1JKOC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*GP*TP*AP*AP*GP*A)-3'
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkoC00
1K61A 5M3MJ 1H89C 1T56A 4XIDA 4DYCA 2LTPA 3FK6A 2CJJA 3HGGA 1JGGA 2EZHA 1WH7A 3SJMA 1MH4A 2XB0X 5M5YJ 1OJLA 4CYCB 3GTKJ 2HXOA 2JMWA 2NVXJ 4A3GJ 5HODA 4V2GA 4AYBN 1JKPC 2L7MP 2O8KA 4IHVA 2RAEA 1WI3A 2M34A 1NK2P 3HGYA 3JREA 3HOYJ 2L7ZA 4A3LJ 3W6VA 3JRDA 1YRNB 2W48A 4C3IJ 1H8AC 1TWHJ 3G1OA 1HDPA 3HBLA 3OIOA 1YRNA 3TP3A 1JUPA 2DMNA 3IH3A 2GM4A 3HDDA 3TP0A 2AO9A 3FK7A 3C2BA 1JKQC 2ELKA 1BL0A 2DA1A 2DA6A 3JRHA 1A5JA 2ZB9A 1ENHA 2K9SA 2E2IJ 2IBDA 1MBJA 1CQTA 5E3MA 1BW5A 3BG3A 4NDLA 1MH3A 1XC5A 2DMUA 5EZGA 2FX0A 1BA5A 5C4JJ 3RZDJ 5E3OA 3IH2A 3CMYA 1OCTC 3GTLJ 2XGEA 4DZPA 2VUMJ 3GTQJ 9ANTA 5DTDA 2DMQA 5F08A 3B6AA 5IP7J 3BQYA 5GPAA 1HDDC 4DZJA 2E1OA 2M0CA 4UUSB 3BR3A 5DS9A 2DA7A 5FJ8J 3LSJA 1FJLA 1HOMA 2L7FP 5EDNA 1ETXA 1VF9A 4XRMA 2AHQA 2XPUA 4A3EJ 3SFIA 2K9QA 5J3LA 4MLOA 1R9TJ 4A3BJ 5EZHA 4QSHA 3BQZA 4UUSA 4I76A 1Q1VA 3O8GA 1QRYA 5GP9A 5EGOA 1JTYA 2LLKA 1G2HA 2QF7A 2XRLA 1WPKA 5EGOB 1IJWC 3Q0WA 1H88C 1IGNA 1FIAA 5IYBJ 2Y9YA 3H0GJ 3RQIA 3F0CA 1B8IA 3S1QJ 4D5CA 4W97A 4HNVA 1Y1WJ 3G1LA 2XSDC 2XGDA 1UG2A 3IV5A 4JX4A 4L5EA 4A3KJ 2VPRA 2CQQA 5C44J 3S2DJ 4XK4A 4D7NA 1IDZA 1LE8B 2EBIA 2HOAA 3FIWA 3ZQCA 1ETOA 1UMQA 3HM5A 5K7ZA 2YU9J 3IH4A 4JX6A 1IUFA 3SDGA 3LSRA 5K7FA 3QPLA 3OSGA 1X2NA 4M3FA 1WH5A 1ETYA 1IDYA 4X6AJ 1SFOJ 4M3BA 1ETQA 2D5VA 3ZQLA 4RDUA 1B72B 3S2HJ 3UKGA 2G0EA 4FE4A 3S17J 3B6CA 1MBGA 3A02A 5FKKA 1ORKA 2HDDA 5IOZA 2LKXA 1FEXA 1OCPA 1HLVA 4JP0A 5IPAA 3MVPA 1K83J 2COBA 4B4CA 1JKOC 1F36A 4DYRA 2R93J 1Y1VJ 3MKLA 4QIWN 1GV5A 1GUUA 1IC8A 3O8HA 2LD5A 4A93J 1TWGJ 4MO7A 5FLVA 4M6VA 1GVDA 5J1UA 1BW6A 2EH3A 3CCYA 2ME0A 4A69C 2OPTA 5FLMJ 3BT9A 3TEDA 1ZR2A 3HOWJ 2M8GX 5IYCJ 2JN6A 3RZOJ 4G12A 1P7IA 1FTTA 2L9RA 3RKQA 2CUEA 1Z77A 2HQ5A 2CRGA 1ZTRA 4V2FA 3BTCA 1F43A 5F0CA 5JLXA 4XRSA 1VNDA 1X58A 2DMTA 1PUFA 2NS8A 3LNQA 3WHBA 3A01B 2LVSA 5BNGA 3HEFA 3A01A 2NVQJ 1MSFC 4XRSG 2R5YA 3E7LA 1S7EA 4IHWA 3M4OJ 3WHCA 3MN2A 1ETKA 1NTCA 4IHXA 2JK3A 2DMPA 2EZIA 3CDLA 1ITYA 2DTZA 3PO2J 1OFCX 1ZKGA 2NS7A 1W0TA 3VPRA 4A3JJ 1VI0A 1DU6A 3H3VK 5M5XJ 2R5YB 2O9LA 3JRAA 3BR1A 2WAQN 1NK3P 1POGA 2Y31A 4GFBA 3TW7A 1U8BA 5E3NA 1RETA 5IP9J 2DA5A 1JT0A 3PO3J 4FTHA 1JUSA 5K7HA 2MGQA 4A3IJ 5FKLA 3BTJA 5J1YA 2K9NA 2Y30A 3Q3SA 4UUTA 3OOUA 1D5YA 5EYRA 3NARA 4M3GA 4MFEA 2WV1A 4Y52J 2FJ1A 3GTJJ 2E2HJ 3JRIA 3BG5A 3HOXJ 1JJ8C 4S0HB 1TC3C 1TWCJ 3I4MJ 1Z0XA 1MNMC 4C2MJ 4BBRJ 1I6HJ 4FISA 4IHYA 3BR6A 4J19A 2IEKA 2MSYA 1IV6A 1ZK8A 3LSPA 2YS9A 3HOUJ 2ID6A 1BJZA 3GTGJ 1B72A 4A3MJ 5F1JA 5GPCA 5JLWA 2DJNA 5F0FA 3ZQHA 4B3AA 3LOCA 3S1RJ 1WCMJ 2ME6A 2LFBA 3JRCA 2LK2A 2NOGA 3S15J 2MG4A 4JX5A 1QPIA 1FIPA 3M3YJ 4AUXA 3GBGA 2KDZA 1VFCA 1W0UA 3S1NJ 2VKVA 3K7AJ 2NVTJ 2FD5A 4Y7NJ 2LY9A 3HOVJ 2HOTA 2OF7A 3G1MA 1DU0A 1LFBA 2NVYJ 2R92J 1JTXA 3HOZJ 1RPWA 1EF4A 2E19A 1RESA 3DCFA 5M3FJ 1MBEA 4FE7A 4D5FA 3QPSA 1JKRC 2TRTA 3LSGA 4XICA 1XS9A 1IG7A 3GTPJ 2JA5J 2JJ7A 2KT0A 4B1RA 2K40A 2PMZN 4BY1J 4BKXA 5FKNA 2R5ZB 3GTOJ 1LE8A 3BG9A 3NAUA 2P81A 2R5ZA 1P7JA 3FKIJ 1AKHA 1MBKA 4X1EA 3BTLA 3BR5A 1AU7A 2XPVA 2H8RA 5C4XJ 3JRFA 2M2EA 2X6OA 2HYJA 5IYDJ 4C3JJ 4MFDA 3ZQFA 2Y9ZA 3Q0UA 4D7MA 5F0HA 1T33A 1U78A 1MBFA 4AC0A 1X2MA 3L1PA 4DW6A 1JT6A 3S1MJ 1HCRA 2R0QC 3CQZJ 2ID3A 3OSFA 4QTRA 4BXXJ 2L0KA 3ZQIA 5EF6A 4DYQA 3QQAA 3HKZN 3PM1A 1JUMA 1O4XA 4A3DJ 5J1RA 1PUFB 1JJ6C 3TW6A 4W1UA 4A3CJ 5EG0B 5F27A 2X48A 2JWTA 2VKEA 3FISA 5EG0A 1MBHA 1WGXA 2XPWA 3A03A 5C3EJ 2ECBA 2XGCA 1ZGWA 3S16J 2IAIA 3I4NJ 5E3LA 2E2JJ 1QVUA 1U9OA 2LP0A 2HXIA 2TCTA 4I6ZA 1ETVA 4M3DA 1GDTA 2ECCA 4IEJA 2DA4A 2Y2ZA 2YUSA 2B63J 2EZLA 2GBYA 2QCOA 4MIMA 1U9NA 3BTIA 1IRZA 1RKTA 2LR8A 4ABZA 4CYCA 1AKHB 2DA2A 1FTZA 3DEWA 4M3EA 5IP6A 2Y0SN 3GTMJ 5EEAA 1B8IB 3Q0VA 3HB9A 1RKWA 2CUFA 1I3QJ 2JA7J 1QVTA 3S14J 1TWAJ 2DA3A 2N8GA 1A6IA 1E3OC 4C3HJ 3JRGA 2HI3A 1I50J 1APLC 1UHSA 2JA6J 3JRBA 2I10A 2JA8J 4A3FJ 4FCYA 1XG1A 2CU7A 1TWFJ 2O7OA 2WB1N 3K2AA 3BR0A 3BR2A 4EEFG 2XB5A 2H1KA 2EZKA 5M5WJ 1ZQ3P 2M9HA 4LOCA 2CQXA 4BY7J 3ZOBA 2VI6A 4RBOA 2GLOA 1MSEC 5IOYA 2HOSA 1GV2A 4JYKA 1ZR4A 1GT0C 1AHDP 5FKMA 1HF0A 2X9DA 4BBSJ 2R7ZJ 3JR9A 5F04A 1LFUP 1ETWA 2FQ4A 2EQRA 3ZQGA 3D1NI 2MW8A 1SANA 1RR7A 2DN0A 5FKOA
chains in the Genus database with same CATH superfamily
4YEJA 4BNCA 3GFLA 1T56A 2IS1A 3AG1H 1V54H 1XMXA 2ZXIA 1DDNA 4B43A 5B1BH 2LTPA 2I8DA 3FK6A 2CJJA 3KPHA 2DFFA 1JGGA 3SEQA 1FBQA 1IZ1A 3ROUA 2ELHA 2EZHA 1D5VA 1I1SA 2XB0X 3AL0C 1OJLA 2HXOA 4L9JA 4PJLA 4ZH4F 5HODA 3VFZA 1JGSA 4NC6A 5L3CA 1JKPC 2O8KA 2RAEA 3DTEA 2JZYA 2M34A 5HS7A 1QPMA 2ESNA 1EH7A 3JRDA 4ETSA 1Y0NA 1H8AC 1TWHJ 4FETA 1HDPA 1T2KA 3FXQA 1BM9A 2M0MA 1G3YA 3HDDA 3TP0A 3V8KA 2AO9A 1IF1A 5E8IA 2HPIA 3FK7A 3L9FA 3MZ8A 1YLFA 1BL0A 1R1UA 2DA1A 4WX9A 1T0FA 2L01A 3QP5A 1S7OA 5DUKA 2LH9A 1F4KA 1G6NA 3HSEA 4Q4ZF 2GAUA 4RMNA 2IBDA 4YIIA 3IRRA 1P9QC 4LK1F 1MMDA 3ZMVA 5LGTA 1MMGA 4N9IA 5E3MA 1VQ9I 2R7XA 5E8GA 4D9JA 4KN7X 3BG3A 1BJAA 4AM3A 1ON2A 2DYRH 4PJNA 2GA2A 3CC2I 4AWXB 5DCFA 3TDZC 2DPUA 5C4JJ 1HXDA 1AA7A 1XSDA 3OYEA 2OTLI 1USSA 2VC0A 4R1HA 2OZ6A 1OCTC 2XGEA 1FWZA 4DZPA 5GTIC 2VUMJ 1MNDA 4IQJA 3K4CA 1A36A 1Z1DA 2DMQA 4RAGA 2OV7A 2ZO4A 5F08A 1KYWA 1YIJI 2CV0A 2R7SA 2X1CA 1JXSA 1HDDC 4UUSB 3T5XA 2JTVA 3DWLE 4G7HF 4XLCA 3L2VA 3ZP5A 3BP8A 3QYBA 1QZYA 1YJ9I 1ZGJA 4IQ4A 4A3EJ 3FXUA 3SFIA 1R71A 4Q47A 4LB6B 5H2FC 4U7BA 2H8WA 3HPGA 3C7JA 1HW1A 1R49A 2QBYA 3FMQA 1LVAA 3O8GA 3J7YJ 2ZXJA 4ON0A 2LBFA 5E79C 3G6EI 3QP6A 1D0XA 1HKTA 2UUZA 1JE8A 2KRHA 2XRLA 5IY5H 2XAGA 3TQNA 4H4KC 3Q0WA 3S93A 2VIXA 1QHHD 3F8MA 3OWTA 4IKFA 1Y1WJ 1GLNA 1IN4A 4L5EA 4A3KJ 4A12A 3S2DJ 3TL4X 1MKMA 4XK4A 1IDZA 3FIWA 2HKOA 1L0OC 3VOEA 2KIMA 4BHBA 1UMQA 2ZJ2A 4CSWA 2CV1A 4IRIA 4ZDLA 3ZQ7A 1YJWI 1G3WA 2V4JC 1J9IA 4CUGA 5GAHJ 2WY8Q 3PUFA 4N4OB 1SD4A 2CWEA 1D0YA 1PUEE 4BQQA 2E5ZA 1K7AA 3LSIA 4KT5C 4M3BA 2D5VA 2H1LA 5FFXA 5LGUA 3S2HJ 1I3AA 4ESFA 3UKGA 2STTA 2E5NA 1D3YA 1IXSB 3O6BB 4ZTFA 3PQKA 5FKKA 1ORKA 2HDDA 1S7AA 2EA2A 3D0SA 1HQCA 1HLVA 4JP0A 5IPAA 3HG9A 3WTUC 1F36A 3OMYA 1WJ5A 2LNBA 3I53A 3VWBA 1NHAA 3LQQA 1YX3A 1EKEA 1UZCA 1QQIA 2EWNA 2FNAA 4MO7A 3HJEA 3OYNA 2ADUA 1WFXA 2VKHA 4PJ0C 4ZYAA 4E70A 5FLVA 2QQBA 2Z1DA 2FBIA 4E4HA 3M8JA 2EH3A 3C2GA 3W6KB 1W7PB 2JPCA 1BI2A 3K4LA 4QPQA 3B73A 4Y13A 4IO9F 5FO5A 5FLMJ 1XSVA 1FOWA 2LG4A 1OYWA 3BT9A 5D8KB 3DBRB 3LA7A 4EJVA 1S3JA 1MDMB 3HOWJ 1P4AA 3BPXA 1D8JA 4IRGA 3G73A 1R5GA 2C6YA 2LY1A 5FRMA 1H9TA 2L9RA 3TGNA 3RKQA 2GXGA 2ZC2A 4XL9A 2F4IA 1F43A 5F0CA 5JLXA 4XRSA 4HV5A 3L2QA 2KQRA 2OQGA 1BR1A 2OQRA 1I39A 1IAWA 2HEOA 3WHBA 3A01B 4E7HA 3MMYB 1MJBA 3A01A 5BOXA 2IRFG 2NVQJ 2Z2SB 1WQ2A 3I71A 4XRSG 5JI6A 2MC3A 5B1AH 1KU7A 1R22A 3WHCA 2HVSA 3MKZA 2EILH 3BG7A 3ZN0A 1HBXG 2JK3A 4FX4A 4B09A 1BR4A 2DMPA 3ECOA 2DTZA 4CCLA 3CDIA 2NS7A 4A3JJ 2HKXA 1MMSA 1Y56A 3H3VK 3E5XA 2HYFA 2O9LA 2VE9A 1SVLA 5LRSA 3O3KA 4M71A 3IWFA 3EETA 1ONVA 3DTKA 4OIQF 1OCZH 2QENA 3PIOF 1U8BA 4RB2C 5IP9J 3L2UA 3Q9SA 2QYOA 4FASD 5K7HA 4EQQA 2MGQA 1IRFA 4A3IJ 1YI2I 3CJRB 2LY2A 1TT0A 4XSZF 4UUTA 3DFGA 3ZMDA 3WE3A 2FRHA 3OY9A 3OOUA 3CUQC 4M3GA 3GWZA 3IAS2 2MH9A 4Y52J 3EPZA 2E2HJ 3JRIA 4MTEA 5E20A 3HXLA 2XAQA 1U8RA 2A6HF 1TWCJ 4BYYA 3K4NA 1JHFA 1FZPB 2OU2A 4CDGA 1Z0XA 4N9HA 3EYIA 3CZ6A 4XONA 1IN8A 2KP6A 3J81K 2V1NA 3BR6A 1HW2A 1MD0A 1ON1A 1R4NB 3IHUA 5L3FA 4HF2A 2Z9OA 1W5SA 5D5VB 1C0WA 4ZJZA 3P5JA 2W1OA 2E1MC 1USTA 3D5RC 3J80Z 5JHUA 3LA2A 2IS4A 1MW7A 1ERDA 1YS6A 5DD8A 1IV8A 2Z99A 4KISA 2RQQA 5F0FA 4PFOA 2STWA 4IF4A 3KYDB 2NOGA 3S15J 5FLXZ 2VQCA 1VQ7I 1ZHFA 2A3SA 2WAEA 4UXNA 3V7RA 2NRAC 5D4SA 2VKVA 3K7AJ 1LQ1A 3CJTB 2OA4A 3OS2A 1CF7A 2FD5A 3IKTA 3HOVJ 1IRXA 5LHIA 2F4OB 5BS6A 3CO7C 1U0JA 3LQRA 5CVVA 3WG9A 2DDAA 2RREA 1YITI 2XC7A 5M3FJ 4FE7A 4EJWA 2TRTA 3NWTA 3H5RA 1IG7A 5K5RA 2PMZN 3REOA 3DTIA 3WE2A 3CCSI 2XF5A 4JQFA 4BKXA 5DCMB 4KT6A 2R5ZB 1RZ4A 1TL8A 2R5ZA 2P81A 3KLNA 2G7HA 3FKIJ 1MBKA 4X1EA 3BTLA 4J00A 4XKVA 2FOKA 4RA2A 2XPVA 1FP1D 2HQRA 5F64A 1OYYA 2M2EA 2ZCWA 4DJAA 2HYJA 3CC7I 2V7FA 2F48A 2Y9ZA 1U78A 4LITA 1QZEA 1QNTA 3ZMZA 4AC0A 5DEQA 3N97A 1E0EA 1X2MA 3L1PA 4DW6A 1J75A 3S3OA 3BZKA 4GYIA 3OSFA 1XMKA 4BDYA 2L0KA 5EF6A 1MMAA 4IRHA 2NNNA 3IRQA 1LEBA 1PUFB 4AU7A 5L3DA 2KL4A 2WY7Q 5L3EA 4A3CJ 3EUHC 4EM0B 3A03A 3JSPA 5C3EJ 3L2RA 1EA3A 2XGCA 1DGRM 1OYIA 2E2JJ 2DT7B 4PGGA 2K86A 2HXIA 3CJNA 3GYHX 4I6ZA 4HSTA 4ESBA 1XN7A 3ISPA 2JPBA 1E3HA 3MWMA 2MH2A 3FMRA 3GZ5A 3KP2A 2QCOA 2DYSH 1FYLA 3S8PA 2B7EA 3BJOA 5KAFC 5GADJ 1ZG1A 2EV5A 2ZSIB 4B48A 4M3EA 1SD5A 2JUGA 2KIFA 4B47A 3SXYA 3R0AA 3UNGC 3HB9A 5H6QA 2WV0A 2CUJA 2EJRA 