWA 4KHRA 2HWIA 4IRKA 3OHAA 4ZP6A 4NLPA 5KG4A 1FKPB 1RT7B 5L1LA 1HPZB 1REVA 3GV7B 3DMJB 4RW4A 4WFYA 5DGBA 3G86A 1IKXB 5C42A 1GX5A 5KFZA 2ZKUA 3BR9A 3BSOA 3KHRA 4IDKA 4ED2A 3DI6A 3CWJA 4O3NA 1RTHA 3LP1B 1RA6A
chains in the Genus database with same CATH superfamily
2YKMA 4ZVSB 3TVKA 4OHZA 4YR3A 4JV5J 3CD0A 4B3SJ 2ALZA 3B54A 2G1DA 2UZAA 1N48A 2QEXS 2XGPA 2XS7A 3MAHA 2X1AA 3BBCA 2GVZB 2KYZA 1Y7PA 4XO0A 2QO3A 3M2UB 4CI0B 1GQEA 3G6XA 5B7WA 5KFYA 2RILA 2VPWB 3MR6A 1MU2A 3M2RA 4FNHA 1FNMA 1ROFA 1VFJA 2M4MA 3KUHA 4YQWA 4DV7J 4CH7A 2HQCA 4ZMMA 3DOMA 2NUUG 5K8MA 4FPIA 2YQ1A 2YWEA 1KRPA 3MAQA 2CDQA 3MEGB 4F67A 2E9RX 2CNNB 2KO1A 4ZKAA 4LFCF 4KV8A 1RADB 1KP6A 3AODA 4C0BA 1R31A 3GIIA 4LF8J 4Y2MA 2HFUA 4ELVA 2FJXA 4LF4J 2CQGA 2QL5B 2WSFC 3NAIA 1N5TA 3MR2A 4OZ1A 3ETMA 3IWNC 1OSDA 1LQ9A 3N0VA 5GVQA 4DXLA 4TU9A 1EAYC 4YMEA 4YY3J 1ZBTA 3J81U 1REVB 1S79A 1ZOTA 4NL5A 4YHHJ 1H74A 2HAIA 4BS2A 2RRNA 5CYQA 5C7PA 5D15A 4BWMA 4IKAA 4OZJA 1RHMB 4CH1A 2LLZA 5C5JA 3LP1A 1EX8A 2A18A 4N5SA 3KJNB 2XI3A 2KDOA 4JV2A 1IBKF 2RKIB 2YWFA 2V94A 4KPCA 2IAJA 3NKYA 4IH5A 2BV3A 3FBBA 1HA1A 4X2BA 2HNZA 2XSJB 4J91A 1QE1A 1X4FA 2DRDA 2XMWA 3L7OA 4O3NA 3PFOA 3D1OA 2OEMA 2KT5A 3MMAB 4M8LA 5D6GA 2ZH6A 1FJGF 4R5PB 2AYMA 1Q53A 4D3GA 3NMRA 4OI2A 3HPOA 4ILMA 1IWGA 2V50A 2WZ1A 1WKLA 2YNGB 2E1AA 3EXYA 3MM5B 3P5BP 1FD2A 4OJ3A 1PKUA 3I5CA 5BXIA 3HHKA 4DV1F 1JLQA 3VAIA 1TZ0A 1UWBA 2VA3A 2P6TA 1YZ7A 2W8KA 1S49A 3TZWA 1EIYB 3SDEA 4RU9A 2VV5A 3KG1A 3R7BB 4RW8B 3NCQA 3D0IE 3DGPB 1YJUA 1LW0B 3DFEA 4RZRA 5M2RA 2WTFA 4EBEA 1HNWF 4N47A 2W7PA 2V6AA 2OO4A 3AQOA 1Y5IB 2YNHB 2GGPA 3SSRA 4QJVA 1H3DA 4ZVQB 5A0YB 3D6TB 2OHDA 5A8KA 1U0HB 5GMKa 3Q8QB 3K5LA 1HNXF 1VLOA 1S9EB 3UQSA 4B3MJ 4PG7A 2BYCA 1FJ7A 2D3OR 3HSDA 1WC5A 4CLLA 4NCBA 1NDKA 1UAWA 4NYZA 2Y8WA 4DF8A 2GHWA 4LSZB 1VQ8S 3CCTA 4F4WA 2HZAA 4KGVB 1K0VA 5HP1B 4RW6B 2K3KA 3ISNC 2MKJA 3OD2A 4QR2A 2DR6A 1FK9A 5B0AA 3J7YU 2B7BB 3NCPA 1CSJA 5ETOA 4FBTA 2AJ4A 3RB4A 2ACYA 2VL1A 1N54B 4CT9A 1RT4A 5DQHA 1Y3JA 3OBIA 4PWWA 3GV8B 3BDEA 3GLJA 3I4HX 3VAHA 4QR0A 5EWFA 2UUAF 5H9FK 4KBIA 3RB0A 2LFVA 3AFGA 2DH9A 2JNJA 4UZBA 1X60A 3I0SA 4DFPA 2BANA 5I3QA 2UXBJ 3P96A 4GKKJ 4K4ZA 2V2KA 3JXOA 3PKMA 1NHKL 2AJ1A 2FVCA 4CM0A 1IKWB 4QWDA 1HYSB 3R5BA 4PQUB 1U02A 3GR1A 2ZHAA 1X0FA 3JYTA 3S01A 4KKOB 3BYPA 3UD5A 1FJCA 1T9YA 2K7JA 3TX8A 2OPRB 4HVZA 2KFYA 2KZMA 4IRCA 2X1GA 4KB7A 1ZYQA 4NXMF 3KNAA 4EYHB 4YP3A 4DSJA 3KLEB 2JX2A 1RUSA 4JI4F 4DUYJ 3QSYB 5KFIA 3LF0A 4USIA 4KSEB 1U1LA 1HKAA 1UVKA 1S0MA 2EC2A 2DR5A 4DR7F 3OXGA 3FMWA 5HVFA 2JOQA 4JV1A 4RW9B 2ABYA 4DR1J 2J9DA 1LWEA 3E51A 1X4AA 3B82A 5L8RC 4B17A 1SV5B 1S6QB 3QGHA 4DCPB 4DV5J 4A8FA 5GADI 2UUBJ 1HMVB 2EEYA 5RUBA 2B5JA 2XZTB 2J9CA 7FDRA 3CJTA 2A1BA 3ZZRA 1MN9A 4F4YA 4DUYF 2DCUB 1RZMA 4ZPCA 2ADCA 3C19A 3ZO7A 3CF5Q 3GIJA 1D8YA 2ZDOA 4DR3J 1HARA 1IBMF 4JI7F 3KYLA 3K57A 1P1LA 2VG7B 1NZ8A 1C1BB 1JKHA 1T9VA 4QIGA 2KRBA 2HWHA 3VAFA 4J9UE 1SJQA 1B64A 3HHNB 2W9BA 4PXDA 4LUBA 3F56A 4X4TA 3JSBA 4WTYA 2IJFA 1T9TA 3UPFA 4ILLA 2CQDA 3V6KA 2JEGA 2CZVC 3TUZC 2XY6A 1UCNA 3CIMA 3HSZA 1CEZA 5HMXA 1TKTB 3F73A 1T9WA 4URQU 1WTBA 5KTQA 5HROA 3HI9A 2XNRA 1QY7A 2HBQB 3IAS9 5K5MA 2WK4A 4ILRA 1NPPA 2J7KA 3CC2S 4W92B 3DOLA 2MKHA 2LEAA 1ZZFA 4X62F 4IOCQ 2XEXA 3CJ5A 2I2YA 2PN6A 4HHUA 2HFNA 1SH3A 1Q8IA 4ID8A 1VGYA 1YI2S 1X5OA 2ZHBA 4RNFA 4A8WA 3IWLA 3Q8PB 2HIYA 3LP2B 2PE8A 1Q95G 2V34A 2PSZA 3EGVA 3POTB 4ZJLA 1FKOB 5KFRA 1N52B 3BS9A 3HSJA 5GAHU 3E8OA 3MEKA 3MM6A 4FS1A 2YY3A 3OPKA 1GXTA 3LGNA 4ZCIA 4B3MF 2LA4A 4IFVA 2HVDA 4U8VA 2R2UA 5EWEA 2I8EA 4PQAA 1O8BA 3W65A 4QQBA 4ZIWA 3HDSA 1S6UA 1EKSA 2NQPA 1OJ4A 4P2FA 4OMFG 3CULA 3T6JA 2AZ3A 2HQIA 1RJJA 1NJIT 3C3LA 2NZ4A 3EPGA 3CJ0A 1I6JA 1BY9A 1X5SA 2CIMA 1U1MA 3J7AN 4LR8A 5A6WA 1U26A 3B8HA 1U6BA 1HWLA 2EPIA 1UEUA 4C11A 4DV1J 1VQSA 1S1UA 3D6HB 3ZFVA 2DEJA 3D3BJ 1V6HA 5K8PA 2M8DB 1CJUA 4DR3F 1S6QA 1IBMJ 4JI7J 2W4DA 2WVBA 1FFGB 4OX8A 2RAQA 2C2RA 2HFZA 1RTIB 3FBCA 4ID5A 1TKZB 2EBEA 5DDRC 1MW7A 2WOMB 2ROPA 2FY8A 3I4PA 4OIXA 4RL1A 1VK8A 2VFSA 4HACA 4WJBA 4LT6A 2WVDA 3M8YA 2AEFA 3L3CA 4Q8EA 4DR1F 4KQZA 2VPYB 1Q8LA 3K89A 2NLWA 4TN2A 4DL0C 2RMLA 2HNYB 4K4XA 4MYUA 1D1UA 4P2SA 2BR0A 4KIAA 1K44A 