1JL1A

D10a e. coli ribonuclease hi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
152
structure length
152
Chain Sequence
KQVEIFTAGSALGNPGPGGYGAILRYRGREKTFSAGYTRTTNNRMELMAAIVALEALKEHAEVILSTDSQYVRQGITQWIHNWKKRGWKTADKKPVKNVDLWQRLDAALGQHQIKWEWVKGHAGHPENERADELARAAAMNPTLEDTGYQVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RIBONUCLEASE HI
publication title Native-state energetics of a thermostabilized variant of ribonuclease HI.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 49
structure length 152
sequence length 152
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1jl1A00
3KJVA 3RR7A 3HK2A 2E6MA 3QIOA 1S1WA 3QNNA 1HPZA 1RDCA 3BGRA 4KRFA 4C8MA 4ZHRA 1UA1A 1K6YA 4E0DA 3AVCA 3KK3A 4DMNA 3OYFA 3EZ5A 1IKWA 1QSYA 1VSIA 4FW2A 1A5WA 3L2UA 2BE2A 2XY8A 4KFBA 2B5JA 2VWKA 5CYQA 3V1RA 4BWMA 1IKVA 1T7PA 4YFUA 1A5XA 1TVRA 3AO1A 3AVMA 2ZQBA 5FROA 3VA0A 4DTOA 3QEVA 2YNIA 3OY9A 3OYMA 4FXDA 4OPJA 1HJRA 4O0JA 3KK2A 2KW4A 4FLYA 1CXQA 4E7HA 4CIGA 4CGJA 3V9SA 1FKOA 4FJKA 5FRNA 3AVGA 3D0PA 1S6QA 1A5VA 4C8KA 1RCHA 4W5TA 1RT6A 1ASVA 1KCFA 3IAYA 3O3GA 3O3HA 4DQIA 3DYAA 1WLJA 4E3SA 4W5OA 3RMAA 3JYTA 2XO7A 3NHGA 3OYAA 1T03A 3VQ8A 1QTMA 4PQUA 2IS3A 1CZ9A 1EX4A 4Q5VA 3KLGA 1RT2A 3WNHA 1U47A 1T05A 2PYJA 4CJLA 3VQPA 2KQ2A 1HNIA 3QESA 2P1JA 3BDPA 3AA3A 3K57A 3PX0A 1ASWA 4AHCA 3C6TA 1UAXA 4OKJA 1HRHA 3ZSVA 4AH9A 3ZT3A 4CJEA 1NKEA 2Z1HA 1VSEA 2X78A 1U49A 5C25A 3VQ7A 1J9AA 4J2DA 2F8TA 4OLAA 4AHUA 2IDOA 4DS5A 4M3TA 2YV0X 1S9GA 2I5JA 3I0SA 4DTSA 2FC0A 2PYLA 1QSLA 3L3VA 4DFMA 2DY4A 4DSFA 1VSMA 2YHAA 3TARA 5CZ1A 1O1WA 4K8ZA 3ITHA 1QHTA 4NYFA 3S3NA 4UQGA 1WAFA 4Z4IA 3I8DA 1SKRA 4FJGA 4FJNA 3V6DA 1ZBFA 3NF8A 3TAFA 4KHWA 4DSEA 2G8WA 3NF6A 5FDLA 4M45A 3TAQA 3DLEA 1TAUA 3LALA 2KFNA 1L3VA 2G8KA 5C24A 2HB5A 1D9FA 3AVLA 1JKHA 4BWJA 4EP5A 3L2RA 3SV4A 3DRRA 3AV9A 4LD0A 4FJXA 4KKOA 4RG8A 2PZSA 3NH0A 4OKKA 1SKWA 2GUIA 4KPYA 1RBUA 3G10A 3ALYA 4CERA 1EXQA 3LP1A 3WNEA 1Y97A 5DMRA 4DFJA 5D3GA 2HNYA 4CF9A 4OLBA 3CFPA 4OPKA 5J2MA 3HPHA 4DTUA 2HHWA 3CFRA 1C0UA 4PY5A 1C6VA 2RKIA 1VRTA 1TL1A 5C42A 4B9LA 5I3UA 3NGIA 4Y1CA 1EP4A 4CJTA 1JXEA 1WSJA 3AA4A 4CF1A 3K5LA 3PV8A 4C8OA 2O4IA 4H4MA 2WOMA 1LW0A 4FJ5A 4CHZA 1CLQA 4CGDA 2YKNA 1WSFA 4GVMA 4CESA 3K5MA 4ELTA 4F2RA 3L8BA 3K58A 3QETA 4CCHA 1KVAA 4YNQA 3EYZA 4DU1A 3P5JA 1D5AA 4IDKA 4FJLA 5J2PA 3V1QA 3U3GA 3PO5A 4M3UA 4CJQA 1S5JA 2G8VA 1NK9A 1BHLA 3VQ6A 4CHQA 4FLZA 3QIPA 3C6UA 3ZT2A 4RW6A 4KTWA 3SQ0A 3TAMA 3OYJA 4JS4A 4CE9A 2Z1GA 4KV8A 3S9HA 3PX4A 4CK1A 1RILA 4B8AB 1VSKA 2VG5A 3ZSZA 3EY1A 3V9WA 3ISNC 1SUQA 1UOCA 4CJ4A 2GBZA 1EETA 5JS1A 1SKSA 3LP0A 2D5RA 3AO2A 1FK9A 3V9ZA 3ZT0A 1X9MA 2HHXA 2RPIA 1ZBIA 4CF2A 4E7KA 3OJUA 1RNHA 2X74A 3HSTB 1RBSA 4Z4HA 1T8EA 4N41A 4CEDA 3DLBA 4DQPA 4FLTA 1RDDA 3OS2A 2HW3A 2HHQA 3AVFA 3QEWA 3NE6A 1FKPA 3AVNA 4AHRA 3RWUA 2HHVA 3LP3A 3KLFA 1VRUA 1WAJA 3P1GA 4M3XA 1CXUA 4DSIA 4FJMA 4CK2A 2HNDA 4OVLA 1S1XA 3DLRA 4LSNA 3O3FA 4KHNA 4DU4A 1NJZA 4I2PA 3E01A 3HT3A 1RBRA 5KGXA 2F8SA 4DS4A 4KTQA 1F21A 1J53A 3T1AA 5SZTA 1C1AA 3AVHA 3S3OA 3I0RA 1R0AA 1ASUA 1I3AA 4B8CA 4BE0A 1LWCA 4CEQA 2A1RA 1L3TA 4AILC 4WE1A 4PA1A 4FJJA 4DTNA 2Z1JA 3SQ1A 1NK7A 2QKKA 2Y1JA 4ID5A 1BGXT 1LWFA 4IG3A 1ZBUA 2DFEA 5HP1A 4IFYA 3CM5A 3MEDA 3MAQA 3V4IA 1KFDA 1WNSA 1Z26A 5CY4A 3LDSA 1ZBLA 4KHYA 4XIUA 1N6QA 3NBPA 3AO4A 1NK4A 1LAVA 1GOBA 