2CUFA 3OYBA 2JA7J 1QVTA 4RAYA 1X3UA 1RC9A 2PJRA 2DA3A 2N8GA 1R36A 1A6IA 4S04A 4IJAA 4C3HJ 2A6TA 2DK8A 3ZR8X 1I50J 2JA6J 4BE2A 2K3FA 3GFJA 3H9GA 3QPHA 3ZXSA 4FCYA 4EEFG 3Q5FA 2ZXHA 3BR0A 4PFPA 3L2CA 3ELKA 1ZQ3P 2VI6A 2X0LA 4G7ZF 3O2PE 1PJRA 2UZKA 1MSEC 2P4WA 1KQ8A 3MQ0A 1Y0UA 4JYKA 1TT5B 4RAFA 1GT0C 1ZARA 1FC3A 2RQPA 1ZRDA 1ZH5A 1FOXA 2R7ZJ 5EJCA 5FFZA 5F04A 1LFUP 4XBFA 3CCRI 1ETWA 1HW5A 4KN4X 4F55A 4M6XA 2MW8A 2ICWG 4UB6C 5KVRA 5F6FA 2OTJI 1T38A 2DN0A 5FKOA 2UWMA 1UFMA 3FXOA 4XIDA 1IRGA 3HL2A 4HDUA 4WXCA 3K70C 1YG2A 4XLEA 4L5JA 3T8TA 2XDVA 1MH4A 2DT5A 4CYCB 3WTXC 1O3QA 2O03A 1NH3A 2JMWA 4CCMA 3CD6I 4A3GJ 3V8LA 4V2GA 1WWXA 3DKXA 4DNCA 4NNJA 2EFQA 2ZNZA 3JREA 5CQEA 2HZDA 2CQ7A 4BDZA 2D45A 2W48A 3K10A 4X0GA 2FXAA 2K3PA 3G2BA 3G1OA 3OIOA 5HNFA 4KNYA 3KP3A 2DMNA 2GOXB 4WWCA 1BIAA 3COAC 2GM4A 2E7WA 1PYVA 2QSHX 2QKLB 2NAZA 1U3EM 3Q9VA 3G71I 1X3ZB 1Y8QB 4O6JA 5TGTA 4R8HA 3VYRB 4GDFA 1A5JA 3GLLA 5KHDA 4NB5A 1ENHA 3K1NA 1MNEA 4M6YA 4LG0A 3E0JB 4OOIA 1DPRA 1BN5A 3RQ4A 4NDLA 1VQPI 3ABTA 5EZGA 2R7OA 1I1GA 3E6DA 5TJJA 4JOMA 2YPRA 4A6DA 5E3OA 1V3FA 3P9IA 1RUOA 3CCEI 3J7AO 2QSFX 4QPOA 1ZREA 2JRTA 3OIQA 3LSTA 5A2QZ 4I2OA 3BQYA 4CICA 4M74A 1F5TA 4BQNA 2W84A 3JAMK 3ZMUA 5DS9A 2DA7A 1Z6TA 3BCBA 5BPIA 2MLGA 3VSLA 2AQFA 3OYIA 1ETXA 2ZMEC 3GMEA 2IA1A 4NQWB 2H6CA 1XD7A 4U87A 2RC4A 4HLXA 2R7UA 4L9TA 5CVIA 2K9QA 5J3LA 1R9TJ 1U6GA 3WTZA 2OUMA 4O3MA 5EZHA 2Z5UA 4I76A 1Q1VA 3SFZA 3FHNA 3WG7H 5LEKA 3OR2C 3NEUA 5GP9A 3FMSA 1DP7P 4OIPF 4E7SA 3DF8A 2HNHA 2KIUA 4EGZA 1G2HA 3HOTA 5EGOB 2DFHA 2VT2A 3TBIA 4I09A 1IGNA 1FIAA 3I9V2 2BY1A 1Z7LA 5E1WA 2V1XA 1Z05A 2JUCA 4FHTA 4XLNF 1YO5C 3H0GJ 3RQIA 3S1QJ 1OR7C 4D5CA 3P9CA 4W97A 2XGDA 5CJ9A 4KMUX 2XIGA 2HGCA 4JX4A 3QWLA 2IGMA 5C44J 2D2WA 4MTDA 2DK5A 4D7NA 1LE8B 1OCCH 4YFNF 5D4RA 5K7ZA 2FA5A 2EIMH 2UXNA 3PSIA 4JX6A 3CP8A 3F22A 4UHTA 5K7FA 2M1BA 4A2UA 1ODDA 2A69F 1IDYA 2PEXA 1FP2A 3I58A 3BLYA 3VEPA 4XOTA 3ZGKA 2Q2EB 3OYCA 2O0YA 4P1WA 4B8XA 2D1VA 5HDNA 1WZ2A 3ZQLA 5J4VA 3W2WA 2EIKH 1YTYA 2R4GA 3F6VA 2F6CA 4RDUA 1ZLJA 3CCMI 1LDDA 3S17J 1ZGAA 2B0LA 1O7FA 1UHWA 4LLLA 1RIOH 3PNTA 2LSOA 4ZYGA 1U2WA 1OCPA 2L54A 3ZCOA 3MVPA 1K83J 1B6AA 2PI0A 2CG4A 3C1DA 3MKLA 4BS9A 1IC8A 3O8HA 2DODA 4A93J 3FXJA 2EV0A 4UV8A 2Y48A 4HYEA 3FKJA 2R7WA 4FT8A 2AQEA 1XCBA 2FBHA 3JTGA 4ZDPA 4M9XA 1XSXA 4CA0A 3TEDA 1X3WB 2X6YA 4WK8F 1VQ8I 2W57A 2JSCA 2BY2A 2A05A 4IHSA 3I54A 1P7IA 4XSXF 3I55I 2KIQA 2CUEA 1Z77A 2CRGA 2GQQA 4LJZF 2O3FA 1W7PA 2DI3A 3I4PA 2VBXA 2HS5A 5J8CA 2XF6A 2DT6A 1V4RA 3RSNA 2DMTA 1MJAA 5LEJA 4HEA2 5CVUA 3LL7A 2P0WA 4WCGA 1PUFA 1SMTA 3KETA 4U0YA 2NOJB 1MSFC 2R5YA 4LG3A 3EUKL 5KAIC 4EVIA 2LF7A 1TQIA 1D1AA 3FXRA 2VBZA 2CW0F 2GWRA 3PNVA 3WTSC 1ETKA 4IHXA 2DQLA 1SEUA 2XKPA 2ZBKA 4BU2A 2EZIA 3PO2J 1ZKGA 3RIRA 1KQ9A 3VPRA 5J47A 3CDHA 2TDXA 3CP2A 1WJDA 5M5XJ 1WRJA 3OS1A 3HSRA 4ZYHA 2FEZA 4U7DA 5HDGA 1D1BA 4P9FA 3K4MA 5ERIA 4IPAA 2BW3B 2K5CA 2M45A 4RB1A 1SVOA 1F1ZA 1Y8RB 2EFOA 3KP6A 5FKLA 3MAJA 2V6CA 3GO5A 3BTJA 5J1YA 2K9NA 3Q3SA 4ENKA 2CSOA 3CUQB 1DGWY 1RRJA 1LB2A 4RGUA 2QBYB 5FD6A 4GRIA 2IS2A 2AS5F 1XDUA 1Z21A 5DYMA 4MEYF 1ZN2A 3HOXJ 1T8IA 2GOMA 1EH6A 1KGSA 3HRTA 3I4MJ 3HHGA 4BACA 1K6YA 2F2EA 2A5YB 4C2MJ 4PJMA 1VZ0A 4FISA 4IHYA 2E36A 1G8XA 1UCRA 3PFYA 2IEKA 3VB2A 4RM3A 3ABUA 1NG6A 4KIFA 5LFAA 1ZK8A 2ACJA 2E34A 2ID6A 2JRMA 3TDUC 1B72A 2IGNA 2YSRA 4S05A 4EJUA 4A3MJ 4RAZA 3CCUI 2FMLA 4N4NB 3GUDA 1VQOI 1RI7A 1OPCA 2XAFA 3ZQHA 3S1RJ 5KCMA 3DEEA 2ME6A 2LFBA 3JRCA 3PJRA 3TO7A 4IOAF 3SHFA 4G94A 1E17A 2H94A 3M3YJ 1W0UA 3GBGA 4RS8A 2KDZA 5TRDA 4G9YA 4PDKA 3F8CA 3S3NA 2HOTA 3G1MA 2BE5F 1TW3A 2NVYJ 2RKHA 5LHGA 4CH7A 3OOPA 3DCFA 1XDSA 2DOEA 1STZA 4WXDA 3GZ6A 4KYWA 1BI0A 4AVPA 5BMZA 3LSGA 1GXQA 3KE2A 4LK0F 2KZVA 3GTPJ 4B44A 4B1RA 4I0BA 3KEYA 1K6OA 1S9HA 4BY1J 1HKSA 5CVJA 5IT3A 2D1HA 4GXOA 1LE8A 3BG9A 4YIFA 5FRNA 4HF0A 2V9VA 3RKWA 1EH8A 4HRIA 2BV6A 4OINF 1A04A 2H8RA 4HX4A 3A0HC 2X4HA 4U0VA 3U1DA 2R7QA 2W85A 3ZQFA 3PUBA 1YE9A 4HF1A 1RUNA 3E6CC 1ACIA 3OYJA 4I02A 4MNUA 3W2VA 1IXRC 4XR6A 1UHMA 4AIKA 1HCRA 1ZYRF 2R0QC 3F9KA 4YELA 4QTRA 3BDDA 4BXXJ 3K1MA 3ZQIA 3HKZN 1SD6A 2CMPA 1JUMA 1J0RA 5E17F 4WXHA 4CGZA 3BY6A 5J1RA 2MC4A 3F72A 1O57A 4W1UA 4BAYA 4CHUA 4PGHA 1K78A 2HPMA 2F5DA 1FY7A 2JWTA 2E35A 2QWWA 2VKEA 4ZYEA 2VBWA 3R0JA 4D1QA 2LOOA 1FYMA 2X6WA 3TMOA 3I4NJ 2K7LA 3W3CA 1ZGWA 4DBRA 4U0WA 1MIJA 4PJJA 4XQFA 1YIOA 2NS0A 1QVUA 2VXZA 3HIFA 2TCTA 3KP7A 2P8TA 2MYSA 2Z16A 3GF2A 2OC6A 1GDTA 2JQ7A 2YX7A 5DCMA 2B63J 2E1MB 3ZN1A 5DM7F 2Z33A 1A31A 2GBYA 3JSOA 4V19K 3BTIA 1FMVA 4A6EA 1IRZA 1RKTA 4CYCA 2DA2A 2LREA 3K9TA 3K6GA 4F3QA 4A0XA 5IP6A 1V5EA 4KJZA 5HS9A 2DTRA 3GTMJ 1B8IB 2JVHA 5HNHA 3Q0VA 2LF8A 3RI4A 1BIBA 3LA3A 2LC2A 2CYYA 4UUVA 1Z3YA 5J8FA 5HLHA 3DLAA 1HKQA 1BR2A 3H5AA 3S14J 2WAQA 2BBYA 3ZMTA 3QRFF 3SYTA 2E1CA 1XCVA 3HZJA 4HLYA 2KPMA 1XG1A 3KEQA 1TWFJ 3HPHA 2O7OA 4GCVA 4E7LA 3BR2A 2H1KA 2XB5A 2EZKA 4KA4A 2E7XA 4BY7J 3E97A 3EDPA 2A61A 3F8BA 4F7ZA 2LKPA 4Y15A 1SFEA 2HTJA 2XV4S 1LUJB 4Y4RA 4HBLA 1E3PA 1KQ0A 1HF0A 2X9DA 4BBSJ 1SD7A 5B66C 4BH9A 1ZRFA 2RV8A 2FQ4A 2WADA 3IKVA 4GGGA 1SFKA 3ZQGA 1F9NA 2K4BA 2OZUA 2Z3YA 2ZNYA 1J2XA 1SANA 4YG2F 4DOZA 1R00A 3ABMH 3LWFA 2KJCA 2IT0A 2V6EA 4UY8I 1DPUA 1K61A 5M3MJ 3D5SC 1H89C 1WJCA 3U9GA 2FBKA 4DYCA 3KIOA 3H9QA 2HWVA 3WTVC 3HGGA 4I01A 2FSWA 2VJ5A 4G6TB 2XSJC 1WH7A 1R5HA 4RGRA 2P7CB 2VOOA 2ISZA 2NVXJ 1I6XA 2ETHA 3MCZA 2HVQA 5ILSA 4NQWA 2DJIA 2HQAA 4WF2A 4IHVA 4I0AA 3H5NA 1NK2P 2QLZA 3E6MA 3HOYJ 4A3LJ 1VQLI 5LGNA 3W6VA 2V79A 3VYTB 1YRNB 3K0LA 1K79A 1TQPA 2O5RA 3HBLA 3J7ZI 4A0ZA 3OYFA 4H0EA 1YRNA 2RN7A 3WTTC 3PNYA 3HTSB 3FHZA 2IA2A 2DFEA 3C2BA 2RDPA 1JKQC 2ZMEA 4HOBA 2DA6A 5D6EA 2ESHA 2H6BA 4MQVA 4AD9A 3ERED 2WTEA 2L4AA 5CPRB 1HSJA 3SZGA 1SC7A 2K85A 2CGPA 3OL3A 4BUPA 1BW5A 5IT9Z 1ZG5A 2DMUA 1WKMA 2L9SA 3G4SI 3T1BA 1BA5A 3RZDJ 4RGXA 4LD5A 4TV7A 4ZYDA 3GTLJ 3E3VA 1B9MA 1H0MA 3SZTA 2PG4A 3E1SA 3PSFA 5DTDA 3GTQJ 1P4WA 5DDGA 5ICEA 2NXNB 3HC7A 5IP7J 2ZFWA 4IVNA 5GPAA 2CH0A 2XRNA 3QPTA 2VQHA 2E1OA 2M0CA 4DZJA 3IWZA 3HOSA 5FJ8J 1YW7A 2Y0MA 3KFWX 1FJLA 4F52A 1HOMA 2L7FP 5EDNA 3QYFA 2VJ4A 1IN6A 3J7AY 2KISA 3ZQQA 2AHQA 2LKSA 5HDKA 2XPUA 3OIPA 3F23A 1VQKI 1TLHB 2GZWA 4A3BJ 3NQOA 2L5QA 3CTAA 3MZHA 3BQZA 1GVJA 2V1DA 1MDMA 4HW0A 3FBIB 1QRYA 1SMYF 2FUG2 1O3SA 1JTYA 2LBFB 2QGUA 2PJRB 3DBLB 1WPKA 2X51A 2EV6A 1FOYA 4A5MA 1IJWC 3M8FA 2M87A 3WU0A 3V42A 2EFNA 3F0CA 2MFZA 5LD2C 2XSDC 1UG2A 4ENMA 4BL0B 4PZJA 1QGPA 4OIRF 4LG0B 2EBIA 5JFRA 2HOAA 1N78A 3LFUA 2F5FA 2LRDA 3HM5A 3KEOA 3IH4A 1UB9A 5KK1A 3TO6A 2WWYA 3M07A 1IUFA 3LSRA 2M4GA 4HAMA 3FDYA 4M3FA 1ETYA 2P6SA 4M9SA 2PMZA 4X6AJ 4IHTA 2BYVE 2BXZA 4N0BA 2KHMA 4DQ2A 2BY3A 3BOQA 5FROA 1B72B 4FE4A 3B6CA 3AFHA 4HA8A 1MBGA 3A02A 4YFXF 5H6RA 3CMEI 2ZSHB 4BXFA 4ENJA 1IUYA 2PMHA 4CZZA 3GXOA 5IOZA 2LKXA 3DQVC 4JK1X 4P55A 3MEXA 2Q2EA 5FD5A 1OKRA 1JKOC 2R93J 3U2RA 1Y1VJ 1W36D 2XAHA 2JT1A 4JBAA 2YR2A 3BWGA 3QU3A 2K4JA 2LD5A 3PIPF 1QBJA 1YOVB 5HLGA 2ZKZA 2ZXWH 4M73A 1Q1HA 4LLGF 4CCNA 2IGKA 5J1UA 2M7BA 3W2AA 1OCOH 2F5CA 3OYMA 2L7KA 2OPTA 2VN2A 1EJ9A 2LYCA 3N4MA 2O61A 1ZR2A 3BJ6A 1V5GA 2JN6A 3RZOJ 3CF2A 3E5QA 1FTTA 3CJQB 2IXSA 3CCVI 1YS7A 3I59A 2HQ5A 1ZTRA 3UR3C 3TO9A 1R6RA 4V2FA 1BBYA 4ZTJA 1W36C 3S2WA 2EFPA 3H0DA 4M9ZA 3NWSA 3LNQA 4HX7A 5BNGA 1MMNA 1IN7A 4BGDA 3HEFA 2QUFA 3RYPA 2VT3A 2P7VB 4L0ZB 5BPDA 4IHWA 1S7EA 4R79A 3TOAA 2BY0A 2E1NA 2Y0SA 1OMIA 1NTCA 1T98A 2XASA 1UG0A 3R6SA 3KP5A 3H36A 2IVMA 5CQGA 1W0TA 1R58A 3KZZA 3CLOA 1G3SA 1VI0A 5D6FA 1DU6A 3FM5A 2R5YB 3KYCB 4XLHA 1KZHA 3JRAA 2GXAA 2WAQN 5D5XB 1KU3A 1MZBA 1FX7A 1W7PD 4KUMA 1POGA 3HSFA 3TW7A 2VQLA 2V1UA 2BXYA 1YQAA 4FTHA 1JUSA 4ANJA 3K69A 2W4SA 4XN3A 2L9NA 3ASOH 4C30A 2Y30A 2ZMEB 2E60A 1REPC 4C9YA 1G3TA 3FWEA 5CLSA 5EYRA 4XNFA 6PAXA 2QQ8A 2FJ1A 1BI1A 2P5LC 2ZJRF 3BG5A 1MGTA 2I5UA 4OAYA 4S0HB 1JJ8C 1BOBA 4L9VA 1ULYA 1T95A 2A68F 3IUOA 5H20A 2EA4A 3RKXA 2L4MA 4BBRJ 3AG4H 4F92B 3F8FA 3PL8A 2K9MA 2DOAA 2DW4A 1HSTA 2MSYA 1IV6A 2R7FA 3FF5A 3LSPA 4PSWA 3HOUJ 3GTGJ 3C2HA 1S8NA 3OYDA 5AIPA 4HPQA 2VE8A 4AYBA 4EJTA 5GPCA 1RR8C 5JLWA 1LFPA 2DJNA 4CCOA 1I5ZA 4CCJA 4KIGA 3LOCA 3M7GA 3C3WA 2VLAA 1S6LA 4LGWA 1Z91A 3TKYA 2MG4A 4JX5A 3DBHB 3RPUA 2R7TA 1YW9A 3OL4A 2XGXA 1VFCA 4PK4A 1YJNI 3DU6A 2NVTJ 4Y7NJ 3FM3A 3W6JB 1AWCA 1O3TA 1DU0A 3R60A 1DUXC 2R92J 4EJOA 1RPWA 2COMA 1EF4A 4E7KA 4I98B 1JKRC 3QPSA 4XICA 3BROA 2IP2A 3ABKH 3SQNA 4YIRX 1XS9A 1P4XA 2DDBA 2MD5A 4BEHB 3OYAA 2JA5J 2JJ7A 4BJTA 2JA2A 5DV5A 5ILUA 2KRCA 3DXJF 3IL2A 3GTOJ 1BI3A 3JW4A 2H09A 2W24A 3NAUA 3CO6C 1WSUA 2GIZA 3CESA 2A6EF 2HR3A 3ASNH 1P7JA 2XAUA 3LMMA 1AKHA 2F5VA 3U1KA 5DM6F 5CYVA 4J01A 