2DGUA 2DNQA 3DRPB 4C7QA 4FF2A 1E6VB 2XWYA 4DR6J 4ES1A 2BACA 1S9GB 2L48A 3O44A 3UR3C 5FD1A 4UUXA 4AQYF 3HKZD 3MEEB 1DY3A 2DNPA 4NXMJ 1TL7B 1G2EA 2NXCA 3VQSA 2NXUA 2AU0A 1Y5LB 5LJ3Y 2CPEA 3C6TB 5K14B 4ZVGA 1SL0A 1Q79A 3MOZA 2H5IB 2HRUA 3LGMA 3OR2B 4WP3A 3OL8A 1MMDA 1EP4B 1U24A 2BE7D 5ETRA 4ZLJA 3VVTA 3UDCA 2LEPA 2DRAA 2BQUA 4X66J 4DUZF 2W9AA 5ETLA 5J2QA 2YKMB 4QW8A 5AXLA 4WE1A 1E6YB 1M1HA 2FHJD 2XMMA 1R89A 1O6XA 4MYTA 1RTIA 3TEGA 5KFNA 1WEYA 2ZUGA 3I31A 3I5BA 3UDLA 4A8QA 3RBDA 1TP7A 1ZA2B 3H20A 4Y2IA 4HTIA 2M9KA 1N5YA 1XC9A 1DARA 4ZHRA 5KFGA 1VRTB 4ECQA 1XBWA 1U8SA 1WI8A 1ELOA 1N0VC 1VR6A 3LAKA 2HWTA 1CJKB 2HKEA 3MPDA 4FYYB 4KH0B 2WAQD 3HT3A 1VQPS 2DNNA 4FYDA 5IT9U 5JMNA 3DRPA 5LXRA 4B3SF 3HP6A 4JV5F 4ECTA 3N4WA 4PAAA 4DPYA 3T1HJ 4J9SA 4OZ3A 2NREA 1EARA 1YJVA 3EE3A 3THTA 1FKAF 1XNRJ 2MQ8A 4CYUB 3HO1A 3LH2S 3KLFA 2XHWA 2D69A 3CCWA 5F3TA 4UOGA 1F0XA 2ZBQA 3ZZPA 1S0OA 2N7CA 1KONA 3IRXA 1PYOB 2J8AA 1UW9A 2J7WA 1VOMA 3Q23A 4QYRA 4CO5A 2F8HA 2MQOA 3IN5A 3N5BA 2POKA 2K1RA 1FRMA 5B08A 4ZVEA 2R8KA 1R0BG 4MAKA 2MQLA 3OR1B 1ZH5A 1FXDA 3T19A 2A3JA 2R7XA 1FEHA 2AJFE 5KAKA 2CJKA 3NL0A 1VJQA 4DN9A 4V19J 1S59A 2W2QP 2ZNZA 4LRDA 1BC6A 1YJTA 2BE9B 5F8LA 3NNAA 1OPZA 2FZCB 1NK5A 3G82A 2O3DA 4NXNJ 1JK9B 1U1NA 1R27B 4IG3B 1LWCA 1RK8A 1SJRA 3QT7A 4TYBA 4DPUA 3KMSA 3FGVA 4HEA9 2L9WA 4MJKA 3WDOA 4EK2A 1R8PA 1OSCA 1L3UA 1NZAA 1HFEL 3GG1A 3NGDA 4QIFA 4ZPWR 2OIHA 1FJGJ 3OSNA 2CWKA 3MDFA 4MKBA 2V9WA 1WG1A 5KFQA 4JV0A 3HVRA 1M5HA 4HH1A 3DM2A 3OLAA 1MMLA 4LSLB 3KLFB 1JB0C 1LK5A 3OTOJ 4DHVA 4OI1A 4PXCA 1HQEA 1LNQA 2UV8A 1HI1A 2FLNA 1KQSR 4B08A 2B56A 3KK2B 2LMIA 4K5SA 5ADZA 2Y1RI 2B0GA 4DV6F 3CCZA 4YHHF 3DGPA 3ISND 4G1QB 2JRSA 2E1PA 3MD1A 2M70A 4TKTA 2HYIB 1I1GA 1AB8A 1F6TA 4YY3F 2JLFA 5B0DA 3A4TA 5HI7A 5EHHA 1PYSB 2DH7A 2ZM6F 2EFNA 2YQ3A 4HT5A 5DZ6A 4BBYA 1XNQJ 1RWPB 1LW2A 2FVPA 2PMZD 2XQCA 2MLXA 1JLFA 1IUJA 2H3EB 1D09B 4K59A 3PX6A 4LF4F 4I2PB 2WB4A 3HX9A 4HLBA 3G8SA 1TFYA 3H5SA 2V2ZA 4F0KA 1YLXA 4LFCJ 2JLGA 4LVOP 4HI1A 1BE4A 3MPYA 6FDRA 1VHIA 3FUYA 1JWWA 1S1TA 2DNOA 5LT5A 1RT5A 1WOSA 2CQHA 2CRLA 2DD8S 3JSYA 5CZVA 4AE5A 3BJYA 4DV7F 3PRDA 1RU1A 2VHGA 1AUDA 4X4SA 3ENAA 1SJ3P 1M5KC 2R42A 4DV0J 4B9MA 4P9SA 4CO4A 5KT4A 2Z57B 4P7VA 4NI2B 1MWYA 2BJ3A 5HLFA 1FXRA 3I0SB 3D2WA 2PA3A 2YH0A 3I82A 3BZQA 3QWPA 3SSQA 4RU2A 2UVWA 2QLWA 1TUVA 4J90A 4ZK7M 1VRQC 2AX0A 2YPZA 1BQMA 3UW1A 3CMQA 1B70B 1UZHA 5IC6B 3MMJA 5CABA 2ZZMA 1NEEA 3KHLA 2HHSA 5MAOA 2VODA 5J1EB 3T6BA 2OPPB 1J27A 4XIUA 3OUYA 4I2PA 4ZVHA 2DHHA 2Z30B 2B9EA 3R5AA 4XTTA 3P49B 2OI2A 2LXIA 2HNZB 3FSIA 2XSJA 3C6UB 2E5LF 1H73A 3UE2A 1DURA 2JFKA 1MNEA 3I0RB 2J6UA 2OEKA 4EMDA 2RD5C 2HS4A 1P8GA 1ACMB 1B0TA 4FN5A 3AJ2A 4S0MA 3HHLC 1IQTA 2QMUB 3ZTQA 1F5AA 1HQEB 2DGOA 4MMOA 3L4BC 3K5PA 2PEHA 3KWMA 4O4GA 3NS7B 6AT1B 2Z58B 5C24B 2OLWA 4AL6A 5B0CA 4N56A 4RW8A 3SFUA 3H25A 2D9OA 1OWXA 3MM6B 3QPIA 3TW0A 4DDFA 2VKRA 3KXDA 1U1OA 2YBVA 4J9VA 3VGUA 1TAQA 4C8LA 2ZKTA 2GO8A 2YNHA 2GGPB 5LSOA 2CQ0A 4LF7J 1S7IA 4ZVOB 2W01A 3TVYA 2KH9A 4X4RA 1A9NB 5HVGA 1W2IA 3BH7B 2VUGA 1RLDA 3ISZA 3KHHA 3NBPB 4R5PA 3C6UA 1FRLA 2BA9A 2HFVA 2KT2A 3LALA 1RTJA 1MWQA 1VQYA 3B78A 3KLHB 1IWAA 3OXLA 4IH7A 4K4TA 2OH2A 1C0UB 2VH7A 4JI8J 3TX0A 4P72A 1OMSA 2ZH7A 3T1YF 4RBTA 5IXUA 2W2MP 3MR3A 2MQMA 2RS8A 4ED0A 3OL9A 4Y28C 5I4MA 2UXCF 4J9RA 2BRKA 4IUFA 4NRTA 4ECWA 3MF5A 3MEDB 1FRKA 1J2VA 2DGVA 3MECA 4O4GB 3CDUA 2JWNA 1UMJA 1MG7A 2DHXA 2QN6B 3MD3A 3NRBA 3VV2B 4DPWA 3PYFA 4LFBF 3PYDA 2G2YA 3OV7A 4K2XA 3QLHB 5E2QA 2GO9A 2GVDB 3IG1A 2HFSA 3DCAA 4QWEA 2ZH1A 2FD2A 5CZXA 4C8OA 1DFDA 1FFWB 4WIIA 1Q1KA 2V4QA 4ANEA 1KOOA 1ZTWA 1YG0A 4WFAQ 5D0HA 2UVUA 3CD5A 4ECSA 4LREA 1BXNA 5KG5A 2IM1A 4JOUA 3G6YA 5AE3A 1SJFA 5C25A 2GIRA 1XMOF 2BDPA 2YX7A 3I56S 3K58A 1Y3KA 3C14B 2QLFB 3GFXA 1NK6A 1PGZA 4B3OB 4K4UA 3UCZP 2B7CB 1S1WA 4ZVUB 2ASDA 3IGNA 5BR8J 1KS2A 3IBFB 3IS9B 5GAEI 2HWIA 4RUHA 3OHAA 4FKYA 1W26A 4NLPA 5G0RA 4DSKA 2Q66A 2H1YA 2VQEF 2PMWA 2MZ1A 1AFIA 3IO1A 3UDVA 2GAGC 4PPZA 3DMJB 3BGUA 5DGBA 3GV7B 1UVMA 5C42A 5KFZA 2DNHA 3BR9A 3EZOA 4DX8H 1Z1ZA 2MHNA 4IDKA 2XZDB 4O23A 3SSSA 3UCUP 3CWJA 3JQJA 1DZ5A 4ED8A 3QO9A 3LGHA 1J5EF 3ET6A 4F4AA 5GAGU 3DKDA 2WONB 1NK0A 2BABA 