1JKOC

Testing the water-mediated hin recombinase dna recognition by systematic mutations
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
46
structure length
46
Chain Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Testing water-mediated DNA recognition by the Hin recombinase.
pubmed doi rcsb
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*TP*GP*TP*TP*TP*TP*TP*GP*GP*TP*AP*AP*GP*A)-3'
total genus 10
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02796 HTH_7 Helix-turn-helix domain of resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1jkoC00
3S2DJ 1FIPA 1XG1A 1JTXA 1AKHA 5F0CA 1MBFA 5C3EJ 1ZKGA 5C44J 3ZQCA 4A3FJ 9ANTA 1QVUA 1SFOJ 2IEKA 2YU9J 5EZGA 4M3DA 2DN0A 2Y0SN 3TP3A 1DU6A 1JT0A 3HOXJ 1JGGA 4A69C 5IOYA 2ID3A 4NDLA 4FCYA 4A93J 4BY1J 1DU0A 1IDZA 2HXOA 5EDNA 1FIAA 2MGQA 1ITYA 3RZOJ 1IRZA 3H3VK 4MFEA 5GP9A 5J3LA 3HGGA 2CRGA 3FISA 3Q0UA 2EZHA 5EGOA 2JA6J 1A6IA 2L9RA 1IGNA 2NVXJ 5FLMJ 3CQZJ 3SDGA 1GV2A 5EG0A 4D5FA 1R9TJ 2DMQA 2L0KA 2R5YB 3GTKJ 1APLC 2DA3A 3CMYA 3NARA 3S1RJ 1WH5A 3IH4A 1RPWA 4S0HB 1U78A 4A3BJ 1JKOC 2LR8A 1H89C 3LSGA 3GTMJ 1JT6A 2CQXA 2FD5A 2R5ZA 4B3AA 2JA7J 3BT9A 2VKEA 2NVTJ 5J1YA 4W97A 3UKGA 2EZLA 1MBHA 2DMNA 2DA2A 2VI6A 2XPUA 2VPRA 3Q0VA 5M5XJ 4XICA 1OFCX 4A3MJ 1ETWA 4MO7A 5C4JJ 1X2MA 2LP0A 4IHXA 4EEFG 3JRFA 1VI0A 1UMQA 1W0UA 2NVYJ 3OOUA 1IUFA 2O7OA 1LE8B 3S17J 4V2GA 1GV5A 3IH2A 5E3NA 2MW8A 5IP6A 3GTJJ 4RBOA 5FKNA 2EBIA 4A3CJ 2E1OA 3LNQA 4DZPA 1U9OA 3HB9A 5DTDA 2HI3A 3GBGA 2MSYA 1HOMA 2E19A 3K2AA 3JRIA 3Q3SA 3JRCA 4A3KJ 3HDDA 1QPIA 3BQYA 4JYKA 2HXIA 5IOZA 2NS8A 3FK6A 4M3BA 3K7AJ 4M3EA 4IHYA 2COBA 2LLKA 3O8GA 2ME0A 4DYRA 3GTQJ 2HQ5A 1ORKA 3JREA 3ZQLA 3HM5A 2R7ZJ 4FE4A 3G1MA 4QSHA 2NS7A 4C3JJ 1ZTRA 3BR2A 4XRSG 2AHQA 2K40A 4DW6A 3BTJA 1RR7A 2DMTA 2XSDC 2HDDA 1T56A 1I50J 2DJNA 4JX5A 2X48A 1ZR4A 3E7LA 4I6ZA 3MKLA 4X1EA 5JLWA 1JKPC 1W0TA 4I76A 4C3IJ 3ZQHA 4LOCA 1LFBA 4AC0A 1OJLA 4C3HJ 4XK4A 3OSFA 2WV1A 3JRAA 1CQTA 2LKXA 2VKVA 3RQIA 3HOYJ 2CUFA 2EQRA 4BBRJ 1IDYA 1B8IA 4A3JJ 3CDLA 1NK2P 2Y2ZA 5FJ8J 1JKRC 3G1LA 5K7FA 2HOTA 3ZQIA 1MBJA 5FLVA 4D5CA 3WHBA 1PUFA 1AHDP 3W6VA 1JUSA 1ZK8A 1BA5A 2XGDA 3ZOBA 3SJMA 2E2JJ 2EZIA 2YUSA 2PMZN 5K7HA 5IYDJ 3BR1A 2X6OA 4GFBA 4G12A 3NAUA 3FKIJ 4A3DJ 1P7IA 1D5YA 5IPAA 2RAEA 4MIMA 3BR5A 3TEDA 1TWHJ 1AU7A 1X2NA 1JUPA 3LSJA 2CU7A 1E3OC 2XGCA 3BR3A 5F27A 4DYQA 2HOAA 2M34A 4M3GA 3C2BA 1F36A 1UHSA 3GTOJ 3TW7A 4ABZA 3LSPA 2GBYA 3BG9A 2Y31A 4B1RA 3LOCA 2R92J 2E2IJ 3GTPJ 2M2EA 2R0QC 1VF9A 2DA1A 2M0CA 2DMUA 2LVSA 2O9LA 1XS9A 3LSRA 3A01B 2ELKA 4UUSB 5FKMA 2O8KA 2AO9A 3SFIA 2FQ4A 3ZQFA 2KT0A 3M3YJ 1LFUP 2FJ1A 4QTRA 4JX4A 1HCRA 2ME6A 3CCYA 2LTPA 4CYCA 3HKZN 3BQZA 1FEXA 1VFCA 5IYCJ 2CUEA 1FJLA 3HEFA 2DA7A 1AKHB 1TC3C 4UUSA 2GM4A 2WB1N 4BBSJ 1HF0A 1F43A 2R5ZB 3Q0WA 4AUXA 3DEWA 2VUMJ 1JUMA 2XPVA 4A3GJ 3S14J 2JJ7A 1YRNA 1JTYA 4JP0A 4BY7J 1ETVA 3HOWJ 3S1NJ 2LFBA 1IV6A 4M3FA 5E3OA 2E2HJ 4A3IJ 2H8RA 1WCMJ 4AYBN 1MBKA 4QIWN 5EG0B 4A3EJ 5FKOA 1ZGWA 3BG5A 2KDZA 3IV5A 5M5YJ 3WHCA 2XB5A 1GVDA 1NTCA 4A3LJ 2YS9A 1ZR2A 2ID6A 4J19A 2NOGA 3H0GJ 3FIWA 1G2HA 1B8IB 3RZDJ 2JWTA 5E3MA 1Z0XA 4V2FA 5BNGA 2LY9A 4CYCB 3HBLA 3M4OJ 1MH3A 3PO3J 1TWCJ 2JA5J 1TWGJ 2DTZA 2IBDA 2R93J 5EF6A 2K9SA 3VPRA 2CJJA 3A02A 5F04A 1U8BA 3FK7A 2DMPA 1YRNB 4C2MJ 2TRTA 1BL0A 3S1QJ 5IYBJ 3HGYA 1JJ8C 3OIOA 5IP7J 5F0FA 2WAQN 2B63J 3F0CA 1BW6A 1TWFJ 3PM1A 2JK3A 5JLXA 1B72A 1X58A 3BTIA 3O8HA 4DZJA 2FX0A 2L7MP 1VNDA 1RKTA 1K61A 1K83J 3QPLA 3JRHA 5C4XJ 4MLOA 1Y1WJ 2Y9YA 1MSFC 2ECBA 2HOSA 5HODA 4L5EA 3DCFA 1GDTA 2G0EA 3B6AA 1MSEC 2CQQA 2GLOA 5K7ZA 3D1NI 1Y1VJ 5F0HA 2ZB9A 3BG3A 1Q1VA 3JRGA 1MNMC 1TWAJ 2JN6A 4BXXJ 2N8GA 2D5VA 1IG7A 2M9HA 1I6HJ 1GUUA 5M5WJ 1T33A 4FISA 3ZQGA 4Y52J 4MFDA 5FKLA 3S16J 3TP0A 1RESA 3OSGA 1GT0C 1IC8A 1B72B 3BTLA 1QRYA 1NK3P 3IH3A 3G1OA 2P81A 3HOZJ 3S2HJ 5FKKA 2ECCA 4RDUA 1LE8A 1HDDC 4XIDA 2L7FP 2X9DA 2L7ZA 1MH4A 2EZKA 1POGA 3JRDA 2M8GX 2K9NA 2Y9ZA 3S15J 2K9QA 3QQAA 2I10A 1ZQ3P 2QCOA 1U9NA 2MG4A 1WI3A 1S7EA 5J1UA 3TW6A 3MVPA 1RKWA 2TCTA 1HDPA 3GTGJ 1JKQC 4B4CA 1WH7A 3I4NJ 2R5YA 1ETQA 3MN2A 4M6VA 5M3MJ 4XRMA 2OF7A 2OPTA 2QF7A 3I4MJ 1XC5A 3JRBA 4IEJA 1MBEA 1FTZA 1MBGA 5M3FJ 1ETOA 1OCTC 2JA8J 2HYJA 4IHWA 1FTTA 3BR0A 4Y7NJ 5EGOB 3GTLJ 3BTCA 1UG2A 3JR9A 5E3LA 1BW5A 2W48A 4UUTA 5F1JA 1H8AC 3A03A 2LD5A 1WGXA 1PUFB 2H1KA 1O4XA 1ETKA 1ETYA 3B6CA 2DA6A 3S1MJ 2XPWA 2Y30A 2XB0X 3HOUJ 5GPAA 1QVTA 4XRSA 1ENHA 2LK2A 1JJ6C 1I3QJ 4DYCA 5J1RA 3BR6A 5GPCA 2JMWA 5EYRA 4X6AJ 1EF4A 4BKXA 1P7JA 3HOVJ 2EH3A 4FE7A 5IP9J 1H88C 3A01A 3QPSA 5DS9A 1OCPA 2XRLA 4HNVA 1HLVA 3RKQA 4D7MA 5F08A 4D7NA 5EEAA 1SANA 4JX6A 1RETA 2NVQJ 1A5JA 1WPKA 2DA4A 5EZHA 4IHVA 2XGEA 1ETXA 4W1UA 3PO2J 1BJZA 4FTHA 2IAIA 1Z77A 3L1PA 1IJWC 2DA5A
chains in the Genus database with same CATH superfamily
2F5FA 4OMZA 1FIPA 4XLFA 2NRAC 1MBFA 3CD6I 9ANTA 3ZQCA 2FOWA 1SFOJ 4OIPF 2L01A 4RA2A 2YU9J 4B3XA 1JT0A 3AL0C 3J81Z 4II3A 2EIJH 3HOXJ 1DUXC 3FXKA 4A69C 2NS0A 4G6DA 4S04A 1G6NA 4DBRA 3C2HA 1FIAA 1GXPA 1D5VA 1FOKA 5AONA 2CV0A 4BXFA 2VKDA 6PAXA 4OMYA 5D4RA 4KIGA 2VC0A 3H3VK 4F92B 3K70C 3PNVA 2CRGA 2R4GA 2KDOA 2EZHA 3HJEA 2GIZA 1A6IA 2JA6J 1IGNA 2NVXJ 3ERED 3CQZJ 3K1NA 1HSTA 2DT6A 1R9TJ 2KPMA 2FBIA 3PSFA 3GTKJ 3RTRA 2R5YB 1QBJA 2HZDA 3HTSB 2DA3A 3T8TA 2KRHA 3S1RJ 1ON1A 1YE9A 4S0HB 5FB2A 1U78A 1ZARA 1H89C 2LF8A 2HVSA 3GTMJ 2FD5A 3HOTA 1FP1D 3K70D 3K4JA 2VKEA 3SDBA 2EFOA 2EZLA 3QOPA 2L9SA 2VI6A 4PGGA 4HQMA 2UXXA 3QPHA 4XICA 1ETWA 2OUMA 4MO7A 4E7LA 2LC2A 5J40A 2GOXB 2NVUB 3OYBA 1Z91A 3OL3A 4DBQA 1VI0A 4PCQA 3VOEA 1D1CA 1U6GA 2BY3A 1OISA 4BE0A 1JXSA 2H09A 1W0UA 2K4BA 2NVYJ 5CVVA 3WTUC 1IUFA 1IRGA 2RV8A 1L0OC 1LE8B 1EV7A 2W4SA 1K7AA 1V5FA 4O3MA 2JVHA 3GTJJ 2CW8A 1MW7A 1XDUA 1DDNA 1X1AA 3GLXA 4A3CJ 1XX5A 2DXIA 3WTWC 5ILVA 1VQNI 5E79C 2DDBA 2J5OA 3GBGA 2VN2A 3DU5A 3RKWA 2JVGA 5TGTA 2VOPA 3HDDA 4P55A 4E7IA 2WY8Q 2MC3A 3BCAA 3DTKA 4H4KC 3FK6A 1V55H 5LRSA 4IHYA 5A2QK 3O8GA 5D5UB 1V4RA 4A0ZA 2KKOA 3ZR8X 3GTQJ 3KP2A 1WJCA 3JREA 4CCMA 2HYGD 3E6MA 2R7ZJ 2NYXA 1VQPI 2FEZA 1U2WA 2KFDA 1WQ2A 2W24A 3R4KA 4ZJZA 1MGTA 3MKWB 2L2OA 5CQGA 4C3JJ 2MABA 3CMMA 2VQLA 4DW6A 3BTJA 3PFIA 2WA0A 1BR2A 1T56A 1I50J 2L3DA 4JX5A 3FWEA 5HVQC 1A31A 3KP4A 5FLXZ 3G3ZA 2E5NA 2V79A 2DU9A 2KP6A 4M9XA 1SFUA 1W0TA 4IHSA 1MJAA 1OJLA 4WXHA 4C3HJ 4MTEA 2VBXA 4XK4A 1YHQI 2NXNB 4F93B 1K4TA 2WAEA 1CQTA 3QP6A 1IV8A 2CMPA 4D1QA 4EATA 1IDYA 5HOOA 4CYDA 1NK2P 5FJ8J 1JKRC 4E7JA 4YFKF 3ZQIA 2XC7A 5FLVA 4EGZA 3JTGA 5K5QA 4F91B 1AHDP 4HSRA 1JUSA 1ZLKA 2A69F 1V5GA 3BWGA 3ZOBA 3SJMA 2BVMA 4EV0A 1X4PA 2E2JJ 3BR1A 2VE8A 1YQAA 3NAUA 4UB6C 3FKIJ 3JAMK 3VEPA 5IPAA 2UV1A 4J00A 1TZLA 2WY7Q 3B73A 5CLSA 2VJIA 4LB5A 3P9IA 4AVPA 4ZDLA 2CU7A 3BR3A 2YX4A 2DQLA 3CUQC 4M3GA 4LK0F 4OIRF 1F36A 3GTOJ 4KICA 5HLIA 1O7LA 2DOAA 2X6YA 2DAOA 4B1RA 1YS7A 2Y31A 5TRDA 4BHPA 2E2IJ 3DWLE 3G2BA 2DA1A 1HW5A 3AG2H 2D45A 1VQ5I 1BIAA 2QQBA 1N77A 4U0WA 3LSRA 3A01B 2FNPA 3FXMA 1GLNA 4CCLA 3X2QH 2G7UA 4CCKA 4CICA 1BR4A 1IW7F 3O6BB 3CCYA 1YIOA 1QA6A 1OYYA 2H6BA 3ZXSA 4ZYGA 1A35A 2XHKA 4B8XA 2FXAA 2CUEA 1NG6A 5DUKA 2JPBA 3HEFA 3I59B 3SZTA 2ZJ2A 2WB1N 3FXRA 4A6DA 1QHHD 4BBSJ 4PFPA 1F43A 2R5ZB 2VASA 3CJNA 3CZ6A 3DEWA 3S93A 2DOEA 2IS6A 2PLYA 2BXYA 2XPVA 4PJJA 1LJ9A 4A3GJ 1S9HA 4PK4A 3S3NA 4XONA 3GZ6A 4G7ZF 1JTYA 1X1DA 1G3SA 4JP0A 4BY7J 3HOWJ 5LFAA 3OYNA 4M73A 2E5ZA 3RI4A 2R7VA 5DCMB 3KP5A 1WCMJ 5LD2C 3GO5A 3BG5A 2KDZA 1K79A 3PQJA 2YU3A 4JQFA 4AM3A 2A6EF 2WC2A 3WTYC 1GVDA 4I7HA 2DW4A 4HBLA 2V1UA 1BI2A 2XAUA 1G2HA 4N4NB 1Z6TA 3TDUC 3V8LA 2XF6A 2JWTA 2FOKA 4V2FA 3SZGA 3KIOA 2F4IA 3HBLA 4XRFA 5CVRA 4WXDA 1LEBA 1FT9A 2EFQA 5BQTA 3CP8A 3PO3J 1TWCJ 3M7GA 1XSDA 2ZJQF 4BEHB 3BROA 3AG3H 2F5VA 4KITB 1UHMA 5F04A 1Y8RB 2R7QA 2WBMA 3FK7A 4C2MJ 2TRTA 4F3QA 5IYBJ 3CLQA 4BHCA 1OYIA 2EINH 2DQRA 2VKHA 2OCEA 2BYVE 2ZSHB 3L2RA 2EJRA 5HS8A 1FWZA 2CO5A 4P9FA 3U9GA 2E1MB 3ZMDA 3O8HA 2FX0A 4EMSA 4NQWB 2L7MP 1RIOH 2CFOA 1VNDA 1VQ7I 1MMSA 1K61A 2KZVA 3QPLA 1YX5A 5A2QZ 3JRHA 2OD5A 5C4XJ 3A0BC 3BJAA 1ZLJA 1QU3A 3LWFA 1W36C 5HODA 3L9FA 3QU6A 3I53A 3BG7A 5D5WB 1MSEC 2GLOA 3J81K 3DF8A 3HPHA 5F0HA 1HQCA 1RI7A 2VL8A 1KYWA 4NQWA 2N8GA 2M9HA 4WF2A 2GIVA 3ZQGA 2EV5A 4MFDA 5FKLA 3S16J 2MLGA 5KHDA 3TGNA 3J7ZI 1MJBA 1RESA 2E35A 4G9YA 1KQ0A 3OSGA 1T39A 4M9ZA 1NK3P 3EYYA 2P81A 3JW4A 4HLYA 3F23A 4KJZA 3L2UA 3M8EA 1R1UA 4UUVA 1LE8A 2OTJI 3KLNA 1ZG5A 3RKXA 2X9DA 4AIHA 1OCOH 2A5WA 3OOPA 3S2WA 4XOTA 4GYIA 1UHWA 3H0DA 1YX3A 3W2AA 2D1HA 2RDPA 2K9QA 2CUZA 3E1SA 4L5IA 2I10A 1ZQ3P 3HRUA 4QPQA 3ZPLA 3E5UA 4U0YA 1WI3A 3Q9VA 1FYMA 1USSA 1RKWA 4LG0B 2LKSA 2GXGA 4BXUA 4XORA 1HDPA 3GFMA 3K1MA 3ML6A 1JKQC 5E8GA 3MN2A 3GYHX 4B44A 3GUDA 3J80Z 5M3MJ 1X4OA 