4HTUA 3P83D 4H8KA 4CJ3A 2IGIA 3B6PA 1KFSA 2HHSA 1B9DA 3VQBA 2W42A 4CFBA 3SYZA 3KKSA 1NJYA 4O5BA 3SUNA 3OS1A 1Q9XA 4O55A 4FZZA 3NFAA 3PUFA 4FK2A 1NKCA 1Q9YA 3V1OA 3OYIA 2P5OA 3MECA 4LH5A 3HP9A 3NH1A 4BACA 3OYKA 2RN2A 5CZ2A 1XWLA 1JL1A 1B9FA 4MQ3A 5KTQA 3HM9A 2VG7A 3HJFA 1YTAA 1RTDA 4CIEA 4CHYA 1YVUA 4G1QA 3ULDA 3OYBA 2X6NA 2LSNA 3VN5A 3AVKA 2Z1IA 3DMJA 3NDKA 5I42A 1XI1A 3IG1A 1SL0A 3SI6A 1NJXA 3NGZA 4H4OA 1WSIA 2D0BA 4JRPA 1B92A 1TK8A 1NK5A 3QERA 3RRGA 3SUQA 4CIFA 1X1PA 4R5PA 1VSFA 1W9HA 1J54A 4ID1A 4TSXA 3O4QA 3NF7A 1JLAA 4Q0BA 3KKRA 4FM2A 5EU7A 1KVBA 1TGOA 1ZYQA 1NOYA 2VG6A 3HVTA 3O4NA 2GV9A 1BL3A 2JLEA 4CJKA 4CECA 5KI6A 2HVIA 1QS4A 2E4LA 3L2QA 4BDYA 2RF2A 2G8HA 4DSLA 2QKBA 4DG1A 2HHUA 4JRQA 3U6FA 1HYZA 4OGEA 4DSKA 2YNHA 4M3ZA 3QINA 4M3RA 1BCOA 5E41A 2X6SA 4BE2A 4F3TA 3ZSRA 4EZ9A 1RBTA 3HVRA 3UIQA 4E7JA 2PY5A 2O4GA 3ZT4A 3V9UA 4KB1A 1JLEA 1RTIA 4GW6A 2XY7A 1ZBHA 4E1NA 1TKXA 4KHQA 3HL8A 1JLQA 4EZ6A 1EKEA 1IH7A 1HYVA 4B9TA 5KRTA 4KREA 4CGFA 2D0CA 3OYHA 4ELUA 3VQQA 5HRNA 4Z4FA 4ZTFA 3C94A 4FLVA 4B9SA 2FBTA 3NCIA 4CJWA 5T7BA 4GMJB 3VQ9A 3SQ2A 2P51A 2OYQA 3K2PA 1SL2A 4E7LA 3KTQA 3DRPA 2XY5A 4KTZA 4CHOA 3AVBA 1IG9A 4F3OA 1RTHA 3VA3A 2G8FA 5K14A 4FJ7A 4BDPA 3QO9A 4HUEA 4DTXA 3SV3A 3M8PA 4CEEA 1GOAA 4CEFA 3VQEA 1KSPA 3KK1A 4ELVA 3A2FA 3D45A 1NK8A 3VQAA 4DFKA 1IKXA 4Z0UA 3LAMA 4DQQA 4C8NA 1VSJA 3V9XA 1ITGA 3OYDA 1XC9A 4HCCA 1JL2A 4FZYA 1I39A 1TK5A 2P5GA 4CK3A 4JS5A 4B9VA 4DF4A 4FLUA 3SZ2A 1C0TA 3AVAA 4DQRA 3KIOA 1LWEA 3ZSXA 2YHBA 4OKEA 4E19A 1C1CA 1X9SA 1RDAA 3QEPA 2XY6A 1WSHA 1LW2A 1U04A 3CFOA 5SWMA 1L3SA 1J5OA 1HQEA 1Q8IA 1VSDA 2OPPA 4IFVA 4M3WA 1QSSA 4FYDA 4DSJA 2KTQA 1MU2A 4CHPA 3TABA 4CJFA 4DTRA 2F96A 3LPUA 4RW9A 4ZTJA 4IKFA 1L5UA 3ZSWA 3TR8A 5FRMA 1WSGA 2QXFA 3K5OA 3LANA 2G8IA 3VQCA 4CJUA 4CF0A 1DTQA 4PUOA 4B9UA 4M42A 3OYNA 4DLGA 1S1TA 1XHXA 2FBXA 1RTJA 4CFDA 1KVCA 5J1EA 1BISA 4CJPA 4FW1A 3OVNA 4K8XA 4B9NA 4J2EA 4CEBA 3H08A 3AO5A 2ETJA 4HUGA 3NF9A 4N76A 3MXJA 4J2AA 1TL3A 4KAZA 4W5NA 2FBVA 3TAEA 3QEXA 1FXXA 3AVJA 4PWDA 3IRXA 3S3MA 4FJHA 3KLEA 3LPTA 2FBYA 3DOKA 4IBNA 3KLIA 3JSMA 1BQMA 1VSLA 3VQ5A 3MXMA 3L2VA 3MEGA 2HMIA 4OJRA 4M3YA 3F73A 3TAPA 4IG0A 4DLEA 1S9EA 3U3YA 4RW4A 3LZIA 2YNGA 4F4KA 3OJSA 3THVA 3HO1A 1UWBA 3SUOA 1NKBA 1RT4A 3LP2A 1TKDA 2YKMA 1D8YA 4NYNA 1JLGA 4ICLA 2OPSA 4DU3A 2YNFA 4LH4A 1U4BA 1RT7A 3CQ8A 3HYFA 4FM1A 3T19A 4CFAA 2IC3A 1X9WA 3DLGA 4KHUA 1NK0A 1JLCA 2ATQA 2Q3SA 4CGIA 1XHZA 1HQUA 3PO4A 4I9QA 4KO0A 4HUFA 4CF8A 5DK5A 2HNZA 3HPGA 4FM0A 4CEOA 4FK0A 3OS0A 4LY7A 3AA5X 3KLHA 4KI4A 5HLFA 3ZSYA 1WN7A 1IKYA 1VSHA 1KLNA 2WONA 1RT5A 4KB0A 4AHVA 1HNVA 3AO3A 3SQ4A 1IO2A 2B6AA 3DRSA 5HRPA 3SUPA 3OYCA 3KD1E 3LZJA 1BIUA 1L3UA 4LSLA 1BIZA 1W0HA 1VK0A 2NUBA 2OPQA 4QOZB 1S1VA 3T3FA 4N47A 1QE1A 3G0ZA 4Y1DA 3HP6A 5HRSA 4CEAA 2G8UA 1TAQA 4FK4A 1NOZA 2EHGA 3VQDA 3LWLA 3RMDA 1NK6A 2IAJA 4EP4A 4DF8A 1UA0A 1NJWA 2OZMA 3L2WA 1HMVA 4QCLA 2KZZA 4I9LA 4CJSA 1BQNA 1YT3A 3ZCMA 4FVMA 2XHBA 4J2BA 3HPOA 4B9MA 4AHTA 4RW7A 2VWJA 4F8RA 3NGYA 2QK9A 3ASMA 4NCAA 3RR8A 4FLXA 3CYMA 1S6PA 3SCXA 2OZSA 4BE1A 2B4JA 1U48A 4HVJA 3SNNA 3K5NA 2AJQA 2ZD1A 3VQ4A 2BDPA 2XRIA 4CFCA 3HXMA 2IOCA 3SPZA 4NCGA 2BGGA 4FZXC 2R7YA 3WNFA 3NH2A 3DOLA 3ZSOA 4KI6A 3L3UA 3LWMA 4CHNA 4I2QA 4HHTA 3RRHA 5HBMA 1RDBA 2E6LA 4CJRA 4O0IA 3QNOA 4DFPA 4L8RB 2KFZA 4CEZA 1RT3A 5HRRA 