2H65B 4ZCMA 3AB2B 4OJGA 3QLHA 2XO7A 3VAKA 1N36F 3BH6B 4GC6A 1NLKL 5AXKA 3PO5A 3IC1A 3BBBA 1R0AA 1BLUA 4PYDA 5BJRA 1PBUA 4OX6A 2PIIA 3TR5A 1WG5A 3DRRB 3IR7B 1C2PA 1SH2A 2AJ2A 3CB4A 1VQNS 1RTDA 1CULB 1WELA 2FJBB 2VDIA 4B3OA 1BHNA 1DJ0A 3IBCB 3MTKA 1D9FA 5LOQA 2ASLA 4F2RA 1S0VA 2CVEA 4O0NA 4NLUA 3DLKA 3QBCA 3U27A 1FKPA 1RT7A 1TL3A 4RW9A 3D54A 1HLWA 4WP9A 1YITS 1XWLA 3M1VB 2UVRA 2XS5A 2JLEA 3FZBA 2PC6A 4NZ6A 3G8TA 4FYXB 1A6LA 3R1LA 1SBRA 1AXQA 4ZVFA 4ZVPB 3PHEA 5E41A 4K4WA 3LPYA 3TZZA 3L7PA 3CCSS 2J0XA 2WB1D 3EGWB 1L3VA 4CTAB 4N8OA 4ATNA 2APOA 3MCSA 1LEOA 4QWCA 5KFDA 2VQFF 1WDTA 1T03B 1C4CA 2RQKA 4DR4F 1RAGB 1YDLA 3G2XA 3UWTA 1GX6A 1HBOA 2BJ1A 3MUTP 1P9YA 2BBEA 3HFKA 4NLGA 3R6GB 2F5GA 2FJWA 2LCWA 1KKHA 3I9V9 2HHHJ 2UP1A 1CULA 1KDNA 3LOUA 1GFWB 3DHXA 2GJ2A 1B7YB 3IS9A 1PO6A 2Y9HA 2CQ2A 3IP0A 5KFPA 3DOLB 1NBEB 3FBFA 4C48A 4I7FA 3W2VB 4BCAA 3W60A 3M8ZA 3VGSA 4ZJQA 4MKVA 4W98A 1X9SA 1V3ZA 3P6YC 1S4FA 3JB9k 1CJUB 2LQ5A 1Y4ZB 3CT9A 2XY7A 4F26A 2QYGA 3M4XA 2HK2A 5K9FA 4CP5A 4DCJB 2DR8A 4OJHA 2QSFA 2PEBA 4Q0BA 1NM2A 5KT5A 4DI6A 3M9MB 3CCVS 4I67A 3CO0P 3KK1B 3US5A 3AD8C 2KXHA 3CDEA 5DM6Q 2A2DA 4F3OA 2CPHA 2AF6A 2NPIA 2RHSB 2LQBA 5KG3A 3RW6A 3Q24A 3CJ2A 4OYBA 4UW2A 4CO1A 3H8YA 4P74A 2IYIA 2OMOA 2DR9A 3KJVB 5I3UA 3HHEA 1ZA1B 3H4BA 3KLIA 4CNYA 3W2WB 2L08A 3M9NB 3WC0A 3KLGB 2B8PA 2DIUA 1REGX 4MIWA 1U45A 3AOAA 2QJ3A 4L6V3 2ATCB 3SIPB 2C2KB 4F36A 2XG8A 4J9OA 4J9LA 1R8AA 5KFHA 3ZZUA 3RRHA 2RDJA 2BOAA 1IKYB 1TL1B 3G8QA 3H5UA 3T5JA 4DFMA 1K1SA 1PAUB 4DL3A 1YJWS 1N8RT 1BQNA 4Y2CA 1LFPA 1OO0B 2I1RA 3AA9A 2RSQA 4G1QA 4PG6A 4A46A 1SKUB 2R2SA 4Q5VA 1SXLA 1HNVA 4O44B 1X5TA 1WHXA 4NLWA 2DYAA 5E3RA 1JLBA 1RT6B 3CNQP 3N01A 2F7VA 1VIOA 3UN5A 3PRVA 4CLWA 3KK3B 1CC8A 2J5AA 3IBWA 4UOFA 1SL2A 1RBAA 2BQRA 1NSPA 3TZXA 3MI7X 1OQ6A 2ZE2A 4DS4A 3BBFA 1RT3A 2V5HG 3GILA 4EWTA 4M63A 2J0WA 5HAOA 2HZCA 3FVYA 4FXVA 3VR1A 2KL8A 3AOCA 3NP5A 3BSNA 2AKWB 2KYXA 4RNMA 2Z2MA 4JI1J 2YNGA 1DHMA 4NASA 1R6VA 4QR1A 4GKJF 2YKAA 4JI0F 3THPA 3PVXA 2UUTA 2CQ4A 4EFAC 4IYQA 1VQ9S 2AJQA 1UVIA 4KR0B 1SVDA 1IKYA 4NMXA 2CQ1A 3SDEB 2AV5A 1FK9B 2CZ4A 4M5KA 3PW7A 2VONA 2OPSB 1MWZA 5ETMA 2B4OA 3GCWP 3U02A 5HMZA 3J7YI 3SV3A 1SKSA 2XYPB 4GKJJ 4CLSA 1U6ZA 5C2GA 4QPXA 3NG8A 1HWKA 2EFGA 1U6FA 1CJVA 3FCWA 4NCGA 2QTWA 1HNIB 3MM8B 4NX9A 1S1XA 1T95A 2KU7A 1Q7YT 3Q86A 1PIEA 2H54B 2MZTA 5AE2A 3GIRA 1RHKB 1OQ3A 1HNZJ 5L39A 3DXBA 1Y5NB 2QC3A 4ZVRB 1C1CB 3W8PA 5BYSA 4HKQA 4GO7X 2VOPA 2C2OB 8AT1B 3D6FB 1NNDA 2RQ4A 2LDYA 4WTOB 3CJRA 1R0CB 5AT1B 2RH3A 2B43A 1XERA 4IO1A 4YOEA 4ZPVR 1I94F 1RI7A 3D66A 1K1QA 4RUBA 5L38A 3S8SA 4J9NA 4ED7A 1DQAA 1KWMA 2CQPA 2DY9A 3FCHA 5CA5A 1QUVA 2K3IA 1HQ2A 4JYAF 1Q81T 5F9LA 1S99A 2NXEA 1F9FA 1CQMA 2QA1A 3V5RA 2FUG9 3MEDA 3VVUA 4A8OA 2AYEA 2CPDA 3UDEA 3CC4S 2XY5A 1YRXA 3M9OB 7FD1A 3V4IB 1JXVA 1S12A 2DCLA 4U9RA 5FJ4A 2DHAA 4F7VA 2BM1A 5HBMA 3M8QA 2MQNA 3LA0A 2B5JB 1U1PA 4OZ2A 1V3SA 1O0PA 3VF0B 2ROEA 3TI0A 1N34J 4M94A 1QUPA 2J0QD 3MFIA 2LDIA 1P6TA 2QLBB 4EYIB 2DR7A 3I6PA 3M8SA 2DITA 2XMJA 4CCHA 2ZBRA 1P1TA 2HEKA 3M2RB 3PG9A 2V0NA 3EVMA 3W9JA 2HHTA 4HL9A 4ZOSA 1LXJA 3DDIA 3W66A 1S4EA 1I94J 1RTJB 2E9TA 1RKIA 2KHDA 4AL7A 1FDAA 5EX0A 2KM8B 2VD3A 1TMMA 2E5IA 1Q16B 4EO8A 2K8GA 5D8HB 4ZLPA 1HIYA 3MHYA 5LL6d 2B9WA 3JAMU 3BGRB 2ZD1B 1AUSL 3QRQA 2HHQA 2E7WA 3OLBA 4U96A 4DOZA 3BPDA 2Q6BA 2DBBA 2OPSA 4PUOA 3G71S 2W2PP 1GTEA 2DNKA 1JLCB 1X4BA 5L1JA 3RRGA 1FKOA 2KTQA 5KFSA 4YB6A 1QLNA 2YNIA 3TANA 3JQKA 3DRSB 1JXEA 1BQMB 1N88A 3H90A 3SQOP 3T3FA 1NH7A 3NS5A 2W9BB 4DR4J 2GS8A 1B7FA 3UN2A 2ZBPA 4DG1A 1JLGB 1DQ8A 3C14A 1L5UA 3AD9C 2MHEA 4LF9F 2NPFA 4OYIA 1O5JA 1TKTA 1UFWA 1Z2LA 2YWWA 1DTQB 1MROB 3RGIA 5LSRA 1FXLA 3C15A 1ICEB 2I0XA 2PD1A 1VBZA 2BKOA 3BO4A 3ITHB 1FDDA 3G9CA 3TAPA 3H59A 2FHOB 5GMDA 1SJ1A 3R5JB 4IFYB 2CA9A 3SXLA 5CD4H 2IMWP 4DV4F 3DLEB 1FNOA 2GMLA 2XMTA 5L9XA 3DMJA 2MY7A 2BXJA 1XQIA 2DRBA 2XZWA 4C8MA 4PWUA 2OPQA 2IC3A 2MZJA 2FIUA 2W7AA 3OVSA 5BYRA 3NCRA 2R7QA 2R2RA 4ECYA 2KB2A 1FA0A 1V5IB 2R8IA 2HW3A 1WOPA 1RTHB 2FZGB 3MM7A 2YWGA 1ZM3A 2DISA 4DBQA 3OJSA 2DO4A 4UY85 1QVFR 2DGXA 2V69A 2FYXA 2VFRA 2J7UA 4NLSA 4ZP7A 2Z56B 1S6PB 3FFIB 2YKPA 1G3OA 2V4JB 3GYNA 5KFWA 5J1EA 