1OR7A 3F6OA 3PFIA 1AU7A 1FLIA 4KDPA 4GO1A 1N77A 2XAJA 2X6OA 2Y75A 1VQMI 3Q0UA 5F0HA 3EYYA 1XGOA 5IT9K 3I64A 2DPDA 2J5PA 1LEAA 3VYSB 3AAFA 4KFCA 3K4JA 2M7AA 4FX0A 2YU3A 2ID3A 1J7KA 3C18A 1YW8A 1XB4A 1A6QA 4DYQA 1P2FA 2V9PA 5FLXK 1S5LC 2J5OA 2OAZA 2HQNA 2FF4A 3P7NA 1JJ6C 3TW6A 4UB8C 4ZZDA 1QZZA 2BGCA 5F27A 4EMSA 5EG0B 4Y33A 2BHZA 5EG0A 1MBHA 1NG7A 2XPWA 3R61A 2BOLA 1VQ4I 1VQNI 3HTUA 5E1ZB 2WAFA 2BW3A 4OMYA 1BC7C 4MGRA 5L3BA 3GLXA 4HG2A 3GFMA 1U9OA 2LP0A 1R1TA 2YX4A 4EM1A 4LLNA 1ETVA 4M3DA 4CO8A 2VOPA 3I5UA 2ECCA 1TQMA 2HTSA 3P9KA 2IA0A 4LMYA 1U5TB 3AG3H 1TBXA 2CFXA 3HRUA 1U5TA 1FPQA 3BZ6A 1U9NA 4MIMA 4UV9A 4IOCF 1U5TC 4ABZA 2LR8A 3V8JA 1FNNA 1W4MA 5D8LB 3M1CA 3H3UA 1W5CC 3WTYC 5HS8A 1Z7UA 1XGNA 1GHCA 3ESWB 3QU6A 3ECHA 3K4KA 2FU4A 3FX3A 2BZTA 4ZZLA 3HUGB 4HQMA 2DCEA 4XLAA 1IO2A 3HUGA 4II2A 1TWAJ 3KLOA 3FXKA 1FYKA 2HDWA 1E3OC 2CO5A 2BVMA 3JRGA 5E1XA 4HQEA 1APLC 1TW2A 3GVAA 1SFUA 5L3GA 4LB5A 2JA8J 4A3FJ 2WB1N 2FMYA 4F91B 3K2AA 2DO7A 2KRFA 4IX7A 4LOCA 1TTYA 1DP3A 3ZOBA 4G8XA 2KKOA 1B59A 3GZNB 4HSRA 2F5EA 5IOYA 2VBYA 3BPVA 1ZR4A 2OBPA 5BQTA 5GTHC 2Y69H 4QLCU 2DBBA 4B3XA 1AHDP 5FKMA 2HU9A 2DU9A 4HZFA 2RNGA 3VSKA 1OLTA 2X85A 2XUBA 2KDOA 3HRMA 2EQRA 4ITVA 3WGHA 4E7JA 1WI9A 3WU2C 2DLLA 1QU3A 2GXBA 1RR7A 1MJ9A 2RGVA 5ED4A 2PN6A 1D8KA 1B1BA 1LVKA 4Z2YA 2VONA 3K1PA 3KX2A 4C2UA 2R7VA 2NNYA 2PJPA 1XPXA 2KMUA 2HFHA 2Q0OA 3OYGA 3SZPA 2EFWA 4XKWA 5D5UB 2BHYA 3A2KA 4XKCA 3T0YA 5E18F 3SJMA 4G7OF 1WJEA 5M5YJ 2WBMA 3ML6A 2P5VA 3JTHA 3GTKJ 4BQAA 3J80K 3T8RA 1B4AA 1O7LA 1X4OA 4AYBN 1BOAA 2F4MB 1LKXA 2MABA 2QQ9A 2L7MP 2IW5A 3N05A 4EM2A 2ZJQF 1WI3A 2MD0A 1QA6A 3HGYA 1ZLKA 2CW7A 2L7ZA 2X1EA 1J5YA 4EV0A 4C3IJ 3R4KA 3KCCA 3GEZA 3TP3A 1JUPA 2O8XA 4HX8A 3WGGA 2QVOA 3JAMZ 3IH3A 1YX5A 1VQ5I 4CXFA 1KU2A 4XMYA 2PMUA 4E7IA 2ELKA 2VQGA 3F21A 1TNTA 2VJIA 3JRHA 2ZB9A 1D0ZA 4C2TA 2K9SA 2E2IJ 1D1CA 1IW7F 1MBJA 3WTWC 1CQTA 2KLOA 2RVCA 4RGSA 4UVBA 4XLPF 4D0PA 4F93B 1MH3A 3H92A 1XC5A 4Q48A 2DAOA 2FX0A 1T39A 2XKOA 4ESJA 1JI8A 4G6QA 1Y39A 3F8NA 1UJ8A 3IH2A 3CMYA 3X2QH 1LNWA 3VYUB 2PBIA 2EK5A 2EPFA 2HDCA 9ANTA 4ZC3A 4XM3A 3KYLA 1G59A 2CUZA 1ZAOA 5EEHA 3B6AA 2EINH 1S29A 2M8EA 3DU5A 3LSKA 2WC2A 2JSPA 2P5KA 3BR3A 2PQ8A 3LSJA 2XHKA 1EV7A 3ULQB 5DUIA 2UV1A 1WHUA 3PQJA 4LIVA 1VF9A 4XRMA 4HV6A 2HYGD 4KICA 3ZMSA 4L0YB 4MLOA 1PVEA 1QO0D 5J40A 4QSHA 5LRRA 3BC8A 4UUSA 3CF5F 2QEXI 4BJ6C 3FZVA 5EGOA 2W82A 2LLKA 1KONA 3BCAA 2QF7A 3DPTA 3CC4I 3CCLI 3IC7A 2Q1ZB 1FBUA 1X4PA 1H88C 4HDVA 5IYBJ 2Y9YA 2UXXA 1I27A 1B8IA 3LFKA 3FXMA 3V4GA 4HNVA 3FXLA 3G1LA 3OR1C 4XRFA 1R7JA 3IV5A 3WODF 4L18B 2V9KA 2Q8KA 3ABLH 3RPQA 3GCMA 2HZTA 2VPRA 2CQQA 4L5IA 3TOBA 1ZG3A 4PUSA 3ZQCA 1QHGA 5J6XA 1ETOA 3H35A 2YU9J 3DP7A 2PFBA 2ELJA 3VDXA 1HA8A 3BJAA 1LDKB 3H3ZA 3SDGA 3RPUD 5ICCA 2FOWA 3QPLA 5EEGA 3OSGA 5AIQA 5HLTA 1X2NA 1WH5A 2KJBA 5LLQA 4XLFA 4KITB 5KNLA 2G7UA 3MKYB 3WGIA 2VB6A 1W5TA 1XTAA 1Z3XA 1ZELA 1SFOJ 1ETQA 2L2OA 5FB2A 1K78B 3IP4B 2DXIA 1P92A 1CF7B 3CUOA 4XORA 3OYKA 2G0EA 1WJBA 3GW2A 1R1VA 3RJPA 1O3RA 2R7RA 3L7WA 2WB1A 2QKMB 1R4MB 4NC8A 3LAJA 1FMWA 1FEXA 1E2XA 3ONQA 4E6KG 4I99C 2COBA 3ERMA 4B4CA 4DYRA 2X6XA 2CV2A 4QIWN 1GV5A 1GUUA 2IGOA 2KFDA 2GA1A 1TWGJ 3DEUA 1R5ID 1X1AA 4OU0A 1B9NA 2QSGX 3RYRA 4M6VA 2MA3A 1GVDA 3K4BA 2W7NA 1BW6A 3CCYA 2RNJA 3HKZA 2ME0A 5ICFA 4NUBA 4A69C 1X1DA 2FNPA 2ISYA 1J09A 1XX5A 4I7HA 4OIOF 5K5OA 4A5NA 2M8GX 5A2QK 5IYCJ 2XF7A 1V55H 1UELB 4G12A 3BG6A 1YHQI 1T0FC 4E7ZA 4OAZA 5CVRA 3HRSA 4ZDOA 3A4CA 1FSHA 1RNLA 3VODA 4IL6C 4MHGA 3CCJI 5K5QA 3BTCA 3M9AA 2B9SA 4O5VA 1SVMA 1KA8A 2ZFUA 2L02A 1VNDA 4ENNA 1X58A 2FQ3A 2NS8A 2LVSA 3DLLF 4HNUA 2L3DA 5GAEJ 1Z67A 3D5LA 1WJAA 3A1YA 3J81Z 2X1DA 4XKBA 3E7LA 4BHCA 3M4OJ 4L9NA 3MN2A 2R7DA 3E5UA 3G3ZA 3LSMA 1LDJA 2DOFA 2V26A 2CW8A 2P6TA 1DQUA 3KP4A 3CDLA 1ITYA 1OFCX 2A07F 5K1YA 3U21A 2FE3A 2HOEA 3V7SA 4DBQA 3DKWA 3BR1A 3HHHA 1NK3P 3DPLC 3S3MA 2Y31A 4GFBA 1FT9A 3K2ZA 2K9LA 2OD5A 5E3NA 1RETA 2DA5A 1JT0A 1LPQA 4P9UA 3PO3J 2AXLA 2HVRA 4PSXA 5FGMA 4EATA 4M72A 1VQ6I 5ICGA 3QOEA 2WA0A 5HLIA 5JHFA 4CZCA 4BEHA 2CFOA 3CUQA 4Y3OA 2K02A 1D5YA 3EUAA 3HYIA 2VODA 3NARA 5AONA 4MFEA 1YYVA 2NYXA 2WV1A 3OYLA 1YFHA 1SFXA 1PDNC 3OV8A 4OWRB 3GTJJ 5TISC 4BHPA 3S32A 2VASA 3FBNB 1K4SA 3MD2A 3AG2H 1TC3C 1Z9CA 1JHHA 2LMDA 1KU9A 3OS0A 1W1WE 1MNMC 4AIJA 1I6HJ 3L2WA 3GFIA 4A0YA 3V7CA 2O6GE 4J19A 2DQRA 2R3SA 1A35A 4AIDA 5F1RA 4LIUA 4II3A 2YS9A 1BJZA 1BC8C 2M5WA 3RTRA 3WU1B 5F1JA 3EUHA 2G9WA 1XMAA 4ASNA 2OCEA 5LHHA 1WVRA 4UNOA 1TZLA 1Y6IA 4B3AA 1WCMJ 4QWQA 1XGSA 2LK2A 1G4DA 1FSEA 1N25A 3DPUA 3I3LA 1QPIA 5GAGJ 2ZJPF 1FIPA 1Z6RA 3CLQA 4LFUA 4AUXA 3QAHA 1ZRCA 3H1CA 2LY9A 2OF7A 2PLYA 1LFBA 2A5WA 2QM3A 3JCUC 5B3SH 1JTXA 2IPQX 1SAXA 2W00A 3DKYA 3HOZJ 2VPLA 2E19A 1RESA 1MBEA 2M4KA 4P96A 4D5FA 4RM2A 3CMAI 1J59A 1R23A 2KT0A 3QOPA 2K40A 2MBFA 3EQLF 3L09A 1T6SA 3AKZA 3RDIA 1FBSA 2IS6A 4UVCA 4RB3C 4BQOA 4DGWB 4OMZA 5FKNA 5J4YA 4BJ5C 3CMMA 2QA4I 4Z6YA 2BEOA 3SDBA 2VC1A 3H9JA 4RLFA 2QQAA 1IN5A 1L3LA 3BR5A 4IZZA 3KZIC 2E71A 5C4XJ 3JRFA 1OQYA 5IYDJ 4GYGA 4C3JJ 4YRVA 1OISA 4MFDA 4HNTA 1VTNC 4D7MA 4RB0A 1T33A 2OCCH 1PP7U 4CCKA 1MBFA 3B02A 3K70D 3OYHA 1K4TA 2VJJA 2EB7A 2VL8A 1N75A 1JT6A 2PX9A 3I59B 3LSHA 5JVGF 4MEXF 4G6DA 3CQZJ 3S1MJ 5CKTA 3F3XA 4K2EA 3M1EA 2M30A 2JVGA 3NRVA 2KZGA 3QQAA 4NC7A 4YFKF 2OJED 2VXDA 3PM1A 4XOPA 4BXUA 2W25A 3DV8A 1LJ9A 4FQGA 1O4XA 2CS3A 4UVAA 1SAUA 4A3DJ 1AOYA 1IXCA 4KIBA 4EGYA 3M8EA 5JR3A 4AVZA 2NVUB 2CQKA 3LAPA 2X48A 1X19A 4IXAA 3L00A 3FISA 2XROA 1WGXA 1X1PA 5JVTA 2EIJH 2ECBA 1FOKA 4PCQA 3MKWB 3S16J 2IAIA 2LDUA 1V5FA 2IJLA 1TP4A 5E3LA 5HVQC 1GXPA 5DD4A 1XGMA 3I56I 3BZCA 1OCRH 2XVCA 4IEJA 2DA4A 1WJFA 2Y2ZA 2YUSA 2EZLA 1PP8F 4CYDA 1H9GA 1CGPA 2H27A 3QYEA 1P6RA 4BE0A 2L9VA 1X1CA 4MQ9F 3SEZA 5D5WB 3GX4X 3QODA 1AKHB 3DEWA 3AL0B 1FTZA 2MLKA 2Y0SN 3KZYA 3MZYA 5EEAA 5ILVA 4XN0A 2CQNA 1RKWA 3E6BA 1I3QJ 1S72I 4U88A 4RLQA 3IAM2 3A0BC 4Q5SF 2AXTC 2HI3A 5B5EC 1UHSA 3JRBA 2I10A 3RCOA 5HOOA 3S1NJ 2CU7A 2M3AA 1UAAA 3MFKA 3CCQI 5M5WJ 2M9HA 2CQXA 2GLOA 4RBOA 3I0TA 3ZPLA 2HOSA 1GV2A 1HC8A 4DIQA 2VKDA 1TNSA 4BE1A 4NHJA 4AIHA 3JR9A 1X1BA 2GIVA 2BVLA 3ZRGA 4P5OA 2K27A 1M1EB 2DFIA 4KMFA 5LBQA 4Y17A 4NBQA 3D1NI 2QZ8A 1T08B 1KYZA 3RKYA
chains in the Genus database with same CATH topology
1K61A 5M3MJ 1H89C 1T56A 4XIDA 4DYCA 2LTPA 3FK6A 2CJJA 3HGGA 1JGGA 2EZHA 1WH7A 3SJMA 1MH4A 2XB0X 5M5YJ 1OJLA 4CYCB 3GTKJ 2HXOA 2JMWA 2NVXJ 4A3GJ 5HODA 4V2GA 4AYBN 1JKPC 2L7MP 2O8KA 4IHVA 2RAEA 1WI3A 2M34A 1NK2P 3HGYA 3JREA 3HOYJ 2L7ZA 4A3LJ 3W6VA 3JRDA 1YRNB 2W48A 4C3IJ 1H8AC 1TWHJ 3G1OA 1HDPA 3HBLA 3OIOA 1YRNA 3TP3A 1JUPA 2DMNA 3IH3A 2GM4A 3HDDA 3TP0A 2AO9A 3FK7A 3C2BA 1JKQC 2ELKA 1BL0A 2DA1A 2DA6A 3JRHA 1A5JA 2ZB9A 1ENHA 2K9SA 2E2IJ 2IBDA 1MBJA 1CQTA 5E3MA 1BW5A 3BG3A 4NDLA 1MH3A 1XC5A 2DMUA 5EZGA 2FX0A 1BA5A 5C4JJ 3RZDJ 5E3OA 3IH2A 3CMYA 1OCTC 3GTLJ 2XGEA 4DZPA 2VUMJ 3GTQJ 9ANTA 5DTDA 2DMQA 5F08A 3B6AA 5IP7J 3BQYA 5GPAA 1HDDC 4DZJA 2E1OA 2M0CA 4UUSB 3BR3A 5DS9A 2DA7A 5FJ8J 3LSJA 1FJLA 1HOMA 2L7FP 5EDNA 1ETXA 1VF9A 4XRMA 2AHQA 2XPUA 4A3EJ 3SFIA 2K9QA 5J3LA 4MLOA 1R9TJ 4A3BJ 5EZHA 4QSHA 3BQZA 4UUSA 4I76A 1Q1VA 3O8GA 1QRYA 5GP9A 5EGOA 1JTYA 2LLKA 1G2HA 2QF7A 2XRLA 1WPKA 5EGOB 1IJWC 3Q0WA 1H88C 1IGNA 1FIAA 5IYBJ 2Y9YA 3H0GJ 3RQIA 3F0CA 1B8IA 3S1QJ 4D5CA 4W97A 4HNVA 1Y1WJ 3G1LA 2XSDC 2XGDA 1UG2A 3IV5A 4JX4A 4L5EA 4A3KJ 2VPRA 2CQQA 5C44J 3S2DJ 4XK4A 4D7NA 1IDZA 1LE8B 2EBIA 2HOAA 3FIWA 3ZQCA 1ETOA 1UMQA 3HM5A 5K7ZA 2YU9J 3IH4A 4JX6A 1IUFA 3SDGA 3LSRA 5K7FA 3QPLA 3OSGA 1X2NA 4M3FA 1WH5A 1ETYA 1IDYA 4X6AJ 1SFOJ 4M3BA 1ETQA 2D5VA 3ZQLA 4RDUA 1B72B 3S2HJ 3UKGA 2G0EA 4FE4A 3S17J 3B6CA 1MBGA 3A02A 5FKKA 1ORKA 2HDDA 5IOZA 2LKXA 1FEXA 1OCPA 1HLVA 4JP0A 5IPAA 3MVPA 1K83J 2COBA 4B4CA 1JKOC 1F36A 4DYRA 2R93J 1Y1VJ 3MKLA 4QIWN 1GV5A 1GUUA 1IC8A 3O8HA 2LD5A 4A93J 1TWGJ 4MO7A 5FLVA 4M6VA 1GVDA 5J1UA 1BW6A 2EH3A 3CCYA 2ME0A 4A69C 2OPTA 5FLMJ 3BT9A 3TEDA 1ZR2A 3HOWJ 2M8GX 5IYCJ 2JN6A 3RZOJ 4G12A 1P7IA 1FTTA 2L9RA 3RKQA 2CUEA 1Z77A 2HQ5A 2CRGA 1ZTRA 4V2FA 3BTCA 1F43A 5F0CA 5JLXA 4XRSA 1VNDA 1X58A 2DMTA 1PUFA 2NS8A 3LNQA 3WHBA 3A01B 2LVSA 5BNGA 3HEFA 3A01A 2NVQJ 1MSFC 4XRSG 2R5YA 3E7LA 1S7EA 4IHWA 3M4OJ 3WHCA 3MN2A 1ETKA 1NTCA 4IHXA 2JK3A 2DMPA 2EZIA 3CDLA 1ITYA 2DTZA 3PO2J 1OFCX 1ZKGA 2NS7A 1W0TA 3VPRA 4A3JJ 1VI0A 1DU6A 3H3VK 5M5XJ 2R5YB 2O9LA 3JRAA 3BR1A 2WAQN 1NK3P 1POGA 2Y31A 4GFBA 3TW7A 1U8BA 5E3NA 1RETA 5IP9J 2DA5A 1JT0A 3PO3J 4FTHA 1JUSA 5K7HA 2MGQA 4A3IJ 5FKLA 3BTJA 5J1YA 2K9NA 2Y30A 3Q3SA 4UUTA 3OOUA 1D5YA 5EYRA 3NARA 4M3GA 4MFEA 2WV1A 4Y52J 2FJ1A 3GTJJ 2E2HJ 3JRIA 3BG5A 3HOXJ 1JJ8C 4S0HB 1TC3C 1TWCJ 