3RMCA 5KRSA 2BANA 3MXIA 1D9DA 1RT1A 4CJ5A 1LAWA 2ZE2A 1LV5A 5CYMA 3PY8A 4DTJA 4CGGA 4O44A 2JGUA 4F2SA 3OYGA 4FJ8A 1KTQA 1BI4B 1JLBA 1S1UA 3ZSQA 3TAGA 1U45A 3QLHA 1KLMA 4M41A 4W5QA 3C95A 3DLHA 1BI4A 5J2NA 2HVHA 1HYSA 1C1BA 5J2QA 4B08A 3SPYA 1N5YA 4C8LA 4FJ9A 2ITGA 3AVIA 3V81A 1DTTA 3M8RA 2KZMA 5HROA 1TV6A 4DQSA 1G15A 4Z4EA 1TKZA 5KGWA 3DLKA 4HCBA 3AA2A 4FCYA 2OA8A 3F9KA 1CZBA 1DLOA 4Z4CA 1BCMA 2EX3A 4W5RA 4OGCA 4DTPA 4Z4GA 3KD5E 3PX6A 3B6OA 2A1SA 4AHSA 3FFIA 1KRPA 1RBVA 3DM2A 4CJVA 1JXBA 4E89A 1SL1A 2DFHA 4FJIA 4NCBA 3M8SA 3NAEA 3TWHA 3CG7A 3TANA 3DI6A 4E7IA 3LAKA 2DFFA 1JLFA 1REVA 1C0MA 4O4GA 2DTUA 1WSEA 3OYLA 1GOCA 1TK0A 4N5SA 4E1MA 1QQCA 3RMBA 4MFBA 3OYEA 2HHTA 3IS9A 4RW8A 4N56A 4BDZA 1Z25A 1TKTA 3ZT1A 3SJJA 3CM6A 4KHSA 3RTVA 4CGHA 3K59A 4FLWA 5JS2A 3M8QA 1SV5A 2Y1IA 4QAGA 1YTUA 3TI0A 2OPRA 3QEIA 4I7FA 4JLHA 3WNGA 3MEEA 4DTMA 4B3OA 4DWIA 2D0AA
chains in the Genus database with same CATH superfamily
3HK2A 3QIOA 1S1WA 3H6EA 3QNNA 1HPZA 3CIPA 3BGRA 4B1VA 4C8MA 1H1VA 2CGLA 2P9IA 4DMNA 3EZ5A 2P9PB 3GBTA 2XY8A 2P9PA 4KFBA 5AQYA 3V1RA 1IKVA 4IO8A 4YFUA 1TVRA 4NXNK 3AO1A 3AVMA 4DTOA 1VHXA 4JI4K 3QEVA 3CXCM 1KXPA 4CIGA 3D0PA 2FF6A 3O9SA 3O3GA 5KPTA 1T03A 2GEMA 3JYTA 4PQUA 2IS3A 3KLGA 1RT2A 1RGIA 1T05A 4CJLA 1HNIA 2YX6A 3VF6A 4AH9A 1UAXA 4OKJA 3HI0A 4FWRA 2Z1HA 3DLLL 1VSEA 3K9KA 2X78A 4AHUA 2IDOA 1QVGM 5C2FA 3L4QA 2I5JA 1QZ5A 3R9PA 4DQ8A 2DY4A 4DSFA 4K8ZA 1BWFO 4UQGA 1WAFA 4FJGA 4JHDB 4DR7K 3NF8A 1YJWN 4OPAA 3WXJA 3NF6A 5ELZA 3DLEA 2Q2RA 4YOXA 2KFNA 1T6CA 2QW9A 3AVLA 4BWJA 3L2RA 3SV4A 4FJXA 4NLCA 3IFRA 5LY3A 4KPYA 4FWOA 3WEEA 3G10A 3ZX0A 1TUYA 5D3GA 3M1FA 1T44A 1HKGA 4YOWA 3PLAA 4OPKA 3H45C 5J2MA 5AQKA 5LJWA 3IUCA 1S3XA 1LOTB 5I3UA 3NGIA 4Y1CA 3PV8A 3AA4A 1U6ZA 2O4IA 4H4MA 3A5LC 2ZGZA 4ELTA 4CZLA 4F2RA 3L8BA 4BGAA 4YNQA 4DU1A 2P9LB 3CCQN 1D5AA 4FJLA 5J2PA 2P9LA 3PO5A 4CJQA 4C1NI 3NVKA 3GE1A 3QIPA 3ZT2A 3SQ0A 3VENA 4BGBA 2Z1GA 3S9HA 3PX4A 2VG5A 1N33K 2O8FA 2HHXA 1HJOA 4E7KA 3HSTB 5FPNA 4DQPA 1EWQA 2HHQA 3AVFA 3C65A 4WFNL 3AVNA 4AHRA 5BRFA 3KLFA 1VRUA 1CXUA 3WXKA 3THYA 1QVFM 4DS4A 3TTCA 1YUWA 3T1AA 5SZTA 1C1AA 1T6DA 1R0AA 3FE1A 2A1RA 1ZC6A 4WE1A 4K41A 2DPNA 4ISGA 4BREA 4O5FA 5AJ3K 1NK7A 2W6KA 1LWFA 4IG3A 4WQ4C 1QHAA 2DFEA 4IFYA 4RWTA 1XC3A 3V4IA 5CY4A 4DV6K 1EWRA 4BRMA 3DXKB 3GG4A 3MDQA 1LAVA 4JK7A 5AQZA 3JXUA 4CJ3A 3DXKA 3B6PA 3SYZA 4CFBA 1NJYA 2F7TA 5FPEA 2O8CB 3OS1A 1Q9XA 3UB5A 2O8BA 2O8CA 2P5OA 2WBNA 5CZ2A 4MQ3A 4DCHA 3CJ1A 1RTDA 4CIEA 1SQKA 4G1QA 3OYBA 2KLAA 3VN5A 3AVKA 2D0OA 4H4OA 1TK8A 4LC9B 5TKYA 4CIFA 1X1PA 3G4SN 1JLAA 3T7ZA 1HX1A 4FM2A 5E26A 5AQNA 1ZYQA 2GV9A 3MWTA 4CJKA 2Q36A 4JRQA 4OGEA 2YNHA 4M3ZA 3QINA 2YHYA 3C7NB 1BCOA 5E41A 1J5EK 3C7NA 1RBTA 3HVRA 4E7JA 3ZT4A 3LM9A 3MN5A 1JLEA 1RTIA 4GW6A 4CJ7A 1ZBHA 4E1NA 1TKXA 3JAMO 4DUYK 4XH5A 1IH7A 5KRTA 3OYHA 4Z4FA 4JD2B 1NMDA 4DV3K 4YHHK 1P8ZA 3NCIA 4JKAA 4GV6A 3ATUA 2P9KB 4E7LA 3KTQA 3H1VX 4KTZA 4CHOA 1IG9A 3RSEA 1VQNN 1T3VA 4FJ7A 4HUEA 3M8PA 3WUHA 1GOAA 3O5BA 4JK9A 1NK8A 4JI0K 3VQAA 3CF5L 4BG8A 4Z0UA 3LAMA 4HCCA 1JL2A 3SZ2A 1VQ4N 2UXBK 4DQRA 2D1KA 3KIOA 4DB3A 1P90A 3TTDA 4OKEA 4XEIA 5F0XA 1WSHA 2W41A 1Q8IA 2OPPA 1QSSA 4CHPA 3LPUA 4HWIA 3TR8A 4YOVA 1WSGA 1VQ6N 2G8IA 4PUOA 4YDUA 2UXDK 4DLGA 2FBXA 1KVCA 5J1EA 3ZETB 1M1KO 5M1PA 4B1UB 4CBUA 3ZETA 2YCHA 3DXMA 3O4WA 4N76A 3MXJA 1TL3A 4W5NA 