3CTAA 2VB6A 4OU0A 3ZP5A 3ZGKA 2I8DA 2QF7A 3DPLC 3TL4X 2Z33A 4PJLA 2HKOA 3V7RA 2DLLA 5HS9A 5KCMA 3HIFA 2JA8J 2V1XA 1BI1A 3BR0A 1T95A 3KYDB 3ZRGA 3C18A 2A6HF 4PGHA 1VTNC 1K4SA 4M9SA 4RLQA 1UJ8A 2QKLB 2YPRA 1ZN2A 2LYCA 4L9NA 1P4XA 4GYGA 3LFKA 5E3LA 2HPIA 1YW8A 1S8NA 2FBHA 1YO5C 2ZCWA 3I5UA 3A03A 1WJDA 2XAQA 2KJCA 2DDAA 3H3UA 1UFMA 1AWCA 2IRFG 2IA1A 1EA3A 2QQ9A 3S1MJ 1PYVA 1OR7C 4AYBA 2GXAA 3N05A 3K4MA 4XKWA 4EQQA 4CO8A 5L3EA 2MA3A 5ERIA 2Q2EB 4JK1X 2OC6A 5KNLA 3F6VA 1SMTA 2DYSH 2XF5A 1FOYA 4L9JA 3IL2A 4I99C 4HA8A 1D8KA 5GAGJ 2IS1A 1FOWA 3ROUA 3J80K 1T0FC 4BKXA 3HSEA 2H94A 3HOVJ 3DKXA 1WRJA 4FE7A 1P6RA 4WK8F 3RKYA 4ENMA 1U3EM 1FMWA 1G59A 1J9IA 3DP7A 1ZGAA 5F08A 3E3VA 1BI3A 1WJFA 1S72I 2K7LA 4JX6A 4IQ4A 3ECHA 4N0BA 2OQRA 2DO7A 3V42A 5L3GA 3VWBA 2XGEA 4PZJA 1ETXA 4W1UA 1BJZA 2QBYB 3L1PA 3K9TA 2QUFA 4HPQA 4ZC3A 3S2DJ 1JHFA 1IF1A 4LIVA 4CSWA 1FNNA 3VYTB 1T6SA 5C44J 1QVUA 2XV4S 2Z16A 3QODA 5EZGA 4M3DA 4KISA 1B4AA 1DGWY 2Y0SN 3TP3A 3GMEA 2QA4I 5IOYA 3ZQ7A 3LSTA 2JRMA 4XLHA 3F3XA 3QOEA 4Z6YA 2HDWA 2HVQA 2BW3B 2V9KA 2HXOA 4XKVA 4DNCA 3V8JA 3JAMZ 2VONA 4UB8C 5J4VA 1VQOI 2MD0A 2DPUA 3RZOJ 3LL7A 4MFEA 2E1MC 3RYPA 1HKSA 5J3LA 2IXSA 3ZQQA 3FHZA 3RJPA 2E60A 2O5RA 3PNTA 3DV8A 1IXSB 1U5TB 5LGNA 1XMAA 2CV1A 1MNEA 3EYIA 3KPHA 5FLMJ 3BZ6A 4MNUA 3SDGA 1GV2A 2DFFA 4D5FA 3OYDA 1F4KA 3OS2A 2VT3A 4IKFA 3ESWB 2IPQX 3U1KA 1APLC 1FX7A 2UXNA 5DCMA 2VOOA 4LLGF 4RAFA 3EUKL 4UVAA 3CCRI 2BOLA 2HNHA 3ABTA 3OY9A 1B59A 2F2EA 3VDXA 5DM6F 3R0AA 1W5SA 4FX4A 2LR8A 4I02A 1J0RA 3LSGA 4F55A 1RUNA 3K10A 4XLCA 4B3AA 3HOSA 3BT9A 3LA3A 3PIOF 3S32A 2QZ8A 1LUJB 2DMNA 2DA2A 2LBFA 3D5RC 2QENA 4LJZF 1I1GA 2DODA 1OFCX 2DK8A 4A3MJ 1T0FA 1KONA 2X1EA 2LP0A 4ZZDA 4EEFG 4I0AA 2ZO4A 4PUSA 1K78A 4KNYA 4IZZA 1IN6A 5JI6A 4DGWB 1S7AA 3OOUA 1P4AA 4NC8A 4ZYDA 5B5EC 1LQ1A 2QBYA 2DCEA 2WV0A 3OL4A 2PEXA 2MW8A 4RGXA 1SD5A 2IVMA 5IP6A 2DFEA 4CZZA 1KU7A 4RBOA 5FKNA 2EBIA 4ZYEA 3LNQA 4B09A 1MD0A 2L4MA 3PSIA 3FKJA 3CC7I 4RB0A 2CG4A 1S5LC 3Q3SA 1R6RA 3BQYA 4UV9A 2ESNA 3CLOA 2HXIA 4ZTFA 2V1NA 3PFYA 1LNWA 1SVMA 4CXFA 3DU6A 4L5JA 2COBA 5E1XA 4BQOA 1SAUA 4ENNA 3CO7C 4ENJA 2J5PA 1YJWI 1ORKA 2KJBA 5FRNA 2P6SA 3ZQLA 3HM5A 3KP3A 1XMXA 3O2PE 3LSMA 2Z99A 2Q1ZB 4YIFA 4M72A 1ZTRA 1MKMA 2BZTA 2OQGA 2XAGA 1RR7A 1O3RA 1Z7LA 2VPLA 4A5NA 4NC6A 2HDDA 3R61A 2DJNA 1SFKA 2X48A 3T1BA 2HPMA 1H9TA 1FMVA 1V5EA 3C7JA 3GWZA 2DFHA 4LLNA 4ESBA 3MKLA 5JLWA 4DIQA 4C2UA 1PJRA 4RAGA 2PQ8A 4AC0A 1YW9A 3DPTA 2ZFUA 1Y8QB 3HYIA 1HKQA 4Z2YA 3TO7A 2WV1A 4XBFA 3DTEA 3KEQA 2ZXIA 2W84A 5F64A 3EPZA 3LFUA 4TV7A 4ZTJA 4A3JJ 4IQJA 2CUJA 4XQFA 2HOTA 4E7KA 2K85A 4P1WA 5FLXK 2IA2A 1MBJA 1STZA 1WJ5A 2R7OA 1ZK8A 4KIBA 3WG9A 5J4YA 2XGDA 3OIQA 4HEA2 3IRQA 2H1LA 2EZIA 1O3SA 2PMZN 3CMEI 5IYDJ 3NQOA 4BQNA 1SEUA 4G12A 2LSOA 1IN4A 5LGTA 3T8RA 1YG2A 4I09A 2RAEA 3L09A 1OR7A 2LY1A 3BR5A 4J01A 1IN8A 1OKRA 3DBHB 4UV8A 2B9SA 1X2NA 2WWYA 4WCGA 3LSJA 1G3YA 1IN7A 2O8XA 3M1EA 1D1AA 1QO0D 2HOAA 2JUGA 4DYQA 3C2BA 5H6RA 1UHSA 3I55I 2JSPA 2K3PA 4MGRA 2X1CA 4ABZA 4WX9A 2LKPA 3LSPA 1MDMA 2A68F 4YELA 3LOCA 4LG0A 1VZ0A 1AOYA 2R0QC 3CC2I 2M0CA 2PJRB 2XAHA 1JI8A 3WU0A 2O9LA 1XS9A 3FXJA 1KZHA 2ELKA 1SD7A 3CCMI 1MMNA 5FKMA 2HYFA 3DLAA 4CH7A 3S3OA 2RC4A 2O8KA 3AG1H 3SFIA 2FQ4A 2KT0A 2RNJA 4ZDOA 2NNNA 2QGUA 2IGOA 1IUYA 5E1ZB 2MH2A 4NHJA 1VFCA 3PQKA 4HF1A 2VE9A 2E7XA 1R4MB 1TC3C 2RQQA 3IP4B 1XN7A 1Z67A 2VUMJ 3FX3A 2KHMA 2P6TA 4E7HA 3WODF 4BJ5C 4EM0B 3OS1A 3S14J 5EJCA 3T5XA 2K9LA 3S1NJ 5LLQA 2LFBA 1IV6A 1FPQA 1EKEA 2F48A 2LOOA 4M3FA 2E2HJ 4PSWA 5F1RA 3FDYA 1OPCA 2H8RA 3HXLA 1MBKA 5FKOA 4B48A 1ZGWA 3IV5A 3L00A 5M5YJ 4ETSA 1N75A 3NWSA 3MKZA 3BY6A 4BU2A 2ETHA 2LF7A 5D8KB 4P5OA 3R6SA 4MQ9F 3P9CA 1HBXG 2IW5A 5ICEA 2NOGA 3O3KA 3HRSA 4V19K 4ZZLA 1B8IB 2JTVA 4RAZA 3RZDJ 2F4MB 3WGGA 5FFXA 2LY9A 2O03A 3F8BA 4HV5A 4KDPA 4EJTA 4E7ZA 3HG9A 3HZJA 3PNYA 1Z21A 1FY7A 2DTZA 3KETA 5EF6A 5DV5A 5JFRA 3VPRA 1PUEE 3M8FA 1SFEA 3A02A 3SHFA 2K27A 1R4NB 1YRNB 3WTXC 1JJ8C 2EB7A 3CUOA 1ONVA 1TQIA 4HX8A 4CCNA 2CYYA 3QRFF 5F0FA 3T0YA 3WTSC 5FROA 2B63J 2QLZA 2JZYA 2OZUA 3KFWX 2AXTC 2JK3A 5LBQA 3ABKH 3BTIA 4P9UA 4XKBA 1DGRM 3GX4X 2V4JC 1KA8A 1RKTA 3DQVC 1K83J 3V7CA 4IRHA 1BIBA 3MZYA 1X1BA 2HOSA 1X1PA 2ZMEA 3OR2C 2G0EA 3BPXA 1TQPA 3CUQA 1XGOA 2CSOA 4YEJA 5KK1A 5K7ZA 2MC4A 2WADA 4UY8I 3CO6C 2O61A 4LD5A 3BG3A 3W3CA 3Q9SA 2Z3YA 4L9TA 4BXXJ 1HXDA 1Y56A 5GTIC 2HEOA 4DOZA 3TQNA 2M1BA 3VFZA 5D4SA 5M5WJ 1LB2A 4HYEA 2LNBA 4FISA 3FXUA 5J6XA 4Y52J 1MDMB 4IX7A 3ZMTA 1A36A 3H5NA 2DBBA 3CJTB 4IHTA 4N4OB 2RVCA 5HNHA 3A2KA 2HTSA 3HC7A 4LB6B 1GT0C 5HDNA 1B72B 3IH3A 2P4WA 2QKMB 2HQAA 1K78B 1U5TC 1MNDA 2RREA 2M7BA 5FFZA 3IAS2 3E6DA 2K3FA 2L7FP 4ANJA 4YFNF 1R5HA 1MH4A 2CH0A 1YLFA 1POGA 3LQQA 5E20A 2M8EA 3S15J 3K0LA 2E71A 3QQAA 3RIRA 4OOIA 2QCOA 2FMLA 3MD2A 4IJAA 5D6EA 4M6YA 1U9NA 5J1UA 4L18B 2H6CA 3MKYB 4XR6A 4RB2C 4FASD 2W57A 3GTGJ 4A12A 1YIJI 3I4NJ 1M1EB 2R5YA 2ADUA 1D0XA 1LKXA 4M6VA 4NB5A 1D0ZA 5H2FC 4XRMA 1OLTA 4CUGA 1KQ9A 1ON2A 3EUHC 4ZDPA 1UCRA 2FA5A 5HLTA 5L3CA 1MBEA 1FTZA 1MBGA 2JT1A 3OYMA 4CGZA 2HQNA 4KMUX 3G71I 5CYVA 4BDZA 2HYJA 1WHUA 2P5KA 3E5XA 1LPQA 5L3BA 4EGYA 5LHIA 3GTLJ 3BTCA 1UG2A 4XLEA 1ZHFA 2IJLA 3JR9A 1Y39A 1WSUA 2W48A 5H20A 1ACIA 3M8JA 2F5CA 5F1JA 3OYGA 3DKYA 2JPCA 3M1CA 3TO6A 1PUFB 2LREA 1O4XA 1ETKA 1ETYA 3FXQA 5E8IA 1RRJA 2JA2A 2DA6A 3M9AA 2XPWA 2E1NA 1WKMA 2Y30A 2XB0X 1BM9A 5LEJA 1OCZH 1P4WA 4XRSA 2Q8KA 1JJ6C 4PSXA 1I3QJ 1DQUA 2L9NA 5J1RA 3BZCA 4OIOF 3KEYA 3ZMZA 5GPCA 2JMWA 2PJRA 2VIXA 5EYRA 3E97A 3GLLA 4X6AJ 3TDZC 2DOFA 3UNGC 2V26A 2Y69H 4YIRX 4Y17A 5IP9J 1UELB 1H88C 3N4MA 3QPSA 5DS9A 1OCPA 2XRLA 2DFIA 3QYFA 4HRIA 1PP8F 2WTEA 2A61A 1SD6A 2OTLI 4D7NA 3QPTA 2DTRA 4B47A 3E0JB 1WPKA 3SYTA 3CCVI 1MMAA 4O5VA 3W6JB 4FTHA 1SVOA 1HW1A 3AG4H 3CP2A 4XN0A 1FSHA 1TW2A 1XG1A 4C30A 1AKHA 5F0CA 3G6EI 4Y15A 1TT0A 4RM3A 3VB2A 4XKCA 4XSXF 4BEHA 4FHTA 3CCSI 1MMDA 2XSJC 2IEKA 3LAPA 3UR3C 2DN0A 5D6FA 1DU6A 4K2EA 1TNTA 5KAIC 3OYLA 4IRIA 2EFPA 3PUFA 2Y75A 4FCYA 1EH8A 4BY1J 2QEXI 4A93J 3I4PA 5EDNA 4PDKA 2MGQA 1TL8A 1ITYA 2BY2A 4KYWA 1KU2A 4HAMA 1IRZA 3IAM2 5GP9A 2L4AA 4F7ZA 1LEAA 1AA7A 2B0LA 2CW7A 1W4MA 2IP2A 3FISA 2L9RA 2PMUA 4E6KG 5H6QA 1I3AA 1QPMA 2FF4A 1H0MA 3BP8A 2PMZA 3BZKA 2L9VA 3HHGA 2L0KA 3KCCA 2HGCA 2G7HA 4Q48A 5DUIA 4XNFA 1R36A 1RPWA 3LQRA 3SEZA 4A3BJ 1JKOC 1UB9A 3HKZA 4P96A 4KUMA 3OS0A 2R5ZA 2M30A 5GAEJ 2JA7J 2EFNA 3EUHA 2NVTJ 1XD7A 2VQGA 4W97A 4A0YA 2PFBA 2QVOA 1RR8C 1MBHA 4AU7A 4HQEA 2XPUA 1I27A 2VPRA 1IN5A 4A0XA 2QM3A 4U7DA 4L0ZB 1I1SA 4DQ2A 1XTAA 2QQAA 1X2MA 1J5YA 4RB3C 4XLNF 2HOEA 2HS5A 3R60A 3MEXA 3JRFA 1UAAA 4G7OF 4Y4RA 3BC8A 2E36A 1UMQA 3A0HC 1TTYA 1VQLI 2O7OA 4V2GA 1GV5A 1S7OA 3IH2A 2EA4A 3C2GA 3HSRA 3HRTA 4CA0A 1XGNA 4L9VA 1EJ9A 4M74A 2E1OA 1LDDA 5ILSA 4DZPA 1G4DA 3HB9A 4PFOA 5DTDA 2FMYA 1X3ZB 3K2AA 2UWMA 4A6EA 4S05A 2KRCA 3I54A 4LK1F 4WWCA 4Q4ZF 2BHZA 4A3KJ 2VQHA 5IOZA 2STWA 4M3EA 2KIFA 4HNUA 2B7EA 3I3LA 2LLKA 3VODA 1IXRC 2HZTA 2ISYA 2ME0A 2V9PA 3DPUA 4RAYA 3CCEI 4DYRA 1BOBA 3FBNB 2R7FA 4HV6A 2HQ5A 4XSZF 1X1CA 3FZVA 3OYFA 2IS4A 4OWRB 3CC4I 1BJAA 2P7CB 3FM3A 5D5XB 1B1BA 1W7PA 4IPAA 3JSPA 4ZYAA 3EETA 3KYLA 2F5DA 3P7NA 4LLLA 4QSHA 5JVTA 1YJ9I 4BE1A 4HDUA 1Z1DA 4XRSG 2AHQA 5KVRA 2KIQA 4IF4A 2DMTA 2XSDC 3KE2A 4BL0B 1ZR4A 2DJIA 3E7LA 3H9QA 3SQNA 4I6ZA 4ENKA 1H9GA 4X1EA 2ESHA 1R22A 3ZQHA 3L2VA 1LFBA 3IWFA 3A1YA 3BLYA 1Z6RA 3RPUA 1T08B 1VQMI 2LKXA 3HOYJ 2CUFA 2EQRA 3ZMSA 4M71A 2R7DA 3FF5A 2Y2ZA 2ZXWH 3G1LA 5J47A 4HZFA 1I5ZA 5K7FA 2CGPA 5BPIA 4ESJA 4JOMA 4EJUA 1BA5A 3W6VA 2FBKA 1W1WE 3CCQI 1B9NA 1IZ1A 3WTZA 2AQEA 1IRFA 2YUSA 5K7HA 4HX4A 2X6OA 4GFBA 4A3DJ 3IRRA 2DPDA 5FD5A 3QP5A 2F5EA 2MBFA 5DD8A 3LA2A 3ABMH 1Z3XA 1X3UA 4YIIA 1E3OC 2DT7B 2X6WA 1A6QA 1S6LA 3BCBA 3TOAA 2YX7A 1E3PA 1V3FA 1CGPA 1OQYA 5L3FA 3TW7A 1J09A 4BUPA 2GBYA 5HS7A 4LIUA 1J75A 1R5ID 5LGUA 4FT8A 5FO5A 2EFWA 1J59A 2R92J 4BQQA 1VF9A 4IL6C 4R8HA 1MJ9A 2V7FA 5B1AH 4CHUA 3F8FA 2AO9A 3CCUI 3ZQFA 3M3YJ 1LFUP 4LG3A 2UZKA 2FE3A 2FJ1A 4NUBA 3FBIB 4JX4A 4Q47A 1O3TA 5BMZA 5GADJ 1P9QC 2ME6A 3RYRA 2YR2A 2ELJA 2IS2A 4CYCA 2A07F 4BAYA 2IA0A 4AIJA 2MLKA 1FJLA 1ZREA 2ZNZA 2AQFA 3GEZA 1AKHB 2DA7A 2XDVA 3RPUD 3ZN1A 1PVEA 1HF0A 1E0EA 2STTA 3F22A 4RM2A 3Q0WA 1D1BA 5CQEA 4AUXA 3MZ8A 3OYJA 4G8XA 3F8CA 3H5AA 2A5YB 4A5MA 2GQQA 2XKOA 5FGMA 4KMFA 1I6XA 4ESFA 2JJ7A 4KA4A 3RSNA 1IXCA 1ETVA 4ON0A 3TOBA 2HU9A 2EPFA 1U5TA 2R3SA 1X19A 3ASNH 5E3OA 2PMHA 4A3IJ 2H8WA 4II2A 3EQLF 4ZYHA 2COMA 3MCZA 1R7JA 5EG0B 2GA1A 3VYSB 3RCOA 3VSKA 1YW7A 1T98A 2GA2A 3WHCA 2OA4A 1FC3A 2ZKZA 3DEUA 4HX7A 1NHAA 1WZ2A 4OINF 1MZBA 2OCCH 2DT5A 2E7WA 2Q2EA 1ZR2A 2ID6A 1KQ8A 2EA2A 3F21A 2DK5A 4ZH4F 4J19A 2IGNA 2IGKA 1UG0A 4HF2A 1WFXA 1VQ6I 