3I4MJ 1Z0XA 1MNMC 4C2MJ 4BBRJ 1I6HJ 4FISA 4IHYA 3BR6A 4J19A 2IEKA 2MSYA 1IV6A 1ZK8A 3LSPA 2YS9A 3HOUJ 2ID6A 1BJZA 3GTGJ 1B72A 4A3MJ 5F1JA 5GPCA 5JLWA 2DJNA 5F0FA 3ZQHA 4B3AA 3LOCA 3S1RJ 1WCMJ 2ME6A 2LFBA 3JRCA 2LK2A 2NOGA 3S15J 2MG4A 4JX5A 1QPIA 1FIPA 3M3YJ 4AUXA 3GBGA 2KDZA 1VFCA 1W0UA 3S1NJ 2VKVA 3K7AJ 2NVTJ 2FD5A 4Y7NJ 2LY9A 3HOVJ 2HOTA 2OF7A 3G1MA 1DU0A 1LFBA 2NVYJ 2R92J 1JTXA 3HOZJ 1RPWA 1EF4A 2E19A 1RESA 3DCFA 5M3FJ 1MBEA 4FE7A 4D5FA 3QPSA 1JKRC 2TRTA 3LSGA 4XICA 1XS9A 1IG7A 3GTPJ 2JA5J 2JJ7A 2KT0A 4B1RA 2K40A 2PMZN 4BY1J 4BKXA 5FKNA 2R5ZB 3GTOJ 1LE8A 3BG9A 3NAUA 2P81A 2R5ZA 1P7JA 3FKIJ 1AKHA 1MBKA 4X1EA 3BTLA 3BR5A 1AU7A 2XPVA 2H8RA 5C4XJ 3JRFA 2M2EA 2X6OA 2HYJA 5IYDJ 4C3JJ 4MFDA 3ZQFA 2Y9ZA 3Q0UA 4D7MA 5F0HA 1T33A 1U78A 1MBFA 4AC0A 1X2MA 3L1PA 4DW6A 1JT6A 3S1MJ 1HCRA 2R0QC 3CQZJ 2ID3A 3OSFA 4QTRA 4BXXJ 2L0KA 3ZQIA 5EF6A 4DYQA 3QQAA 3HKZN 3PM1A 1JUMA 1O4XA 4A3DJ 5J1RA 1PUFB 1JJ6C 3TW6A 4W1UA 4A3CJ 5EG0B 5F27A 2X48A 2JWTA 2VKEA 3FISA 5EG0A 1MBHA 1WGXA 2XPWA 3A03A 5C3EJ 2ECBA 2XGCA 1ZGWA 3S16J 2IAIA 3I4NJ 5E3LA 2E2JJ 1QVUA 1U9OA 2LP0A 2HXIA 2TCTA 4I6ZA 1ETVA 4M3DA 1GDTA 2ECCA 4IEJA 2DA4A 2Y2ZA 2YUSA 2B63J 2EZLA 2GBYA 2QCOA 4MIMA 1U9NA 3BTIA 1IRZA 1RKTA 2LR8A 4ABZA 4CYCA 1AKHB 2DA2A 1FTZA 3DEWA 4M3EA 5IP6A 2Y0SN 3GTMJ 5EEAA 1B8IB 3Q0VA 3HB9A 1RKWA 2CUFA 1I3QJ 2JA7J 1QVTA 3S14J 1TWAJ 2DA3A 2N8GA 1A6IA 1E3OC 4C3HJ 3JRGA 2HI3A 1I50J 1APLC 1UHSA 2JA6J 3JRBA 2I10A 2JA8J 4A3FJ 4FCYA 1XG1A 2CU7A 1TWFJ 2O7OA 2WB1N 3K2AA 3BR0A 3BR2A 4EEFG 2XB5A 2H1KA 2EZKA 5M5WJ 1ZQ3P 2M9HA 4LOCA 2CQXA 4BY7J 3ZOBA 2VI6A 4RBOA 2GLOA 1MSEC 5IOYA 2HOSA 1GV2A 4JYKA 1ZR4A 1GT0C 1AHDP 5FKMA 1HF0A 2X9DA 4BBSJ 2R7ZJ 3JR9A 5F04A 1LFUP 1ETWA 2FQ4A 2EQRA 3ZQGA 3D1NI 2MW8A 1SANA 1RR7A 2DN0A 5FKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K61 A;  5M3M J;  1H89 C;  1T56 A;  4XID A;  4DYC A;  2LTP A;  3FK6 A;  2CJJ A;  3HGG A;  1JGG A;  2EZH A;  1WH7 A;  3SJM A;  1MH4 A;  2XB0 X;  5M5Y J;  1OJL A;  4CYC B;  3GTK J;  2HXO A;  2JMW A;  2NVX J;  4A3G J;  5HOD A;  4V2G A;  4AYB N;  1JKP C;  2L7M P;  2O8K A;  4IHV A;  2RAE A;  1WI3 A;  2M34 A;  1NK2 P;  3HGY A;  3JRE A;  3HOY J;  2L7Z A;  4A3L J;  3W6V A;  3JRD A;  1YRN B;  2W48 A;  4C3I J;  1H8A C;  1TWH J;  3G1O A;  1HDP A;  3HBL A;  3OIO A;  1YRN A;  3TP3 A;  1JUP A;  2DMN A;  3IH3 A;  2GM4 A;  3HDD A;  3TP0 A;  2AO9 A;  3FK7 A;  3C2B A;  1JKQ C;  2ELK A;  1BL0 A;  2DA1 A;  2DA6 A;  3JRH A;  1A5J A;  2ZB9 A;  1ENH A;  2K9S A;  2E2I J;  2IBD A;  1MBJ A;  1CQT A;  5E3M A;  1BW5 A;  3BG3 A;  4NDL A;  1MH3 A;  1XC5 A;  2DMU A;  5EZG A;  2FX0 A;  1BA5 A;  5C4J J;  3RZD J;  5E3O A;  3IH2 A;  3CMY A;  1OCT C;  3GTL J;  2XGE A;  4DZP A;  2VUM J;  3GTQ J;  9ANT A;  5DTD A;  2DMQ A;  5F08 A;  3B6A A;  5IP7 J;  3BQY A;  5GPA A;  1HDD C;  4DZJ A;  2E1O A;  2M0C A;  4UUS B;  3BR3 A;  5DS9 A;  2DA7 A;  5FJ8 J;  3LSJ A;  1FJL A;  1HOM A;  2L7F P;  5EDN A;  1ETX A;  1VF9 A;  4XRM A;  2AHQ A;  2XPU A;  4A3E J;  3SFI A;  2K9Q A;  5J3L A;  4MLO A;  1R9T J;  4A3B J;  5EZH A;  4QSH A;  3BQZ A;  4UUS A;  4I76 A;  1Q1V A;  3O8G A;  1QRY A;  5GP9 A;  5EGO A;  1JTY A;  2LLK A;  1G2H A;  2QF7 A;  2XRL A;  1WPK A;  5EGO B;  1IJW C;  3Q0W A;  1H88 C;  1IGN A;  1FIA A;  5IYB J;  2Y9Y A;  3H0G J;  3RQI A;  3F0C A;  1B8I A;  3S1Q J;  4D5C A;  4W97 A;  4HNV A;  1Y1W J;  3G1L A;  2XSD C;  2XGD A;  1UG2 A;  3IV5 A;  4JX4 A;  4L5E A;  4A3K J;  2VPR A;  2CQQ A;  5C44 J;  3S2D J;  4XK4 A;  4D7N A;  1IDZ A;  1LE8 B;  2EBI A;  2HOA A;  3FIW A;  3ZQC A;  1ETO A;  1UMQ A;  3HM5 A;  5K7Z A;  2YU9 J;  3IH4 A;  4JX6 A;  1IUF A;  3SDG A;  3LSR A;  5K7F A;  3QPL A;  3OSG A;  1X2N A;  4M3F A;  1WH5 A;  1ETY A;  1IDY A;  4X6A J;  1SFO J;  4M3B A;  1ETQ A;  2D5V A;  3ZQL A;  4RDU A;  1B72 B;  3S2H J;  3UKG A;  2G0E A;  4FE4 A;  3S17 J;  3B6C A;  1MBG A;  3A02 A;  5FKK A;  1ORK A;  2HDD A;  5IOZ A;  2LKX A;  1FEX A;  1OCP A;  1HLV A;  4JP0 A;  5IPA A;  3MVP A;  1K83 J;  2COB A;  4B4C A;  1JKO C;  1F36 A;  4DYR A;  2R93 J;  1Y1V J;  3MKL A;  4QIW N;  1GV5 A;  1GUU A;  1IC8 A;  3O8H A;  2LD5 A;  4A93 J;  1TWG J;  4MO7 A;  5FLV A;  4M6V A;  1GVD A;  5J1U A;  1BW6 A;  2EH3 A;  3CCY A;  2ME0 A;  4A69 C;  2OPT A;  5FLM J;  3BT9 A;  3TED A;  1ZR2 A;  3HOW J;  2M8G X;  5IYC J;  2JN6 A;  3RZO J;  4G12 A;  1P7I A;  1FTT A;  2L9R A;  3RKQ A;  2CUE A;  1Z77 A;  2HQ5 A;  2CRG A;  1ZTR A;  4V2F A;  3BTC A;  1F43 A;  5F0C A;  5JLX A;  4XRS A;  1VND A;  1X58 A;  2DMT A;  1PUF A;  2NS8 A;  3LNQ A;  3WHB A;  3A01 B;  2LVS A;  5BNG A;  3HEF A;  3A01 A;  2NVQ J;  1MSF C;  4XRS G;  2R5Y A;  3E7L A;  1S7E A;  4IHW A;  3M4O J;  3WHC A;  3MN2 A;  1ETK A;  1NTC A;  4IHX A;  2JK3 A;  2DMP A;  2EZI A;  3CDL A;  1ITY A;  2DTZ A;  3PO2 J;  1OFC X;  1ZKG A;  2NS7 A;  1W0T A;  3VPR A;  4A3J J;  1VI0 A;  1DU6 A;  3H3V K;  5M5X J;  2R5Y B;  2O9L A;  3JRA A;  3BR1 A;  2WAQ N;  1NK3 P;  1POG A;  2Y31 A;  4GFB A;  3TW7 A;  1U8B A;  5E3N A;  1RET A;  5IP9 J;  2DA5 A;  1JT0 A;  3PO3 J;  4FTH A;  1JUS A;  5K7H A;  2MGQ A;  4A3I J;  5FKL A;  3BTJ A;  5J1Y A;  2K9N A;  2Y30 A;  3Q3S A;  4UUT A;  3OOU A;  1D5Y A;  5EYR A;  3NAR A;  4M3G A;  4MFE A;  2WV1 A;  4Y52 J;  2FJ1 A;  3GTJ J;  2E2H J;  3JRI A;  3BG5 A;  3HOX J;  1JJ8 C;  4S0H B;  1TC3 C;  1TWC J;  3I4M J;  1Z0X A;  1MNM C;  4C2M J;  4BBR J;  1I6H J;  4FIS A;  4IHY A;  3BR6 A;  4J19 A;  2IEK A;  2MSY A;  1IV6 A;  1ZK8 A;  3LSP A;  2YS9 A;  3HOU J;  2ID6 A;  1BJZ A;  3GTG J;  1B72 A;  4A3M J;  5F1J A;  5GPC A;  5JLW A;  2DJN A;  5F0F A;  3ZQH A;  4B3A A;  3LOC A;  3S1R J;  1WCM J;  2ME6 A;  2LFB A;  3JRC A;  2LK2 A;  2NOG A;  3S15 J;  2MG4 A;  4JX5 A;  1QPI A;  1FIP A;  3M3Y J;  4AUX A;  3GBG A;  2KDZ A;  1VFC A;  1W0U A;  3S1N J;  2VKV A;  3K7A J;  2NVT J;  2FD5 A;  4Y7N J;  2LY9 A;  3HOV J;  2HOT A;  2OF7 A;  3G1M A;  1DU0 A;  1LFB A;  2NVY J;  2R92 J;  1JTX A;  3HOZ J;  1RPW A;  1EF4 A;  2E19 A;  1RES A;  3DCF A;  5M3F J;  1MBE A;  4FE7 A;  4D5F A;  3QPS A;  1JKR C;  2TRT A;  3LSG A;  4XIC A;  1XS9 A;  1IG7 A;  3GTP J;  2JA5 J;  2JJ7 A;  2KT0 A;  4B1R A;  2K40 A;  2PMZ N;  4BY1 J;  4BKX A;  5FKN A;  2R5Z B;  3GTO J;  1LE8 A;  3BG9 A;  3NAU A;  2P81 A;  2R5Z A;  1P7J A;  3FKI J;  1AKH A;  1MBK A;  4X1E A;  3BTL A;  3BR5 A;  1AU7 A;  2XPV A;  2H8R A;  5C4X J;  3JRF A;  2M2E A;  2X6O A;  2HYJ A;  5IYD J;  4C3J J;  4MFD A;  3ZQF A;  2Y9Z A;  3Q0U A;  4D7M A;  5F0H A;  1T33 A;  1U78 A;  1MBF A;  4AC0 A;  1X2M A;  3L1P A;  4DW6 A;  1JT6 A;  3S1M J;  1HCR A;  2R0Q C;  3CQZ J;  2ID3 A;  3OSF A;  4QTR A;  4BXX J;  2L0K A;  3ZQI A;  5EF6 A;  4DYQ A;  3QQA A;  3HKZ N;  3PM1 A;  1JUM A;  1O4X A;  4A3D J;  5J1R A;  1PUF B;  1JJ6 C;  3TW6 A;  4W1U A;  4A3C J;  5EG0 B;  5F27 A;  2X48 A;  2JWT A;  2VKE A;  3FIS A;  5EG0 A;  1MBH A;  1WGX A;  2XPW A;  3A03 A;  5C3E J;  2ECB A;  2XGC A;  1ZGW A;  3S16 J;  2IAI A;  3I4N J;  5E3L A;  2E2J J;  1QVU A;  1U9O A;  2LP0 A;  2HXI A;  2TCT A;  4I6Z A;  1ETV A;  4M3D A;  1GDT A;  2ECC A;  4IEJ A;  2DA4 A;  2Y2Z A;  2YUS A;  2B63 J;  2EZL A;  2GBY A;  2QCO A;  4MIM A;  1U9N A;  3BTI A;  1IRZ A;  1RKT A;  2LR8 A;  4ABZ A;  4CYC A;  1AKH B;  2DA2 A;  1FTZ A;  3DEW A;  4M3E A;  5IP6 A;  2Y0S N;  3GTM J;  5EEA A;  1B8I B;  3Q0V A;  3HB9 A;  1RKW A;  2CUF A;  1I3Q J;  2JA7 J;  1QVT A;  3S14 J;  1TWA J;  2DA3 A;  2N8G A;  1A6I A;  1E3O C;  4C3H J;  3JRG A;  2HI3 A;  1I50 J;  1APL C;  1UHS A;  2JA6 J;  3JRB A;  2I10 A;  2JA8 J;  4A3F J;  4FCY A;  1XG1 A;  2CU7 A;  1TWF J;  2O7O A;  2WB1 N;  3K2A A;  3BR0 A;  3BR2 A;  4EEF G;  2XB5 A;  2H1K A;  2EZK A;  5M5W J;  1ZQ3 P;  2M9H A;  4LOC A;  2CQX A;  4BY7 J;  3ZOB A;  2VI6 A;  4RBO A;  2GLO A;  1MSE C;  5IOY A;  2HOS A;  1GV2 A;  4JYK A;  1ZR4 A;  1GT0 C;  1AHD P;  5FKM A;  1HF0 A;  2X9D A;  4BBS J;  2R7Z J;  3JR9 A;  5F04 A;  1LFU P;  1ETW A;  2FQ4 A;  2EQR A;  3ZQG A;  3D1N I;  2MW8 A;  1SAN A;  1RR7 A;  2DN0 A;  5FKO A; 
#chains in the Genus database with same CATH topology