4GKKK 5AQTA 2FBYA 3CJ7A 2PBDA 4JKHA 3VQ5A 5AQVA 1BDGA 4M3YA 1ESVA 3TAPA 4BQLA 4GNIA 3TSQA 1S9EA 3U3YA 2CH6A 2CH5A 3LZIA 1E3MA 3HSCA 3CC4N 4AM7A 2UXCK 1XNQK 1RT4A 2YKMA 4LFAK 1JLGA 4GV9A 4LH4A 4FWLA 1RT7A 1U4BA 4YOUA 4GVEA 3T19A 4JI5K 3DLGA 3VF4A 3I56N 1NK0A 1JLCA 2Q3SA 2VQEK 1XHZA 4FM0A 1NGJA 4FK0A 4CD3A 3KLHA 3ZSYA 3FZFA 1IKYA 1VSHA 5AQQA 1KLNA 4KB0A 4DR2K 3SQ4A 5HRPA 3LZJA 4CZHA 1W0HA 1QE1A 2A41A 4CEAA 3J7ZO 4Y0WA 1NOZA 1NJWA 5GIPA 3AAQA 1HMVA 4BR4A 4QCLA 1BA1A 1YT3A 3ZCMA 4KH4A 3HPOA 4AHTA 4JYAK 3T1HK 3RR8A 4FLXA 2OZSA 5AQWA 3ZLJA 2BDPA 2OCEA 2XRIA 3HXMA 4NCGA 3QBXA 2R7YA 3WNFA 3ZSOA 4KHPK 3L3UA 4HHTA 4I2QA 1XMQK 4DFPA 2E6LA 4EAHD 2A6AA 2BANA 1RT1A 4JI1K 2ZE2A 1ATRA 1XMOK 1KAYA 4F2SA 3PSIA 3VTHA 3TAGA 2Q0RA 3ZSQA 1U45A 1KLMA 3C95A 1HYSA 1C1BA 3VEVA 3QFPA 4X65K 5BR8K 1N5YA 1VAZA 3EE8A 3V81A 4FJ9A 3FFKB 4DQSA 2E1ZA 1G15A 3OTOK 4Z4EA 4HCBA 4BR9A 5AQHA 4BR2A 3CCVN 5KPRA 1CZBA 5AQJA 5EX5A 5CR4A 4BRAA 3FFIA 1S72N 1KRPA 1RBVA 4ISFA 1JXBA 4E89A 2FSJA 3M8SA 3NAEA 2CGKA 3TWHA 1JLFA 4L3QA 2V52B 4O4GA 2DTUA 4H0YB 4E1MA 3G25A 1QQCA 3RMBA 4MFBA 3OYEA 2HHTA 2PAVA 1TUUA 2F9WA 1Z25A 2ZGYA 4N56A 4DV0K 3CM6A 3SJJA 4KHSA 1SV5A 2E88A 3E1YA 3TI0A 3K9JA 4JLHA 3WNGA 3MEEA 1HKBA 2ITMA 2Q1NA 3SAFA 4B3RK 2QM1A 4KRFA 1RDCA 5AQPA 4H0VB 3AVCA 4QS9A 2P9NB 3BP8A 3VPZA 2BE2A 4PKHA 2B5JA 2VWKA 3UKRB 2E2NA 4BWMA 1JCGA 3UKRA 5FROA 2YNIA 4FXDA 4OPJA 1HJRA 2KW4A 3R3LA 4CGJA 1GLEG 4X64K 4FJKA 5FRNA 1S6QA 1A5VA 4BRIA 4C8KA 4W5TA 4DQIA 3CMAN 1WLJA 4E3SA 3FR0A 3RMAA 3NHGA 2XO7A 3OYAA 1QTMA 3VQ8A 1GLLO 4A62A 3UE5A 3DWLA 3WNHA 3M3ZA 3P31A 2QTDA 5HL7L 3K57A 3PX0A 4AHCA 3ZSVA 3ZT3A 3QMLA 2GTDA 4BRKA 1J9AA 4LF9K 2F8TA 1NGHA 4M3TA 2VGMA 2FC0A 4FWQA 5AQIA 2PYLA 5DM6L 3L3VA 4DFMA 4CW7B 2YHAA 1OVYA 1V4TA 3ITHA 3FZMA 1YIJN 4IO9L 3VTIA 4KHWA 3EEQA 4FWSA 5FDLA 4M45A 2BUPA 4DHYA 4JKBA 3LDOA 4AM6A 1TAUA 3DRRA 3EE9A 4KKOA 4RG8A 4LFCK 3CJ9A 4XH4A 3ALYA 5GINA 4WQ5A 1HLUA 1Y97A 4CF9A 4MLHA 2KKZA 1SZ2A 1LCUA 4I6MB 5AR0A 3LL3A 1S22A 3HPHA 4DTUA 2HHWA 4PY5A 4H0XB 5C42A 1EP4A 4CJTA 4C8OA 5BR9A 1YVNA 1LW0A 2WOMA 2OTLN 5JMVA 2RE2A 3MN9A 3K5MA 1YAGA 1NGGA 2ASMA 3K58A 4JNEA 3P5JA 3V1QA 2GWKA 3UKUB 1S5JA 2G8VA 4BRGA 3UKUA 3VQ6A 3C6UA 3ENHA 5MLCQ 3OYJA 1DGKN 4JS4A 5GIOA 4CE9A 4DR5K 5M1QA 4CK1A 4B8AB 1VSKA 5KQ8A 3OW2M 1UOCA 1EETA 5JS1A 3W3DA 2D5RA 1FK9A 1X9MA 2X74A 3CJAA 5C2DA 2HW3A 3D7EO 3A5NC 3R8EA 5AFUA 1S1XA 3DLRA 4LSNA 4KHNA 1NJZA 3CC2N 2F8SA 2HBMA 3N4QA 3SMPA 1OKJA 3AVHA 1ASUA 1I3AA 4BE0A 3U4LA 3SAGA 4CEQA 1HUXA 1L3TA 4AILC 4IEIA 4DTNA 5AZIB 2YJFA 3SQ1A 3OBWA 2Y1JA 5AZIA 5HP1A 1NM1A 5M1NA 3MN7A 1N6QA 3NBPA 3G6EN 1GOBA 4H8KA 1KFSA 3VQBA 4WCEL 4FZZA 3PUFA 4FK2A 3V1OA 5M1FA 2D4WA 3OYKA 5KTQA 3HM9A 1B9FA 1YTAA 3HBTA 1OVQA 1EQYA 4EHTA 3A8YA 2LSNA 1JCFA 1V4SA 3HOSA 2Z1IA 3NDKA 1XI1A 5BPMA 3IG1A 4BC5A 1WSIA 3ZEUB 4U7BA 3RRGA 3ZEUA 4TSXA 5AQLA 3O6WA 3O4NA 4JHDA 1RDWX 2JLEA 3VOVA 2HHUA 3L2QA 2QKBA 3L0QA 1HNXK 1OH6A 3SJHA 3U8XA 4M63C 3ZSRA 1Q7YO 2PY5A 2O4GA 4CVNE 5JLHA 3V9UA 1ATNA 2HSTA 2XY7A 3A5OC 1JLQA 1HYVA 3ULEB 4CGFA 4ELUA 3VGLA 3C94A 4R79A 2FBTA 3K2PA 1SL2A 1CZAN 4B3SK 4F3OA 3CPEA 3H46O 1RTHA 3VA3A 3J8AA 1JJ2M 4CZKA 2FXUA 3SV3A 4CEEA 3VQEA 3D45A 3WXIA 4DFKA 1SS6A 3F9MA 4FO0A 3V9XA 1I39A 3Q7BA 4CK3A 3BF3A 4DF4A 2IVPA 1C0TA 3AVAA 4E19A 3PIOL 1LW2A 5SWMA 4FYDA 3F5TA 3VGKA 3HOTA 2F96A 3C6HA 