2B9XA 2RQCA 3RG6A 3BKTA 4QZVB 2OPPA 2XHCA 5T14A 3AH6A 1NCLA 4Y0FA 3EPIA 1TK0A 2EFPA 1F2GA 3CSKA 1S9GA 2HVZA 1N36J 2D3ZA 2R7TA 2V8GA 1Q82T 3AD7C 3W5YA 5T41A 1R43A 2RNEA 5F0UA 1S0NA 1NUEA 3A12A 4I68A 2YKNB 1BMQB 5CXTA 4WZMA 3GMGA 2XLJA 3BPSP 4A8KA 5KFAA 2YX4A 4I0WA 3TYTA 4ZPTR 5I3PA 3C16B 3OL6A 2RDIA 4F02A 3M1VA 5DM7Q 1TL7A 1RT1B 3T41A 4O0IA 1RABB 4EU0A 4B9SA 5LJ5Y 4DLGA 1AZSA 3ENQA 2F8MA 2G0CA 3FBEA 1M1KT 2F9DA 3ICLA 4PUOB 2P8IA 5BR8F 3K7RA 5KG1A 2G2OA 2WW8A 2H5EA 2JH3A 5HK4A 5IZHA 3DLBA 3RBEA 3TOQA 3DOKA 3GB0A 2FVSA 2CPJA 5J2QB 2MMYA 4C3LA 4QYZJ 2YNIB 1SB6A 1NRKA 3DRSA 4ZPBA 3DXSX 2HGLA 1CJKA 2AZ1A 4FF4A 1JJCB 2ZH5A 2AD9A 3DLLQ 2IFXA 2N7YA 5HMWA 4URSA 3CXCR 2JSXA 1N5YB 3DLHA 4IG0B 4W90B 2IM2A 3BDPA 3RTVA 4GMKA 2EVZA 4UOCA 1FRJA 2AEJA 3KLGA 4I6YA 3MMCB 4Y6IA 1JXLA 1HI0P 4L3NA 2UU9J 2RU9A 1M5VC 3RU0A 3KTQA 3QGGA 4K0KF 3CTRA 3MPVA 2R7VA 5CH7B 3VAJA 4TVAB 1GXLA 3IRXB 2CG4A 5D4LA 3SQGB 3BQ2A 1HPZA 1P9QC 2QT7A 4FP9A 2R2TA 3DDNA 4WYLA 2VQFJ 1SQGA 2A6OA 2GQCA 2Q43A 3BO3A 3IR6B 1S57A 3T1YJ 9ATCB 1H2TZ 4RNHA 3MXHP 4ZP9A 3TZYA 2UUWA 3JSRA 4TYAA 2NCKL 2P6SA 4M5DB 5GAGI 2J76E 1QSLA 5FLXU 3N9UC 1D8ZA 4DPTA 1URNA 1UPPA 2MQQA 3L7UA 5DG7A 1VMBA 3MPWA 5F8HA 3M7VA 4WIQA 1LFWA 2CNOB 4DR2J 5K8OA 2M5YA 2QA4G 4LRAA 4DU8A 3K17A 1RHQB 3HFZB 5C2CA 2RRAA 1WF1A 2CNLB 1WWHA 1RCOB 4X65J 2G0JA 4DFJA 3C46A 3G82B 2ZJQQ 2EKYA 4QOTA 2K2PA 4YN3B 3FC9A 3AQPA 3QJLA 4OQJA 2R7UA 3IM9A 3WX4A 5DGAA 1HHTP 2CPXA 5H9EJ 4IR1A 1UVNA 5ETNA 3IAM9 3BB5A 3JAMY 2RDDA 5H9EK 1RYRA 3CCUS 3NOGA 3UNYA 3FCVA 5D0EA 2YNFB 2L41A 1UKUA 3MWBA 2DJWA 4KY3A 4B3RJ 2G4BA 1UJ6A 3GG0A 3CJ3A 1W7WA 2MKSA 5C42B 2BMBA 4FVMA 4OYOA 1KNZA 2B8QA 4DQPA 1WC1A 1CJTA 1JLBB 3GFHA 3KFWX 5SZTA 4DFKA 5IWAJ 1R8BA 1HWUA 2E5LJ 5I42B 2WONA 2RJZA 2LXFA 1KVKA 2PDAA 3FRZA 1MSWD 1EETA 2XGQA 2CJ9A 2VQEJ 1NJXA 2PFFB 2IY5B 3QIDA 4USUA 3CCQS 3E01A 4Z7CA 4DV4J 2IPOB 1JLFB 4Q7AA 2C3OA 4NLVA 3GYGA 2Y8YA 3DU5A 2EFQA 2RT3A 2OMLA 4HTJA 4QIWD 2M8HA 1URRA 2L3MA 4YB7A 3MEEA 2GIQA 4YEAA 4RUCA 2Y1JA 3NNCA 4KO0B 1WHWA 2RQMA 5J2NA 2VC1A 2XO6A 2WHOA 4L73A 4I69A 3PKYA 2DH8A 1DBDA 4DV0F 5KFXA 4ENOA 2Y3YA 5HLFB 3WC2A 1SIZA 5E7OB 2X1FA 1YX2A 3BGFA 4C3KA 3MR7A 1FD8A 4IOAQ 1WHVA 3ZZYA 1KTQA 4DSLA 3RB6A 2XMKA 2HBYB 1FRXA 4DMZA 3J7ZT 3M05A 3K59A 5D4PA 4GO5X 4USJC 2ACMA 4KTQA 2ZH4A 2XMVA 2HNYA 1WKKA 2VBXA 4CDIA 3KLVA 5JUMA 2OELA 5F0WA 1Z2ZA 2MZSA 3M6WA 4Z2XA 4JI8F 1IN0A 1TV6A 1T94A 5IM0A 2ZZNA 5HL7Q 2X3GA 3K8WA 2OUGA 4OYAA 3W7BA 5M2UA 1S9EA 1XNQF 2XI2A 3CJKB 1SC1B 1AYEA 3I87A 3G6VA 2GHVC 3M8PA 3SFGA 5KFMA 4ECZA 2R8GA 4NMLA 2O01C 4DV6J 2RS2A 4FVCA 4LF7F 1JLQB 5LXYA 3UN3A 2QMXA 2BX6A 1HQUB 4EBCA 5AJ3J 4QWAA 3SCIE 3DI6B 2PI4A 1RWVB 4DV2J 1EQMA 4ZIVA 4CWBA 1WC4A 2E7XA 2P9GA 2WW4A 2UVVA 3KMQA 2HBRB 5E3CA 2IBOA 3NGTA 1JLAA 3VCDA 4ED4A 1HHSA 4O44A 1PJ7A 4DV3F 3Q83A 4DF4A 3KK1A 4WWSA 1XJWB 1U49A 2ZUAA 2VF3A 3HHLB 1F5BA 5L1IA 1FWLA 3R1HA 4ED1A 1VLYA 1DLOA 1FT8A 2IRUA 2XMAA 1WJ9A 4DJBA 2ZVIA 1EZZB 4WU2A 5KFCA 1HD0A 4ZN3A 2BKPA 1S1VA 2BJ8A 5HP1A 5IV4A 1YTYA 2Y1LB 2ZOMA 1IBCB 3A8KA 2ZC3A 5J1PA 5HN0A 3VGVA 4MK8A 4ZN1A 3BGRA 3GU0A 3OL7A 3H2LA 4KO0A 5EDWA 4K4VA 3BF4A 4ZP6A 1VQ5S 4OYZA 2MKCA 2D9PA 1TK8A 5LM7E 1FEEA 1TUWA 3OR1A 4WFYA 4LRBA 1IKXB 1GX5A 4PKDB 2ZKUA 1M5PC 2B4VA 4ED2A 3O1LA 1YJNS 1EB0A 4P7TA 4EI2A 5IQ6A 2W2OP 1RA6A 3LW5C 2ILYA 1UA1A 3QNWB 4V19X 2GC8A 1FVQA 2F8EX 2UV8G 3D4JA 4ICLA 1YBUA 2X3DA 1LWCB 4IG3A 3W5ZA 5GADU 2H5JB 5DQGA 1X4GA 2G0IA 5DG8A 4LF5J 3PR5B 3K5MA 4YR0A 5B0FA 4YDDB 2VPZB 3DLGA 2GHPA 4L76A 5HQ8A 2VFTA 3UI3A 4DR5J 2W9CB 1IJEB 1JNRB 1GT8A 3BV8A 4P6QA 3CCES 3EVWA 1Y10A 4EUVA 2E29A 4HHHA 2EK6A 3CW2C 4DQIA 4AXIA 4X66F 2PMHA 4TQRA 1BQXA 2ZBCA 3GFZA 4ANDA 4K8RA 4DUZJ 2MZQA 4B3TF 3BN7A 1CQNA 3A8IA 1UJ4A 4JBCA 1C0TB 3PX4A 3Q2SC 3TO8A 4OX9J 4CM2A 4IDKB 1H2VZ 1TTHB 3DRXA 3JTPA 1A7GE 3U1LA 2ZM6J 4N77A 1IKXA 1T9UA 4H4MA 1RWXB 2HURA 2VU5A 3SCLE 4A48A 4B02A 5B0GA 3HFVA 3PW5A 1Q0NA 2VG7A 4AQYJ 2UUCF 5D3GB 1FF2A 4DR6F 1S1XB 2Z8QA 1HBNB 2VIHA 3BKFA 3F44A 4E98A 3PJWA 4KGKA 3ET6B 1OPIA 1S48A 3SCKE 1KQGB 1RE1B 1RT2B 1BUXA 1TL5A 2BJ9A 1VRUA 1SC3B 3QSIA 3OTOF 3UD4P 1CS4B 3HZEA 3B4DA 1S1VB 3V81B 2GMHA 2JC0A 5AXNA 3PW4A 2E1RA 5IT4A 