 4YEJ A;  4BNC A;  3GFL A;  1T56 A;  2IS1 A;  3AG1 H;  1V54 H;  1XMX A;  2ZXI A;  1DDN A;  4B43 A;  5B1B H;  2LTP A;  2I8D A;  3FK6 A;  2CJJ A;  3KPH A;  2DFF A;  1JGG A;  3SEQ A;  1FBQ A;  1IZ1 A;  3ROU A;  2ELH A;  2EZH A;  1D5V A;  1I1S A;  2XB0 X;  3AL0 C;  1OJL A;  2HXO A;  4L9J A;  4PJL A;  4ZH4 F;  5HOD A;  3VFZ A;  1JGS A;  4NC6 A;  5L3C A;  1JKP C;  2O8K A;  2RAE A;  3DTE A;  2JZY A;  2M34 A;  5HS7 A;  1QPM A;  2ESN A;  1EH7 A;  3JRD A;  4ETS A;  1Y0N A;  1H8A C;  1TWH J;  4FET A;  1HDP A;  1T2K A;  3FXQ A;  1BM9 A;  2M0M A;  1G3Y A;  3HDD A;  3TP0 A;  3V8K A;  2AO9 A;  1IF1 A;  5E8I A;  2HPI A;  3FK7 A;  3L9F A;  3MZ8 A;  1YLF A;  1BL0 A;  1R1U A;  2DA1 A;  4WX9 A;  1T0F A;  2L01 A;  3QP5 A;  1S7O A;  5DUK A;  2LH9 A;  1F4K A;  1G6N A;  3HSE A;  4Q4Z F;  2GAU A;  4RMN A;  2IBD A;  4YII A;  3IRR A;  1P9Q C;  4LK1 F;  1MMD A;  3ZMV A;  5LGT A;  1MMG A;  4N9I A;  5E3M A;  1VQ9 I;  2R7X A;  5E8G A;  4D9J A;  4KN7 X;  3BG3 A;  1BJA A;  4AM3 A;  1ON2 A;  2DYR H;  4PJN A;  2GA2 A;  3CC2 I;  4AWX B;  5DCF A;  3TDZ C;  2DPU A;  5C4J J;  1HXD A;  1AA7 A;  1XSD A;  3OYE A;  2OTL I;  1USS A;  2VC0 A;  4R1H A;  2OZ6 A;  1OCT C;  2XGE A;  1FWZ A;  4DZP A;  5GTI C;  2VUM J;  1MND A;  4IQJ A;  3K4C A;  1A36 A;  1Z1D A;  2DMQ A;  4RAG A;  2OV7 A;  2ZO4 A;  5F08 A;  1KYW A;  1YIJ I;  2CV0 A;  2R7S A;  2X1C A;  1JXS A;  1HDD C;  4UUS B;  3T5X A;  2JTV A;  3DWL E;  4G7H F;  4XLC A;  3L2V A;  3ZP5 A;  3BP8 A;  3QYB A;  1QZY A;  1YJ9 I;  1ZGJ A;  4IQ4 A;  4A3E J;  3FXU A;  3SFI A;  1R71 A;  4Q47 A;  4LB6 B;  5H2F C;  4U7B A;  2H8W A;  3HPG A;  3C7J A;  1HW1 A;  1R49 A;  2QBY A;  3FMQ A;  1LVA A;  3O8G A;  3J7Y J;  2ZXJ A;  4ON0 A;  2LBF A;  5E79 C;  3G6E I;  3QP6 A;  1D0X A;  1HKT A;  2UUZ A;  1JE8 A;  2KRH A;  2XRL A;  5IY5 H;  2XAG A;  3TQN A;  4H4K C;  3Q0W A;  3S93 A;  2VIX A;  1QHH D;  3F8M A;  3OWT A;  4IKF A;  1Y1W J;  1GLN A;  1IN4 A;  4L5E A;  4A3K J;  4A12 A;  3S2D J;  3TL4 X;  1MKM A;  4XK4 A;  1IDZ A;  3FIW A;  2HKO A;  1L0O C;  3VOE A;  2KIM A;  4BHB A;  1UMQ A;  2ZJ2 A;  4CSW A;  2CV1 A;  4IRI A;  4ZDL A;  3ZQ7 A;  1YJW I;  1G3W A;  2V4J C;  1J9I A;  4CUG A;  5GAH J;  2WY8 Q;  3PUF A;  4N4O B;  1SD4 A;  2CWE A;  1D0Y A;  1PUE E;  4BQQ A;  2E5Z A;  1K7A A;  3LSI A;  4KT5 C;  4M3B A;  2D5V A;  2H1L A;  5FFX A;  5LGU A;  3S2H J;  1I3A A;  4ESF A;  3UKG A;  2STT A;  2E5N A;  1D3Y A;  1IXS B;  3O6B B;  4ZTF A;  3PQK A;  5FKK A;  1ORK A;  2HDD A;  1S7A A;  2EA2 A;  3D0S A;  1HQC A;  1HLV A;  4JP0 A;  5IPA A;  3HG9 A;  3WTU C;  1F36 A;  3OMY A;  1WJ5 A;  2LNB A;  3I53 A;  3VWB A;  1NHA A;  3LQQ A;  1YX3 A;  1EKE A;  1UZC A;  1QQI A;  2EWN A;  2FNA A;  4MO7 A;  3HJE A;  3OYN A;  2ADU A;  1WFX A;  2VKH A;  4PJ0 C;  4ZYA A;  4E70 A;  5FLV A;  2QQB A;  2Z1D A;  2FBI A;  4E4H A;  3M8J A;  2EH3 A;  3C2G A;  3W6K B;  1W7P B;  2JPC A;  1BI2 A;  3K4L A;  4QPQ A;  3B73 A;  4Y13 A;  4IO9 F;  5FO5 A;  5FLM J;  1XSV A;  1FOW A;  2LG4 A;  1OYW A;  3BT9 A;  5D8K B;  3DBR B;  3LA7 A;  4EJV A;  1S3J A;  1MDM B;  3HOW J;  1P4A A;  3BPX A;  1D8J A;  4IRG A;  3G73 A;  1R5G A;  2C6Y A;  2LY1 A;  5FRM A;  1H9T A;  2L9R A;  3TGN A;  3RKQ A;  2GXG A;  2ZC2 A;  4XL9 A;  2F4I A;  1F43 A;  5F0C A;  5JLX A;  4XRS A;  4HV5 A;  3L2Q A;  2KQR A;  2OQG A;  1BR1 A;  2OQR A;  1I39 A;  1IAW A;  2HEO A;  3WHB A;  3A01 B;  4E7H A;  3MMY B;  1MJB A;  3A01 A;  5BOX A;  2IRF G;  2NVQ J;  2Z2S B;  1WQ2 A;  3I71 A;  4XRS G;  5JI6 A;  2MC3 A;  5B1A H;  1KU7 A;  1R22 A;  3WHC A;  2HVS A;  3MKZ A;  2EIL H;  3BG7 A;  3ZN0 A;  1HBX G;  2JK3 A;  4FX4 A;  4B09 A;  1BR4 A;  2DMP A;  3ECO A;  2DTZ A;  4CCL A;  3CDI A;  2NS7 A;  4A3J J;  2HKX A;  1MMS A;  1Y56 A;  3H3V K;  3E5X A;  2HYF A;  2O9L A;  2VE9 A;  1SVL A;  5LRS A;  3O3K A;  4M71 A;  3IWF A;  3EET A;  1ONV A;  3DTK A;  4OIQ F;  1OCZ H;  2QEN A;  3PIO F;  1U8B A;  4RB2 C;  5IP9 J;  3L2U A;  3Q9S A;  2QYO A;  4FAS D;  5K7H A;  4EQQ A;  2MGQ A;  1IRF A;  4A3I J;  1YI2 I;  3CJR B;  2LY2 A;  1TT0 A;  4XSZ F;  4UUT A;  3DFG A;  3ZMD A;  3WE3 A;  2FRH A;  3OY9 A;  3OOU A;  3CUQ C;  4M3G A;  3GWZ A;  3IAS 2;  2MH9 A;  4Y52 J;  3EPZ A;  2E2H J;  3JRI A;  4MTE A;  5E20 A;  3HXL A;  2XAQ A;  1U8R A;  2A6H F;  1TWC J;  4BYY A;  3K4N A;  1JHF A;  1FZP B;  2OU2 A;  4CDG A;  1Z0X A;  4N9H A;  3EYI A;  3CZ6 A;  4XON A;  1IN8 A;  2KP6 A;  3J81 K;  2V1N A;  3BR6 A;  1HW2 A;  1MD0 A;  1ON1 A;  1R4N B;  3IHU A;  5L3F A;  4HF2 A;  2Z9O A;  1W5S A;  5D5V B;  1C0W A;  4ZJZ A;  3P5J A;  2W1O A;  2E1M C;  1UST A;  3D5R C;  3J80 Z;  5JHU A;  3LA2 A;  2IS4 A;  1MW7 A;  1ERD A;  1YS6 A;  5DD8 A;  1IV8 A;  2Z99 A;  4KIS A;  2RQQ A;  5F0F A;  4PFO A;  2STW A;  4IF4 A;  3KYD B;  2NOG A;  3S15 J;  5FLX Z;  2VQC A;  1VQ7 I;  1ZHF A;  2A3S A;  2WAE A;  4UXN A;  3V7R A;  2NRA C;  5D4S A;  2VKV A;  3K7A J;  1LQ1 A;  3CJT B;  2OA4 A;  3OS2 A;  1CF7 A;  2FD5 A;  3IKT A;  3HOV J;  1IRX A;  5LHI A;  2F4O B;  5BS6 A;  3CO7 C;  1U0J A;  3LQR A;  5CVV A;  3WG9 A;  2DDA A;  2RRE A;  1YIT I;  2XC7 A;  5M3F J;  4FE7 A;  4EJW A;  2TRT A;  3NWT A;  3H5R A;  1IG7 A;  5K5R A;  2PMZ N;  3REO A;  3DTI A;  3WE2 A;  3CCS I;  2XF5 A;  4JQF A;  4BKX A;  5DCM B;  4KT6 A;  2R5Z B;  1RZ4 A;  1TL8 A;  2R5Z A;  2P81 A;  3KLN A;  2G7H A;  3FKI J;  1MBK A;  4X1E A;  3BTL A;  4J00 A;  4XKV A;  2FOK A;  4RA2 A;  2XPV A;  1FP1 D;  2HQR A;  5F64 A;  1OYY A;  2M2E A;  2ZCW A;  4DJA A;  2HYJ A;  3CC7 I;  2V7F A;  2F48 A;  2Y9Z A;  1U78 A;  4LIT A;  1QZE A;  1QNT A;  3ZMZ A;  4AC0 A;  5DEQ A;  3N97 A;  1E0E A;  1X2M A;  3L1P A;  4DW6 A;  1J75 A;  3S3O A;  3BZK A;  4GYI A;  3OSF A;  1XMK A;  4BDY A;  2L0K A;  5EF6 A;  1MMA A;  4IRH A;  2NNN A;  3IRQ A;  1LEB A;  1PUF B;  4AU7 A;  5L3D A;  2KL4 A;  2WY7 Q;  5L3E A;  4A3C J;  3EUH C;  4EM0 B;  3A03 A;  3JSP A;  5C3E J;  3L2R A;  1EA3 A;  2XGC A;  1DGR M;  1OYI A;  2E2J J;  2DT7 B;  4PGG A;  2K86 A;  2HXI A;  3CJN A;  3GYH X;  4I6Z A;  4HST A;  4ESB A;  1XN7 A;  3ISP A;  2JPB A;  1E3H A;  3MWM A;  2MH2 A;  3FMR A;  3GZ5 A;  3KP2 A;  2QCO A;  2DYS H;  1FYL A;  3S8P A;  2B7E A;  3BJO A;  5KAF C;  5GAD J;  1ZG1 A;  2EV5 A;  2ZSI B;  4B48 A;  4M3E A;  1SD5 A;  2JUG A;  2KIF A;  4B47 A;  3SXY A;  3R0A A;  3UNG C;  3HB9 A;  5H6Q A;  2WV0 A;  2CUJ A;  2EJR A;  2CUF A;  3OYB A;  2JA7 J;  1QVT A;  4RAY A;  1X3U A;  1RC9 A;  2PJR A;  2DA3 A;  2N8G A;  1R36 A;  1A6I A;  4S04 A;  4IJA A;  4C3H J;  2A6T A;  2DK8 A;  3ZR8 X;  1I50 J;  2JA6 J;  4BE2 A;  2K3F A;  3GFJ A;  3H9G A;  3QPH A;  3ZXS A;  4FCY A;  4EEF G;  3Q5F A;  2ZXH A;  3BR0 A;  4PFP A;  3L2C A;  3ELK A;  1ZQ3 P;  2VI6 A;  2X0L A;  4G7Z F;  3O2P E;  1PJR A;  2UZK A;  1MSE C;  2P4W A;  1KQ8 A;  3MQ0 A;  1Y0U A;  4JYK A;  1TT5 B;  4RAF A;  1GT0 C;  1ZAR A;  1FC3 A;  2RQP A;  1ZRD A;  1ZH5 A;  1FOX A;  2R7Z J;  5EJC A;  5FFZ A;  5F04 A;  1LFU P;  4XBF A;  3CCR I;  1ETW A;  1HW5 A;  4KN4 X;  4F55 A;  4M6X A;  2MW8 A;  2ICW G;  4UB6 C;  5KVR A;  5F6F A;  2OTJ I;  1T38 A;  2DN0 A;  5FKO A;  2UWM A;  1UFM A;  3FXO A;  4XID A;  1IRG A;  3HL2 A;  4HDU A;  4WXC A;  3K70 C;  1YG2 A;  4XLE A;  4L5J A;  3T8T A;  2XDV A;  1MH4 A;  2DT5 A;  4CYC B;  3WTX C;  1O3Q A;  2O03 A;  1NH3 A;  2JMW A;  4CCM A;  3CD6 I;  4A3G J;  3V8L A;  4V2G A;  1WWX A;  3DKX A;  4DNC A;  4NNJ A;  2EFQ A;  2ZNZ A;  3JRE A;  5CQE A;  2HZD A;  2CQ7 A;  4BDZ A;  2D45 A;  2W48 A;  3K10 A;  4X0G A;  2FXA A;  2K3P A;  3G2B A;  3G1O A;  3OIO A;  5HNF A;  4KNY A;  3KP3 A;  2DMN A;  2GOX B;  4WWC A;  1BIA A;  3COA C;  2GM4 A;  2E7W A;  1PYV A;  2QSH X;  2QKL B;  2NAZ A;  1U3E M;  3Q9V A;  3G71 I;  1X3Z B;  1Y8Q B;  4O6J A;  5TGT A;  4R8H A;  3VYR B;  4GDF A;  1A5J A;  3GLL A;  5KHD A;  4NB5 A;  1ENH A;  3K1N A;  1MNE A;  4M6Y A;  4LG0 A;  3E0J B;  4OOI A;  1DPR A;  1BN5 A;  3RQ4 A;  4NDL A;  1VQP I;  3ABT A;  5EZG A;  2R7O A;  1I1G A;  3E6D A;  5TJJ A;  4JOM A;  2YPR A;  4A6D A;  5E3O A;  1V3F A;  3P9I A;  1RUO A;  3CCE I;  3J7A O;  2QSF X;  4QPO A;  1ZRE A;  2JRT A;  3OIQ A;  3LST A;  5A2Q Z;  4I2O A;  3BQY A;  4CIC A;  4M74 A;  1F5T A;  4BQN A;  2W84 A;  3JAM K;  3ZMU A;  5DS9 A;  2DA7 A;  1Z6T A;  3BCB A;  5BPI A;  2MLG A;  3VSL A;  2AQF A;  3OYI A;  1ETX A;  2ZME C;  3GME A;  2IA1 A;  4NQW B;  2H6C A;  1XD7 A;  4U87 A;  2RC4 A;  4HLX A;  2R7U A;  4L9T A;  5CVI A;  2K9Q A;  5J3L A;  1R9T J;  1U6G A;  3WTZ A;  2OUM A;  4O3M A;  5EZH A;  2Z5U A;  4I76 A;  1Q1V A;  3SFZ A;  3FHN A;  3WG7 H;  5LEK A;  3OR2 C;  3NEU A;  5GP9 A;  3FMS A;  1DP7 P;  4OIP F;  4E7S A;  3DF8 A;  2HNH A;  2KIU A;  4EGZ A;  1G2H A;  3HOT A;  5EGO B;  2DFH A;  2VT2 A;  3TBI A;  4I09 A;  1IGN A;  1FIA A;  3I9V 2;  2BY1 A;  1Z7L A;  5E1W A;  2V1X A;  1Z05 A;  2JUC A;  4FHT A;  4XLN F;  1YO5 C;  3H0G J;  3RQI A;  3S1Q J;  1OR7 C;  4D5C A;  3P9C A;  4W97 A;  2XGD A;  5CJ9 A;  4KMU X;  2XIG A;  2HGC A;  4JX4 A;  3QWL A;  2IGM A;  5C44 J;  2D2W A;  4MTD A;  2DK5 A;  4D7N A;  1LE8 B;  1OCC H;  4YFN F;  5D4R