2VODA 1DPRA 3R0JA 2AXLA 3ABUA 1U0JA 4PJMA 5BNGA 4CYCB 3LAJA 2VXZA 2ZNYA 4Y3OA 1MIJA 2D1VA 1FP2A 2JA5J 3S8PA 1TWGJ 2KL4A 2IBDA 2R93J 2K9SA 4YFXF 2CJJA 4IVNA 2R7TA 1W5TA 1XDSA 1U8BA 3N97A 3S1QJ 1OCRH 1W36D 2L02A 5IP7J 3I9V2 3OWTA 3U2RA 1ZYRF 4G7HF 4GDFA 3F0CA 2KIUA 4U0VA 2VJ4A 1TWFJ 3PM1A 1RC9A 5JLXA 4BJTA 1X58A 1GVJA 1B72A 4DZJA 1G8XA 3CF2A 4MHGA 3BDDA 2VBZA 5ICCA 4MLOA 2I5UA 1MSFC 1QNTA 1RZ4A 2ECBA 2DYRH 2P7VB 3LMMA 1VQKI 3DCFA 2ZFWA 3B6AA 1K6YA 3HL2A 3QYEA 1FYLA 2JRTA 4RS8A 1HW2A 1Y1VJ 2R7WA 2W25A 1MNMC 1Q1VA 2MFZA 1IG7A 2D5VA 1I6HJ 3KYCB 1J2XA 3QYBA 1GUUA 1T33A 1N78A 2CS3A 2QSHX 3AKZA 1V54H 5LHGA 1O3QA 3TP0A 4E70A 3TO9A 1UZCA 1PP7U 1IAWA 4ASNA 4R1HA 2PN6A 1HA8A 1IC8A 3BTLA 1QRYA 3WE2A 5CVIA 3HOZJ 2BV6A 2ZBKA 3HHHA 2ECCA 1D3YA 1LVAA 1Q1HA 3M07A 2VXDA 3OYAA 3ASOH 1HDDC 3ECOA 1REPC 3E6BA 1NG7A 3ISPA 4LGWA 1TBXA 2UUZA 2L7ZA 3L7WA 5K5RA 1BN5A 3ZMVA 2K9NA 3WE3A 3ZN0A 2Y9ZA 4QPOA 1IRXA 3WTTC 5CVJA 5ILUA 4HF0A 4YG2F 4EJVA 3BJOA 3C1DA 1S7EA 1T8IA 3VSLA 3MVPA 2BVLA 2TCTA 1ZAOA 2KRFA 1KGSA 4B4CA 5EEGA 1W7PD 3HRMA 3AFHA 3B02A 2NNYA 4JBAA 4HOBA 3W6KB 3QU3A 3JSOA 2OF7A 2ZXHA 2OPTA 2ZXJA 3DBLB 2MH9A 4QWQA 1XC5A 3IKTA 3JRBA 2ZJRF 3TBIA 4U7BA 3MQ0A 1GXQA 4FX0A 4IEJA 1XPXA 2R7UA 5M3FJ 5TJJA 1FBSA 4L0YB 3COAC 4IXAA 3MWMA 1OYWA 4AIDA 4IHWA 1FTTA 1R71A 4G6TB 5L3DA 4Y7NJ 2V6CA 2WB1A 3KLOA 5EGOB 3GW2A 1BW5A 5BS6A 2LD5A 1BBYA 1WGXA 4CZCA 4RGRA 1BC8C 1N25A 2E34A 1GHCA 2XAFA 3HOUJ 1OMIA 2GZWA 4UVBA 5E18F 1ENHA 2LK2A 5JR3A 2K02A 1TT5B 2XUBA 1T38A 1QQIA 2VBYA 2HVRA 2LH9A 4RGSA 3ERMA 3BR6A 4GGGA 2CQ7A 3LSIA 1WVRA 3I0TA 1LVKA 1WJAA 4ITVA 3RPQA 3HUGB 2P0WA 3E6CC 2OJED 1FYKA 4DJAA 1YOVB 4HNVA 1QHGA 1E2XA 1KU3A 2VC1A 1HLVA 4D7MA 3FXLA 3OYKA 4N9HA 3NEUA 2A05A 5EEAA 1SANA 1J7KA 2R7XA 3NRVA 1JE8A 1RETA 5EZHA 4IHVA 1P2FA 2LY2A 3PO2J 2IAIA 3K4CA 1IJWC 1R1VA 1JTXA 2W00A 5C3EJ 2RN7A 4RB1A 1ZKGA 2JUCA 4A3FJ 3E5QA 2L7KA 3PIPF 1Y0UA 4G94A 2K4JA 2RQPA 1R00A 1JGGA 4XM3A 3KZZA 1YFHA 2ID3A 3FHNA 4NDLA 3SFZA 1YITI 2VJJA 3CCJI 3HTUA 3U21A 1DU0A 1E17A 2IGMA 1IDZA 2BW3A 3F72A 2HTJA 3HPGA 4XN3A 3WG7H 2M7AA 2CFXA 3J7AO 5B1BH 2K5CA 3FM5A 3EDPA 3BOQA 4PJNA 3HGGA 3K6GA 4U88A 2F6CA 2LRDA 5B66C 1RNLA 4F52A 3Q0UA 3K4KA 2FU4A 4MQVA 5EGOA 1QZZA 1WWXA 5LRRA 5EG0A 3GVAA 2ISZA 3P5JA 1TNSA 5GTHC 2Z1DA 2P5LC 2DMQA 2A3SA 2M4KA 1QGPA 3CMYA 4MEXF 4YRVA 1FLIA 1Z05A 3WU1B 2TDXA 3NARA 1WH5A 2V1DA 3IH4A 2XAJA 2Z9OA 2O0YA 1ZRCA 1D8JA 1VQ8I 1JT6A 2CQXA 3DTIA 4H0EA 3H9JA 3F8NA 3TMOA 4E4HA 5J1YA 3H9GA 3UKGA 1WJBA 3HUGA 5J8CA 1SAXA 1KU9A 3Q0VA 2EILH 5ED4A 5F6FA 1ULYA 5M5XJ 2GWRA 2MD5A 4EVIA 5C4JJ 1SFXA 1ODDA 3MZHA 3W2WA 4IHXA 1NH3A 3QAHA 1QZYA 2EV0A 4Q5SF 2V9VA 1ZELA 3FXOA 4XLAA 2HR3A 5FD6A 5JHUA 1ZG3A 3L2QA 3S17J 2BE5F 3EUAA 5E3NA 4X0GA 3WU2C 2D2WA 2VQCA 3KEOA 3LSKA 4D9JA 2V6EA 3D0SA 2OZ6A 1B6AA 1OCCH 1U9OA 2HKXA 2K86A 1U8RA 2X6XA 5DEQA 2HI3A 2MSYA 1HOMA 2OV7A 1R58A 2E19A 3JRIA 3JRCA 2PI0A 1QPIA 4JYKA 2MYSA 2NS8A 4GXOA 4M3BA 5LEKA 3K7AJ 3OMYA 3KX2A 2O3FA 3FMSA 3OYEA 4UXNA 2PX9A 1SVLA 3OYCA 2G9WA 2XASA 3VYRB 1F5TA 2DI3A 3JCUC 2QQ8A 3A4CA 1JGSA 1EH6A 4FE4A 3G1MA 2XVCA 2EV6A 1DP3A 3LA7A 2FQ3A 2NS7A 3LSHA 4UHTA 3REOA 4BHBA 4BACA 2W85A 3BR2A 2K40A 3IUOA 2X1DA 3BPVA 2CWEA 5CPRB 2A6TA 3WGIA 2BY0A 2HDCA 3DFGA 3K4BA 3VYUB 1E3HA 1JKPC 4LITA 5E17F 4C9YA 4I76A 4C3IJ 4LOCA 1YS6A 1XSXA 3OSFA 3DBRB 1FZPB 4CCJA 3JRAA 3V7SA 2VKVA 3RQIA 5IT3A 3L2CA 4BBRJ 1B8IA 4NBQA 3CDLA 4GCVA 4XLPF 2X0LA 2EK5A 4Y13A 1FBQA 3GZ5A 4D5CA 3WHBA 1PUFA 3I64A 4CDGA 4EJOA 4GO1A 2ICWG 3OYHA 2KZGA 4BH9A 4NC7A 3GCMA 1P7IA 1D5YA 3ULQB 4GRIA 2OAZA 1HSJA 3F6OA 5EEHA 4MIMA 3J7AY 5IT9K 3JTHA 3TEDA 1ZRDA 3Q5FA 1TWHJ 2GOMA 1AU7A 3G73A 4AVZA 4UNOA 1JUPA 2KMUA 3DXJF 2RKHA 2XGCA 4EM2A 5F27A 3QWLA 2M34A 2YSRA 3K4NA 4KT5C 5AIPA 2Z5UA 5HLGA 3KZIC 3KZYA 4MTDA 3P9KA 3MAJA 1P92A 3HSFA 4HDVA 2FNAA 4BJ6C 3BG9A 4AWXB 2WAFA 4EM1A 4FETA 3GTPJ 1A04A 2M2EA 3C3WA 1CF7A 3CJRB 3WTVC 2DMUA 2ELHA 2LVSA 4OAZA 3ZMUA 1G3WA 3IWZA 4G6QA 2CQKA 4UUSB 1RUOA 3OV8A 1WJEA 5CJ9A 1ERDA 1R49A 4BE2A 2X85A 1W7PB 2VBWA 2M5WA 1X3WB 4QTRA 1DPUA 2M45A 1HKTA 1IO2A 4LMYA 1HCRA 4N9IA 3CCLI 2LTPA 3IKVA 2CW0F 3RDIA 1TLHB 3HKZN 3BQZA 2O6GE 1FEXA 3PL8A 5IYCJ 3PUBA 3H3ZA 1L3LA 3SZPA 5DCFA 4BDYA 2GM4A 4UUSA 3BJ6A 2QWWA 4KN7X 2ACJA 2K9MA 1JUMA 4HLXA 1CF7B 1YRNA 2OBPA 4KN4X 3G4SI 1KYZA 2HFHA 3CJQB 3KP6A 5ICFA 1DP7P 1G3TA 3H36A 1XGMA 2RNGA 2LMDA 1C0WA 1XSVA 5KAFC 3ONQA 4AYBN 4QIWN 4A3EJ 2W7NA 5K1YA 2RGVA 1D0YA 3J7YJ 3AAFA 1ZH5A 2XB5A 5CVUA 1XCVA 1QZEA 4RLFA 1NTCA 2BEOA 2XKPA 4B43A 2YS9A 2W82A 1YJNI 4A3LJ 1BI0A 2FUG2 2VT2A 2HQRA 1TQMA 5CKTA 4BQAA 3CDIA 2FSWA 3L2WA 3H0GJ 2BY1A 3FIWA 4KIFA 3CF5F 4BNCA 4RMNA 2CV2A 4XMYA 2EIMH 3FMQA 1VQ4I 1T2KA 1Z3YA 1SC7A 5JVGF 2LDUA 5E3MA 1Z0XA 3DEEA 3I71A 1F9NA 4OAYA 4R79A 5BOXA 4QLCU 4BYYA 3GXOA 3IC7A 3ZCOA 3M4OJ 2QSGX 1MH3A 3CMAI 4C2TA 1SD4A 3WGHA 2EIKH 2DMPA 1BL0A 3HGYA 5B3SH 2OU2A 4I2OA 2M87A 3OIOA 3OR1C 2HWVA 2VJ5A 2WAQN 3H35A 2CQNA 1BW6A 5DD4A 4I98B 2ZC2A 2ZMEC 2PG4A 3KP7A 3ELKA 3SEQA 5BPDA 3DKWA 2JQ7A 4XL9A 2ZSIB 5J8FA 5LHHA 2L5QA 1ZG1A 3D5LA 2Y9YA 1Y1WJ 2FRHA 1O7FA 2AS5F 1O57A 1FOXA 1PDNC 1EH7A 3I56I 3CUQB 1JHHA 4L5EA 1Z9CA 1B9MA 1GDTA 5HLHA 2Z2SB 2CQQA 5HDGA 4AD9A 3D1NI 2M4GA 4D0PA 2ZB9A 4M6XA 1VQ9I 3JRGA 1TWAJ 2JN6A 1WI9A 2KQRA 4IOAF 4KFCA 2W1OA 1XCBA 4KT6A 3MFKA 5D8LB 1XGSA 2NAZA 2M3AA 2NOJB 2P8TA 3K2ZA 1TW3A 1FBUA 3G1OA 1USTA 2Y0MA 1Z7UA 2LG4A 4IOCF 2Y48A 3S2HJ 3DLLF 5FKKA 3F8MA 4RDUA 4I0BA 1Y0NA 4E7SA 4XIDA 3W2VA 3ABLH 2R7RA 4A2UA 3RQ4A 3V4GA 1SMYF 2Q0OA 2EZKA 3JRDA 2M8GX 4EJWA 1YYVA 3BG6A 5FRMA 1W5CC 2PJPA 2KIMA 2BBYA 2BHYA 4NNJA 1TP4A 1BC7C 4LFUA 2MG4A 3TW6A 4HG2A 3V8KA 1ZGJA 5IT9Z 2PBIA 5JHFA 2X4HA 3S3MA 1WH7A 1LDJA 5D5VB 1YTYA 2KLOA 2QYOA 1ETQA 2BXZA 5HDKA 3NWTA 4I01A 3AL0B 3K1PA 4UVCA 5TISC 4IRGA 5K5OA 1BR1A 1LDKB 4WXCA 3MMYB 4CCOA 3CESA 3I4MJ 1ETOA 2KISA 3PJRA 4U87A 3H1CA 3K4LA 3H5RA 1OCTC 3FMRA 5E1WA 2P5VA 2C6YA 1XB4A 1R23A 5HNFA 3IHUA 2GAUA 4RGUA 2H27A 1HC8A 3I59A 4UUTA 3F9KA 5DYMA 4BGDA 4HW0A 4BS9A 1H8AC 4XOPA 2R7SA 4AIKA 1MMGA 1ZRFA 2H1KA 3GF2A 3B6CA 1FSEA 5DDGA 2X51A 1I39A 2XF7A 4FQGA 4PJ0C 2QSFX 1LFPA 4IO9F 4MEYF 1K6OA 4O6JA 1YI2I 2E1CA 5GPAA 4Y33A 4OIQF 5GAHJ 1QVTA 3OYIA 3K69A 1R5GA 1S29A 1Y6IA 4DYCA 2Y0SA 3D5SC 2ZJPF 1S3JA 3H92A 3U1DA 1R1TA 2LBFB 1EF4A 2VLAA 3GFLA 2ZMEB 2IT0A 1P7JA 2EH3A 3GZNB 2WAQA 3I58A 5IY5H 3A01A 2XGXA 2XIGA 2XROA 3CDHA 4HNTA 2EWNA 3RKQA 3GFIA 5DM7F 5AIQA 1F1ZA 2JSCA 4HSTA 2L54A 1XMKA 2NVQJ 1A5JA 1BOAA 2DA4A 3GFJA 2GXBA 5ICGA 2F4OB 3SXYA 2XRNA 2BGCA 3OIPA 1Z77A 2M0MA 3TKYA 2DA5A
chains in the Genus database with same CATH topology
3S2DJ 1FIPA 1XG1A 1JTXA 1AKHA 5F0CA 1MBFA 5C3EJ 1ZKGA 5C44J 3ZQCA 4A3FJ 9ANTA 1QVUA 1SFOJ 2IEKA 2YU9J 5EZGA 4M3DA 2DN0A 2Y0SN 3TP3A 1DU6A 1JT0A 3HOXJ 1JGGA 4A69C 5IOYA 2ID3A 4NDLA 4FCYA 4A93J 4BY1J 1DU0A 1IDZA 2HXOA 5EDNA 1FIAA 2MGQA 1ITYA 3RZOJ 1IRZA 3H3VK 4MFEA 5GP9A 5J3LA 3HGGA 2CRGA 3FISA 3Q0UA 2EZHA 5EGOA 2JA6J 1A6IA 2L9RA 1IGNA 2NVXJ 5FLMJ 3CQZJ 3SDGA 1GV2A 5EG0A 4D5FA 1R9TJ 2DMQA 2L0KA 2R5YB 3GTKJ 1APLC 2DA3A 3CMYA 3NARA 3S1RJ 1WH5A 3IH4A 1RPWA 4S0HB 1U78A 4A3BJ 1JKOC 2LR8A 1H89C 3LSGA 3GTMJ 1JT6A 2CQXA 2FD5A 2R5ZA 4B3AA 2JA7J 3BT9A 2VKEA 2NVTJ 5J1YA 4W97A 3UKGA 2EZLA 1MBHA 2DMNA 2DA2A 2VI6A 2XPUA 2VPRA 3Q0VA 5M5XJ 4XICA 1OFCX 4A3MJ 1ETWA 4MO7A 5C4JJ 1X2MA 2LP0A 4IHXA 4EEFG 3JRFA 1VI0A 1UMQA 1W0UA 2NVYJ 3OOUA 1IUFA 2O7OA 1LE8B 3S17J 4V2GA 1GV5A 3IH2A 5E3NA 2MW8A 5IP6A 3GTJJ 4RBOA 5FKNA 2EBIA 4A3CJ 2E1OA 3LNQA 4DZPA 1U9OA 3HB9A 5DTDA 2HI3A 3GBGA 2MSYA 1HOMA 2E19A 3K2AA 3JRIA 3Q3SA 3JRCA 4A3KJ 3HDDA 1QPIA 3BQYA 4JYKA 2HXIA 5IOZA 2NS8A 3FK6A 4M3BA 3K7AJ 4M3EA 4IHYA 2COBA 2LLKA 3O8GA 2ME0A 4DYRA 3GTQJ 2HQ5A 1ORKA 3JREA 3ZQLA 3HM5A 2R7ZJ 4FE4A 3G1MA 4QSHA 2NS7A 4C3JJ 1ZTRA 3BR2A 4XRSG 2AHQA 2K40A 4DW6A 3BTJA 1RR7A 2DMTA 2XSDC 2HDDA 1T56A 1I50J 2DJNA 4JX5A 2X48A 1ZR4A 3E7LA 4I6ZA 3MKLA 4X1EA 5JLWA 1JKPC 1W0TA 4I76A 4C3IJ 3ZQHA 4LOCA 1LFBA 4AC0A 1OJLA 4C3HJ 4XK4A 3OSFA 2WV1A 3JRAA 1CQTA 2LKXA 2VKVA 3RQIA 3HOYJ 2CUFA 2EQRA 4BBRJ 1IDYA 1B8IA 4A3JJ 3CDLA 1NK2P 2Y2ZA 5FJ8J 1JKRC 3G1LA 5K7FA 2HOTA 3ZQIA 1MBJA 5FLVA 4D5CA 3WHBA 1PUFA 1AHDP 3W6VA 1JUSA 1ZK8A 1BA5A 2XGDA 3ZOBA 3SJMA 2E2JJ 2EZIA 2YUSA 2PMZN 5K7HA 5IYDJ 3BR1A 2X6OA 4GFBA 4G12A 3NAUA 3FKIJ 4A3DJ 1P7IA 1D5YA 5IPAA 2RAEA 4MIMA 3BR5A 3TEDA 1TWHJ 1AU7A 1X2NA 1JUPA 3LSJA 2CU7A 1E3OC 2XGCA 3BR3A 5F27A 4DYQA 2HOAA 2M34A 4M3GA 3C2BA 1F36A 1UHSA 3GTOJ 3TW7A 4ABZA 3LSPA 2GBYA 3BG9A 2Y31A 4B1RA 3LOCA 2R92J 2E2IJ 3GTPJ 2M2EA 2R0QC 1VF9A 2DA1A 2M0CA 2DMUA 2LVSA 2O9LA 1XS9A 3LSRA 3A01B 2ELKA 4UUSB 5FKMA 2O8KA 2AO9A 3SFIA 2FQ4A 3ZQFA 2KT0A 3M3YJ 1LFUP 2FJ1A 4QTRA 4JX4A 1HCRA 