4ZTJA 4H5RA 1GLFO 4A61A 3VQCA 3VERA 3OVNA 4CEBA 2I7NA 4BQZA 5GAHP 4HUGA 4BRCA 4J2AA 2FBVA 3TAEA 3QEXA 4IXCA 3IRXA 3S3MA 4FPBA 4FJHA 3DOKA 4IBNA 3JSMA 4A2BA 2HMIA 3VMFB 4UY8O 3OJSA 1UWBA 3SUOA 1NBWA 1D8YA 4NYNA 5FPDA 1TYQB 5C10A 1QQMA 1HQUA 4KO0A 4HUFA 4CF8A 3H1QA 1O13A 4JI7K 4KI4A 3WQTA 1WN7A 4IOAL 3ZX3A 1N36K 1I94K 1KD1O 2W6LA 5C12A 2QWPA 3SUPA 1BUPA 1BIUA 1L3UA 4LSLA 4BRFA 3QB0A 4QOZB 2G8UA 4ILHA 4N47A 4M7YA 5ADXA 3HP6A 1HKCA 4C23A 1TAQA 3VEZA 2OZMA 3CCJN 2WUSA 2HMPA 4I9LA 1BQNA 4M7XA 5BRHA 4NO7A 4J2BA 4B9MA 4OX9K 4RW7A 4F8RA 3NGYA 4NCAA 2J4RA 3SCXA 4BE1A 2B4JA 3K5NA 5I9EB 3CC7N 3BY5A 3KWIA 4OPHA 1QZ6A 1DEJA 2NRWA 3DOLA 3ID6A 4JD2A 3EL2A 5HBMA 3MX5A 3J80O 1RT3A 5HRRA 5KRSA 3PIPL 1D9DA 4CJ5A 2P9KA 3DJCA 3PY8A 3MN6A 5FPMA 2JGUA 4FJ8A 1E4GT 1YF5L 2WC9A 3B8AX 1S1UA 1NNEA 3DLHA 2W40A 2HVHA 1J6ZA 2BH1A 5J2QA 2P9UB 3F2KA 1YI2N 4O8KA 2P9UA 3AVIA 4KH6A 1VQ7N 4MLEA 4GKJK 4B3MK 5KGWA 2AP1A 1DLOA 4W5RA 5AQGA 4AHSA 4NCBA 4FJIA 5DM7L 2FLOA 1D4XA 1WB9A 2DFFA 3QDKA 1REVA 1C0MA 1OH8A 2QWLA 1XQSC 4DV4K 3OYLA 1TK0A 4N5SA 1IBMK 4BDZA 4B3TK 3O8MA 1NLVA 4DR1K 4QAGA 1NGAA 2E2OA 3QEIA 1MWKA 4I7FA 4DTMA 4DWIA 2D0AA 3CCUN 1K73O 3J81O 3KJVA 3RR7A 2OTJN 3JS6A 3BUZB 3A0IX 1X3NA 2H3GX 1K6YA 1BA0A 1IKWA 4YDUC 1VSIA 4FW2A 1QSYA 3L2UA 5LMUK 4BC4A 5CYQA 1WUAA 3LM2A 1T7PA 3VA0A 1DT9A 3OY9A 3OYMA 4DV7K 2NLXA 4C1NK 3AY9A 3KK2A 1CXQA 4LF4K 1RCHA 3RVCA 4K0KK 1RT6A 1KCFA 4BVOA 3O3HA 3DYAA 4ILGB 2GWJA 3CETA 1NG9A 1CZ9A 1EX4A 2BTFA 4KH5A 3SLCA 3VQPA 2FF3B 3AA3A 1ASWA 3C6TA 5AZJB 4CJEA 1N32K 2FSNA 5AZJA 1U49A 3VQ7A 4J2DA 4B1YB 4OLAA 3ENBA 4FOIA 3CCRN 2F4VK 1E4FT 1IV0A 4FL9A 1S9GA 3I0SA 4MDBA 1FW6A 1QSLA 4JN4A 3P39A 4BR7A 5CZ1A 1XUPO 4Z94A 4JKCA 1QHTA 4K42A 1SKRA 4FJNA 3H3NO 1ZBFA 3TAFA 4BROA 3Q7CA 5JICA 3TAQA 3BZCA 2RHKA 1L3VA 3K0SA 2G8KA 1ZBSA 5C24A 2HB5A 3VEYA 4GY2B 4EP5A 4LD0A 3AV9A 1YJNN 3SMSA 2PZSA 3NH0A 4OKKA 4K43A 2GUIA 2JWLA 5EOYA 4CERA 2ASPA 3GL1A 4CZMA 4FWPA 3ATVA 3LP1A 5DMRA 4DFJA 4WYBA 4IEEA 5BN9A 5GAEP 3IMXA 3CFRA 4YOTA 1OH7A 1VQ5N 1K8AO 2UYTA 1QQOA 4B9LA 3K5LA 1JXEA 4CF1A 3HZ6A 4JI3K 4IZ9A 1CLQA 3VEOA 4CGDA 4CESA 4YOYA 5C0YA 3EYZA 3U3GA 1BHLA 1YHQN 4RW6A 3CCSN 3AO2A 2GUPA 3V9ZA 2QWRA 2RPIA 5AQXA 3TTFA 3OJUA 1RNHA 4Z4HA 3I55N 1T8EA 3DLBA 4FWNA 4FLTA 2NRVA 1FKPA 2HHVA 5BN8A 3LP3A 3OHRA 2HBJA 1WAJA 4DSIA 4JKGB 2HNDA 4OVLA 3O3FA 4JKGA 3T1YK 2ASOA 4I2PA 3HT3A 5KGXA 3E9LA 2P9NA 4KTQA 1W7AA 3S3OA 3KZBA 3WT0A 1W97L 2WTUA 1GLAG 4B8CA 1LWCA 3KVGA 4PA1A 4FJJA 1NGDA 4ID5A 2VYPA 5AFUH 1KFDA 1WNSA 4KHYA 4XIUA 4AF1A 1WBDA 4RTFD 2O8DB 3EKUA 4U67L 2O8DA 1MWMA 3ZYYX 3SUNA 2V7ZA 3O9QA 4O55A 5HOOA 1NKCA 4JKFA 2OANA 3MECA 4LH5A 3HP9A 2NRZA 4BACA 2RN2A 3HJFA 2VG7A 3AARA 1BU6O 4IOCL 1YVUA 4BY9C 3ULDA 5H1SQ 1SL0A 3NGZA 4JRPA 3OBYA 1HR0K 1W9HA 3QBWA 1J54A 4ID1A 3O08A 3O4QA 3NF7A 3H3OB 4JI2K 4Q0BA 3KKRA 3O1BA 1KVBA 4B1XB 2QI2A 5KI6A 3CQXA 4BDYA 4DSLA 2A5XA 3U6FA 1HYZA 3O9TA 4M3RA 3R1XA 4JI8K 2V7YA 3WXLA 4BE2A 5A2QO 4F3TA 2F9TA 2HBKA 4KB1A 4LF6K 4WF9L 2YHXA 4YORA 1NGCA 1GLJO 4H03B 5KPZA 3SAHA 4B9TA 1NGBA 4KREA 4IJNA 1VQMN 4I6MA 4JKDA 2WFBA 4CJWA 5BPLA 3DAWA 1OH5A 4GMJB 3VQ9A 3SQ2A 2P51A 2OYQA 3SK3A 1U2VB 2GELA 3AVBA 4DV2K 1U2VA 3I33A 1Q86O 2GX9A 5K14A 3QO9A 1RFQA 3O1WA 3TSPA 1GLDG 4ELVA 3A2FA 4WQ5C 2UUAK 4DV1K 1IKXA 3P38A 1WOQA 2I7PA 4DQQA 4C8NA 1VSJA 5JVHL 4FZYA 4BR5A 2P5GA 4JS5A 