A;  5K7Z A;  2FA5 A;  2EIM H;  2UXN A;  3PSI A;  4JX6 A;  3CP8 A;  3F22 A;  4UHT A;  5K7F A;  2M1B A;  4A2U A;  1ODD A;  2A69 F;  1IDY A;  2PEX A;  1FP2 A;  3I58 A;  3BLY A;  3VEP A;  4XOT A;  3ZGK A;  2Q2E B;  3OYC A;  2O0Y A;  4P1W A;  4B8X A;  2D1V A;  5HDN A;  1WZ2 A;  3ZQL A;  5J4V A;  3W2W A;  2EIK H;  1YTY A;  2R4G A;  3F6V A;  2F6C A;  4RDU A;  1ZLJ A;  3CCM I;  1LDD A;  3S17 J;  1ZGA A;  2B0L A;  1O7F A;  1UHW A;  4LLL A;  1RIO H;  3PNT A;  2LSO A;  4ZYG A;  1U2W A;  1OCP A;  2L54 A;  3ZCO A;  3MVP A;  1K83 J;  1B6A A;  2PI0 A;  2CG4 A;  3C1D A;  3MKL A;  4BS9 A;  1IC8 A;  3O8H A;  2DOD A;  4A93 J;  3FXJ A;  2EV0 A;  4UV8 A;  2Y48 A;  4HYE A;  3FKJ A;  2R7W A;  4FT8 A;  2AQE A;  1XCB A;  2FBH A;  3JTG A;  4ZDP A;  4M9X A;  1XSX A;  4CA0 A;  3TED A;  1X3W B;  2X6Y A;  4WK8 F;  1VQ8 I;  2W57 A;  2JSC A;  2BY2 A;  2A05 A;  4IHS A;  3I54 A;  1P7I A;  4XSX F;  3I55 I;  2KIQ A;  2CUE A;  1Z77 A;  2CRG A;  2GQQ A;  4LJZ F;  2O3F A;  1W7P A;  2DI3 A;  3I4P A;  2VBX A;  2HS5 A;  5J8C A;  2XF6 A;  2DT6 A;  1V4R A;  3RSN A;  2DMT A;  1MJA A;  5LEJ A;  4HEA 2;  5CVU A;  3LL7 A;  2P0W A;  4WCG A;  1PUF A;  1SMT A;  3KET A;  4U0Y A;  2NOJ B;  1MSF C;  2R5Y A;  4LG3 A;  3EUK L;  5KAI C;  4EVI A;  2LF7 A;  1TQI A;  1D1A A;  3FXR A;  2VBZ A;  2CW0 F;  2GWR A;  3PNV A;  3WTS C;  1ETK A;  4IHX A;  2DQL A;  1SEU A;  2XKP A;  2ZBK A;  4BU2 A;  2EZI A;  3PO2 J;  1ZKG A;  3RIR A;  1KQ9 A;  3VPR A;  5J47 A;  3CDH A;  2TDX A;  3CP2 A;  1WJD A;  5M5X J;  1WRJ A;  3OS1 A;  3HSR A;  4ZYH A;  2FEZ A;  4U7D A;  5HDG A;  1D1B A;  4P9F A;  3K4M A;  5ERI A;  4IPA A;  2BW3 B;  2K5C A;  2M45 A;  4RB1 A;  1SVO A;  1F1Z A;  1Y8R B;  2EFO A;  3KP6 A;  5FKL A;  3MAJ A;  2V6C A;  3GO5 A;  3BTJ A;  5J1Y A;  2K9N A;  3Q3S A;  4ENK A;  2CSO A;  3CUQ B;  1DGW Y;  1RRJ A;  1LB2 A;  4RGU A;  2QBY B;  5FD6 A;  4GRI A;  2IS2 A;  2AS5 F;  1XDU A;  1Z21 A;  5DYM A;  4MEY F;  1ZN2 A;  3HOX J;  1T8I A;  2GOM A;  1EH6 A;  1KGS A;  3HRT A;  3I4M J;  3HHG A;  4BAC A;  1K6Y A;  2F2E A;  2A5Y B;  4C2M J;  4PJM A;  1VZ0 A;  4FIS A;  4IHY A;  2E36 A;  1G8X A;  1UCR A;  3PFY A;  2IEK A;  3VB2 A;  4RM3 A;  3ABU A;  1NG6 A;  4KIF A;  5LFA A;  1ZK8 A;  2ACJ A;  2E34 A;  2ID6 A;  2JRM A;  3TDU C;  1B72 A;  2IGN A;  2YSR A;  4S05 A;  4EJU A;  4A3M J;  4RAZ A;  3CCU I;  2FML A;  4N4N B;  3GUD A;  1VQO I;  1RI7 A;  1OPC A;  2XAF A;  3ZQH A;  3S1R J;  5KCM A;  3DEE A;  2ME6 A;  2LFB A;  3JRC A;  3PJR A;  3TO7 A;  4IOA F;  3SHF A;  4G94 A;  1E17 A;  2H94 A;  3M3Y J;  1W0U A;  3GBG A;  4RS8 A;  2KDZ A;  5TRD A;  4G9Y A;  4PDK A;  3F8C A;  3S3N A;  2HOT A;  3G1M A;  2BE5 F;  1TW3 A;  2NVY J;  2RKH A;  5LHG A;  4CH7 A;  3OOP A;  3DCF A;  1XDS A;  2DOE A;  1STZ A;  4WXD A;  3GZ6 A;  4KYW A;  1BI0 A;  4AVP A;  5BMZ A;  3LSG A;  1GXQ A;  3KE2 A;  4LK0 F;  2KZV A;  3GTP J;  4B44 A;  4B1R A;  4I0B A;  3KEY A;  1K6O A;  1S9H A;  4BY1 J;  1HKS A;  5CVJ A;  5IT3 A;  2D1H A;  4GXO A;  1LE8 A;  3BG9 A;  4YIF A;  5FRN A;  4HF0 A;  2V9V A;  3RKW A;  1EH8 A;  4HRI A;  2BV6 A;  4OIN F;  1A04 A;  2H8R A;  4HX4 A;  3A0H C;  2X4H A;  4U0V A;  3U1D A;  2R7Q A;  2W85 A;  3ZQF A;  3PUB A;  1YE9 A;  4HF1 A;  1RUN A;  3E6C C;  1ACI A;  3OYJ A;  4I02 A;  4MNU A;  3W2V A;  1IXR C;  4XR6 A;  1UHM A;  4AIK A;  1HCR A;  1ZYR F;  2R0Q C;  3F9K A;  4YEL A;  4QTR A;  3BDD A;  4BXX J;  3K1M A;  3ZQI A;  3HKZ N;  1SD6 A;  2CMP A;  1JUM A;  1J0R A;  5E17 F;  4WXH A;  4CGZ A;  3BY6 A;  5J1R A;  2MC4 A;  3F72 A;  1O57 A;  4W1U A;  4BAY A;  4CHU A;  4PGH A;  1K78 A;  2HPM A;  2F5D A;  1FY7 A;  2JWT A;  2E35 A;  2QWW A;  2VKE A;  4ZYE A;  2VBW A;  3R0J A;  4D1Q A;  2LOO A;  1FYM A;  2X6W A;  3TMO A;  3I4N J;  2K7L A;  3W3C A;  1ZGW A;  4DBR A;  4U0W A;  1MIJ A;  4PJJ A;  4XQF A;  1YIO A;  2NS0 A;  1QVU A;  2VXZ A;  3HIF A;  2TCT A;  3KP7 A;  2P8T A;  2MYS A;  2Z16 A;  3GF2 A;  2OC6 A;  1GDT A;  2JQ7 A;  2YX7 A;  5DCM A;  2B63 J;  2E1M B;  3ZN1 A;  5DM7 F;  2Z33 A;  1A31 A;  2GBY A;  3JSO A;  4V19 K;  3BTI A;  1FMV A;  4A6E A;  1IRZ A;  1RKT A;  4CYC A;  2DA2 A;  2LRE A;  3K9T A;  3K6G A;  4F3Q A;  4A0X A;  5IP6 A;  1V5E A;  4KJZ A;  5HS9 A;  2DTR A;  3GTM J;  1B8I B;  2JVH A;  5HNH A;  3Q0V A;  2LF8 A;  3RI4 A;  1BIB A;  3LA3 A;  2LC2 A;  2CYY A;  4UUV A;  1Z3Y A;  5J8F A;  5HLH A;  3DLA A;  1HKQ A;  1BR2 A;  3H5A A;  3S14 J;  2WAQ A;  2BBY A;  3ZMT A;  3QRF F;  3SYT A;  2E1C A;  1XCV A;  3HZJ A;  4HLY A;  2KPM A;  1XG1 A;  3KEQ A;  1TWF J;  3HPH A;  2O7O A;  4GCV A;  4E7L A;  3BR2 A;  2H1K A;  2XB5 A;  2EZK A;  4KA4 A;  2E7X A;  4BY7 J;  3E97 A;  3EDP A;  2A61 A;  3F8B A;  4F7Z A;  2LKP A;  4Y15 A;  1SFE A;  2HTJ A;  2XV4 S;  1LUJ B;  4Y4R A;  4HBL A;  1E3P A;  1KQ0 A;  1HF0 A;  2X9D A;  4BBS J;  1SD7 A;  5B66 C;  4BH9 A;  1ZRF A;  2RV8 A;  2FQ4 A;  2WAD A;  3IKV A;  4GGG A;  1SFK A;  3ZQG A;  1F9N A;  2K4B A;  2OZU A;  2Z3Y A;  2ZNY A;  1J2X A;  1SAN A;  4YG2 F;  4DOZ A;  1R00 A;  3ABM H;  3LWF A;  2KJC A;  2IT0 A;  2V6E A;  4UY8 I;  1DPU A;  1K61 A;  5M3M J;  3D5S C;  1H89 C;  1WJC A;  3U9G A;  2FBK A;  4DYC A;  3KIO A;  3H9Q A;  2HWV A;  3WTV C;  3HGG A;  4I01 A;  2FSW A;  2VJ5 A;  4G6T B;  2XSJ C;  1WH7 A;  1R5H A;  4RGR A;  2P7C B;  2VOO A;  2ISZ A;  2NVX J;  1I6X A;  2ETH A;  3MCZ A;  2HVQ A;  5ILS A;  4NQW A;  2DJI A;  2HQA A;  4WF2 A;  4IHV A;  4I0A A;  3H5N A;  1NK2 P;  2QLZ A;  3E6M A;  3HOY J;  4A3L J;  1VQL I;  5LGN A;  3W6V A;  2V79 A;  3VYT B;  1YRN B;  3K0L A;  1K79 A;  1TQP A;  2O5R A;  3HBL A;  3J7Z I;  4A0Z A;  3OYF A;  4H0E A;  1YRN A;  2RN7 A;  3WTT C;  3PNY A;  3HTS B;  3FHZ A;  2IA2 A;  2DFE A;  3C2B A;  2RDP A;  1JKQ C;  2ZME A;  4HOB A;  2DA6 A;  5D6E A;  2ESH A;  2H6B A;  4MQV A;  4AD9 A;  3ERE D;  2WTE A;  2L4A A;  5CPR B;  1HSJ A;  3SZG A;  1SC7 A;  2K85 A;  2CGP A;  3OL3 A;  4BUP A;  1BW5 A;  5IT9 Z;  1ZG5 A;  2DMU A;  1WKM A;  2L9S A;  3G4S I;  3T1B A;  1BA5 A;  3RZD J;  4RGX A;  4LD5 A;  4TV7 A;  4ZYD A;  3GTL J;  3E3V A;  1B9M A;  1H0M A;  3SZT A;  2PG4 A;  3E1S A;  3PSF A;  5DTD A;  3GTQ J;  1P4W A;  5DDG A;  5ICE A;  2NXN B;  3HC7 A;  5IP7 J;  2ZFW A;  4IVN A;  5GPA A;  2CH0 A;  2XRN A;  3QPT A;  2VQH A;  2E1O A;  2M0C A;  4DZJ A;  3IWZ A;  3HOS A;  5FJ8 J;  1YW7 A;  2Y0M A;  3KFW X;  1FJL A;  4F52 A;  1HOM A;  2L7F P;  5EDN A;  3QYF A;  2VJ4 A;  1IN6 A;  3J7A Y;  2KIS A;  3ZQQ A;  2AHQ A;  2LKS A;  5HDK A;  2XPU A;  3OIP A;  3F23 A;  1VQK I;  1TLH B;  2GZW A;  4A3B J;  3NQO A;  2L5Q A;  3CTA A;  3MZH A;  3BQZ A;  1GVJ A;  2V1D A;  1MDM A;  4HW0 A;  3FBI B;  1QRY A;  1SMY F;  2FUG 2;  1O3S A;  1JTY A;  2LBF B;  2QGU A;  2PJR B;  3DBL B;  1WPK A;  2X51 A;  2EV6 A;  1FOY A;  4A5M A;  1IJW C;  3M8F A;  2M87 A;  3WU0 A;  3V42 A;  2EFN A;  3F0C A;  2MFZ A;  5LD2 C;  2XSD C;  1UG2 A;  4ENM A;  4BL0 B;  4PZJ A;  1QGP A;  4OIR F;  4LG0 B;  2EBI A;  5JFR A;  2HOA A;  1N78 A;  3LFU A;  2F5F A;  2LRD A;  3HM5 A;  3KEO A;  3IH4 A;  1UB9 A;  5KK1 A;  3TO6 A;  2WWY A;  3M07 A;  1IUF A;  3LSR A;  2M4G A;  4HAM A;  3FDY A;  4M3F A;  1ETY A;  2P6S A;  4M9S A;  2PMZ A;  4X6A J;  4IHT A;  2BYV E;  2BXZ A;  4N0B A;  2KHM A;  4DQ2 A;  2BY3 A;  3BOQ A;  5FRO A;  1B72 B;  4FE4 A;  3B6C A;  3AFH A;  4HA8 A;  1MBG A;  3A02 A;  4YFX F;  5H6R A;  3CME I;  2ZSH B;  4BXF A;  4ENJ A;  1IUY A;  2PMH A;  4CZZ A;  3GXO A;  5IOZ A;  2LKX A;  3DQV C;  4JK1 X;  4P55 A;  3MEX A;  2Q2E A;  5FD5 A;  1OKR A;  1JKO C;  2R93 J;  3U2R A;  1Y1V J;  1W36 D;  2XAH A;  2JT1 A;  4JBA A;  2YR2 A;  3BWG A;  3QU3 A;  2K4J A;  2LD5 A;  3PIP F;  1QBJ A;  1YOV B;  5HLG A;  2ZKZ A;  2ZXW H;  4M73 A;  1Q1H A;  4LLG F;  4CCN A;  2IGK A;  5J1U A;  2M7B A;  3W2A A;  1OCO H;  2F5C A;  3OYM A;  2L7K A;  2OPT A;  2VN2 A;  1EJ9 A;  2LYC A;  3N4M A;  2O61 A;  1ZR2 A;  3BJ6 A;  1V5G A;  2JN6 A;  3RZO J;  3CF2 A;  3E5Q A;  1FTT A;  3CJQ B;  2IXS A;  3CCV I;  1YS7 A;  3I59 A;  2HQ5 A;  1ZTR A;  3UR3 C;  3TO9 A;  1R6R A;  4V2F A;  1BBY A;  4ZTJ A;  1W36 C;  3S2W A;  2EFP A;  3H0D A;  4M9Z A;  3NWS A;  3LNQ A;  4HX7 A;  5BNG A;  1MMN A;  1IN7 A;  4BGD A;  3HEF A;  2QUF A;  3RYP A;  2VT3 A;  2P7V B;  4L0Z B;  5BPD A;  4IHW A;  1S7E A;  4R79 A;  3TOA A;  2BY0 A;  2E1N A;  2Y0S A;  1OMI A;  1NTC A;  1T98 A;  2XAS A;  1UG0 A;  3R6S A;  3KP5 A;  3H36 A;  2IVM A;  5CQG A;  1W0T A;  1R58 A;  3KZZ A;  3CLO A;  1G3S A;  1VI0 A;  5D6F A;  1DU6 A;  3FM5 A;  2R5Y B;  3KYC B;  4XLH A;  1KZH A;  3JRA A;  2GXA A;  2WAQ N;  5D5X B;  1KU3 A;  