2ME6A 3CCYA 2LTPA 4CYCA 3HKZN 3BQZA 1FEXA 1VFCA 5IYCJ 2CUEA 1FJLA 3HEFA 2DA7A 1AKHB 1TC3C 4UUSA 2GM4A 2WB1N 4BBSJ 1HF0A 1F43A 2R5ZB 3Q0WA 4AUXA 3DEWA 2VUMJ 1JUMA 2XPVA 4A3GJ 3S14J 2JJ7A 1YRNA 1JTYA 4JP0A 4BY7J 1ETVA 3HOWJ 3S1NJ 2LFBA 1IV6A 4M3FA 5E3OA 2E2HJ 4A3IJ 2H8RA 1WCMJ 4AYBN 1MBKA 4QIWN 5EG0B 4A3EJ 5FKOA 1ZGWA 3BG5A 2KDZA 3IV5A 5M5YJ 3WHCA 2XB5A 1GVDA 1NTCA 4A3LJ 2YS9A 1ZR2A 2ID6A 4J19A 2NOGA 3H0GJ 3FIWA 1G2HA 1B8IB 3RZDJ 2JWTA 5E3MA 1Z0XA 4V2FA 5BNGA 2LY9A 4CYCB 3HBLA 3M4OJ 1MH3A 3PO3J 1TWCJ 2JA5J 1TWGJ 2DTZA 2IBDA 2R93J 5EF6A 2K9SA 3VPRA 2CJJA 3A02A 5F04A 1U8BA 3FK7A 2DMPA 1YRNB 4C2MJ 2TRTA 1BL0A 3S1QJ 5IYBJ 3HGYA 1JJ8C 3OIOA 5IP7J 5F0FA 2WAQN 2B63J 3F0CA 1BW6A 1TWFJ 3PM1A 2JK3A 5JLXA 1B72A 1X58A 3BTIA 3O8HA 4DZJA 2FX0A 2L7MP 1VNDA 1RKTA 1K61A 1K83J 3QPLA 3JRHA 5C4XJ 4MLOA 1Y1WJ 2Y9YA 1MSFC 2ECBA 2HOSA 5HODA 4L5EA 3DCFA 1GDTA 2G0EA 3B6AA 1MSEC 2CQQA 2GLOA 5K7ZA 3D1NI 1Y1VJ 5F0HA 2ZB9A 3BG3A 1Q1VA 3JRGA 1MNMC 1TWAJ 2JN6A 4BXXJ 2N8GA 2D5VA 1IG7A 2M9HA 1I6HJ 1GUUA 5M5WJ 1T33A 4FISA 3ZQGA 4Y52J 4MFDA 5FKLA 3S16J 3TP0A 1RESA 3OSGA 1GT0C 1IC8A 1B72B 3BTLA 1QRYA 1NK3P 3IH3A 3G1OA 2P81A 3HOZJ 3S2HJ 5FKKA 2ECCA 4RDUA 1LE8A 1HDDC 4XIDA 2L7FP 2X9DA 2L7ZA 1MH4A 2EZKA 1POGA 3JRDA 2M8GX 2K9NA 2Y9ZA 3S15J 2K9QA 3QQAA 2I10A 1ZQ3P 2QCOA 1U9NA 2MG4A 1WI3A 1S7EA 5J1UA 3TW6A 3MVPA 1RKWA 2TCTA 1HDPA 3GTGJ 1JKQC 4B4CA 1WH7A 3I4NJ 2R5YA 1ETQA 3MN2A 4M6VA 5M3MJ 4XRMA 2OF7A 2OPTA 2QF7A 3I4MJ 1XC5A 3JRBA 4IEJA 1MBEA 1FTZA 1MBGA 5M3FJ 1ETOA 1OCTC 2JA8J 2HYJA 4IHWA 1FTTA 3BR0A 4Y7NJ 5EGOB 3GTLJ 3BTCA 1UG2A 3JR9A 5E3LA 1BW5A 2W48A 4UUTA 5F1JA 1H8AC 3A03A 2LD5A 1WGXA 1PUFB 2H1KA 1O4XA 1ETKA 1ETYA 3B6CA 2DA6A 3S1MJ 2XPWA 2Y30A 2XB0X 3HOUJ 5GPAA 1QVTA 4XRSA 1ENHA 2LK2A 1JJ6C 1I3QJ 4DYCA 5J1RA 3BR6A 5GPCA 2JMWA 5EYRA 4X6AJ 1EF4A 4BKXA 1P7JA 3HOVJ 2EH3A 4FE7A 5IP9J 1H88C 3A01A 3QPSA 5DS9A 1OCPA 2XRLA 4HNVA 1HLVA 3RKQA 4D7MA 5F08A 4D7NA 5EEAA 1SANA 4JX6A 1RETA 2NVQJ 1A5JA 1WPKA 2DA4A 5EZHA 4IHVA 2XGEA 1ETXA 4W1UA 3PO2J 1BJZA 4FTHA 2IAIA 1Z77A 3L1PA 1IJWC 2DA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D J;  1FIP A;  1XG1 A;  1JTX A;  1AKH A;  5F0C A;  1MBF A;  5C3E J;  1ZKG A;  5C44 J;  3ZQC A;  4A3F J;  9ANT A;  1QVU A;  1SFO J;  2IEK A;  2YU9 J;  5EZG A;  4M3D A;  2DN0 A;  2Y0S N;  3TP3 A;  1DU6 A;  1JT0 A;  3HOX J;  1JGG A;  4A69 C;  5IOY A;  2ID3 A;  4NDL A;  4FCY A;  4A93 J;  4BY1 J;  1DU0 A;  1IDZ A;  2HXO A;  5EDN A;  1FIA A;  2MGQ A;  1ITY A;  3RZO J;  1IRZ A;  3H3V K;  4MFE A;  5GP9 A;  5J3L A;  3HGG A;  2CRG A;  3FIS A;  3Q0U A;  2EZH A;  5EGO A;  2JA6 J;  1A6I A;  2L9R A;  1IGN A;  2NVX J;  5FLM J;  3CQZ J;  3SDG A;  1GV2 A;  5EG0 A;  4D5F A;  1R9T J;  2DMQ A;  2L0K A;  2R5Y B;  3GTK J;  1APL C;  2DA3 A;  3CMY A;  3NAR A;  3S1R J;  1WH5 A;  3IH4 A;  1RPW A;  4S0H B;  1U78 A;  4A3B J;  1JKO C;  2LR8 A;  1H89 C;  3LSG A;  3GTM J;  1JT6 A;  2CQX A;  2FD5 A;  2R5Z A;  4B3A A;  2JA7 J;  3BT9 A;  2VKE A;  2NVT J;  5J1Y A;  4W97 A;  3UKG A;  2EZL A;  1MBH A;  2DMN A;  2DA2 A;  2VI6 A;  2XPU A;  2VPR A;  3Q0V A;  5M5X J;  4XIC A;  1OFC X;  4A3M J;  1ETW A;  4MO7 A;  5C4J J;  1X2M A;  2LP0 A;  4IHX A;  4EEF G;  3JRF A;  1VI0 A;  1UMQ A;  1W0U A;  2NVY J;  3OOU A;  1IUF A;  2O7O A;  1LE8 B;  3S17 J;  4V2G A;  1GV5 A;  3IH2 A;  5E3N A;  2MW8 A;  5IP6 A;  3GTJ J;  4RBO A;  5FKN A;  2EBI A;  4A3C J;  2E1O A;  3LNQ A;  4DZP A;  1U9O A;  3HB9 A;  5DTD A;  2HI3 A;  3GBG A;  2MSY A;  1HOM A;  2E19 A;  3K2A A;  3JRI A;  3Q3S A;  3JRC A;  4A3K J;  3HDD A;  1QPI A;  3BQY A;  4JYK A;  2HXI A;  5IOZ A;  2NS8 A;  3FK6 A;  4M3B A;  3K7A J;  4M3E A;  4IHY A;  2COB A;  2LLK A;  3O8G A;  2ME0 A;  4DYR A;  3GTQ J;  2HQ5 A;  1ORK A;  3JRE A;  3ZQL A;  3HM5 A;  2R7Z J;  4FE4 A;  3G1M A;  4QSH A;  2NS7 A;  4C3J J;  1ZTR A;  3BR2 A;  4XRS G;  2AHQ A;  2K40 A;  4DW6 A;  3BTJ A;  1RR7 A;  2DMT A;  2XSD C;  2HDD A;  1T56 A;  1I50 J;  2DJN A;  4JX5 A;  2X48 A;  1ZR4 A;  3E7L A;  4I6Z A;  3MKL A;  4X1E A;  5JLW A;  1JKP C;  1W0T A;  4I76 A;  4C3I J;  3ZQH A;  4LOC A;  1LFB A;  4AC0 A;  1OJL A;  4C3H J;  4XK4 A;  3OSF A;  2WV1 A;  3JRA A;  1CQT A;  2LKX A;  2VKV A;  3RQI A;  3HOY J;  2CUF A;  2EQR A;  4BBR J;  1IDY A;  1B8I A;  4A3J J;  3CDL A;  1NK2 P;  2Y2Z A;  5FJ8 J;  1JKR C;  3G1L A;  5K7F A;  2HOT A;  3ZQI A;  1MBJ A;  5FLV A;  4D5C A;  3WHB A;  1PUF A;  1AHD P;  3W6V A;  1JUS A;  1ZK8 A;  1BA5 A;  2XGD A;  3ZOB A;  3SJM A;  2E2J J;  2EZI A;  2YUS A;  2PMZ N;  5K7H A;  5IYD J;  3BR1 A;  2X6O A;  4GFB A;  4G12 A;  3NAU A;  3FKI J;  4A3D J;  1P7I A;  1D5Y A;  5IPA A;  2RAE A;  4MIM A;  3BR5 A;  3TED A;  1TWH J;  1AU7 A;  1X2N A;  1JUP A;  3LSJ A;  2CU7 A;  1E3O C;  2XGC A;  3BR3 A;  5F27 A;  4DYQ A;  2HOA A;  2M34 A;  4M3G A;  3C2B A;  1F36 A;  1UHS A;  3GTO J;  3TW7 A;  4ABZ A;  3LSP A;  2GBY A;  3BG9 A;  2Y31 A;  4B1R A;  3LOC A;  2R92 J;  2E2I J;  3GTP J;  2M2E A;  2R0Q C;  1VF9 A;  2DA1 A;  2M0C A;  2DMU A;  2LVS A;  2O9L A;  1XS9 A;  3LSR A;  3A01 B;  2ELK A;  4UUS B;  5FKM A;  2O8K A;  2AO9 A;  3SFI A;  2FQ4 A;  3ZQF A;  2KT0 A;  3M3Y J;  1LFU P;  2FJ1 A;  4QTR A;  4JX4 A;  1HCR A;  2ME6 A;  3CCY A;  2LTP A;  4CYC A;  3HKZ N;  3BQZ A;  1FEX A;  1VFC A;  5IYC J;  2CUE A;  1FJL A;  3HEF A;  2DA7 A;  1AKH B;  1TC3 C;  4UUS A;  2GM4 A;  2WB1 N;  4BBS J;  1HF0 A;  1F43 A;  2R5Z B;  3Q0W A;  4AUX A;  3DEW A;  2VUM J;  1JUM A;  2XPV A;  4A3G J;  3S14 J;  2JJ7 A;  1YRN A;  1JTY A;  4JP0 A;  4BY7 J;  1ETV A;  3HOW J;  3S1N J;  2LFB A;  1IV6 A;  4M3F A;  5E3O A;  2E2H J;  4A3I J;  2H8R A;  1WCM J;  4AYB N;  1MBK A;  4QIW N;  5EG0 B;  4A3E J;  5FKO A;  1ZGW A;  3BG5 A;  2KDZ A;  3IV5 A;  5M5Y J;  3WHC A;  2XB5 A;  1GVD A;  1NTC A;  4A3L J;  2YS9 A;  1ZR2 A;  2ID6 A;  4J19 A;  2NOG A;  3H0G J;  3FIW A;  1G2H A;  1B8I B;  3RZD J;  2JWT A;  5E3M A;  1Z0X A;  4V2F A;  5BNG A;  2LY9 A;  4CYC B;  3HBL A;  3M4O J;  1MH3 A;  3PO3 J;  1TWC J;  2JA5 J;  1TWG J;  2DTZ A;  2IBD A;  2R93 J;  5EF6 A;  2K9S A;  3VPR A;  2CJJ A;  3A02 A;  5F04 A;  1U8B A;  3FK7 A;  2DMP A;  1YRN B;  4C2M J;  2TRT A;  1BL0 A;  3S1Q J;  5IYB J;  3HGY A;  1JJ8 C;  3OIO A;  5IP7 J;  5F0F A;  2WAQ N;  2B63 J;  3F0C A;  1BW6 A;  1TWF J;  3PM1 A;  2JK3 A;  5JLX A;  1B72 A;  1X58 A;  3BTI A;  3O8H A;  4DZJ A;  2FX0 A;  2L7M P;  1VND A;  1RKT A;  1K61 A;  1K83 J;  3QPL A;  3JRH A;  5C4X J;  4MLO A;  1Y1W J;  2Y9Y A;  1MSF C;  2ECB A;  2HOS A;  5HOD A;  4L5E A;  3DCF A;  1GDT A;  2G0E A;  3B6A A;  1MSE C;  2CQQ A;  2GLO A;  5K7Z A;  3D1N I;  1Y1V J;  5F0H A;  2ZB9 A;  3BG3 A;  1Q1V A;  3JRG A;  1MNM C;  1TWA J;  2JN6 A;  4BXX J;  2N8G A;  2D5V A;  1IG7 A;  2M9H A;  1I6H J;  1GUU A;  5M5W J;  1T33 A;  4FIS A;  3ZQG A;  4Y52 J;  4MFD A;  5FKL A;  3S16 J;  3TP0 A;  1RES A;  3OSG A;  1GT0 C;  1IC8 A;  1B72 B;  3BTL A;  1QRY A;  1NK3 P;  3IH3 A;  3G1O A;  2P81 A;  3HOZ J;  3S2H J;  5FKK A;  2ECC A;  4RDU A;  1LE8 A;  1HDD C;  4XID A;  2L7F P;  2X9D A;  2L7Z A;  1MH4 A;  2EZK A;  1POG A;  3JRD A;  2M8G X;  2K9N A;  2Y9Z A;  3S15 J;  2K9Q A;  3QQA A;  2I10 A;  1ZQ3 P;  2QCO A;  1U9N A;  2MG4 A;  1WI3 A;  1S7E A;  5J1U A;  3TW6 A;  3MVP A;  1RKW A;  2TCT A;  1HDP A;  3GTG J;  1JKQ C;  4B4C A;  1WH7 A;  3I4N J;  2R5Y A;  1ETQ A;  3MN2 A;  4M6V A;  5M3M J;  4XRM A;  2OF7 A;  2OPT A;  2QF7 A;  3I4M J;  1XC5 A;  3JRB A;  4IEJ A;  1MBE A;  1FTZ A;  1MBG A;  5M3F J;  1ETO A;  1OCT C;  2JA8 J;  2HYJ A;  4IHW A;  1FTT A;  3BR0 A;  4Y7N J;  5EGO B;  3GTL J;  3BTC A;  1UG2 A;  3JR9 A;  5E3L A;  1BW5 A;  2W48 A;  4UUT A;  5F1J A;  1H8A C;  3A03 A;  2LD5 A;  1WGX A;  1PUF B;  2H1K A;  1O4X A;  1ETK A;  1ETY A;  3B6C A;  2DA6 A;  3S1M J;  2XPW A;  2Y30 A;  2XB0 X;  3HOU J;  5GPA A;  1QVT A;  4XRS A;  1ENH A;  2LK2 A;  1JJ6 C;  1I3Q J;  4DYC A;  5J1R A;  3BR6 A;  5GPC A;  2JMW A;  5EYR A;  4X6A J;  1EF4 A;  4BKX A;  1P7J A;  3HOV J;  2EH3 A;  4FE7 A;  5IP9 J;  1H88 C;  3A01 A;  3QPS A;  5DS9 A;  1OCP A;  2XRL A;  4HNV A;  1HLV A;  3RKQ A;  4D7M A;  5F08 A;  4D7N A;  5EEA A;  1SAN A;  4JX6 A;  1RET A;  2NVQ J;  1A5J A;  1WPK A;  2DA4 A;  5EZH A;  4IHV A;  2XGE A;  1ETX A;  4W1U A;  3PO2 J;  1BJZ A;  4FTH A;  2IAI A;  1Z77 A;  3L1P A;  1IJW C;  2DA5 A; 
#chains in the Genus database with same CATH topology