4FWMA 4B9VA 4FLUA 1NJIO 3SBGA 1X9SA 4MO5A 1RDAA 2HOEA 2XY6A 1J5OA 4M3WA 4IFVA 1K8KB 1K8KA 2NRHA 3FZHA 4CJFA 4DTRA 4RW9A 4IKFA 1L5UA 1C0GA 3C0BA 3ZSWA 3LDNA 5FRMA 3K5OA 3CD6N 4BVPA 3CERA 3OYNA 1S1TA 1XHXA 4CFDA 2KHOA 4K25A 1HNWK 4K8XA 4OO1J 3WQUA 2ETJA 5JVGL 1VQLN 1FXXA 4ISEA 3LPTA 4BRLA 4B1WB 3KLIA 2P9IB 1BQMA 1VSLA 3MXMA 4DUZK 3MEGA 3KWGA 3PSFA 4OJRA 3F73A 4DLEA 4H0OA 2Q97A 3AGRA 3LDPA 2A3ZA 4FPAA 1NKBA 3LP2A 4IDHA 3MMVA 3KK7A 4ICLA 4DU3A 1VQON 3CQ8A 3HYFA 5FLXO 3BZKA 4CFAA 2IC3A 5F2RA 1X9WA 1KAZA 1BOTO 2ATQA 4CGIA 2VWBA 3PO4A 5DK5A 3HPGA 4CEOA 2UUBK 4LY7A 3AA5X 4CD1A 2QA4N 5HLFA 2WONA 3L4IA 1RT5A 2E2PA 1HNVA 3AO3A 4LF7K 2B6AA 4KBOA 2CGJA 2NRRA 5AQOA 3T3FA 4E1JA 4CZIA 3CMEN 3RMDA 3LWLA 3VEWA 4PL8A 4DF8A 3L2WA 2KZZA 4IFEA 4H5VA 4FVMA 2XHBA 3M6GA 2ZJPL 3CJBA 4V19S 3CYMA 1U48A 4H5TA 4HVJA 4B1ZA 2E5LK 2ZD1A 4CFCA 2IOCA 5ADXH 2BGGA 3ULEA 3NH2A 4CZFA 2V51B 1NGIA 3RRHA 3QNOA 1RDBA 4CJRA 4O0IA 3L6QA 3WEEB 3MXIA 1LAWA 5CYMA 4BR0A 2IVOA 4CBXA 2NRXA 3IKMA 1BI4B 1Q81O 3QLHA 2IVNA 4A5BA 1BI4A 5J2NA 5LMNK 3D6RA 3D2FB 5LJVA 4C8LA 3D2FA 5M1KA 3M8RA 5HROA 3FGUA 2D0PA 2E1YA 3AA2A 4FCYA 2OA8A 3ID8A 4Z4GA 3KD5E 1G99A 3B6OA 3ZX2A 3OA9A 2O8EB 4CJVA 2O8EA 1Z05A 1VQKN 3CG7A 3TANA 3DI6A 3LAKA 4JI6K 5B8HA 5GAGP 5KQDA 3HRGA 4FSVA 2O8FB 3IS9A 4O8UA 4RW8A 2VCPA 3K59A 5JS2A 3M8QA 1N8RO 3SBTA 1ATSA 2OPRA 5BREA 4B3OA 2E6MA 4WQ4A 1ZXOA 3CCLN 3D2EB 3BEXA 4ZHRA 2AA4A 3THYB 1UA1A 3KK3A 4E0DA 3OYFA 3D2EA 3P4IA 1A5WA 4H5NA 1A5XA 2ZQBA 1IBKK 4BRDA 2Q31A 4FLYA 4O0JA 5M1OA 4CZJA 4E7HA 1JCEA 3V9SA 1FKOA 1XNRK 3AVGA 4PKIA 4H0TB 5AQSA 1TYQA 1ASVA 3IAYA 4W5OA 3A5MC 4BG9A 2ZJQL 3QICA 4Q5VA 1U47A 2PYJA 2HF4A 2KQ2A 3QESA 2P1JA 3BDPA 2E20A 2O8BB 1HRHA 1NKEA 2E8AA 5C25A 4DS5A 4JKEA 1X9JA 2YV0X 4DTSA 3EO3A 1N34K 2QWOA 4NB4A 1VSMA 1C0FA 1BG3A 3TARA 1O1WA 4NYFA 3S3NA 4Z4IA 3I8DA 3V6DA 1YXQA 5IWAK 1IBLK 2Q0UA 4DSEA 2G8WA 4CZGA 4CBWA 4FWKA 3LALA 3CHWA 4AQYK 4LF8K 1D9FA 3CQYA 1JKHA 2VGNA 3FLCO 2ZM6K 4H0PA 3IDHA 3LDQA 5BRDA 4BC3A 1SKWA 1RBUA 1EXQA 3WNEA 2HNYA 4OLBA 3CFPA 5AQUA 4BRNA 1Y64A 3FZLA 1C0UA 1C6VA 1VRTA 2RKIA 1TL1A 5AQFA 3MWPA 5EVZA 4NXMK 1WSJA 3RSEB 1GLCG 2P9SB 3ENOA 4CHZA 4FJ5A 2YKNA 1WSFA 3KHYA 4GVMA 2P9SA 4IOXA 3QFUA 5CHIA 3QETA 4CCHA 1KVAA 4DR4K 3G71N 4IDKA 4M3UA 4NLBA 1NK9A 4CHQA 4FLZA 2NZTA 2QWMA 4KTWA 3TAMA 4KV8A 4A5AA 1RILA 3U9ZA 3EY1A 3ZSZA 3V9WA 5TKWA 3ISNC 1SUQA 4CJ4A 2GBZA 1SKSA 3LP0A 1W2BM 3ZT0A 1ZBIA 4CF2A 4J8FA 4N41A 1RBSA 4CEDA 2QEXN 1RDDA 3OS2A 4X62K 4X66K 3NE6A 3QEWA 3RWUA 3TPQA 3VETA 3P1GA 3MK6A 4LFBK 4FJMA 4CK2A 3AGKA 3MCAB 4MO4A 4DU4A 3E01A 1RBRA 3DXMB 3EZWA 1F21A 1J53A 1M90O 3I0RA 2NNWA 3HM8A 1RDUA 1FJGK 2Z1JA 3U9DA 2QKKA 3VF2A 1BGXT 4H5WA 1NGFA 1ZBUA 5F1XA 1EO1A 3CM5A 2A40A 3MEDA 3MAQA 5IT9O 1ZBLA 1Z26A 3LDSA 3AO4A 1NK4A 4HTUA 3P83D 2IGIA 2HHSA 1HNZK 1B9DA 1NGEA 1BO5O 2W42A 3KKSA 3MCPA 4O5BA 2HBLA 4ILJA 3NFAA 1R59O 4JAXA 1Q9YA 3OYIA 1QQNA 1MDUB 5C15A 3NH1A 1XWLA 1JL1A 1SAZA 4FVUA 4CHYA 2E2QA 2X6NA 3I8BA 3DMJA 5I42A 1NJXA 4M3XA 2NRTA 3SI6A 2D0BA 1B92A 1NK5A 3QERA 3SUQA 4R5PA 1VSFA 2EWSA 4F9OA 5EU7A 1TGOA 1NOYA 2VG6A 3HVTA 3THWB 1BL3A 3NVMA 2VQFK 4CECA 2HVIA 1QS4A 2E4LA 3FZKA 2RF2A 3THWA 2G8HA 4DG1A 2YHWA 4DSKA 4CZEA 1IG8A 2ZWHA 2ZJRL 2X6SA 3VEXA 4EZ9A 3UIQA 4FOEA 3VESA 4KHQA 3HL8A 4EZ6A 1EKEA 5JLFA 4WFAL 2D0CA 3VQQA 3TU5A 5HRNA 3GDQA 4ZTFA 4FLVA 2PFUA 