1MZB A;  1FX7 A;  1W7P D;  4KUM A;  1POG A;  3HSF A;  3TW7 A;  2VQL A;  2V1U A;  2BXY A;  1YQA A;  4FTH A;  1JUS A;  4ANJ A;  3K69 A;  2W4S A;  4XN3 A;  2L9N A;  3ASO H;  4C30 A;  2Y30 A;  2ZME B;  2E60 A;  1REP C;  4C9Y A;  1G3T A;  3FWE A;  5CLS A;  5EYR A;  4XNF A;  6PAX A;  2QQ8 A;  2FJ1 A;  1BI1 A;  2P5L C;  2ZJR F;  3BG5 A;  1MGT A;  2I5U A;  4OAY A;  4S0H B;  1JJ8 C;  1BOB A;  4L9V A;  1ULY A;  1T95 A;  2A68 F;  3IUO A;  5H20 A;  2EA4 A;  3RKX A;  2L4M A;  4BBR J;  3AG4 H;  4F92 B;  3F8F A;  3PL8 A;  2K9M A;  2DOA A;  2DW4 A;  1HST A;  2MSY A;  1IV6 A;  2R7F A;  3FF5 A;  3LSP A;  4PSW A;  3HOU J;  3GTG J;  3C2H A;  1S8N A;  3OYD A;  5AIP A;  4HPQ A;  2VE8 A;  4AYB A;  4EJT A;  5GPC A;  1RR8 C;  5JLW A;  1LFP A;  2DJN A;  4CCO A;  1I5Z A;  4CCJ A;  4KIG A;  3LOC A;  3M7G A;  3C3W A;  2VLA A;  1S6L A;  4LGW A;  1Z91 A;  3TKY A;  2MG4 A;  4JX5 A;  3DBH B;  3RPU A;  2R7T A;  1YW9 A;  3OL4 A;  2XGX A;  1VFC A;  4PK4 A;  1YJN I;  3DU6 A;  2NVT J;  4Y7N J;  3FM3 A;  3W6J B;  1AWC A;  1O3T A;  1DU0 A;  3R60 A;  1DUX C;  2R92 J;  4EJO A;  1RPW A;  2COM A;  1EF4 A;  4E7K A;  4I98 B;  1JKR C;  3QPS A;  4XIC A;  3BRO A;  2IP2 A;  3ABK H;  3SQN A;  4YIR X;  1XS9 A;  1P4X A;  2DDB A;  2MD5 A;  4BEH B;  3OYA A;  2JA5 J;  2JJ7 A;  4BJT A;  2JA2 A;  5DV5 A;  5ILU A;  2KRC A;  3DXJ F;  3IL2 A;  3GTO J;  1BI3 A;  3JW4 A;  2H09 A;  2W24 A;  3NAU A;  3CO6 C;  1WSU A;  2GIZ A;  3CES A;  2A6E F;  2HR3 A;  3ASN H;  1P7J A;  2XAU A;  3LMM A;  1AKH A;  2F5V A;  3U1K A;  5DM6 F;  5CYV A;  4J01 A;  1OR7 A;  3F6O A;  3PFI A;  1AU7 A;  1FLI A;  4KDP A;  4GO1 A;  1N77 A;  2XAJ A;  2X6O A;  2Y75 A;  1VQM I;  3Q0U A;  5F0H A;  3EYY A;  1XGO A;  5IT9 K;  3I64 A;  2DPD A;  2J5P A;  1LEA A;  3VYS B;  3AAF A;  4KFC A;  3K4J A;  2M7A A;  4FX0 A;  2YU3 A;  2ID3 A;  1J7K A;  3C18 A;  1YW8 A;  1XB4 A;  1A6Q A;  4DYQ A;  1P2F A;  2V9P A;  5FLX K;  1S5L C;  2J5O A;  2OAZ A;  2HQN A;  2FF4 A;  3P7N A;  1JJ6 C;  3TW6 A;  4UB8 C;  4ZZD A;  1QZZ A;  2BGC A;  5F27 A;  4EMS A;  5EG0 B;  4Y33 A;  2BHZ A;  5EG0 A;  1MBH A;  1NG7 A;  2XPW A;  3R61 A;  2BOL A;  1VQ4 I;  1VQN I;  3HTU A;  5E1Z B;  2WAF A;  2BW3 A;  4OMY A;  1BC7 C;  4MGR A;  5L3B A;  3GLX A;  4HG2 A;  3GFM A;  1U9O A;  2LP0 A;  1R1T A;  2YX4 A;  4EM1 A;  4LLN A;  1ETV A;  4M3D A;  4CO8 A;  2VOP A;  3I5U A;  2ECC A;  1TQM A;  2HTS A;  3P9K A;  2IA0 A;  4LMY A;  1U5T B;  3AG3 H;  1TBX A;  2CFX A;  3HRU A;  1U5T A;  1FPQ A;  3BZ6 A;  1U9N A;  4MIM A;  4UV9 A;  4IOC F;  1U5T C;  4ABZ A;  2LR8 A;  3V8J A;  1FNN A;  1W4M A;  5D8L B;  3M1C A;  3H3U A;  1W5C C;  3WTY C;  5HS8 A;  1Z7U A;  1XGN A;  1GHC A;  3ESW B;  3QU6 A;  3ECH A;  3K4K A;  2FU4 A;  3FX3 A;  2BZT A;  4ZZL A;  3HUG B;  4HQM A;  2DCE A;  4XLA A;  1IO2 A;  3HUG A;  4II2 A;  1TWA J;  3KLO A;  3FXK A;  1FYK A;  2HDW A;  1E3O C;  2CO5 A;  2BVM A;  3JRG A;  5E1X A;  4HQE A;  1APL C;  1TW2 A;  3GVA A;  1SFU A;  5L3G A;  4LB5 A;  2JA8 J;  4A3F J;  2WB1 N;  2FMY A;  4F91 B;  3K2A A;  2DO7 A;  2KRF A;  4IX7 A;  4LOC A;  1TTY A;  1DP3 A;  3ZOB A;  4G8X A;  2KKO A;  1B59 A;  3GZN B;  4HSR A;  2F5E A;  5IOY A;  2VBY A;  3BPV A;  1ZR4 A;  2OBP A;  5BQT A;  5GTH C;  2Y69 H;  4QLC U;  2DBB A;  4B3X A;  1AHD P;  5FKM A;  2HU9 A;  2DU9 A;  4HZF A;  2RNG A;  3VSK A;  1OLT A;  2X85 A;  2XUB A;  2KDO A;  3HRM A;  2EQR A;  4ITV A;  3WGH A;  4E7J A;  1WI9 A;  3WU2 C;  2DLL A;  1QU3 A;  2GXB A;  1RR7 A;  1MJ9 A;  2RGV A;  5ED4 A;  2PN6 A;  1D8K A;  1B1B A;  1LVK A;  4Z2Y A;  2VON A;  3K1P A;  3KX2 A;  4C2U A;  2R7V A;  2NNY A;  2PJP A;  1XPX A;  2KMU A;  2HFH A;  2Q0O A;  3OYG A;  3SZP A;  2EFW A;  4XKW A;  5D5U B;  2BHY A;  3A2K A;  4XKC A;  3T0Y A;  5E18 F;  3SJM A;  4G7O F;  1WJE A;  5M5Y J;  2WBM A;  3ML6 A;  2P5V A;  3JTH A;  3GTK J;  4BQA A;  3J80 K;  3T8R A;  1B4A A;  1O7L A;  1X4O A;  4AYB N;  1BOA A;  2F4M B;  1LKX A;  2MAB A;  2QQ9 A;  2L7M P;  2IW5 A;  3N05 A;  4EM2 A;  2ZJQ F;  1WI3 A;  2MD0 A;  1QA6 A;  3HGY A;  1ZLK A;  2CW7 A;  2L7Z A;  2X1E A;  1J5Y A;  4EV0 A;  4C3I J;  3R4K A;  3KCC A;  3GEZ A;  3TP3 A;  1JUP A;  2O8X A;  4HX8 A;  3WGG A;  2QVO A;  3JAM Z;  3IH3 A;  1YX5 A;  1VQ5 I;  4CXF A;  1KU2 A;  4XMY A;  2PMU A;  4E7I A;  2ELK A;  2VQG A;  3F21 A;  1TNT A;  2VJI A;  3JRH A;  2ZB9 A;  1D0Z A;  4C2T A;  2K9S A;  2E2I J;  1D1C A;  1IW7 F;  1MBJ A;  3WTW C;  1CQT A;  2KLO A;  2RVC A;  4RGS A;  4UVB A;  4XLP F;  4D0P A;  4F93 B;  1MH3 A;  3H92 A;  1XC5 A;  4Q48 A;  2DAO A;  2FX0 A;  1T39 A;  2XKO A;  4ESJ A;  1JI8 A;  4G6Q A;  1Y39 A;  3F8N A;  1UJ8 A;  3IH2 A;  3CMY A;  3X2Q H;  1LNW A;  3VYU B;  2PBI A;  2EK5 A;  2EPF A;  2HDC A;  9ANT A;  4ZC3 A;  4XM3 A;  3KYL A;  1G59 A;  2CUZ A;  1ZAO A;  5EEH A;  3B6A A;  2EIN H;  1S29 A;  2M8E A;  3DU5 A;  3LSK A;  2WC2 A;  2JSP A;  2P5K A;  3BR3 A;  2PQ8 A;  3LSJ A;  2XHK A;  1EV7 A;  3ULQ B;  5DUI A;  2UV1 A;  1WHU A;  3PQJ A;  4LIV A;  1VF9 A;  4XRM A;  4HV6 A;  2HYG D;  4KIC A;  3ZMS A;  4L0Y B;  4MLO A;  1PVE A;  1QO0 D;  5J40 A;  4QSH A;  5LRR A;  3BC8 A;  4UUS A;  3CF5 F;  2QEX I;  4BJ6 C;  3FZV A;  5EGO A;  2W82 A;  2LLK A;  1KON A;  3BCA A;  2QF7 A;  3DPT A;  3CC4 I;  3CCL I;  3IC7 A;  2Q1Z B;  1FBU A;  1X4P A;  1H88 C;  4HDV A;  5IYB J;  2Y9Y A;  2UXX A;  1I27 A;  1B8I A;  3LFK A;  3FXM A;  3V4G A;  4HNV A;  3FXL A;  3G1L A;  3OR1 C;  4XRF A;  1R7J A;  3IV5 A;  3WOD F;  4L18 B;  2V9K A;  2Q8K A;  3ABL H;  3RPQ A;  3GCM A;  2HZT A;  2VPR A;  2CQQ A;  4L5I A;  3TOB A;  1ZG3 A;  4PUS A;  3ZQC A;  1QHG A;  5J6X A;  1ETO A;  3H35 A;  2YU9 J;  3DP7 A;  2PFB A;  2ELJ A;  3VDX A;  1HA8 A;  3BJA A;  1LDK B;  3H3Z A;  3SDG A;  3RPU D;  5ICC A;  2FOW A;  3QPL A;  5EEG A;  3OSG A;  5AIQ A;  5HLT A;  1X2N A;  1WH5 A;  2KJB A;  5LLQ A;  4XLF A;  4KIT B;  5KNL A;  2G7U A;  3MKY B;  3WGI A;  2VB6 A;  1W5T A;  1XTA A;  1Z3X A;  1ZEL A;  1SFO J;  1ETQ A;  2L2O A;  5FB2 A;  1K78 B;  3IP4 B;  2DXI A;  1P92 A;  1CF7 B;  3CUO A;  4XOR A;  3OYK A;  2G0E A;  1WJB A;  3GW2 A;  1R1V A;  3RJP A;  1O3R A;  2R7R A;  3L7W A;  2WB1 A;  2QKM B;  1R4M B;  4NC8 A;  3LAJ A;  1FMW A;  1FEX A;  1E2X A;  3ONQ A;  4E6K G;  4I99 C;  2COB A;  3ERM A;  4B4C A;  4DYR A;  2X6X A;  2CV2 A;  4QIW N;  1GV5 A;  1GUU A;  2IGO A;  2KFD A;  2GA1 A;  1TWG J;  3DEU A;  1R5I D;  1X1A A;  4OU0 A;  1B9N A;  2QSG X;  3RYR A;  4M6V A;  2MA3 A;  1GVD A;  3K4B A;  2W7N A;  1BW6 A;  3CCY A;  2RNJ A;  3HKZ A;  2ME0 A;  5ICF A;  4NUB A;  4A69 C;  1X1D A;  2FNP A;  2ISY A;  1J09 A;  1XX5 A;  4I7H A;  4OIO F;  5K5O A;  4A5N A;  2M8G X;  5A2Q K;  5IYC J;  2XF7 A;  1V55 H;  1UEL B;  4G12 A;  3BG6 A;  1YHQ I;  1T0F C;  4E7Z A;  4OAZ A;  5CVR A;  3HRS A;  4ZDO A;  3A4C A;  1FSH A;  1RNL A;  3VOD A;  4IL6 C;  4MHG A;  3CCJ I;  5K5Q A;  3BTC A;  3M9A A;  2B9S A;  4O5V A;  1SVM A;  1KA8 A;  2ZFU A;  2L02 A;  1VND A;  4ENN A;  1X58 A;  2FQ3 A;  2NS8 A;  2LVS A;  3DLL F;  4HNU A;  2L3D A;  5GAE J;  1Z67 A;  3D5L A;  1WJA A;  3A1Y A;  3J81 Z;  2X1D A;  4XKB A;  3E7L A;  4BHC A;  3M4O J;  4L9N A;  3MN2 A;  2R7D A;  3E5U A;  3G3Z A;  3LSM A;  1LDJ A;  2DOF A;  2V26 A;  2CW8 A;  2P6T A;  1DQU A;  3KP4 A;  3CDL A;  1ITY A;  1OFC X;  2A07 F;  5K1Y A;  3U21 A;  2FE3 A;  2HOE A;  3V7S A;  4DBQ A;  3DKW A;  3BR1 A;  3HHH A;  1NK3 P;  3DPL C;  3S3M A;  2Y31 A;  4GFB A;  1FT9 A;  3K2Z A;  2K9L A;  2OD5 A;  5E3N A;  1RET A;  2DA5 A;  1JT0 A;  1LPQ A;  4P9U A;  3PO3 J;  2AXL A;  2HVR A;  4PSX A;  5FGM A;  4EAT A;  4M72 A;  1VQ6 I;  5ICG A;  3QOE A;  2WA0 A;  5HLI A;  5JHF A;  4CZC A;  4BEH A;  2CFO A;  3CUQ A;  4Y3O A;  2K02 A;  1D5Y A;  3EUA A;  3HYI A;  2VOD A;  3NAR A;  5AON A;  4MFE A;  1YYV A;  2NYX A;  2WV1 A;  3OYL A;  1YFH A;  1SFX A;  1PDN C;  3OV8 A;  4OWR B;  3GTJ J;  5TIS C;  4BHP A;  3S32 A;  2VAS A;  3FBN B;  1K4S A;  3MD2 A;  3AG2 H;  1TC3 C;  1Z9C A;  1JHH A;  2LMD A;  1KU9 A;  3OS0 A;  1W1W E;  1MNM C;  4AIJ A;  1I6H J;  3L2W A;  3GFI A;  4A0Y A;  3V7C A;  2O6G E;  4J19 A;  2DQR A;  2R3S A;  1A35 A;  4AID A;  5F1R A;  4LIU A;  4II3 A;  2YS9 A;  1BJZ A;  1BC8 C;  2M5W A;  3RTR A;  3WU1 B;  5F1J A;  3EUH A;  2G9W A;  1XMA A;  4ASN A;  2OCE A;  5LHH A;  1WVR A;  4UNO A;  1TZL A;  1Y6I A;  4B3A A;  1WCM J;  4QWQ A;  1XGS A;  2LK2 A;  1G4D A;  1FSE A;  1N25 A;  3DPU A;  3I3L A;  1QPI A;  5GAG J;  2ZJP F;  1FIP A;  1Z6R A;  3CLQ A;  4LFU A;  4AUX A;  3QAH A;  1ZRC A;  3H1C A;  2LY9 A;  2OF7 A;  2PLY A;  1LFB A;  2A5W A;  2QM3 A;  3JCU C;  5B3S