 2F5F A;  4OMZ A;  1FIP A;  4XLF A;  2NRA C;  1MBF A;  3CD6 I;  9ANT A;  3ZQC A;  2FOW A;  1SFO J;  4OIP F;  2L01 A;  4RA2 A;  2YU9 J;  4B3X A;  1JT0 A;  3AL0 C;  3J81 Z;  4II3 A;  2EIJ H;  3HOX J;  1DUX C;  3FXK A;  4A69 C;  2NS0 A;  4G6D A;  4S04 A;  1G6N A;  4DBR A;  3C2H A;  1FIA A;  1GXP A;  1D5V A;  1FOK A;  5AON A;  2CV0 A;  4BXF A;  2VKD A;  6PAX A;  4OMY A;  5D4R A;  4KIG A;  2VC0 A;  3H3V K;  4F92 B;  3K70 C;  3PNV A;  2CRG A;  2R4G A;  2KDO A;  2EZH A;  3HJE A;  2GIZ A;  1A6I A;  2JA6 J;  1IGN A;  2NVX J;  3ERE D;  3CQZ J;  3K1N A;  1HST A;  2DT6 A;  1R9T J;  2KPM A;  2FBI A;  3PSF A;  3GTK J;  3RTR A;  2R5Y B;  1QBJ A;  2HZD A;  3HTS B;  2DA3 A;  3T8T A;  2KRH A;  3S1R J;  1ON1 A;  1YE9 A;  4S0H B;  5FB2 A;  1U78 A;  1ZAR A;  1H89 C;  2LF8 A;  2HVS A;  3GTM J;  2FD5 A;  3HOT A;  1FP1 D;  3K70 D;  3K4J A;  2VKE A;  3SDB A;  2EFO A;  2EZL A;  3QOP A;  2L9S A;  2VI6 A;  4PGG A;  4HQM A;  2UXX A;  3QPH A;  4XIC A;  1ETW A;  2OUM A;  4MO7 A;  4E7L A;  2LC2 A;  5J40 A;  2GOX B;  2NVU B;  3OYB A;  1Z91 A;  3OL3 A;  4DBQ A;  1VI0 A;  4PCQ A;  3VOE A;  1D1C A;  1U6G A;  2BY3 A;  1OIS A;  4BE0 A;  1JXS A;  2H09 A;  1W0U A;  2K4B A;  2NVY J;  5CVV A;  3WTU C;  1IUF A;  1IRG A;  2RV8 A;  1L0O C;  1LE8 B;  1EV7 A;  2W4S A;  1K7A A;  1V5F A;  4O3M A;  2JVH A;  3GTJ J;  2CW8 A;  1MW7 A;  1XDU A;  1DDN A;  1X1A A;  3GLX A;  4A3C J;  1XX5 A;  2DXI A;  3WTW C;  5ILV A;  1VQN I;  5E79 C;  2DDB A;  2J5O A;  3GBG A;  2VN2 A;  3DU5 A;  3RKW A;  2JVG A;  5TGT A;  2VOP A;  3HDD A;  4P55 A;  4E7I A;  2WY8 Q;  2MC3 A;  3BCA A;  3DTK A;  4H4K C;  3FK6 A;  1V55 H;  5LRS A;  4IHY A;  5A2Q K;  3O8G A;  5D5U B;  1V4R A;  4A0Z A;  2KKO A;  3ZR8 X;  3GTQ J;  3KP2 A;  1WJC A;  3JRE A;  4CCM A;  2HYG D;  3E6M A;  2R7Z J;  2NYX A;  1VQP I;  2FEZ A;  1U2W A;  2KFD A;  1WQ2 A;  2W24 A;  3R4K A;  4ZJZ A;  1MGT A;  3MKW B;  2L2O A;  5CQG A;  4C3J J;  2MAB A;  3CMM A;  2VQL A;  4DW6 A;  3BTJ A;  3PFI A;  2WA0 A;  1BR2 A;  1T56 A;  1I50 J;  2L3D A;  4JX5 A;  3FWE A;  5HVQ C;  1A31 A;  3KP4 A;  5FLX Z;  3G3Z A;  2E5N A;  2V79 A;  2DU9 A;  2KP6 A;  4M9X A;  1SFU A;  1W0T A;  4IHS A;  1MJA A;  1OJL A;  4WXH A;  4C3H J;  4MTE A;  2VBX A;  4XK4 A;  1YHQ I;  2NXN B;  4F93 B;  1K4T A;  2WAE A;  1CQT A;  3QP6 A;  1IV8 A;  2CMP A;  4D1Q A;  4EAT A;  1IDY A;  5HOO A;  4CYD A;  1NK2 P;  5FJ8 J;  1JKR C;  4E7J A;  4YFK F;  3ZQI A;  2XC7 A;  5FLV A;  4EGZ A;  3JTG A;  5K5Q A;  4F91 B;  1AHD P;  4HSR A;  1JUS A;  1ZLK A;  2A69 F;  1V5G A;  3BWG A;  3ZOB A;  3SJM A;  2BVM A;  4EV0 A;  1X4P A;  2E2J J;  3BR1 A;  2VE8 A;  1YQA A;  3NAU A;  4UB6 C;  3FKI J;  3JAM K;  3VEP A;  5IPA A;  2UV1 A;  4J00 A;  1TZL A;  2WY7 Q;  3B73 A;  5CLS A;  2VJI A;  4LB5 A;  3P9I A;  4AVP A;  4ZDL A;  2CU7 A;  3BR3 A;  2YX4 A;  2DQL A;  3CUQ C;  4M3G A;  4LK0 F;  4OIR F;  1F36 A;  3GTO J;  4KIC A;  5HLI A;  1O7L A;  2DOA A;  2X6Y A;  2DAO A;  4B1R A;  1YS7 A;  2Y31 A;  5TRD A;  4BHP A;  2E2I J;  3DWL E;  3G2B A;  2DA1 A;  1HW5 A;  3AG2 H;  2D45 A;  1VQ5 I;  1BIA A;  2QQB A;  1N77 A;  4U0W A;  3LSR A;  3A01 B;  2FNP A;  3FXM A;  1GLN A;  4CCL A;  3X2Q H;  2G7U A;  4CCK A;  4CIC A;  1BR4 A;  1IW7 F;  3O6B B;  3CCY A;  1YIO A;  1QA6 A;  1OYY A;  2H6B A;  3ZXS A;  4ZYG A;  1A35 A;  2XHK A;  4B8X A;  2FXA A;  2CUE A;  1NG6 A;  5DUK A;  2JPB A;  3HEF A;  3I59 B;  3SZT A;  2ZJ2 A;  2WB1 N;  3FXR A;  4A6D A;  1QHH D;  4BBS J;  4PFP A;  1F43 A;  2R5Z B;  2VAS A;  3CJN A;  3CZ6 A;  3DEW A;  3S93 A;  2DOE A;  2IS6 A;  2PLY A;  2BXY A;  2XPV A;  4PJJ A;  1LJ9 A;  4A3G J;  1S9H A;  4PK4 A;  3S3N A;  4XON A;  3GZ6 A;  4G7Z F;  1JTY A;  1X1D A;  1G3S A;  4JP0 A;  4BY7 J;  3HOW J;  5LFA A;  3OYN A;  4M73 A;  2E5Z A;  3RI4 A;  2R7V A;  5DCM B;  3KP5 A;  1WCM J;  5LD2 C;  3GO5 A;  3BG5 A;  2KDZ A;  1K79 A;  3PQJ A;  2YU3 A;  4JQF A;  4AM3 A;  2A6E F;  2WC2 A;  3WTY C;  1GVD A;  4I7H A;  2DW4 A;  4HBL A;  2V1U A;  1BI2 A;  2XAU A;  1G2H A;  4N4N B;  1Z6T A;  3TDU C;  3V8L A;  2XF6 A;  2JWT A;  2FOK A;  4V2F A;  3SZG A;  3KIO A;  2F4I A;  3HBL A;  4XRF A;  5CVR A;  4WXD A;  1LEB A;  1FT9 A;  2EFQ A;  5BQT A;  3CP8 A;  3PO3 J;  1TWC J;  3M7G A;  1XSD A;  2ZJQ F;  4BEH B;  3BRO A;  3AG3 H;  2F5V A;  4KIT B;  1UHM A;  5F04 A;  1Y8R B;  2R7Q A;  2WBM A;  3FK7 A;  4C2M J;  2TRT A;  4F3Q A;  5IYB J;  3CLQ A;  4BHC A;  1OYI A;  2EIN H;  2DQR A;  2VKH A;  2OCE A;  2BYV E;  2ZSH B;  3L2R A;  2EJR A;  5HS8 A;  1FWZ A;  2CO5 A;  4P9F A;  3U9G A;  2E1M B;  3ZMD A;  3O8H A;  2FX0 A;  4EMS A;  4NQW B;  2L7M P;  1RIO H;  2CFO A;  1VND A;  1VQ7 I;  1MMS A;  1K61 A;  2KZV A;  3QPL A;  1YX5 A;  5A2Q Z;  3JRH A;  2OD5 A;  5C4X J;  3A0B C;  3BJA A;  1ZLJ A;  1QU3 A;  3LWF A;  1W36 C;  5HOD A;  3L9F A;  3QU6 A;  3I53 A;  3BG7 A;  5D5W B;  1MSE C;  2GLO A;  3J81 K;  3DF8 A;  3HPH A;  5F0H A;  1HQC A;  1RI7 A;  2VL8 A;  1KYW A;  4NQW A;  2N8G A;  2M9H A;  4WF2 A;  2GIV A;  3ZQG A;  2EV5 A;  4MFD A;  5FKL A;  3S16 J;  2MLG A;  5KHD A;  3TGN A;  3J7Z I;  1MJB A;  1RES A;  2E35 A;  4G9Y A;  1KQ0 A;  3OSG A;  1T39 A;  4M9Z A;  1NK3 P;  3EYY A;  2P81 A;  3JW4 A;  4HLY A;  3F23 A;  4KJZ A;  3L2U A;  3M8E A;  1R1U A;  4UUV A;  1LE8 A;  2OTJ I;  3KLN A;  1ZG5 A;  3RKX A;  2X9D A;  4AIH A;  1OCO H;  2A5W A;  3OOP A;  3S2W A;  4XOT A;  4GYI A;  1UHW A;  3H0D A;  1YX3 A;  3W2A A;  2D1H A;  2RDP A;  2K9Q A;  2CUZ A;  3E1S A;  4L5I A;  2I10 A;  1ZQ3 P;  3HRU A;  4QPQ A;  3ZPL A;  3E5U A;  4U0Y A;  1WI3 A;  3Q9V A;  1FYM A;  1USS A;  1RKW A;  4LG0 B;  2LKS A;  2GXG A;  4BXU A;  4XOR A;  1HDP A;  3GFM A;  3K1M A;  3ML6 A;  1JKQ C;  5E8G A;  3MN2 A;  3GYH X;  4B44 A;  3GUD A;  3J80 Z;  5M3M J;  1X4O A;  3CTA A;  2VB6 A;  4OU0 A;  3ZP5 A;  3ZGK A;  2I8D A;  2QF7 A;  3DPL C;  3TL4 X;  2Z33 A;  4PJL A;  2HKO A;  3V7R A;  2DLL A;  5HS9 A;  5KCM A;  3HIF A;  2JA8 J;  2V1X A;  1BI1 A;  3BR0 A;  1T95 A;  3KYD B;  3ZRG A;  3C18 A;  2A6H F;  4PGH A;  1VTN C;  1K4S A;  4M9S A;  4RLQ A;  1UJ8 A;  2QKL B;  2YPR A;  1ZN2 A;  2LYC A;  4L9N A;  1P4X A;  4GYG A;  3LFK A;  5E3L A;  2HPI A;  1YW8 A;  1S8N A;  2FBH A;  1YO5 C;  2ZCW A;  3I5U A;  3A03 A;  1WJD A;  2XAQ A;  2KJC A;  2DDA A;  3H3U A;  1UFM A;  1AWC A;  2IRF G;  2IA1 A;  1EA3 A;  2QQ9 A;  3S1M J;  1PYV A;  1OR7 C;  4AYB A;  2GXA A;  3N05 A;  3K4M A;  4XKW A;  4EQQ A;  4CO8 A;  5L3E A;  2MA3 A;  5ERI A;  2Q2E B;  4JK1 X;  2OC6 A;  5KNL A;  3F6V A;  1SMT A;  2DYS H;  2XF5 A;  1FOY A;  4L9J A;  3IL2 A;  4I99 C;  4HA8 A;  1D8K A;  5GAG J;  2IS1 A;  1FOW A;  3ROU A;  3J80 K;  1T0F C;  4BKX A;  3HSE A;  2H94 A;  3HOV J;  3DKX A;  1WRJ A;  4FE7 A;  1P6R A;  4WK8 F;  3RKY A;  4ENM A;  1U3E M;  1FMW A;  1G59 A;  1J9I A;  3DP7 A;  1ZGA A;  5F08 A;  3E3V A;  1BI3 A;  1WJF A;  1S72 I;  2K7L A;  4JX6 A;  4IQ4 A;  3ECH A;  4N0B A;  2OQR A;  2DO7 A;  3V42 A;  5L3G A;  3VWB A;  2XGE A;  4PZJ A;  1ETX A;  4W1U A;  1BJZ A;  2QBY B;  3L1P A;  3K9T A;  2QUF A;  4HPQ A;  4ZC3 A;  3S2D J;  1JHF A;  1IF1 A;  4LIV A;  4CSW A;  1FNN A;  3VYT B;  1T6S A;  5C44 J;  1QVU A;  2XV4 S;  2Z16 A;  3QOD A;  5EZG A;  4M3D A;  4KIS A;  1B4A A;  1DGW Y;  2Y0S N;  3TP3 A;  3GME A;  2QA4 I;  5IOY A;  3ZQ7 A;  3LST A;  2JRM A;  4XLH A;  3F3X A;  3QOE A;  4Z6Y A;  2HDW A;  2HVQ A;  2BW3 B;  2V9K A;  2HXO A;  4XKV A;  4DNC A;  3V8J A;  3JAM Z;  2VON A;  4UB8 C;  5J4V A;  1VQO I;  2MD0 A;  2DPU A;  3RZO J;  3LL7 A;  4MFE A;  2E1M C;  3RYP A;  1HKS A;  5J3L A;  2IXS A;  3ZQQ A;  3FHZ A;  3RJP A;  2E60 A;  2O5R A;  3PNT A;  3DV8 A;  1IXS B;  1U5T B;  5LGN A;  1XMA A;  2CV1 A;  1MNE A;  3EYI A;  3KPH A;  5FLM J;  3BZ6 A;  4MNU A;  3SDG A;  1GV2 A;  2DFF A;  4D5F A;  3OYD A;  1F4K A;  3OS2 A;  2VT3 A;  4IKF A;  3ESW B;  2IPQ X;  3U1K A;  1APL C;  1FX7 A;  2UXN A;  5DCM A;  2VOO A;  4LLG F;  4RAF A;  3EUK L;  4UVA A;  3CCR I;  2BOL A;  2HNH A;  3ABT A;  3OY9 A;  1B59 A;  2F2E A;  3VDX A;  5DM6 F;  3R0A A;  1W5S A;  4FX4 A;  2LR8 A;  4I02 A;  1J0R A;  3LSG A;  4F55 A;  1RUN A;  3K10 A;  4XLC A;  4B3A A;  3HOS A;  3BT9 A;  3LA3 A;  3PIO F;  3S32 A;  2QZ8 A;  1LUJ B;  2DMN A;  2DA2 A;  2LBF A;  3D5R C;  2QEN A;  4LJZ F;  1I1G A;  2DOD A;  1OFC X;  2DK8 A;  4A3M J;  1T0F A;  1KON A;  2X1E A;  2LP0 A;  4ZZD A;  4EEF G;  4I0A A;  2ZO4 A;  4PUS A;  1K78 A;  4KNY A;  4IZZ A;  1IN6 A;  5JI6 A;  4DGW B;  1S7A A;  3OOU A;  1P4A A;  4NC8 A;  4ZYD A;  5B5E C;  1LQ1 A;  2QBY A;  2DCE A;  2WV0 A;  3OL4 A;  2PEX A;  2MW8 A;  4RGX A;  1SD5 A;  2IVM A;  5IP6 A;  2DFE A;  4CZZ A;  1KU7 A;  4RBO A;  5FKN A;  2EBI A;  4ZYE A;  3LNQ A;  4B09 A;  1MD0 A;  2L4M A;  3PSI A;  3FKJ A;  3CC7 I;  4RB0 A;  2CG4 A;  1S5L C;  3Q3S A;  1R6R A;  3BQY A;  4UV9 A;  2ESN A;  3CLO A;  2HXI A;  4ZTF A;  2V1N A;  3PFY A;  1LNW A;  1SVM A;  4CXF A;  3DU6 A;  4L5J