1YJ9N 4B9SA 4DV5K 1VQPN 5T7BA 3WXMB 3BF1A 3DRPA 2XY5A 3J7YP 1Z6RA 5GADP 2G8FA 3W0LA 4BDPA 4DTXA 1KSPA 4CEFA 3KK1A 3O9RA 3S41A 1ITGA 3OYDA 1XC9A 1TK5A 4BRPA 3CJCA 5LL6Z 4XH1A 1Q82O 1LWEA 3ZSXA 2YHBA 4DR3K 1C1CA 4MDAA 3EKSA 3QEPA 1U04A 3CFOA 1L3SA 1HQEA 1VSDA 1WBBA 4DSJA 2KTQA 1MU2A 3TABA 2QXFA 2UUCK 3LANA 4CJUA 4CF0A 1DTQA 4B9UA 3THXB 4M42A 3VGMA 1RTJA 3THXA 1BISA 4CJPA 4FW1A 3CPWM 4B9NA 4J2EA 3H08A 3AO5A 4QS8A 3NF9A 4PKGA 4KAZA 3AVJA 4PWDA 1DKGD 1HPMA 3KLEA 1KC8O 4GV3A 3L2VA 2HF3A 4IG0A 2HHHK 4RW4A 5EY4A 2YNGA 4F4KA 4IJAA 3THVA 3HO1A 5AQRA 2FSKA 1TKDA 4JV5K 2OPSA 1VQ9N 1MA9B 2YNFA 3HTVA 4FM1A 3GOIA 3E66A 4KHUA 4I9QA 4YY3K 2HNZA 4IWVA 4A2AA 3OS0A 2ZF5O 2UU9K 2QXLA 2YI1A 3AAPA 4JK8A 4AHVA 3MX2A 3KD1E 1IO2A 3DRSA 3OYCA 4DR6K 2KZMA 1BIZA 1VK0A 2IIRA 2NUBA 2OPQA 1S1VA 3E9OA 3G0ZA 4Y1DA 5HRSA 4FK4A 2EHGA 3VQDA 1NK6A 2IAJA 4EP4A 1UA0A 4RCHA 3J7AP 1Q18A 5EXWA 4CJSA 4BRHA 3TSUA 2YJEA 2VWJA 4BRQA 2QK9A 3ASMA 1K9MO 3T69A 1S6PA 3LDLA 4LF5K 3SNNA 2AJQA 1IJJA 3VQ4A 3SPZA 1X3MA 4FZXC 3O9UA 3M5RA 4KI6A 1GLBG 3LWMA 4PL7A 4CHNA 4JEPA 3CCEN 2KFZA 4L8RB 3CI5A 4BC2A 4CEZA 5E84A 3RMCA 2JWKA 1LV5A 3E9PA 4DKWA 4A57A 4DTJA 1YITN 4B9QA 4CGGA 3R6MA 4O44A 4EHUA 3OYGA 1KTQA 3CCMN 4G9ZA 4EFHA 1JLBA 3EN9A 1NWKA 4M41A 4W5QA 4WFBL 4A59A 2QWQA 4B08A 1ILYA 3SPYA 5CE3A 4CI6A 2ITGA 1DTTA 4QS7A 3N4PA 1TV6A 1NMNA 1TKZA 3DLKA 3F9KA 3NMUA 4Z4CA 1BCMA 2EX3A 5BPNA 4OGCA 4DTPA 4PHTX 3PX6A 2A1SA 3C6AA 1KQSM 1KAXA 3DM2A 1SL1A 2DFHA 4E7IA 4EIAA 1WSEA 2A42A 1GOCA 1VQ8N 4HTLA 2QWNA 3ZT1A 1TKTA 3RTVA 4CGHA 4FLWA 2Y1IA 1YTUA 5AQMA 1NU0A 3O80A
chains in the Genus database with same CATH topology
3KJVA 3RR7A 3HK2A 2E6MA 3QIOA 1S1WA 3QNNA 1HPZA 1RDCA 3BGRA 4KRFA 4C8MA 4ZHRA 1UA1A 1K6YA 4E0DA 3AVCA 3KK3A 4DMNA 3OYFA 3EZ5A 1IKWA 1QSYA 1VSIA 4FW2A 1A5WA 3L2UA 2BE2A 2XY8A 4KFBA 2B5JA 2VWKA 5CYQA 3V1RA 4BWMA 1IKVA 1T7PA 4YFUA 1A5XA 1TVRA 3AO1A 3AVMA 2ZQBA 5FROA 3VA0A 4DTOA 3QEVA 2YNIA 3OY9A 3OYMA 4FXDA 4OPJA 1HJRA 4O0JA 3KK2A 2KW4A 4FLYA 1CXQA 4E7HA 4CIGA 4CGJA 3V9SA 1FKOA 4FJKA 5FRNA 3AVGA 3D0PA 1S6QA 1A5VA 4C8KA 1RCHA 4W5TA 1RT6A 1ASVA 1KCFA 3IAYA 3O3GA 3O3HA 4DQIA 3DYAA 1WLJA 4E3SA 4W5OA 3RMAA 3JYTA 2XO7A 3NHGA 3OYAA 1T03A 3VQ8A 1QTMA 4PQUA 2IS3A 1CZ9A 1EX4A 4Q5VA 3KLGA 1RT2A 3WNHA 1U47A 1T05A 2PYJA 4CJLA 3VQPA 2KQ2A 1HNIA 3QESA 2P1JA 3BDPA 3AA3A 3K57A 3PX0A 1ASWA 4AHCA 3C6TA 1UAXA 4OKJA 1HRHA 3ZSVA 4AH9A 3ZT3A 4CJEA 1NKEA 2Z1HA 1VSEA 2X78A 1U49A 5C25A 3VQ7A 1J9AA 4J2DA 2F8TA 4OLAA 4AHUA 2IDOA 4DS5A 4M3TA 2YV0X 1S9GA 2I5JA 3I0SA 4DTSA 2FC0A 2PYLA 1QSLA 3L3VA 4DFMA 2DY4A 4DSFA 1VSMA 2YHAA 3TARA 5CZ1A 1O1WA 4K8ZA 3ITHA 1QHTA 4NYFA 3S3NA 4UQGA 1WAFA 4Z4IA 3I8DA 1SKRA 4FJGA 4FJNA 3V6DA 1ZBFA 3NF8A 3TAFA 4KHWA 4DSEA 2G8WA 3NF6A 5FDLA 4M45A 3TAQA 3DLEA 1TAUA 3LALA 2KFNA 1L3VA 2G8KA 5C24A 2HB5A 1D9FA 3AVLA 1JKHA 4BWJA 4EP5A 3L2RA 3SV4A 3DRRA 3AV9A 4LD0A 4FJXA 4KKOA 4RG8A 2PZSA 3NH0A 4OKKA 1SKWA 2GUIA 4KPYA 1RBUA 3G10A 3ALYA 4CERA 1EXQA 3LP1A 3WNEA 1Y97A 5DMRA 4DFJA 5D3GA 2HNYA 4CF9A 4OLBA 3CFPA 4OPKA 5J2MA 3HPHA 4DTUA 2HHWA 3CFRA 1C0UA 4PY5A 1C6VA 2RKIA 1VRTA 1TL1A 5C42A 4B9LA 5I3UA 3NGIA 4Y1CA 1EP4A 4CJTA 1JXEA 1WSJA 3AA4A 4CF1A 3K5LA 3PV8A 4C8OA 2O4IA 4H4MA 2WOMA 1LW0A 4FJ5A 4CHZA 1CLQA 4CGDA 2YKNA 1WSFA 4GVMA 4CESA 3K5MA 4ELTA 4F2RA 3L8BA 3K58A 3QETA 4CCHA 1KVAA 4YNQA 3EYZA 4DU1A 3P5JA 