1RT5B 1WOOA 2D3O1 4DZDA 1YJRA 2HQDA 4Q2LA 4XPCA 3W5XA 5F8MA 2MZRA 3ZC4A 4OV6A 1IKVA 5HVHA 4NLRA 2HGMA 1QSYA 4LQ3A 2I5JB 3DN9A 2N3OA 2MKKA 2R7RA 4NXNF 4ED6A 2VZ9A 4WFXA 3EJMA 2MPUA 3QAEA 1KLMB 1VCTA 3TA2A 4YFUA 3NXZA 1GK8A 4ERDA 2N3LA 1RAAB 3GJQB 4WFBQ 1RSCA 4B9TA 3FJ2A 4Y00A 1C4AA 2CKWA 4UOHA 4IQMA 3RBXA 4USMA 2BZ2A 4DQQA 3HKWA 4DSFA 2O1PA 2BM0A 2BVZA 2G9OA 3FDSA 4LIRA 5J2PA 1OY8A 1RAOA 4PXBA 1NH8A 4WXWA 1HI8A 3TA1A 1YK9A 1VS3A 2V8DA 4RKUC 5F9NA 3JSMB 4I56A 3MUMP 1KR4A 4QPTA 3RUBL 1LK7A 1SPBP 1U4BA 1Q5YA 1B99A 2V8VA 4J9QA 1VC6A 1T8EA 5HJYA 4OI0A 4CO3A 1T7PA 3M2VB 1XNRF 1H6KX 3MM9B 1T03A 1Q7LB 2VG5A 2WVCA 4P75A 4PZVA 1Q8KA 4XDCA 4JI2F 3CMAS 3T1HF 4M1KA 1CVJA 1H7WA 3UVJB 4R0EA 3H0PA 5KFKA 3DLKB 4C8ZA 4R25A 2YXLA 4USTA 4NE9C 4I7FB 3QZ7A 4MH8A 3SCJE 5D4OA 5D0RA 3PJXA 4Y3CA 3T5HA 4X62J 2CXEA 1P27B 3GIKA 1S5ZA 5L1KA 3PY8A 3RB3A 1N4LA 5D4NA 1QTNB 3KJFB 4JUZA 2L9NA 3AXMA 2AEMA 3OTDA 3D9BA 2QGFB 1NK7A 2JEJA 1X4CA 1WDDA 2JJ4D 5ETVA 1VYAA 2E5HA 2VBWA 1W2BR 3GJTB 4LRCA 1U2RA 2CYYA 2HSEB 2MB0B 4JI6J 2CG8A 3LUYA 4C0HA 3VAGA 2WBMA 2A6MA 3PACA 1OY9A 4DL7A 2OKQA 4LFAF 1X0PA 2CPYA 3PYEA 1O51A 4TY9A 5IT0A 1YKWA 1DQ9A 2KHCA 3NBPA 1UVJA 1KHVA 1XMQJ 3M30A 2HQ3A 1FNXH 1RWKB 4OHYA 2F3JA 2XBPA 3NNHA 5A8RA 4RNNA 3AJ1A 1F5CA 4NLQA 1WG4A 1UJ5A 3JTOA 5DZ7A 3CGIA 4OZNA 4F3QA 3R27A 2QZ8A 1X9WA 3ONQA 1KFSA 1ZAXA 2I6WA 3U1MA 2RVJA 3SMZA 3FEYB 5T7LA 3MM7B 3POTA 4OHWA 1IR1A 1GMWD 3IXQA 1XTZA 5DLFA 2BJDA 4YDXA 2P9EA 4LF2A 2ZDPA 2HVIA 3IG1B 1T0TV 2DIVA 4LBPA 1X31C 3TAMA 4NLXA 4LFAJ 4UZCA 3J7Z5 2OFGX 1UVLA 3MOJB 3L09A 4ZS6A 2QA4S 1NMEB 2VB6A 3QQCD 3CDBA 4N41A 1F3VA 1N5SA 1X4DA 4RW7B 2GVZA 1QAIA 1G7CB 3RBZA 2QIFA 1S77D 1Q86T 2AGQA 2OPRA 4LVNP 5KFFA 2V68A 2AWZA 2EG2A 4OHXA 2UXBF 3PXGa 2AYBA 2FTRA 3LWLA 3MMCA 4WP8A 5HATA 2QL9B 3NLCA 2ASYA 4OV1A 5E3PA 4F25A 4A47A 1TL1A 3HVAA 4BDPA 4WU3A 3AOBA 5HANA 3KLHA 4C8NA 5ETTA 3QT5A 4EZ9A 2XS2A 1C0UA 1JJHA 1WORA 5E5NA 3CEDA 4PCQA 4HH0A 2ZH9A 3W61A 2CZ9A 1NAQA 1U1QA 3QIPA 4IH6A 1KD1T 3MPUB 3B6BA 3BR8A 3WHIA 1PC5A 1SIWB 2DGSA 3BSAA 1IM4A 2QFIA 4ZLLA 4F4ZA 2WOMA 2GQ2A 2XTJP 4FZVA 1FX2A 2ZBIA 5J2MB 3V6DA 3JS9A 5T7LB 1X8DA 3OXFA 1T3OA 1RAJA 1D3WA 1VQ6S 2HPUA 1DLOB 2C2ZB 4KYZA 1KBRA 4M5HA 4PEOA 1UL3A 1NKCA 2PGCA 2KFNA 4NOHA 3G6ES 4NLDA 4JP8A 1U0HA 2OSQA 1RDRA 5LSLA 4M5IA 3EZ5A 1VQMS 3WIVA 5KFVA 1L3TA 1HNWJ 3IGVA 3ELHA 3ZZ0A 3QGIA 3OT9A 1X4HA 4A4JA 1JIHA 3FSXA 3R5DA 2AMCB 5D0GA 3CJSA 3SQGA 5CYJA 2PT0A 3S7RA 1FDBA 1WD6A 3M8WA 4OZ5A 3F0NA 1ZM9A 1RA7A 3Q8RB 4QBUA 1GAOA 2B51A 1B0VA 3T9NA 4WKYA 4B9VA 2KKHA 3OTCA 1F60B 2FJEB 2QYCA 1KFDA 4ZP8A 4DX6A 2Q79A 4MK7A 4AYBD 2UUBF 1LWFA 3BGOP 2LA6A 3D67A 3P4UB 4DV5F 3FSYA 4WK3A 4CLKA 3PW2A 1IBKJ 3TQ1A 2JDJA 4QCLA 4QIEA 5KFUA 5E33A 1LXNA 3EGNA 3WZ0A 3SV4A 1R8HA 5JJBA 1XMQF 1VC5A 3GP9A 4OLPA 1YGYA 4JI4J 2JHEA 1FERA 3JYTB 2Z2ZA 3ZTOA 2UUCJ 3PX0A 3MGJA 4L75A 2XYHB 3EMTA 4M5MA 1TK5A 5HQLA 3GE9A 3LAMA 2ROGA 1FTRA 1RWOB 2ILZA 3D28A 3W64A 4LIWA 4ES2A 4O3SA 5DDPC 3OTBA 2F40A 3I5AA 4OX9F 5B0BA 5ETPA 3FMBA 3G96A 1FE0A 2V2VA 4JI6F 5ETQA 5KG7A 2DY1A 4H54A 4LF8F 2D74B 2MKYA 1HBMA 4OFZA 4Z7YA 4A8YA 3R3TA 4B3TJ 4GKKF 1CLFA 2H51B 2CPIA 2RRBA 1R6YA 1GTHA 3P3DA 2EW9A 3ILOA 3IRWP 2EFOA 3BN4A 4U8YA 2IJNA 4Q44A 1HMVA 2ATLA 2UUAJ 3FK4A 3ZTPA 2BE2A 3NGUA 4DR5F 4F4XA 2D3UA 1NK8A 3OUYB 2BANB 5EN1A 4PG5A 1GH8A 4KKOA 1R3NA 2W1BA 1PSDA 1FVSA 2GFFA 2ZE2B 3OTEA 1HYSA 2FJAB 3OVAA 2Z0GA 1ZM4A 1DTQA 1N5QA 2M52A 3A3OB 3BREA 1RAHB 4O3QA 1E6VA 2IVYA 1T05A 4AXJA 1RYSA 3BSCA 2BUNA 2R7OA 3JQMA 4X4QA 4JI2J 2UXDJ 3W9IA 3MCNA 3HCXA 4X4OA 3DM2B 1VHFA 1F3FA 2WSEC 4ZPAA 1HNXJ 4AUKA 4C97A 3OHBA 5LMUF 5A8WB 4J5OA 4LR9A 1AA1B 2MSTA 3LO3A 2XSFA 3TQEA 2BRLA 5DETA 4CLUA 4ZCKA 3EM1A 1XR6A 4USVA 2E1CA 2KN4A 3KG0A 3N28A 2A0FB 5A6PA 2G13A 1VQOS 3HJFA 1TQLA 2CJBA 3WIUA 3TUJC 1VQ4S 5KT6A 4LBHA 2IDLA 4Q0BB 1HNIA 1I3OB 3D0GE 3MM8A 1U47A 3GQCA 4UY8T 4J37A 2Q6CA 1H72C 1RBLA 3C8YA 4OI4A 1WACA 2EI5A 1CPZA 3NY0A 1BWEA 3GSIA 3M2UA 1TL4A 3QT6A 5DDOC 2ALYB 3V81A 4M5GA 2GV1A 3AJDA 4MKYA 1RQ0A 4CO2A 4JB8B 2V9KA 2DPJA 2B6AA 3IA0A 4DV3J 5HROB 4GRSA 3CJKA 4YUDA 3W2WA 5GAEU 2QA2A 2OFHX 3DOMB 3LANA 3FKBA 4NEZA 3THVA 5B09A 3H4DA 3HM9A 4DV2F 4NEYA 3TUPA 