A;  2COB A;  5E1X A;  4BQO A;  1SAU A;  4ENN A;  3CO7 C;  4ENJ A;  2J5P A;  1YJW I;  1ORK A;  2KJB A;  5FRN A;  2P6S A;  3ZQL A;  3HM5 A;  3KP3 A;  1XMX A;  3O2P E;  3LSM A;  2Z99 A;  2Q1Z B;  4YIF A;  4M72 A;  1ZTR A;  1MKM A;  2BZT A;  2OQG A;  2XAG A;  1RR7 A;  1O3R A;  1Z7L A;  2VPL A;  4A5N A;  4NC6 A;  2HDD A;  3R61 A;  2DJN A;  1SFK A;  2X48 A;  3T1B A;  2HPM A;  1H9T A;  1FMV A;  1V5E A;  3C7J A;  3GWZ A;  2DFH A;  4LLN A;  4ESB A;  3MKL A;  5JLW A;  4DIQ A;  4C2U A;  1PJR A;  4RAG A;  2PQ8 A;  4AC0 A;  1YW9 A;  3DPT A;  2ZFU A;  1Y8Q B;  3HYI A;  1HKQ A;  4Z2Y A;  3TO7 A;  2WV1 A;  4XBF A;  3DTE A;  3KEQ A;  2ZXI A;  2W84 A;  5F64 A;  3EPZ A;  3LFU A;  4TV7 A;  4ZTJ A;  4A3J J;  4IQJ A;  2CUJ A;  4XQF A;  2HOT A;  4E7K A;  2K85 A;  4P1W A;  5FLX K;  2IA2 A;  1MBJ A;  1STZ A;  1WJ5 A;  2R7O A;  1ZK8 A;  4KIB A;  3WG9 A;  5J4Y A;  2XGD A;  3OIQ A;  4HEA 2;  3IRQ A;  2H1L A;  2EZI A;  1O3S A;  2PMZ N;  3CME I;  5IYD J;  3NQO A;  4BQN A;  1SEU A;  4G12 A;  2LSO A;  1IN4 A;  5LGT A;  3T8R A;  1YG2 A;  4I09 A;  2RAE A;  3L09 A;  1OR7 A;  2LY1 A;  3BR5 A;  4J01 A;  1IN8 A;  1OKR A;  3DBH B;  4UV8 A;  2B9S A;  1X2N A;  2WWY A;  4WCG A;  3LSJ A;  1G3Y A;  1IN7 A;  2O8X A;  3M1E A;  1D1A A;  1QO0 D;  2HOA A;  2JUG A;  4DYQ A;  3C2B A;  5H6R A;  1UHS A;  3I55 I;  2JSP A;  2K3P A;  4MGR A;  2X1C A;  4ABZ A;  4WX9 A;  2LKP A;  3LSP A;  1MDM A;  2A68 F;  4YEL A;  3LOC A;  4LG0 A;  1VZ0 A;  1AOY A;  2R0Q C;  3CC2 I;  2M0C A;  2PJR B;  2XAH A;  1JI8 A;  3WU0 A;  2O9L A;  1XS9 A;  3FXJ A;  1KZH A;  2ELK A;  1SD7 A;  3CCM I;  1MMN A;  5FKM A;  2HYF A;  3DLA A;  4CH7 A;  3S3O A;  2RC4 A;  2O8K A;  3AG1 H;  3SFI A;  2FQ4 A;  2KT0 A;  2RNJ A;  4ZDO A;  2NNN A;  2QGU A;  2IGO A;  1IUY A;  5E1Z B;  2MH2 A;  4NHJ A;  1VFC A;  3PQK A;  4HF1 A;  2VE9 A;  2E7X A;  1R4M B;  1TC3 C;  2RQQ A;  3IP4 B;  1XN7 A;  1Z67 A;  2VUM J;  3FX3 A;  2KHM A;  2P6T A;  4E7H A;  3WOD F;  4BJ5 C;  4EM0 B;  3OS1 A;  3S14 J;  5EJC A;  3T5X A;  2K9L A;  3S1N J;  5LLQ A;  2LFB A;  1IV6 A;  1FPQ A;  1EKE A;  2F48 A;  2LOO A;  4M3F A;  2E2H J;  4PSW A;  5F1R A;  3FDY A;  1OPC A;  2H8R A;  3HXL A;  1MBK A;  5FKO A;  4B48 A;  1ZGW A;  3IV5 A;  3L00 A;  5M5Y J;  4ETS A;  1N75 A;  3NWS A;  3MKZ A;  3BY6 A;  4BU2 A;  2ETH A;  2LF7 A;  5D8K B;  4P5O A;  3R6S A;  4MQ9 F;  3P9C A;  1HBX G;  2IW5 A;  5ICE A;  2NOG A;  3O3K A;  3HRS A;  4V19 K;  4ZZL A;  1B8I B;  2JTV A;  4RAZ A;  3RZD J;  2F4M B;  3WGG A;  5FFX A;  2LY9 A;  2O03 A;  3F8B A;  4HV5 A;  4KDP A;  4EJT A;  4E7Z A;  3HG9 A;  3HZJ A;  3PNY A;  1Z21 A;  1FY7 A;  2DTZ A;  3KET A;  5EF6 A;  5DV5 A;  5JFR A;  3VPR A;  1PUE E;  3M8F A;  1SFE A;  3A02 A;  3SHF A;  2K27 A;  1R4N B;  1YRN B;  3WTX C;  1JJ8 C;  2EB7 A;  3CUO A;  1ONV A;  1TQI A;  4HX8 A;  4CCN A;  2CYY A;  3QRF F;  5F0F A;  3T0Y A;  3WTS C;  5FRO A;  2B63 J;  2QLZ A;  2JZY A;  2OZU A;  3KFW X;  2AXT C;  2JK3 A;  5LBQ A;  3ABK H;  3BTI A;  4P9U A;  4XKB A;  1DGR M;  3GX4 X;  2V4J C;  1KA8 A;  1RKT A;  3DQV C;  1K83 J;  3V7C A;  4IRH A;  1BIB A;  3MZY A;  1X1B A;  2HOS A;  1X1P A;  2ZME A;  3OR2 C;  2G0E A;  3BPX A;  1TQP A;  3CUQ A;  1XGO A;  2CSO A;  4YEJ A;  5KK1 A;  5K7Z A;  2MC4 A;  2WAD A;  4UY8 I;  3CO6 C;  2O61 A;  4LD5 A;  3BG3 A;  3W3C A;  3Q9S A;  2Z3Y A;  4L9T A;  4BXX J;  1HXD A;  1Y56 A;  5GTI C;  2HEO A;  4DOZ A;  3TQN A;  2M1B A;  3VFZ A;  5D4S A;  5M5W J;  1LB2 A;  4HYE A;  2LNB A;  4FIS A;  3FXU A;  5J6X A;  4Y52 J;  1MDM B;  4IX7 A;  3ZMT A;  1A36 A;  3H5N A;  2DBB A;  3CJT B;  4IHT A;  4N4O B;  2RVC A;  5HNH A;  3A2K A;  2HTS A;  3HC7 A;  4LB6 B;  1GT0 C;  5HDN A;  1B72 B;  3IH3 A;  2P4W A;  2QKM B;  2HQA A;  1K78 B;  1U5T C;  1MND A;  2RRE A;  2M7B A;  5FFZ A;  3IAS 2;  3E6D A;  2K3F A;  2L7F P;  4ANJ A;  4YFN F;  1R5H A;  1MH4 A;  2CH0 A;  1YLF A;  1POG A;  3LQQ A;  5E20 A;  2M8E A;  3S15 J;  3K0L A;  2E71 A;  3QQA A;  3RIR A;  4OOI A;  2QCO A;  2FML A;  3MD2 A;  4IJA A;  5D6E A;  4M6Y A;  1U9N A;  5J1U A;  4L18 B;  2H6C A;  3MKY B;  4XR6 A;  4RB2 C;  4FAS D;  2W57 A;  3GTG J;  4A12 A;  1YIJ I;  3I4N J;  1M1E B;  2R5Y A;  2ADU A;  1D0X A;  1LKX A;  4M6V A;  4NB5 A;  1D0Z A;  5H2F C;  4XRM A;  1OLT A;  4CUG A;  1KQ9 A;  1ON2 A;  3EUH C;  4ZDP A;  1UCR A;  2FA5 A;  5HLT A;  5L3C A;  1MBE A;  1FTZ A;  1MBG A;  2JT1 A;  3OYM A;  4CGZ A;  2HQN A;  4KMU X;  3G71 I;  5CYV A;  4BDZ A;  2HYJ A;  1WHU A;  2P5K A;  3E5X A;  1LPQ A;  5L3B A;  4EGY A;  5LHI A;  3GTL J;  3BTC A;  1UG2 A;  4XLE A;  1ZHF A;  2IJL A;  3JR9 A;  1Y39 A;  1WSU A;  2W48 A;  5H20 A;  1ACI A;  3M8J A;  2F5C A;  5F1J A;  3OYG A;  3DKY A;  2JPC A;  3M1C A;  3TO6 A;  1PUF B;  2LRE A;  1O4X A;  1ETK A;  1ETY A;  3FXQ A;  5E8I A;  1RRJ A;  2JA2 A;  2DA6 A;  3M9A A;  2XPW A;  2E1N A;  1WKM A;  2Y30 A;  2XB0 X;  1BM9 A;  5LEJ A;  1OCZ H;  1P4W A;  4XRS A;  2Q8K A;  1JJ6 C;  4PSX A;  1I3Q J;  1DQU A;  2L9N A;  5J1R A;  3BZC A;  4OIO F;  3KEY A;  3ZMZ A;  5GPC A;  2JMW A;  2PJR A;  2VIX A;  5EYR A;  3E97 A;  3GLL A;  4X6A J;  3TDZ C;  2DOF A;  3UNG C;  2V26 A;  2Y69 H;  4YIR X;  4Y17 A;  5IP9 J;  1UEL B;  1H88 C;  3N4M A;  3QPS A;  5DS9 A;  1OCP A;  2XRL A;  2DFI A;  3QYF A;  4HRI A;  1PP8 F;  2WTE A;  2A61 A;  1SD6 A;  2OTL I;  4D7N A;  3QPT A;  2DTR A;  4B47 A;  3E0J B;  1WPK A;  3SYT A;  3CCV I;  1MMA A;  4O5V A;  3W6J B;  4FTH A;  1SVO A;  1HW1 A;  3AG4 H;  3CP2 A;  4XN0 A;  1FSH A;  1TW2 A;  1XG1 A;  4C30 A;  1AKH A;  5F0C A;  3G6E I;  4Y15 A;  1TT0 A;  4RM3 A;  3VB2 A;  4XKC A;  4XSX F;  4BEH A;  4FHT A;  3CCS I;  1MMD A;  2XSJ C;  2IEK A;  3LAP A;  3UR3 C;  2DN0 A;  5D6F A;  1DU6 A;  4K2E A;  1TNT A;  5KAI C;  3OYL A;  4IRI A;  2EFP A;  3PUF A;  2Y75 A;  4FCY A;  1EH8 A;  4BY1 J;  2QEX I;  4A93 J;  3I4P A;  5EDN A;  4PDK A;  2MGQ A;  1TL8 A;  1ITY A;  2BY2 A;  4KYW A;  1KU2 A;  4HAM A;  1IRZ A;  3IAM 2;  5GP9 A;  2L4A A;  4F7Z A;  1LEA A;  1AA7 A;  2B0L A;  2CW7 A;  1W4M A;  2IP2 A;  3FIS A;  2L9R A;  2PMU A;  4E6K G;  5H6Q A;  1I3A A;  1QPM A;  2FF4 A;  1H0M A;  3BP8 A;  2PMZ A;  3BZK A;  2L9V A;  3HHG A;  2L0K A;  3KCC A;  2HGC A;  2G7H A;  4Q48 A;  5DUI A;  4XNF A;  1R36 A;  1RPW A;  3LQR A;  3SEZ A;  4A3B J;  1JKO C;  1UB9 A;  3HKZ A;  4P96 A;  4KUM A;  3OS0 A;  2R5Z A;  2M30 A;  5GAE J;  2JA7 J;  2EFN A;  3EUH A;  2NVT J;  1XD7 A;  2VQG A;  4W97 A;  4A0Y A;  2PFB A;  2QVO A;  1RR8 C;  1MBH A;  4AU7 A;  4HQE A;  2XPU A;  1I27 A;  2VPR A;  1IN5 A;  4A0X A;  2QM3 A;  4U7D A;  4L0Z B;  1I1S A;  4DQ2 A;  1XTA A;  2QQA A;  1X2M A;  1J5Y A;  4RB3 C;  4XLN F;  2HOE A;  2HS5 A;  3R60 A;  3MEX A;  3JRF A;  1UAA A;  4G7O F;  4Y4R A;  3BC8 A;  2E36 A;  1UMQ A;  3A0H C;  1TTY A;  1VQL I;  2O7O A;  4V2G A;  1GV5 A;  1S7O A;  3IH2 A;  2EA4 A;  3C2G A;  3HSR A;  3HRT A;  4CA0 A;  1XGN A;  4L9V A;  1EJ9 A;  4M74 A;  2E1O A;  1LDD A;  5ILS A;  4DZP A;  1G4D A;  3HB9 A;  4PFO A;  5DTD A;  2FMY A;  1X3Z B;  3K2A A;  2UWM A;  4A6E A;  4S05 A;  2KRC A;  3I54 A;  4LK1 F;  4WWC A;  4Q4Z F;  2BHZ A;  4A3K J;  2VQH A;  5IOZ A;  2STW A;  4M3E A;  2KIF A;  4HNU A;  2B7E A;  3I3L A;  2LLK A;  3VOD A;  1IXR C;  2HZT A;  2ISY A;  2ME0 A;  2V9P A;  3DPU A;  4RAY A;  3CCE I;  4DYR A;  1BOB A;  3FBN B;  2R7F A;  4HV6 A;  2HQ5 A;  4XSZ F;  1X1C A;  3FZV A;  3OYF A;  2IS4 A;  4OWR B;  3CC4 I;  1BJA A;  2P7C B;  3FM3 A;  5D5X B;  1B1B A;  1W7P A;  4IPA A;  3JSP A;  4ZYA A;  3EET A;  3KYL A;  2F5D A;  3P7N A;  4LLL A;  4QSH A;  5JVT A;  1YJ9 I;  4BE1 A;  4HDU A;  1Z1D A;  4XRS G;  2AHQ A;  5KVR A;  2KIQ A;  4IF4 A;  2DMT A;  2XSD C;  3KE2 A;  4BL0 B;  1ZR4 A;  2DJI A;  3E7L A;  3H9Q A;  3SQN A;  4I6Z A;  4ENK A;  1H9G A;  4X1E A;  2ESH A;  1R22 A;  3ZQH A;  3L2V A;  1LFB A;  3IWF A;  3A1Y A;  3BLY A;  1Z6R A;  3RPU A;  1T08 B;  1VQM I;  2LKX A;  3HOY J;  2CUF A;  2EQR A;  3ZMS A;  4M71 A;  2R7D A;  3FF5 A;  2Y2Z A;  2ZXW H;  3G1L A;  5J47 A;  4HZF A;  1I5Z A;  5K7F A;  2CGP A;  5BPI A;  4ESJ A;  4JOM A;  4EJU A;  1BA5 A;  3W6V A;  2FBK A;  1W1W E;  3CCQ I;  1B9N A;  1IZ1 A;  3WTZ A;  2AQE A;  1IRF A;  2YUS A;  5K7H A;  4HX4 A;  2X6O A;  4GFB A;  4A3D J;  3IRR A;  2DPD A;  5FD5 A;  3QP5 A;  2F5E A;  2MBF A;  5DD8 A;  3LA2 A;  3ABM H;  1Z3X A;  1X3U A;  4YII A;  1E3O C;  2DT7 B;  2X6W A;  1A6Q A;  1S6L A;  3BCB A;  3TOA A;  2YX7 A;  1E3P A;  1V3F A;  1CGP A;  1OQY A;  5L3F A;  3TW7 A;  1J09 A;  4BUP A;  2GBY A;  5HS7 A;  4LIU A;  1J75 A;  1R5I D;  5LGU A;  4FT8 A;  5FO5 A;  2EFW A;  1J59 A;  2R92 J;  4BQQ A;  1VF9 A;  4IL6 C;  4R8H A;  