H;  1JTX A;  2IPQ X;  1SAX A;  2W00 A;  3DKY A;  3HOZ J;  2VPL A;  2E19 A;  1RES A;  1MBE A;  2M4K A;  4P96 A;  4D5F A;  4RM2 A;  3CMA I;  1J59 A;  1R23 A;  2KT0 A;  3QOP A;  2K40 A;  2MBF A;  3EQL F;  3L09 A;  1T6S A;  3AKZ A;  3RDI A;  1FBS A;  2IS6 A;  4UVC A;  4RB3 C;  4BQO A;  4DGW B;  4OMZ A;  5FKN A;  5J4Y A;  4BJ5 C;  3CMM A;  2QA4 I;  4Z6Y A;  2BEO A;  3SDB A;  2VC1 A;  3H9J A;  4RLF A;  2QQA A;  1IN5 A;  1L3L A;  3BR5 A;  4IZZ A;  3KZI C;  2E71 A;  5C4X J;  3JRF A;  1OQY A;  5IYD J;  4GYG A;  4C3J J;  4YRV A;  1OIS A;  4MFD A;  4HNT A;  1VTN C;  4D7M A;  4RB0 A;  1T33 A;  2OCC H;  1PP7 U;  4CCK A;  1MBF A;  3B02 A;  3K70 D;  3OYH A;  1K4T A;  2VJJ A;  2EB7 A;  2VL8 A;  1N75 A;  1JT6 A;  2PX9 A;  3I59 B;  3LSH A;  5JVG F;  4MEX F;  4G6D A;  3CQZ J;  3S1M J;  5CKT A;  3F3X A;  4K2E A;  3M1E A;  2M30 A;  2JVG A;  3NRV A;  2KZG A;  3QQA A;  4NC7 A;  4YFK F;  2OJE D;  2VXD A;  3PM1 A;  4XOP A;  4BXU A;  2W25 A;  3DV8 A;  1LJ9 A;  4FQG A;  1O4X A;  2CS3 A;  4UVA A;  1SAU A;  4A3D J;  1AOY A;  1IXC A;  4KIB A;  4EGY A;  3M8E A;  5JR3 A;  4AVZ A;  2NVU B;  2CQK A;  3LAP A;  2X48 A;  1X19 A;  4IXA A;  3L00 A;  3FIS A;  2XRO A;  1WGX A;  1X1P A;  5JVT A;  2EIJ H;  2ECB A;  1FOK A;  4PCQ A;  3MKW B;  3S16 J;  2IAI A;  2LDU A;  1V5F A;  2IJL A;  1TP4 A;  5E3L A;  5HVQ C;  1GXP A;  5DD4 A;  1XGM A;  3I56 I;  3BZC A;  1OCR H;  2XVC A;  4IEJ A;  2DA4 A;  1WJF A;  2Y2Z A;  2YUS A;  2EZL A;  1PP8 F;  4CYD A;  1H9G A;  1CGP A;  2H27 A;  3QYE A;  1P6R A;  4BE0 A;  2L9V A;  1X1C A;  4MQ9 F;  3SEZ A;  5D5W B;  3GX4 X;  3QOD A;  1AKH B;  3DEW A;  3AL0 B;  1FTZ A;  2MLK A;  2Y0S N;  3KZY A;  3MZY A;  5EEA A;  5ILV A;  4XN0 A;  2CQN A;  1RKW A;  3E6B A;  1I3Q J;  1S72 I;  4U88 A;  4RLQ A;  3IAM 2;  3A0B C;  4Q5S F;  2AXT C;  2HI3 A;  5B5E C;  1UHS A;  3JRB A;  2I10 A;  3RCO A;  5HOO A;  3S1N J;  2CU7 A;  2M3A A;  1UAA A;  3MFK A;  3CCQ I;  5M5W J;  2M9H A;  2CQX A;  2GLO A;  4RBO A;  3I0T A;  3ZPL A;  2HOS A;  1GV2 A;  1HC8 A;  4DIQ A;  2VKD A;  1TNS A;  4BE1 A;  4NHJ A;  4AIH A;  3JR9 A;  1X1B A;  2GIV A;  2BVL A;  3ZRG A;  4P5O A;  2K27 A;  1M1E B;  2DFI A;  4KMF A;  5LBQ A;  4Y17 A;  4NBQ A;  3D1N I;  2QZ8 A;  1T08 B;  1KYZ A;  3RKY A; 
#chains in the Genus database with same CATH homology
 1K61 A;  5M3M J;  1H89 C;  1T56 A;  4XID A;  4DYC A;  2LTP A;  3FK6 A;  2CJJ A;  3HGG A;  1JGG A;  2EZH A;  1WH7 A;  3SJM A;  1MH4 A;  2XB0 X;  5M5Y J;  1OJL A;  4CYC B;  3GTK J;  2HXO A;  2JMW A;  2NVX J;  4A3G J;  5HOD A;  4V2G A;  4AYB N;  1JKP C;  2L7M P;  2O8K A;  4IHV A;  2RAE A;  1WI3 A;  2M34 A;  1NK2 P;  3HGY A;  3JRE A;  3HOY J;  2L7Z A;  4A3L J;  3W6V A;  3JRD A;  1YRN B;  2W48 A;  4C3I J;  1H8A C;  1TWH J;  3G1O A;  1HDP A;  3HBL A;  3OIO A;  1YRN A;  3TP3 A;  1JUP A;  2DMN A;  3IH3 A;  2GM4 A;  3HDD A;  3TP0 A;  2AO9 A;  3FK7 A;  3C2B A;  1JKQ C;  2ELK A;  1BL0 A;  2DA1 A;  2DA6 A;  3JRH A;  1A5J A;  2ZB9 A;  1ENH A;  2K9S A;  2E2I J;  2IBD A;  1MBJ A;  1CQT A;  5E3M A;  1BW5 A;  3BG3 A;  4NDL A;  1MH3 A;  1XC5 A;  2DMU A;  5EZG A;  2FX0 A;  1BA5 A;  5C4J J;  3RZD J;  5E3O A;  3IH2 A;  3CMY A;  1OCT C;  3GTL J;  2XGE A;  4DZP A;  2VUM J;  3GTQ J;  9ANT A;  5DTD A;  2DMQ A;  5F08 A;  3B6A A;  5IP7 J;  3BQY A;  5GPA A;  1HDD C;  4DZJ A;  2E1O A;  2M0C A;  4UUS B;  3BR3 A;  5DS9 A;  2DA7 A;  5FJ8 J;  3LSJ A;  1FJL A;  1HOM A;  2L7F P;  5EDN A;  1ETX A;  1VF9 A;  4XRM A;  2AHQ A;  2XPU A;  4A3E J;  3SFI A;  2K9Q A;  5J3L A;  4MLO A;  1R9T J;  4A3B J;  5EZH A;  4QSH A;  3BQZ A;  4UUS A;  4I76 A;  1Q1V A;  3O8G A;  1QRY A;  5GP9 A;  5EGO A;  1JTY A;  2LLK A;  1G2H A;  2QF7 A;  2XRL A;  1WPK A;  5EGO B;  1IJW C;  3Q0W A;  1H88 C;  1IGN A;  1FIA A;  5IYB J;  2Y9Y A;  3H0G J;  3RQI A;  3F0C A;  1B8I A;  3S1Q J;  4D5C A;  4W97 A;  4HNV A;  1Y1W J;  3G1L A;  2XSD C;  2XGD A;  1UG2 A;  3IV5 A;  4JX4 A;  4L5E A;  4A3K J;  2VPR A;  2CQQ A;  5C44 J;  3S2D J;  4XK4 A;  4D7N A;  1IDZ A;  1LE8 B;  2EBI A;  2HOA A;  3FIW A;  3ZQC A;  1ETO A;  1UMQ A;  3HM5 A;  5K7Z A;  2YU9 J;  3IH4 A;  4JX6 A;  1IUF A;  3SDG A;  3LSR A;  5K7F A;  3QPL A;  3OSG A;  1X2N A;  4M3F A;  1WH5 A;  1ETY A;  1IDY A;  4X6A J;  1SFO J;  4M3B A;  1ETQ A;  2D5V A;  3ZQL A;  4RDU A;  1B72 B;  3S2H J;  3UKG A;  2G0E A;  4FE4 A;  3S17 J;  3B6C A;  1MBG A;  3A02 A;  5FKK A;  1ORK A;  2HDD A;  5IOZ A;  2LKX A;  1FEX A;  1OCP A;  1HLV A;  4JP0 A;  5IPA A;  3MVP A;  1K83 J;  2COB A;  4B4C A;  1JKO C;  1F36 A;  4DYR A;  2R93 J;  1Y1V J;  3MKL A;  4QIW N;  1GV5 A;  1GUU A;  1IC8 A;  3O8H A;  2LD5 A;  4A93 J;  1TWG J;  4MO7 A;  5FLV A;  4M6V A;  1GVD A;  5J1U A;  1BW6 A;  2EH3 A;  3CCY A;  2ME0 A;  4A69 C;  2OPT A;  5FLM J;  3BT9 A;  3TED A;  1ZR2 A;  3HOW J;  2M8G X;  5IYC J;  2JN6 A;  3RZO J;  4G12 A;  1P7I A;  1FTT A;  2L9R A;  3RKQ A;  2CUE A;  1Z77 A;  2HQ5 A;  2CRG A;  1ZTR A;  4V2F A;  3BTC A;  1F43 A;  5F0C A;  5JLX A;  4XRS A;  1VND A;  1X58 A;  2DMT A;  1PUF A;  2NS8 A;  3LNQ A;  3WHB A;  3A01 B;  2LVS A;  5BNG A;  3HEF A;  3A01 A;  2NVQ J;  1MSF C;  4XRS G;  2R5Y A;  3E7L A;  1S7E A;  4IHW A;  3M4O J;  3WHC A;  3MN2 A;  1ETK A;  1NTC A;  4IHX A;  2JK3 A;  2DMP A;  2EZI A;  3CDL A;  1ITY A;  2DTZ A;  3PO2 J;  1OFC X;  1ZKG A;  2NS7 A;  1W0T A;  3VPR A;  4A3J J;  1VI0 A;  1DU6 A;  3H3V K;  5M5X J;  2R5Y B;  2O9L A;  3JRA A;  3BR1 A;  2WAQ N;  1NK3 P;  1POG A;  2Y31 A;  4GFB A;  3TW7 A;  1U8B A;  5E3N A;  1RET A;  5IP9 J;  2DA5 A;  1JT0 A;  3PO3 J;  4FTH A;  1JUS A;  5K7H A;  2MGQ A;  4A3I J;  5FKL A;  3BTJ A;  5J1Y A;  2K9N A;  2Y30 A;  3Q3S A;  4UUT A;  3OOU A;  1D5Y A;  5EYR A;  3NAR A;  4M3G A;  4MFE A;  2WV1 A;  4Y52 J;  2FJ1 A;  3GTJ J;  2E2H J;  3JRI A;  3BG5 A;  3HOX J;  1JJ8 C;  4S0H B;  1TC3 C;  1TWC J;  3I4M J;  1Z0X A;  1MNM C;  4C2M J;  4BBR J;  1I6H J;  4FIS A;  4IHY A;  3BR6 A;  4J19 A;  2IEK A;  2MSY A;  1IV6 A;  1ZK8 A;  3LSP A;  2YS9 A;  3HOU J;  2ID6 A;  1BJZ A;  3GTG J;  1B72 A;  4A3M J;  5F1J A;  5GPC A;  5JLW A;  2DJN A;  5F0F A;  3ZQH A;  4B3A A;  3LOC A;  3S1R J;  1WCM J;  2ME6 A;  2LFB A;  3JRC A;  2LK2 A;  2NOG A;  3S15 J;  2MG4 A;  4JX5 A;  1QPI A;  1FIP A;  3M3Y J;  4AUX A;  3GBG A;  2KDZ A;  1VFC A;  1W0U A;  3S1N J;  2VKV A;  3K7A J;  2NVT J;  2FD5 A;  4Y7N J;  2LY9 A;  3HOV J;  2HOT A;  2OF7 A;  3G1M A;  1DU0 A;  1LFB A;  2NVY J;  2R92 J;  1JTX A;  3HOZ J;  1RPW A;  1EF4 A;  2E19 A;  1RES A;  3DCF A;  5M3F J;  1MBE A;  4FE7 A;  4D5F A;  3QPS A;  1JKR C;  2TRT A;  3LSG A;  4XIC A;  1XS9 A;  1IG7 A;  3GTP J;  2JA5 J;  2JJ7 A;  2KT0 A;  4B1R A;  2K40 A;  2PMZ N;  4BY1 J;  4BKX A;  5FKN A;  2R5Z B;  3GTO J;  1LE8 A;  3BG9 A;  3NAU A;  2P81 A;  2R5Z A;  1P7J A;  3FKI J;  1AKH A;  1MBK A;  4X1E A;  3BTL A;  3BR5 A;  1AU7 A;  2XPV A;  2H8R A;  5C4X J;  3JRF A;  2M2E A;  2X6O A;  2HYJ A;  5IYD J;  4C3J J;  4MFD A;  3ZQF A;  2Y9Z A;  3Q0U A;  4D7M A;  5F0H A;  1T33 A;  1U78 A;  1MBF A;  4AC0 A;  1X2M A;  3L1P A;  4DW6 A;  1JT6 A;  3S1M J;  1HCR A;  2R0Q C;  3CQZ J;  2ID3 A;  3OSF A;  4QTR A;  4BXX J;  2L0K A;  3ZQI A;  5EF6 A;  4DYQ A;  3QQA A;  3HKZ N;  3PM1 A;  1JUM A;  1O4X A;  4A3D J;  5J1R A;  1PUF B;  1JJ6 C;  3TW6 A;  4W1U A;  4A3C J;  5EG0 B;  5F27 A;  2X48 A;  2JWT A;  2VKE A;  3FIS A;  5EG0 A;  1MBH A;  1WGX A;  2XPW A;  3A03 A;  5C3E J;  2ECB A;  2XGC A;  1ZGW A;  3S16 J;  2IAI A;  3I4N J;  5E3L A;  2E2J J;  1QVU A;  1U9O A;  2LP0 A;  2HXI A;  2TCT A;  4I6Z A;  1ETV A;  4M3D A;  1GDT A;  2ECC A;  4IEJ A;  2DA4 A;  2Y2Z A;  2YUS A;  2B63 J;  2EZL A;  2GBY A;  2QCO A;  4MIM A;  1U9N A;  3BTI A;  1IRZ A;  1RKT A;  2LR8 A;  4ABZ A;  4CYC A;  1AKH B;  2DA2 A;  1FTZ A;  3DEW A;  4M3E A;  5IP6 A;  2Y0S N;  3GTM J;  5EEA A;  1B8I B;  3Q0V A;  3HB9 A;  1RKW A;  2CUF A;  1I3Q J;  2JA7 J;  1QVT A;  3S14 J;  1TWA J;  2DA3 A;  2N8G A;  1A6I A;  1E3O C;  4C3H J;  3JRG A;  2HI3 A;  1I50 J;  1APL C;  1UHS A;  2JA6 J;  3JRB A;  2I10 A;  2JA8 J;  4A3F J;  4FCY A;  1XG1 A;  2CU7 A;  1TWF J;  2O7O A;  2WB1 N;  3K2A A;  3BR0 A;  3BR2 A;  4EEF G;  2XB5 A;  2H1K A;  2EZK A;  5M5W J;  1ZQ3 P;  2M9H A;  4LOC A;  2CQX A;  4BY7 J;  3ZOB A;  2VI6 A;  4RBO A;  2GLO A;  1MSE C;  5IOY A;  2HOS A;  1GV2 A;  4JYK A;  1ZR4 A;  1GT0 C;  1AHD P;  5FKM A;  1HF0 A;  2X9D A;  4BBS J;  2R7Z J;  3JR9 A;  5F04 A;  1LFU P;  1ETW A;  2FQ4 A;  2EQR A;  3ZQG A;  3D1N I;  2MW8 A;  1SAN A;  1RR7 A;  2DN0 A;  5FKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...