4G65A 2IC3B 3FEXB 3GFYA 3UO0A 4I1TA 3OJUA 1SC6A 5GAHI 5H9FJ 1K0TA 2D1CA 3R8YA 4X64F 2MLZA 3WBZA 3HD1A 4AL5A 5KFJA 2W2NP 1QTMA 3GWCA 3TARA 2DXFA 5E3AA 1IJFB 2EBGA 2ZWPA 2GMJA 4L72B 4PWDA 5E3QA 4N8NA 5IFMA 2RU3A 2ZFHA 1S6PA 3FFIA 2VFUA 3A8EA 3M32B 5SUHA 2J6SA 5IOLA 3A8JA 2MTLA 4K7QA 1MMNA 2HMIB 2HIQA 5A2QY 3PFEA 2VJVA 4F4KA 3Q0AA 1JLEA 5KOWA 4C8KA 2B4UA 1SC4B 1FHTA 2QLXA 2RKIA 2IJRA 2VKZG 3MM9A 3R5CA 3EGZA 1RTDB 3K0JA 4LFBJ 3M8RA 1FESA 1RBOB 2QX0A 2WVEA 4ZCLA 4DR7J 3DRRA 3NEKA 3AA8A 3M30B 3DYAA 2HS0A 2GJFA 4QU6A 2J9EA 3ILJA 4IOBA 4X4PA 3T5KA 1N5VA 5KFEA 2K7KA 2FHKA 2H4WB 2R7WA 2UXDF 5F8JA 3T5LA 4RUAA 1WC0A 4LF5F 1AZSB 2DNRA 1Y00A 2HHVA 1WEXA 3H7HB 3SEOA 2OSRA 2COLA 3ZZOA 8ATCB 1X5PA 3D5MA 4PXEA 4M5DA 2E44A 1NKEA 3VALA 4YB1P 1KQFB 4USHA 4NLYA 4RJVA 3MFHA 1QAJA 1VBXA 2GA7A 3HK2A 3J81Y 1KC8T 2GX8A 3NWRA 5DG9A 3V4MA 3RAXA 4KAIA 4YS2A 1S9FA 1XIQA 4NCGB 1RCXB 2CNKB 3W3SA 4DEZA 1I5OB 3ZNUA 4PQUA 3KJQB 1DRZA 2CQCA 3PYGA 2RE1A 2R9LA 2BQ3A 4ZHRB 3I96A 3BM7A 1CS4A 4DU7A 2V4RA 1N6QB 2W9CA 4I6WA 2EWHA 2P2CB 3HULA 1NJWA 1U0SA 3H98A 5ETSA 4CLFA 3R2DJ 3OVBA 5MLCV 1NPRA 4MT1A 5KFBA 3QYYA 4XK8C 4GVBA 3TWZA 1N32J 3AXKA 3R7NB 2C3UA 2HHPA 4LF6F 2DGWA 4CT8A 2B9YA 1G4CA 4CRJA 4FDFA 1I51B 4ELTA 1TAUA 4RPFA 3P5TL 2M2BA 4RBVA 4F50A 4WXOA 1LW0A 2GW8A 4UTGA 4E8UA 4G1IA 4AT1B 1VRTA 4QW9A 1UPMB 1H7XA 2C2MB 2IM3A 2XM3A 4J9MA 2F4VF 4FBUA 2O5DA 4NYOA 1EJ7L 4WPAA 4OZLA 5JXSA 4X65F 5AJ3F 2OP5A 2DT9A 2CAJA 3TAQA 1OY6A 2FJVA 2DNYA 1KTVA 2H4YB 4DZ6A 2FQQB 5HJXA 2OJ3A 4LR7A 1JNZB 3GJSB 3CCRS 4UF4A 2DEIA 3F41A 3V6HA 3QGPA 1Q4RA 1S1WB 3LP0B 3KLEA 2IHR1 1N6QA 1NHVA 1F9HA 2HG4A 2YPYA 4UUWA 4AD6A 2X7IA 3R6LB 4Q45A 3RAQA 1ZS6A 4HYKA 1FE4A 4IO9Q 2CQIA 2ZOFA 2K1RB 5ETKA 3I9ZA 1TKXB 3ZNJ1 2HVHA 3HHDA 2WBRA 3BO2A 1IBLF 2ZD1A 1ITPA 1PBAA 1RLCL 2YX1A 4OYPA 2FLPA 2FZKB 2YTCA 3KDNA 3VZIA 2KFZA 5CCMA 1CBKA 2VICA 5FIIA 2DPIA 2CADA 1NDLA 2DGQA 1UTAA 1RAFB 2FLOA 4OLOA 5D78A 1YBTA 4C0OC 1IM6A 4K0KJ 2CFXA 5KT2A 2HQFA 2ZH8A 3P8BB 3QZ8A 3J80Y 1HL6A 3PR4A 3QJPA 4IFVB 1R7IA 4IQXA 4ECUA 3DHWC 3SI8A 2VA2A 4CLYA 5FLXY 1NKBA 2EG1A 4ZITA 1YWXA 4IG0A 2LQ8A 4XDDA 1PG5B 2IYGA 2MGZA 3QRPA 3M8PB 2P9CA 4PPDA 2B3TB 3DDKA 1SQFA 4PG4A 1JX4A 1NDCA 1TV6B 3A3NB 2ZVSA 3ETOA 1WC3A 3VGTA 5IM0B 4ELUA 4KC5A 5B0EA 3RJMB 2K06A 2O67A 3HF5A 1WEZA 3PEHA 4KHRA 3R9LA 1FFSB 1FKPB 1RT7B 1UEVA 1WI6A 1WSVA 3TUIC 1AFJA 1SI9A 1HBUB 4CLPA 2J8SA 2E7VA 1REVA 2C2NA 4RW4A 2KJWA 3NOCA 2XLIA 1H38A 3ZXWA 4RR5A 1QD1A 3L9ZA 4X84A 3KHRA 4J7CA 4JI5F 5L46A 1JJ4A 3A13A 5IT9Y 1RGVA 3DI6A 1RWNB 5IWAF 1RTHA 3TRGA 3LP1B 4M5NA 1B4SA 4LF1A 3J80U 3HVTA 2WCXA 1NSAA 4GC7A 3UCGA 2LQJA 2HQGA 2G2ZA 2GVDA 3R5GA 4G6VB 4Q2MA 5A2QU 3MTJA 2QV6A 4ZDNA 5CYQB 1U2FA 4WCEQ 5CD4A 2LECA 2C2DA 1C1BA 1JKHB 1IR2A 3W1YC 3SZ2A 4B3RF 3KUEA 2KZZA 3PIPQ 3SYZA 4UT4A 2C1EB 1S1TB 7AT1B 2IM0A 3CO9A 1T05B 2V8PA 3Q8VA 3CD6S 5HQMA 2QL7B 3QFHA 2U2FA 3HZGA 2D41A 2E5GA 4U7UD 2NS1B 3HT0A 2HBZB 3MMAA 1GXUA 3D68A 4NA2A 3D1QA 2E5JA 1OIAA 2LQ9A 2XULA 1UWBB 3KG4A 3PCOB 4N7TA 5IS2A 3OFHA 2ZC4A 1U48A 4RW6A 1H2UX 2YH1A 1FO1A 4C11B 3GPAA 4FF1A 1HWJA 1S1UB 3M6UA 1HW9A 3TA0A 4RO0A 2Z2YB 1LKZA 2L9DA 1PJ6A 1IXKA 1FTCA 1NO8A 3QIPB 1RWUA 1F9EB 2H9ZA 2VC0A 4FXWA 4DX7A 1HR0F 3ZTRA 2AIRB 3OW2R 3H5XA 3NMAA 3N6NA 1CJTB 2AHOB 1TKZA 4ID5B 5DQIA 5G4DA 1RISA 3GSDA 4O4RA 2ZJRQ 5A0YA 4KRWA 4ICLB 2HHXA 3FRYA 3TAMB 3HVTB 3FNNA 1YRTA 4TLQA 1QSSA 3PV8A 4LF9J 3QRRA 2N4CA 4ZVTB 3Q22A 3N79A 3K2YA 1U25A 4OX7A 1VI7A 4PYAA 1XEZA 4USKA 4G1PA 3ZZTA 4DUTA 5IC4B 1RB0A 1SJ4P 3KJVA 4F0MA 4O3PA 4ETXA 2VBYA 3H40A 2Y1IA 3G4SS 1PCAA 3DU6A 2FGCA 2RB7A 3RRKA 3W9HA 4H4OB 1RAEB 3EUNA 1X9MA 2UU9F 4MFBB 2BEFA 4OI3A 1UWAA 2JVRA 3MCOA 5EX3A 3R2CJ 1Y9OA 4MIAA 3X1LB 4LSNA 2DXDA 4BC7A 1C0TA 1BWVA 1GNKA 3CVKA 3N6LA 2PA8D 4EZ6A 1TL3B 2BW2A 3C2PA 3OR2A 4X4VA 2VG6B 1JLCA 4Y34A 6FD1A 4OYMA 3I55S 1FRIA 4KGMA 1LWEB 3G87A 4PWDB 1V5VA 2DB1A 4KGZB 4TU7A 3B4MA 5LMNJ 2LU1A 1PAEX 5J1NA 1S72S 1HBNA 1L3KA 3D0HE 1XR5A 2Y0SD 3EICA 3CCLS 4QYZK 4M5LA 4CTAA 2F1FA 1Q5VA 2MYFA 1JLGA 2CQBA 2FLLA 1WSRA 1ZPWX 3GZ7A 2KVIA 5FDLA 1RTZA 2X51A 1S10A 3NGKA 1TFWA 1F2HA 2KXFA 2CDRB 5IV3A 2HNDB 2V67A 3M6XA 4FKXA 2LU2A 2D7SA 2WSCC 3MAAA 3T9ZA 