1MJ9 A;  2V7F A;  5B1A H;  4CHU A;  3F8F A;  2AO9 A;  3CCU I;  3ZQF A;  3M3Y J;  1LFU P;  4LG3 A;  2UZK A;  2FE3 A;  2FJ1 A;  4NUB A;  3FBI B;  4JX4 A;  4Q47 A;  1O3T A;  5BMZ A;  5GAD J;  1P9Q C;  2ME6 A;  3RYR A;  2YR2 A;  2ELJ A;  2IS2 A;  4CYC A;  2A07 F;  4BAY A;  2IA0 A;  4AIJ A;  2MLK A;  1FJL A;  1ZRE A;  2ZNZ A;  2AQF A;  3GEZ A;  1AKH B;  2DA7 A;  2XDV A;  3RPU D;  3ZN1 A;  1PVE A;  1HF0 A;  1E0E A;  2STT A;  3F22 A;  4RM2 A;  3Q0W A;  1D1B A;  5CQE A;  4AUX A;  3MZ8 A;  3OYJ A;  4G8X A;  3F8C A;  3H5A A;  2A5Y B;  4A5M A;  2GQQ A;  2XKO A;  5FGM A;  4KMF A;  1I6X A;  4ESF A;  2JJ7 A;  4KA4 A;  3RSN A;  1IXC A;  1ETV A;  4ON0 A;  3TOB A;  2HU9 A;  2EPF A;  1U5T A;  2R3S A;  1X19 A;  3ASN H;  5E3O A;  2PMH A;  4A3I J;  2H8W A;  4II2 A;  3EQL F;  4ZYH A;  2COM A;  3MCZ A;  1R7J A;  5EG0 B;  2GA1 A;  3VYS B;  3RCO A;  3VSK A;  1YW7 A;  1T98 A;  2GA2 A;  3WHC A;  2OA4 A;  1FC3 A;  2ZKZ A;  3DEU A;  4HX7 A;  1NHA A;  1WZ2 A;  4OIN F;  1MZB A;  2OCC H;  2DT5 A;  2E7W A;  2Q2E A;  1ZR2 A;  2ID6 A;  1KQ8 A;  2EA2 A;  3F21 A;  2DK5 A;  4ZH4 F;  4J19 A;  2IGN A;  2IGK A;  1UG0 A;  4HF2 A;  1WFX A;  1VQ6 I;  2VOD A;  1DPR A;  3R0J A;  2AXL A;  3ABU A;  1U0J A;  4PJM A;  5BNG A;  4CYC B;  3LAJ A;  2VXZ A;  2ZNY A;  4Y3O A;  1MIJ A;  2D1V A;  1FP2 A;  2JA5 J;  3S8P A;  1TWG J;  2KL4 A;  2IBD A;  2R93 J;  2K9S A;  4YFX F;  2CJJ A;  4IVN A;  2R7T A;  1W5T A;  1XDS A;  1U8B A;  3N97 A;  3S1Q J;  1OCR H;  1W36 D;  2L02 A;  5IP7 J;  3I9V 2;  3OWT A;  3U2R A;  1ZYR F;  4G7H F;  4GDF A;  3F0C A;  2KIU A;  4U0V A;  2VJ4 A;  1TWF J;  3PM1 A;  1RC9 A;  5JLX A;  4BJT A;  1X58 A;  1GVJ A;  1B72 A;  4DZJ A;  1G8X A;  3CF2 A;  4MHG A;  3BDD A;  2VBZ A;  5ICC A;  4MLO A;  2I5U A;  1MSF C;  1QNT A;  1RZ4 A;  2ECB A;  2DYR H;  2P7V B;  3LMM A;  1VQK I;  3DCF A;  2ZFW A;  3B6A A;  1K6Y A;  3HL2 A;  3QYE A;  1FYL A;  2JRT A;  4RS8 A;  1HW2 A;  1Y1V J;  2R7W A;  2W25 A;  1MNM C;  1Q1V A;  2MFZ A;  1IG7 A;  2D5V A;  1I6H J;  3KYC B;  1J2X A;  3QYB A;  1GUU A;  1T33 A;  1N78 A;  2CS3 A;  2QSH X;  3AKZ A;  1V54 H;  5LHG A;  1O3Q A;  3TP0 A;  4E70 A;  3TO9 A;  1UZC A;  1PP7 U;  1IAW A;  4ASN A;  4R1H A;  2PN6 A;  1HA8 A;  1IC8 A;  3BTL A;  1QRY A;  3WE2 A;  5CVI A;  3HOZ J;  2BV6 A;  2ZBK A;  3HHH A;  2ECC A;  1D3Y A;  1LVA A;  1Q1H A;  3M07 A;  2VXD A;  3OYA A;  3ASO H;  1HDD C;  3ECO A;  1REP C;  3E6B A;  1NG7 A;  3ISP A;  4LGW A;  1TBX A;  2UUZ A;  2L7Z A;  3L7W A;  5K5R A;  1BN5 A;  3ZMV A;  2K9N A;  3WE3 A;  3ZN0 A;  2Y9Z A;  4QPO A;  1IRX A;  3WTT C;  5CVJ A;  5ILU A;  4HF0 A;  4YG2 F;  4EJV A;  3BJO A;  3C1D A;  1S7E A;  1T8I A;  3VSL A;  3MVP A;  2BVL A;  2TCT A;  1ZAO A;  2KRF A;  1KGS A;  4B4C A;  5EEG A;  1W7P D;  3HRM A;  3AFH A;  3B02 A;  2NNY A;  4JBA A;  4HOB A;  3W6K B;  3QU3 A;  3JSO A;  2OF7 A;  2ZXH A;  2OPT A;  2ZXJ A;  3DBL B;  2MH9 A;  4QWQ A;  1XC5 A;  3IKT A;  3JRB A;  2ZJR F;  3TBI A;  4U7B A;  3MQ0 A;  1GXQ A;  4FX0 A;  4IEJ A;  1XPX A;  2R7U A;  5M3F J;  5TJJ A;  1FBS A;  4L0Y B;  3COA C;  4IXA A;  3MWM A;  1OYW A;  4AID A;  4IHW A;  1FTT A;  1R71 A;  4G6T B;  5L3D A;  4Y7N J;  2V6C A;  2WB1 A;  3KLO A;  5EGO B;  3GW2 A;  1BW5 A;  5BS6 A;  2LD5 A;  1BBY A;  1WGX A;  4CZC A;  4RGR A;  1BC8 C;  1N25 A;  2E34 A;  1GHC A;  2XAF A;  3HOU J;  1OMI A;  2GZW A;  4UVB A;  5E18 F;  1ENH A;  2LK2 A;  5JR3 A;  2K02 A;  1TT5 B;  2XUB A;  1T38 A;  1QQI A;  2VBY A;  2HVR A;  2LH9 A;  4RGS A;  3ERM A;  3BR6 A;  4GGG A;  2CQ7 A;  3LSI A;  1WVR A;  3I0T A;  1LVK A;  1WJA A;  4ITV A;  3RPQ A;  3HUG B;  2P0W A;  3E6C C;  2OJE D;  1FYK A;  4DJA A;  1YOV B;  4HNV A;  1QHG A;  1E2X A;  1KU3 A;  2VC1 A;  1HLV A;  4D7M A;  3FXL A;  3OYK A;  4N9H A;  3NEU A;  2A05 A;  5EEA A;  1SAN A;  1J7K A;  2R7X A;  3NRV A;  1JE8 A;  1RET A;  5EZH A;  4IHV A;  1P2F A;  2LY2 A;  3PO2 J;  2IAI A;  3K4C A;  1IJW C;  1R1V A;  1JTX A;  2W00 A;  5C3E J;  2RN7 A;  4RB1 A;  1ZKG A;  2JUC A;  4A3F J;  3E5Q A;  2L7K A;  3PIP F;  1Y0U A;  4G94 A;  2K4J A;  2RQP A;  1R00 A;  1JGG A;  4XM3 A;  3KZZ A;  1YFH A;  2ID3 A;  3FHN A;  4NDL A;  3SFZ A;  1YIT I;  2VJJ A;  3CCJ I;  3HTU A;  3U21 A;  1DU0 A;  1E17 A;  2IGM A;  1IDZ A;  2BW3 A;  3F72 A;  2HTJ A;  3HPG A;  4XN3 A;  3WG7 H;  2M7A A;  2CFX A;  3J7A O;  5B1B H;  2K5C A;  3FM5 A;  3EDP A;  3BOQ A;  4PJN A;  3HGG A;  3K6G A;  4U88 A;  2F6C A;  2LRD A;  5B66 C;  1RNL A;  4F52 A;  3Q0U A;  3K4K A;  2FU4 A;  4MQV A;  5EGO A;  1QZZ A;  1WWX A;  5LRR A;  5EG0 A;  3GVA A;  2ISZ A;  3P5J A;  1TNS A;  5GTH C;  2Z1D A;  2P5L C;  2DMQ A;  2A3S A;  2M4K A;  1QGP A;  3CMY A;  4MEX F;  4YRV A;  1FLI A;  1Z05 A;  3WU1 B;  2TDX A;  3NAR A;  1WH5 A;  2V1D A;  3IH4 A;  2XAJ A;  2Z9O A;  2O0Y A;  1ZRC A;  1D8J A;  1VQ8 I;  1JT6 A;  2CQX A;  3DTI A;  4H0E A;  3H9J A;  3F8N A;  3TMO A;  4E4H A;  5J1Y A;  3H9G A;  3UKG A;  1WJB A;  3HUG A;  5J8C A;  1SAX A;  1KU9 A;  3Q0V A;  2EIL H;  5ED4 A;  5F6F A;  1ULY A;  5M5X J;  2GWR A;  2MD5 A;  4EVI A;  5C4J J;  1SFX A;  1ODD A;  3MZH A;  3W2W A;  4IHX A;  1NH3 A;  3QAH A;  1QZY A;  2EV0 A;  4Q5S F;  2V9V A;  1ZEL A;  3FXO A;  4XLA A;  2HR3 A;  5FD6 A;  5JHU A;  1ZG3 A;  3L2Q A;  3S17 J;  2BE5 F;  3EUA A;  5E3N A;  4X0G A;  3WU2 C;  2D2W A;  2VQC A;  3KEO A;  3LSK A;  4D9J A;  2V6E A;  3D0S A;  2OZ6 A;  1B6A A;  1OCC H;  1U9O A;  2HKX A;  2K86 A;  1U8R A;  2X6X A;  5DEQ A;  2HI3 A;  2MSY A;  1HOM A;  2OV7 A;  1R58 A;  2E19 A;  3JRI A;  3JRC A;  2PI0 A;  1QPI A;  4JYK A;  2MYS A;  2NS8 A;  4GXO A;  4M3B A;  5LEK A;  3K7A J;  3OMY A;  3KX2 A;  2O3F A;  3FMS A;  3OYE A;  4UXN A;  2PX9 A;  1SVL A;  3OYC A;  2G9W A;  2XAS A;  3VYR B;  1F5T A;  2DI3 A;  3JCU C;  2QQ8 A;  3A4C A;  1JGS A;  1EH6 A;  4FE4 A;  3G1M A;  2XVC A;  2EV6 A;  1DP3 A;  3LA7 A;  2FQ3 A;  2NS7 A;  3LSH A;  4UHT A;  3REO A;  4BHB A;  4BAC A;  2W85 A;  3BR2 A;  2K40 A;  3IUO A;  2X1D A;  3BPV A;  2CWE A;  5CPR B;  2A6T A;  3WGI A;  2BY0 A;  2HDC A;  3DFG A;  3K4B A;  3VYU B;  1E3H A;  1JKP C;  4LIT A;  5E17 F;  4C9Y A;  4I76 A;  4C3I J;  4LOC A;  1YS6 A;  1XSX A;  3OSF A;  3DBR B;  1FZP B;  4CCJ A;  3JRA A;  3V7S A;  2VKV A;  3RQI A;  5IT3 A;  3L2C A;  4BBR J;  1B8I A;  4NBQ A;  3CDL A;  4GCV A;  4XLP F;  2X0L A;  2EK5 A;  4Y13 A;  1FBQ A;  3GZ5 A;  4D5C A;  3WHB A;  1PUF A;  3I64 A;  4CDG A;  4EJO A;  4GO1 A;  2ICW G;  3OYH A;  2KZG A;  4BH9 A;  4NC7 A;  3GCM A;  1P7I A;  1D5Y A;  3ULQ B;  4GRI A;  2OAZ A;  1HSJ A;  3F6O A;  5EEH A;  4MIM A;  3J7A Y;  5IT9 K;  3JTH A;  3TED A;  1ZRD A;  3Q5F A;  1TWH J;  2GOM A;  1AU7 A;  3G73 A;  4AVZ A;  4UNO A;  1JUP A;  2KMU A;  3DXJ F;  2RKH A;  2XGC A;  4EM2 A;  5F27 A;  3QWL A;  2M34 A;  2YSR A;  3K4N A;  4KT5 C;  5AIP A;  2Z5U A;  5HLG A;  3KZI C;  3KZY A;  4MTD A;  3P9K A;  3MAJ A;  1P92 A;  3HSF A;  4HDV A;  2FNA A;  4BJ6 C;  3BG9 A;  4AWX B;  2WAF A;  4EM1 A;  4FET A;  3GTP J;  1A04 A;  2M2E A;  3C3W A;  1CF7 A;  3CJR B;  3WTV C;  2DMU A;  2ELH A;  2LVS A;  4OAZ A;  3ZMU A;  1G3W A;  3IWZ A;  4G6Q A;  2CQK A;  4UUS B;  1RUO A;  3OV8 A;  1WJE A;  5CJ9 A;  1ERD A;  1R49 A;  4BE2 A;  2X85 A;  1W7P B;  2VBW A;  2M5W A;  1X3W B;  4QTR A;  1DPU A;  2M45 A;  1HKT A;  1IO2 A;  4LMY A;  1HCR A;  4N9I A;  3CCL I;  2LTP A;  3IKV A;  2CW0 F;  3RDI A;  1TLH B;  3HKZ N;  3BQZ A;  2O6G E;  1FEX A;  3PL8 A;  5IYC J;  3PUB A;  3H3Z A;  1L3L A;  3SZP A;  5DCF A;  4BDY A;  2GM4 A;  4UUS A;  3BJ6 A;  2QWW A;  4KN7 X;  2ACJ A;  2K9M A;  1JUM A;  4HLX A;  1CF7 B;  1YRN A;  2OBP A;  4KN4 X;  3G4S I;  1KYZ A;  2HFH A;  3CJQ B;  3KP6 A;  5ICF A;  1DP7 P;  1G3T A;  3H36 A;  1XGM A;  2RNG A;  2LMD A;  1C0W A;  1XSV A;  5KAF C;  3ONQ A;  4AYB N;  4QIW N;  4A3E J;  2W7N A;  5K1Y A;  2RGV A;  1D0Y A;  3J7Y J;  3AAF A;  1ZH5 A;  2XB5 A;  5CVU A;  1XCV A;  1QZE A;  4RLF A;  1NTC A;  2BEO A;  2XKP A;  4B43 A;  2YS9 A;  2W82 A;  1YJN I;  4A3L J;  1BI0 A;  2FUG 2;  2VT2 A;  2HQR A;  1TQM A;  5CKT A;  4BQA A;  3CDI A;  2FSW A;  3L2W A;  3H0G J;  2BY1 A;  3FIW A;  4KIF A;  3CF5 F;  4BNC A;  4RMN A;  2CV2 A;  4XMY A;  2EIM H;  3FMQ A;  1VQ4 I;  1T2K A;  1Z3Y A;  1SC7 A;  5JVG F;  2LDU A;  5E3M A;  1Z0X A;  3DEE A;  3I71 A;  1F9N A;  4OAY A;  4R79 A;  5BOX A;  4QLC U;  4BYY A;  3GXO A;  3IC7 A;  3ZCO A;  3M4O J;  2QSG X;  1MH3 A;  3CMA I;  4C2T A;  1SD4 A;  3WGH A;  2EIK H;  2DMP A;  1BL0 A;  3HGY A;  5B3S H;  2OU2 A;  4I2O A;  2M87 A;  3OIO A;  3OR1 C;  2HWV A;  2VJ5 A;  2WAQ N;  3H35 A;  2CQN A;  1BW6 A;  5DD4 A;  4I98 B;  2ZC2 A;  2ZME C;  2PG4 A;  3KP7 