3Q2TC 5K20B 2BJ7A 3D7SB 2AYGA 4TY8B 1S6OA 5HO4A 2HRTA 2I5JA 2MSSA 2XC9A 3ILIA 3QFWA 1WF2A 3KKFA 3TVZA 4EBDA 4JI3J 2U1AA 4UQTA 2PFDA 3H42A 4C3MA 3CPWR 1IKVB 4ECVA 4DPOA 3CDAA 1M5OC 5DLGA 1HBMB 1SUQB 2OPQB 1IR0A 3CDWA 4NPOA 5D3GA 5DRKA 3HMJG 3KHGA 1TVRA 4DSEA 2ZOGA 1NJYA 1JLAB 1FI4A 3H5YA 2JEIA 2HVEA 5CYMA 2CWXA 1NK9A 2BE2B 1M90T 2IA6A 1XK8A 2W25A 1RT2A 5CAAA 3H2VE 3QO9B 4P2XA 1RHUB 1FJEB 1RAIB 4LQ9A 3V2UC 1NU4A 1MROA 4DL4A 3BKUA 2BW7A 1QVGR 3M2VA 2V4JA 4KJIA 4ER8A 1MU2B 5I3UB 1UP1A 1FX4A 1LOUA 4RNOA 2YKNA 2R8JA 1KLNA 3E2EA 4XPEA 4Q43A 3KOAA 1TU0B 2CJYB 2FC9A 3NGSA 4KPYA 3J81j 3MCMA 5JVHQ 1FCAA 1KVIA 3Q8UA 4QWBA 4ZA1A 4BC9A 3HXMA 2J9DE 2C2EA 5J2NB 1YJ9S 1AW0A 4WBFA 1D0EA 2V2QA 1ULRA 4P52A 4U67Q 4HDHA 2NSBA 2IIHA 4F3MA 2MQPA 2ZJPQ 2E66A 2LKZA 2Q1LA 3BEGB 1BQNB 5DO2A 2IVFB 2HRYA 4CLZA 3EZUA 4NYPA 4B9LA 1WNEA 3K8VA 2XLKA 4U7CA 4JI0J 3LTOA 1SCJB 2NUHA 1ZETA 1HWIA 4BHQA 1VBYA 4X4NA 1YQHA 2MEWA 1HNVB 4HR2A 2F9JA 1UETA 3OFEA 3HD2A 4FS2A 4Z37A 1T11A 2NYHA 3GONA 2HLTA 4TNOA 4CH0S 2RHQB 1B3TA 2FHMA 3KK3A 1QAXA 1NJZA 2W4CA 4KHPF 5CYMB 3I32A 5BYQA 3HLUA 1S7HA 1Y0HA 3MR5A 2DHGA 5FDLB 2OEJA 2V63A 2E1MC 2R8HA 2G1HA 2ZH2A 3V6JA 2DK2A 3UVJA 2DNZA 4U95A 2YKQA 1K73T 3RAMA 1ZPVA 1M5SA 1UA0A 5KOXA 1OYDA 4CLTA 4C98A 5L9NA 5U47A 1NSQA 4KV8B 1U09A 2XCPA 1R8CA 3AHPA 5A76A 3KNGA 2W7OA 2ZH3A 4DL6A 4M95A 4DSIA 3ENVA 1RWWB 1APSA 3MM5A 2HHWA 4JI3F 2DO0A 1HW8A 2VBZA 3QMQA 4TXSA 3RYLA 1EHWA 3WQPA 4NLOA 2LEBA 1NSKL 1N34F 1N33J 5EWGA 2QMWA 3CIZA 3CE8A 2RF2A 3MMBB 3U1NA 2LXUA 1EKRA 1VJWA 3W63A 2FVQA 3EWGA 3W8GA 4DCOB 3A3PB 2VDHA 1JMTA 2WVFA 2WRMA 4ECXA 2JZ5A 1JJ2R 1QAYA 3PM9A 3PZPA 2BOPA 2FDNA 4WK1A 5M2PA 3M32A 1LW2B 4OJ1A 1X4EA 3IWXA 1A0OB 4ED3A 4EEYA 1N33F 4RWXA 2Y0BB 1KSPA 4I64A 4DL2A 5CHCB 3HHLA 3K5NA 2IAJB 2HZVA 3CJ4A 2AGOA 3C66A 1WKJA 4JYAJ 2KVQE 1DTTB 3X3UA 2KG0A 2CQ3A 3NGRA 1NK4A 3CD7A 2FB0A 3RR7A 2FVRA 4RW7A 1TR0A 4K4SA 1QM9A 2ZZTA 3C6TA 5K14A 1FWPA 2HGNA 2XCAA 5LMNF 4IRDA 4C8YA 4M5JA 5KFTA 4WFZA 3I0RA 1Q8BA 2ZWOA 2QE5A 4LJMA 1NHUA 4FYWB 1UEKA 4USWA 2QFJA 1HNZF 5IQQA 2KRRA 3RW7A 5F8IA 4A8MP 1MN7A 4F04B 1WC6A 4YR2A 2VASA 4KHPJ 2M7SA 2N4DA 4URGA 5KT7A 1YJ7A 2CPZA 5J2MA 3V6DB 4C2MA 1J5OA 2XMUA 4P73A 3R7SB 1PYTA 4WE1B 1E6YA 2CJAA 2GCFA 5GMEA 2GIFA 3CJ8A 2QRRA 1EETB 4V1Ak 4I2QA 3QJJA 2F63A 3BQ1A 4ECRA 4LRFA 3NS6A 2VPXB 5I42A 2JL9A 3NWGA 4HI2A 4GVLA 4F0HA 3JSMA 1RHRB 4K5RA 4Y2KA 2MGZB 1JQGA 1GMVA 1G1XA 2I9SA 2M3DA 1VBKA 2C3PA 1RT3B 2M0GB 2PO4A 2NSCA 3TP2A 3W62A 4JI1F 1EQ0A 2CJXB 3NAHA 4NRUA 4OZ0A 4ED5A 2C28A 2YNFA 2XB2D 3AAWB 3O2IA 3C16A 5F3ZA 4CYUA 2KG1A 1HBUA 2IBKA 4RW4B 3M6VA 4GVBB 2FGOA 4LSLA 1T02A 3H2UB 3N5FA 3TJ9A 5KFOA 2MXYA 2AGPA 4N76A 2YWKA 1TKDA 3HSGA 3CMES 2R7SA 2NYIA 2DGTA 3GTYX 2VFVA 4RX6A 1YVFA 4FYVB 5E0OA 1U1KA 1WHYA 2LP4A 2NXNA 4P2MA 1J5OB 4OYWA 5H1SV 1VQKS 3QAUA 5K8NA 2JEFA 3D3CJ 3E01B 5KT3A 3R97A 5JVGQ 1Q78A 2ADBA 1K8AT 1RHJB 4KH1B 1AROP 4NCAA 4C6AA 3T1AA 2C42A 4CIOA 5EGYA 2E9ZA 4K50A 2ERRA 2EK1A 3ILLA 4C4WA 2I38A 4KFBA 1GMWA 1ZAWA 3HHLD 4NA3A 4P10A 1SKWA 4QU7A 2DKOB 2IDEA 1C1CA 3D6MB 4MFBA 4TU8A 1OYEA 2KI2A 3A1YG 3VWSA 1ZAVA 2IRYA 4PR6A 4DQSA 2LVWA 1B0PA 1CC7A 1RP5A 4IFYA 1T9XA 2RUSA 3DGVA 1ZM2A 3E3XA 1NPKA 2ZEJA 3FEZA 1TKXA 1NDPA 4E2FB 4K4YA 4B9UA 3Q8YA 2GQQA 3L95X 1HD1A 2IRXA 1VC0A 1KLMA 2ZNYA 1U2CA 2X1BA 4F8RA 2GJIA 5KG2A 1VISA 4DWIA 4A8SA 1UFLA 4WKRA 9RUBA 1W25A 2KJVA 2MJNA 4X4UA 4OI6A 4CQ1A 1SQEA 3V4IA 1K47A 1YBAA 3EDQB 4Q8FA 4I2QB 4I4BA 5F41A 1CJVB 3ULHA 1TMJA 2C3MA 4DX5A 3EXCX 4R8UA 3WX8A 3MZIA 3MURP 1H0HB 4C9DA 1R0AB 1SL1A 5CCLA 5CQGA 3O6QA 2FC8A 5A8KB 1D9DA 5C25B 2OD4A 3GIMA 4U7UK 1YHQS 2EFVA 1QE1B 2CUYA 2M88A 3MAAB 3PEJA 2HHHF 3PO4A 1X7VA 2FPHX 1CG2A 3PJ9A 4LSNB 3U7JA 1HQUA 3AB4B 2MY8A 2QG9B 4DPXA 1N0UA 4ES3A 5A8RB 3UR0A 4DR2F 4B9NA 2HHUA 3OQ2A 2XYGB 1RWMB 4FNIA 4TLRA 2VG6A 1XR7A 3VTIA 3O8WA 3ZZZA 2HS3A 3BYRA 5DS7A 4W4MA 3W2VA 4ETZA 2UXCJ 3SBMA 2KXNB 2A10A 3QATA 1SUQA 3VQTA 3BGLA 3FQLA 3TJAA 4BLGA 4J9PA 1RT4B 4ITSA 4F2SA 3N6MA 2EXUA 4L74A 2DVIA 3CC7S 4IR9A 1ZTTA 2JVOA 4ZJOA 2HLUA 1U1RA 1HR0J 1KOHA 1AT1B 2AP6A 1VQ7S 2BKNA 3UNGC 1KN6A 4DN0A 3M8QB 2W4PA 3AY0A 1L3SA 2YQ0A 4H4KA 4NLTA 5KG0A 2N82B 1IVZA 3OFGA 