A;  3ELK A;  3SEQ A;  5BPD A;  3DKW A;  2JQ7 A;  4XL9 A;  2ZSI B;  5J8F A;  5LHH A;  2L5Q A;  1ZG1 A;  3D5L A;  2Y9Y A;  1Y1W J;  2FRH A;  1O7F A;  2AS5 F;  1O57 A;  1FOX A;  1PDN C;  1EH7 A;  3I56 I;  3CUQ B;  1JHH A;  4L5E A;  1Z9C A;  1B9M A;  1GDT A;  5HLH A;  2Z2S B;  2CQQ A;  5HDG A;  4AD9 A;  3D1N I;  2M4G A;  4D0P A;  2ZB9 A;  4M6X A;  1VQ9 I;  3JRG A;  1TWA J;  2JN6 A;  1WI9 A;  2KQR A;  4IOA F;  4KFC A;  2W1O A;  1XCB A;  4KT6 A;  3MFK A;  5D8L B;  1XGS A;  2NAZ A;  2M3A A;  2NOJ B;  2P8T A;  3K2Z A;  1TW3 A;  1FBU A;  3G1O A;  1UST A;  2Y0M A;  1Z7U A;  2LG4 A;  4IOC F;  2Y48 A;  3S2H J;  3DLL F;  5FKK A;  3F8M A;  4RDU A;  4I0B A;  1Y0N A;  4E7S A;  4XID A;  3W2V A;  3ABL H;  2R7R A;  4A2U A;  3RQ4 A;  3V4G A;  1SMY F;  2Q0O A;  2EZK A;  3JRD A;  2M8G X;  4EJW A;  1YYV A;  3BG6 A;  5FRM A;  1W5C C;  2PJP A;  2KIM A;  2BBY A;  2BHY A;  4NNJ A;  1TP4 A;  1BC7 C;  4LFU A;  2MG4 A;  3TW6 A;  4HG2 A;  3V8K A;  1ZGJ A;  5IT9 Z;  2PBI A;  5JHF A;  2X4H A;  3S3M A;  1WH7 A;  1LDJ A;  5D5V B;  1YTY A;  2KLO A;  2QYO A;  1ETQ A;  2BXZ A;  5HDK A;  3NWT A;  4I01 A;  3AL0 B;  3K1P A;  4UVC A;  5TIS C;  4IRG A;  5K5O A;  1BR1 A;  1LDK B;  4WXC A;  3MMY B;  4CCO A;  3CES A;  3I4M J;  1ETO A;  2KIS A;  3PJR A;  4U87 A;  3H1C A;  3K4L A;  3H5R A;  1OCT C;  3FMR A;  5E1W A;  2P5V A;  2C6Y A;  1XB4 A;  1R23 A;  5HNF A;  3IHU A;  2GAU A;  4RGU A;  2H27 A;  1HC8 A;  3I59 A;  4UUT A;  3F9K A;  5DYM A;  4BGD A;  4HW0 A;  4BS9 A;  1H8A C;  4XOP A;  2R7S A;  4AIK A;  1MMG A;  1ZRF A;  2H1K A;  3GF2 A;  3B6C A;  1FSE A;  5DDG A;  2X51 A;  1I39 A;  2XF7 A;  4FQG A;  4PJ0 C;  2QSF X;  1LFP A;  4IO9 F;  4MEY F;  1K6O A;  4O6J A;  1YI2 I;  2E1C A;  5GPA A;  4Y33 A;  4OIQ F;  5GAH J;  1QVT A;  3OYI A;  3K69 A;  1R5G A;  1S29 A;  1Y6I A;  4DYC A;  2Y0S A;  3D5S C;  2ZJP F;  1S3J A;  3H92 A;  3U1D A;  1R1T A;  2LBF B;  1EF4 A;  2VLA A;  3GFL A;  2ZME B;  2IT0 A;  1P7J A;  2EH3 A;  3GZN B;  2WAQ A;  3I58 A;  5IY5 H;  3A01 A;  2XGX A;  2XIG A;  2XRO A;  3CDH A;  4HNT A;  2EWN A;  3RKQ A;  3GFI A;  5DM7 F;  5AIQ A;  1F1Z A;  2JSC A;  4HST A;  2L54 A;  1XMK A;  2NVQ J;  1A5J A;  1BOA A;  2DA4 A;  3GFJ A;  2GXB A;  5ICG A;  2F4O B;  3SXY A;  2XRN A;  2BGC A;  3OIP A;  1Z77 A;  2M0M A;  3TKY A;  2DA5 A; 
#chains in the Genus database with same CATH homology
 3S2D J;  1FIP A;  1XG1 A;  1JTX A;  1AKH A;  5F0C A;  1MBF A;  5C3E J;  1ZKG A;  5C44 J;  3ZQC A;  4A3F J;  9ANT A;  1QVU A;  1SFO J;  2IEK A;  2YU9 J;  5EZG A;  4M3D A;  2DN0 A;  2Y0S N;  3TP3 A;  1DU6 A;  1JT0 A;  3HOX J;  1JGG A;  4A69 C;  5IOY A;  2ID3 A;  4NDL A;  4FCY A;  4A93 J;  4BY1 J;  1DU0 A;  1IDZ A;  2HXO A;  5EDN A;  1FIA A;  2MGQ A;  1ITY A;  3RZO J;  1IRZ A;  3H3V K;  4MFE A;  5GP9 A;  5J3L A;  3HGG A;  2CRG A;  3FIS A;  3Q0U A;  2EZH A;  5EGO A;  2JA6 J;  1A6I A;  2L9R A;  1IGN A;  2NVX J;  5FLM J;  3CQZ J;  3SDG A;  1GV2 A;  5EG0 A;  4D5F A;  1R9T J;  2DMQ A;  2L0K A;  2R5Y B;  3GTK J;  1APL C;  2DA3 A;  3CMY A;  3NAR A;  3S1R J;  1WH5 A;  3IH4 A;  1RPW A;  4S0H B;  1U78 A;  4A3B J;  1JKO C;  2LR8 A;  1H89 C;  3LSG A;  3GTM J;  1JT6 A;  2CQX A;  2FD5 A;  2R5Z A;  4B3A A;  2JA7 J;  3BT9 A;  2VKE A;  2NVT J;  5J1Y A;  4W97 A;  3UKG A;  2EZL A;  1MBH A;  2DMN A;  2DA2 A;  2VI6 A;  2XPU A;  2VPR A;  3Q0V A;  5M5X J;  4XIC A;  1OFC X;  4A3M J;  1ETW A;  4MO7 A;  5C4J J;  1X2M A;  2LP0 A;  4IHX A;  4EEF G;  3JRF A;  1VI0 A;  1UMQ A;  1W0U A;  2NVY J;  3OOU A;  1IUF A;  2O7O A;  1LE8 B;  3S17 J;  4V2G A;  1GV5 A;  3IH2 A;  5E3N A;  2MW8 A;  5IP6 A;  3GTJ J;  4RBO A;  5FKN A;  2EBI A;  4A3C J;  2E1O A;  3LNQ A;  4DZP A;  1U9O A;  3HB9 A;  5DTD A;  2HI3 A;  3GBG A;  2MSY A;  1HOM A;  2E19 A;  3K2A A;  3JRI A;  3Q3S A;  3JRC A;  4A3K J;  3HDD A;  1QPI A;  3BQY A;  4JYK A;  2HXI A;  5IOZ A;  2NS8 A;  3FK6 A;  4M3B A;  3K7A J;  4M3E A;  4IHY A;  2COB A;  2LLK A;  3O8G A;  2ME0 A;  4DYR A;  3GTQ J;  2HQ5 A;  1ORK A;  3JRE A;  3ZQL A;  3HM5 A;  2R7Z J;  4FE4 A;  3G1M A;  4QSH A;  2NS7 A;  4C3J J;  1ZTR A;  3BR2 A;  4XRS G;  2AHQ A;  2K40 A;  4DW6 A;  3BTJ A;  1RR7 A;  2DMT A;  2XSD C;  2HDD A;  1T56 A;  1I50 J;  2DJN A;  4JX5 A;  2X48 A;  1ZR4 A;  3E7L A;  4I6Z A;  3MKL A;  4X1E A;  5JLW A;  1JKP C;  1W0T A;  4I76 A;  4C3I J;  3ZQH A;  4LOC A;  1LFB A;  4AC0 A;  1OJL A;  4C3H J;  4XK4 A;  3OSF A;  2WV1 A;  3JRA A;  1CQT A;  2LKX A;  2VKV A;  3RQI A;  3HOY J;  2CUF A;  2EQR A;  4BBR J;  1IDY A;  1B8I A;  4A3J J;  3CDL A;  1NK2 P;  2Y2Z A;  5FJ8 J;  1JKR C;  3G1L A;  5K7F A;  2HOT A;  3ZQI A;  1MBJ A;  5FLV A;  4D5C A;  3WHB A;  1PUF A;  1AHD P;  3W6V A;  1JUS A;  1ZK8 A;  1BA5 A;  2XGD A;  3ZOB A;  3SJM A;  2E2J J;  2EZI A;  2YUS A;  2PMZ N;  5K7H A;  5IYD J;  3BR1 A;  2X6O A;  4GFB A;  4G12 A;  3NAU A;  3FKI J;  4A3D J;  1P7I A;  1D5Y A;  5IPA A;  2RAE A;  4MIM A;  3BR5 A;  3TED A;  1TWH J;  1AU7 A;  1X2N A;  1JUP A;  3LSJ A;  2CU7 A;  1E3O C;  2XGC A;  3BR3 A;  5F27 A;  4DYQ A;  2HOA A;  2M34 A;  4M3G A;  3C2B A;  1F36 A;  1UHS A;  3GTO J;  3TW7 A;  4ABZ A;  3LSP A;  2GBY A;  3BG9 A;  2Y31 A;  4B1R A;  3LOC A;  2R92 J;  2E2I J;  3GTP J;  2M2E A;  2R0Q C;  1VF9 A;  2DA1 A;  2M0C A;  2DMU A;  2LVS A;  2O9L A;  1XS9 A;  3LSR A;  3A01 B;  2ELK A;  4UUS B;  5FKM A;  2O8K A;  2AO9 A;  3SFI A;  2FQ4 A;  3ZQF A;  2KT0 A;  3M3Y J;  1LFU P;  2FJ1 A;  4QTR A;  4JX4 A;  1HCR A;  2ME6 A;  3CCY A;  2LTP A;  4CYC A;  3HKZ N;  3BQZ A;  1FEX A;  1VFC A;  5IYC J;  2CUE A;  1FJL A;  3HEF A;  2DA7 A;  1AKH B;  1TC3 C;  4UUS A;  2GM4 A;  2WB1 N;  4BBS J;  1HF0 A;  1F43 A;  2R5Z B;  3Q0W A;  4AUX A;  3DEW A;  2VUM J;  1JUM A;  2XPV A;  4A3G J;  3S14 J;  2JJ7 A;  1YRN A;  1JTY A;  4JP0 A;  4BY7 J;  1ETV A;  3HOW J;  3S1N J;  2LFB A;  1IV6 A;  4M3F A;  5E3O A;  2E2H J;  4A3I J;  2H8R A;  1WCM J;  4AYB N;  1MBK A;  4QIW N;  5EG0 B;  4A3E J;  5FKO A;  1ZGW A;  3BG5 A;  2KDZ A;  3IV5 A;  5M5Y J;  3WHC A;  2XB5 A;  1GVD A;  1NTC A;  4A3L J;  2YS9 A;  1ZR2 A;  2ID6 A;  4J19 A;  2NOG A;  3H0G J;  3FIW A;  1G2H A;  1B8I B;  3RZD J;  2JWT A;  5E3M A;  1Z0X A;  4V2F A;  5BNG A;  2LY9 A;  4CYC B;  3HBL A;  3M4O J;  1MH3 A;  3PO3 J;  1TWC J;  2JA5 J;  1TWG J;  2DTZ A;  2IBD A;  2R93 J;  5EF6 A;  2K9S A;  3VPR A;  2CJJ A;  3A02 A;  5F04 A;  1U8B A;  3FK7 A;  2DMP A;  1YRN B;  4C2M J;  2TRT A;  1BL0 A;  3S1Q J;  5IYB J;  3HGY A;  1JJ8 C;  3OIO A;  5IP7 J;  5F0F A;  2WAQ N;  2B63 J;  3F0C A;  1BW6 A;  1TWF J;  3PM1 A;  2JK3 A;  5JLX A;  1B72 A;  1X58 A;  3BTI A;  3O8H A;  4DZJ A;  2FX0 A;  2L7M P;  1VND A;  1RKT A;  1K61 A;  1K83 J;  3QPL A;  3JRH A;  5C4X J;  4MLO A;  1Y1W J;  2Y9Y A;  1MSF C;  2ECB A;  2HOS A;  5HOD A;  4L5E A;  3DCF A;  1GDT A;  2G0E A;  3B6A A;  1MSE C;  2CQQ A;  2GLO A;  5K7Z A;  3D1N I;  1Y1V J;  5F0H A;  2ZB9 A;  3BG3 A;  1Q1V A;  3JRG A;  1MNM C;  1TWA J;  2JN6 A;  4BXX J;  2N8G A;  2D5V A;  1IG7 A;  2M9H A;  1I6H J;  1GUU A;  5M5W J;  1T33 A;  4FIS A;  3ZQG A;  4Y52 J;  4MFD A;  5FKL A;  3S16 J;  3TP0 A;  1RES A;  3OSG A;  1GT0 C;  1IC8 A;  1B72 B;  3BTL A;  1QRY A;  1NK3 P;  3IH3 A;  3G1O A;  2P81 A;  3HOZ J;  3S2H J;  5FKK A;  2ECC A;  4RDU A;  1LE8 A;  1HDD C;  4XID A;  2L7F P;  2X9D A;  2L7Z A;  1MH4 A;  2EZK A;  1POG A;  3JRD A;  2M8G X;  2K9N A;  2Y9Z A;  3S15 J;  2K9Q A;  3QQA A;  2I10 A;  1ZQ3 P;  2QCO A;  1U9N A;  2MG4 A;  1WI3 A;  1S7E A;  5J1U A;  3TW6 A;  3MVP A;  1RKW A;  2TCT A;  1HDP A;  3GTG J;  1JKQ C;  4B4C A;  1WH7 A;  3I4N J;  2R5Y A;  1ETQ A;  3MN2 A;  4M6V A;  5M3M J;  4XRM A;  2OF7 A;  2OPT A;  2QF7 A;  3I4M J;  1XC5 A;  3JRB A;  4IEJ A;  1MBE A;  1FTZ A;  1MBG A;  5M3F J;  1ETO A;  1OCT C;  2JA8 J;  2HYJ A;  4IHW A;  1FTT A;  3BR0 A;  4Y7N J;  5EGO B;  3GTL J;  3BTC A;  1UG2 A;  3JR9 A;  5E3L A;  1BW5 A;  2W48 A;  4UUT A;  5F1J A;  1H8A C;  3A03 A;  2LD5 A;  1WGX A;  1PUF B;  2H1K A;  1O4X A;  1ETK A;  1ETY A;  3B6C A;  2DA6 A;  3S1M J;  2XPW A;  2Y30 A;  2XB0 X;  3HOU J;  5GPA A;  1QVT A;  4XRS A;  1ENH A;  2LK2 A;  1JJ6 C;  1I3Q J;  4DYC A;  5J1R A;  3BR6 A;  5GPC A;  2JMW A;  5EYR A;  4X6A J;  1EF4 A;  4BKX A;  1P7J A;  3HOV J;  2EH3 A;  4FE7 A;  5IP9 J;  1H88 C;  3A01 A;  3QPS A;  5DS9 A;  1OCP A;  2XRL A;  4HNV A;  1HLV A;  3RKQ A;  4D7M A;  5F08 A;  4D7N A;  5EEA A;  1SAN A;  4JX6 A;  1RET A;  2NVQ J;  1A5J A;  1WPK A;  2DA4 A;  5EZH A;  4IHV A;  2XGE A;  1ETX A;  4W1U A;  3PO2 J;  1BJZ A;  4FTH A;  2IAI A;  1Z77 A;  3L1P A;  1IJW C;  2DA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...