2GZOA 4RBUA 3ADAC 4ZPDA 4R8UB 3DLGB 2YWHA 4KFBB 1PILA 5ITHA 1QDUB 3EVOA 3PHTA 1KHWA 3GR0A 3Q8SB 1QJHA 3PW0A 1UW4A 1Y11A 1NB2A 4NWBA 1Z4UA 1YSJA 5KFLA 1D9AA 1G6BA 1S97A 1SKRA 1T3NA 2QLJB 1NXIA 3ITHA 1M1GA 1U8WA 4KHMA 2GNKA 4WF9Q 3CJQA 4DLEA 5C24A 4J9KA 4KE5A 4TQSA 3VAMA 3EDRB 2DHSA 2MDAA 4U6PA 4YB5A 1KVJA 1GMUA 5F8GA 1PC4A 1SV5A 2BJEA 4MIBA 1J5EJ 2MLYA 2ASJA 3RR8A 2AJ0A 3LPEA 3MECB 2AT1B 4JI5J 4H4MB 3IMQJ 4R0JA 3CCJS 1IQZA 1V9OA 2VJUA 2CJQA 2OTLS 3UFCX 3VHQA 4EO6A 1KEKA 3LQVA 5AXMA 4CNZA 1IKWA 2FHJA 2V8HA 3KDOA 2B6AB 2HMIA 1WUUA 4I6AA 1N56A 3DC2A 1HBOB 1YRUA 3ENWA 5F8NA 2B4PA 4RLEA 4DG1B 2IMOA 2OTJS 2JC1A 3DYAB 1VRUB 1U7LA 2DXEA 3FQKA 2Z4PA 5DDQC 2DTJA 4NZ7A 1TELA 4K2JA 1VIXA 3HJVA 3RZAA 1ZZNA 2OD6A 3C15B 2PI5A 1KQKA 1OS5A 2GAHC 1XMOJ 3KUGA 2JFDA 2RUGA 3TJ8A 2HK3A 2AX1A 1H98A 2OGUA 5EUHA 1FDNA 3D1HA 1NB7A 1EP4A 2DNGA 4LMZA 1BGXT 4BWJA 3DLEA 2O66A 2R4FA 2ZITA 4G3IA 5G0RB 2IVMA 1S76D 3O5TB 1DAXA 4NA1A 4OYXA 4KGXB 1FRHA 2XWXA 4KT0C 4MKAA 1F1BB 5THWA 3TNVA 3OFFA 3LWMA 3S6EA 1VQLS 2A2CA 4DS5A 4DQRA 4Y65A 3CCMS 3EX7B 1JLEB 1RT6A 1WF0A 2Q3PA 1XMBA 4PABA 3K5OA 3S1TA 1FWKA 1VK3A 3UD3P 1IBLJ 2LYVA 2C22A 1GEHA 3GYXB 5J2PB 2SXLA 3P45B 3QT8A 4O3OA 4ALZA 4DL5A 2VG5B 1UZDA 3GCXP 4OHVA 3MUVP 2FY1A 3KLIB 2NR0A 2F4FA 2HNDA 5DJBA 4Y2AA 2C3YA 2YVSA 3EYZA 2J6TA 4H4OA 4ANCA 5KG6A 4MK9A 2HAFA 4L3KA 4QIVA 5D77A 2MKIA 1MLAA 2NXJA 2AW0A 2DNMA 4MTPA 4TY8A 4HHJA 4RWWA 1HHQA 1PJ5A 4XAKA 4X64J 5A8WA 2P5VA 2W24A 1RACB 4A8XA 2F65A 2RF2B 2XNQA 3MMBA 1RKJA 1RT1A 1LV5A 4E0DA 3KK2A 4D3HA 2J0SD 1LWXA 2AQ4A 2F4VJ 2ZHOA 3FZ2A 3PTWA 3DOKB 3JTNA 4AFFA 4ZLNA 2W8LA 3PIOQ 5HBMB 1RXOB 1TVRB 2MJUA 1YZ6A 3LP2A 1VDHA 4HDGA 2R3VA 3DLJA 3HVWA 3IM8A 4NZ0A 2Z2LA 1YIJS 2DNLA 3Q89A 3J7A1 1UFKA 1LWFB 4HT7A 4EGLA 4LF6J 2IA0A 4HACB 2KM8C 3PDNA 4FPRA 1DTTA 3BQ0A 2EC0A 2VOOA 1TUGB 1N32F 3GV5B 3OSPA 1K9MT 1SH0A 2NZCA 4CO0A 5HMYA 2HFOA 1M0SA 1BD6A 3GJRB 5AE1A 3LP0A 2QSWA 3IR5B 4P71A 3MEGA 3DNCA 3PRBA 8RUCA 2OAUA 2CPFA 2CVIA 3DRYA 4OL8A 4PG8A 4FF3A 4CZCA 3IFEA 4WZQA 2RIJA 2EKNA 4IRKA 2H48B 5HSPA 5KG4A 3AT1B 1V3RA 3QWUA 4H4KC 4FXDA 3VZHA 1RU2A 3O3LA 4WFNQ 4UQGA 5L1LA 1HPZB 5LMUJ 3G86A 3ZTSA 4WYWA 4PRFA 3PNIA 4NI2A 4LBIA 2FJDB 2YKOA 3BSOA 3CUNA 1XN9A 1WTFA 2KT3A 3TEHB 4O3RA
chains in the Genus database with same CATH topology
2YKMA 3TVKA 4OHZA 4YR3A 3CD0A 2ALZA 2XS7A 2G1DA 2UZAA 1N48A 2QEXS 2XGPA 3MAHA 2X1AA 2KYZA 1Y7PA 4XO0A 2QO3A 3M2UB 4CI0B 1GQEA 3G6XA 5B7WA 5KFYA 2RILA 2VPWB 3MR6A 1MU2A 3M2RA 4FNHA 1FNMA 1ROFA 1VFJA 2M4MA 4YQWA 4CH7A 4ZMMA 3DOMA 2NUUG 5K8MA 2YWEA 1KRPA 3MAQA 2CDQA 3MEGB 4F67A 2E9RX 2KO1A 4LFCF 4ZKAA 4KV8A 4C0BA 1R31A 3GIIA 4Y2MA 4ELVA 2FJXA 2CQGA 2WSFC 3NAIA 3MR2A 1N5TA 4OZ1A 3IWNC 1OSDA 1LQ9A 3N0VA 5GVQA 4TU9A 4YMEA 1ZBTA 1REVB 1S79A 1ZOTA 4NL5A 2HAIA 4BS2A 2RRNA 5CYQA 4BWMA 4IKAA 4OZJA 4CH1A 2LLZA 5C5JA 3LP1A 2A18A 4N5SA 2XI3A 2KDOA 4JV2A 1IBKF 2RKIB 2YWFA 2V94A 2IAJA 3NKYA 4IH5A 2BV3A 4X2BA 1HA1A 2HNZA 2XSJB 1QE1A 1X4FA 2XMWA 3L7OA 4O3NA 3PFOA 3D1OA 3MMAB 2KT5A 5D6GA 4M8LA 2ZH6A 1FJGF 4R5PB 2AYMA 1Q53A 4D3GA 3NMRA 4OI2A 3HPOA 4ILMA 2YNGB 2E1AA 3EXYA 3MM5B 1FD2A 4OJ3A 3I5CA 3HHKA 4DV1F 1JLQA 3VAIA 1TZ0A 1UWBA 2VA3A 2P6TA 2W8KA 1S49A 3SDEA 4RU9A 2VV5A 3KG1A 4RW8B 3NCQA 3D0IE 1YJUA 1LW0B 3DFEA 4RZRA 5M2RA 2WTFA 4EBEA 1HNWF 4N47A 2W7PA 2OO4A 3AQOA 1Y5IB 2YNHB 2GGPA 3SSRA 4QJVA 1H3DA 5A0YB 5A8KA 5GMKa 3Q8QB 3K5LA 1HNXF 1S9EB 3UQSA 4PG7A 2BYCA 2D3OR 4NCBA 4NYZA 1UAWA 4DF8A 2GHWA 1VQ8S 3CCTA 4F4WA 1K0VA 5HP1B 4RW6B 2K3KA 3ISNC 2MKJA 4QR2A 3J7YU 1FK9A 5B0AA 4FBTA 2B7BB 3NCPA 1CSJA 2AJ4A 3RB4A 2ACYA 2VL1A 1N54B 4CT9A 1RT4A 5DQHA 1Y3JA 3OBIA 3GV8B 3BDEA 3I4HX 3VAHA 4QR0A 5EWFA 2UUAF 4KBIA 3RB0A 2DH9A 3I0SA 4DFPA 2BANA 5I3QA 3P96A 4K4ZA 2V2KA 3PKMA 2AJ1A 2FVCA 1IKWB 4QWDA 1HYSB 3R5BA 4PQUB 3GR1A 2ZHAA 1X0FA 3JYTA 3S01A 4KKOB 1FJCA 3TX8A 2K7JA 2KZMA 2OPRB 4HVZA 2KFYA 4IRCA 2X1GA 4KB7A 1ZYQA 4NXMF 3KNAA 4EYHB 4YP3A 4DSJA 3KLEB 2JX2A 4JI4F 5KFIA 3LF0A 4USIA 4KSEB 1U1LA 1UVKA 1S0MA 2DR5A 4DR7F 3OXGA 3FMWA 2JOQA 4JV1A 4RW9B 2ABYA 2J9DA 1LWEA 3E51A 1X4AA 3B82A 5L8RC 4B17A 1SV5B 1S6QB 3QGHA 4A8FA 5GADI 1HMVB 2B5JA 2J9CA 7FDRA 2A1BA 3ZZRA 4F4YA 4DUYF 2DCUB 4ZPCA