1D5AA 4IDKA 4FJLA 5J2PA 3V1QA 3U3GA 3PO5A 4M3UA 4CJQA 1S5JA 2G8VA 1NK9A 1BHLA 3VQ6A 4CHQA 4FLZA 3QIPA 3C6UA 3ZT2A 4RW6A 4KTWA 3SQ0A 3TAMA 3OYJA 4JS4A 4CE9A 2Z1GA 4KV8A 3S9HA 3PX4A 4CK1A 1RILA 4B8AB 1VSKA 2VG5A 3ZSZA 3EY1A 3V9WA 3ISNC 1SUQA 1UOCA 4CJ4A 2GBZA 1EETA 5JS1A 1SKSA 3LP0A 2D5RA 3AO2A 1FK9A 3V9ZA 3ZT0A 1X9MA 2HHXA 2RPIA 1ZBIA 4CF2A 4E7KA 3OJUA 1RNHA 2X74A 3HSTB 1RBSA 4Z4HA 1T8EA 4N41A 4CEDA 3DLBA 4DQPA 4FLTA 1RDDA 3OS2A 2HW3A 2HHQA 3AVFA 3QEWA 3NE6A 1FKPA 3AVNA 4AHRA 3RWUA 2HHVA 3LP3A 3KLFA 1VRUA 1WAJA 3P1GA 4M3XA 1CXUA 4DSIA 4FJMA 4CK2A 2HNDA 4OVLA 1S1XA 3DLRA 4LSNA 3O3FA 4KHNA 4DU4A 1NJZA 4I2PA 3E01A 3HT3A 1RBRA 5KGXA 2F8SA 4DS4A 4KTQA 1F21A 1J53A 3T1AA 5SZTA 1C1AA 3AVHA 3S3OA 3I0RA 1R0AA 1ASUA 1I3AA 4B8CA 4BE0A 1LWCA 4CEQA 2A1RA 1L3TA 4AILC 4WE1A 4PA1A 4FJJA 4DTNA 2Z1JA 3SQ1A 1NK7A 2QKKA 2Y1JA 4ID5A 1BGXT 1LWFA 4IG3A 1ZBUA 2DFEA 5HP1A 4IFYA 3CM5A 3MEDA 3MAQA 3V4IA 1KFDA 1WNSA 1Z26A 5CY4A 3LDSA 1ZBLA 4KHYA 4XIUA 1N6QA 3NBPA 3AO4A 1NK4A 1LAVA 1GOBA 4HTUA 3P83D 4H8KA 4CJ3A 2IGIA 3B6PA 1KFSA 2HHSA 1B9DA 3VQBA 2W42A 4CFBA 3SYZA 3KKSA 1NJYA 4O5BA 3SUNA 3OS1A 1Q9XA 4O55A 4FZZA 3NFAA 3PUFA 4FK2A 1NKCA 1Q9YA 3V1OA 3OYIA 2P5OA 3MECA 4LH5A 3HP9A 3NH1A 4BACA 3OYKA 2RN2A 5CZ2A 1XWLA 1JL1A 1B9FA 4MQ3A 5KTQA 3HM9A 2VG7A 3HJFA 1YTAA 1RTDA 4CIEA 4CHYA 1YVUA 4G1QA 3ULDA 3OYBA 2X6NA 2LSNA 3VN5A 3AVKA 2Z1IA 3DMJA 3NDKA 5I42A 1XI1A 3IG1A 1SL0A 3SI6A 1NJXA 3NGZA 4H4OA 1WSIA 2D0BA 4JRPA 1B92A 1TK8A 1NK5A 3QERA 3RRGA 3SUQA 4CIFA 1X1PA 4R5PA 1VSFA 1W9HA 1J54A 4ID1A 4TSXA 3O4QA 3NF7A 1JLAA 4Q0BA 3KKRA 4FM2A 5EU7A 1KVBA 1TGOA 1ZYQA 1NOYA 2VG6A 3HVTA 3O4NA 2GV9A 1BL3A 2JLEA 4CJKA 4CECA 5KI6A 2HVIA 1QS4A 2E4LA 3L2QA 4BDYA 2RF2A 2G8HA 4DSLA 2QKBA 4DG1A 2HHUA 4JRQA 3U6FA 1HYZA 4OGEA 4DSKA 2YNHA 4M3ZA 3QINA 4M3RA 1BCOA 5E41A 2X6SA 4BE2A 4F3TA 3ZSRA 4EZ9A 1RBTA 3HVRA 3UIQA 4E7JA 2PY5A 2O4GA 3ZT4A 3V9UA 4KB1A 1JLEA 1RTIA 4GW6A 2XY7A 1ZBHA 4E1NA 1TKXA 4KHQA 3HL8A 1JLQA 4EZ6A 1EKEA 1IH7A 1HYVA 4B9TA 5KRTA 4KREA 4CGFA 2D0CA 3OYHA 4ELUA 3VQQA 5HRNA 4Z4FA 4ZTFA 3C94A 4FLVA 4B9SA 2FBTA 3NCIA 4CJWA 5T7BA 4GMJB 3VQ9A 3SQ2A 2P51A 2OYQA 3K2PA 1SL2A 4E7LA 3KTQA 3DRPA 2XY5A 4KTZA 4CHOA 3AVBA 1IG9A 4F3OA 1RTHA 3VA3A 2G8FA 5K14A 4FJ7A 4BDPA 3QO9A 4HUEA 4DTXA 3SV3A 3M8PA 4CEEA 1GOAA 4CEFA 3VQEA 1KSPA 3KK1A 4ELVA 3A2FA 3D45A 1NK8A 3VQAA 4DFKA 1IKXA 4Z0UA 3LAMA 4DQQA 4C8NA 1VSJA 3V9XA 1ITGA 3OYDA 1XC9A 4HCCA 1JL2A 4FZYA 1I39A 1TK5A 2P5GA 4CK3A 4JS5A 4B9VA 4DF4A 4FLUA 3SZ2A 1C0TA 3AVAA 4DQRA 3KIOA 1LWEA 3ZSXA 2YHBA 4OKEA 4E19A 1C1CA 1X9SA 1RDAA 3QEPA 2XY6A 1WSHA 1LW2A 1U04A 3CFOA 5SWMA 1L3SA 1J5OA 1HQEA 1Q8IA 1VSDA 2OPPA 4IFVA 4M3WA 1QSSA 4FYDA 4DSJA 2KTQA 1MU2A 4CHPA 3TABA 4CJFA 4DTRA 2F96A 3LPUA 4RW9A 4ZTJA 4IKFA 1L5UA 3ZSWA 3TR8A 5FRMA 1WSGA 2QXFA 3K5OA 3LANA 2G8IA 3VQCA 4CJUA 4CF0A 1DTQA 4PUOA 4B9UA 4M42A 3OYNA 4DLGA 1S1TA 1XHXA 2FBXA 1RTJA 4CFDA 1KVCA 5J1EA 1BISA 4CJPA 4FW1A 3OVNA 4K8XA 4B9NA 4J2EA 4CEBA 3H08A 3AO5A 2ETJA 4HUGA 3NF9A 4N76A 3MXJA 4J2AA 1TL3A 4KAZA 4W5NA 2FBVA 3TAEA 3QEXA 1FXXA 3AVJA 4PWDA 3IRXA 3S3MA 4FJHA 3KLEA 3LPTA 2FBYA 3DOKA 4IBNA 3KLIA 3JSMA 1BQMA 1VSLA 3VQ5A 3MXMA 3L2VA 3MEGA 2HMIA 4OJRA 4M3YA 3F73A 3TAPA 4IG0A 4DLEA 1S9EA 3U3YA 4RW4A 3LZIA 2YNGA 4F4KA 3OJSA 3THVA 3HO1A 1UWBA 3SUOA 1NKBA 1RT4A 3LP2A 1TKDA 2YKMA 1D8YA 4NYNA 1JLGA 4ICLA 2OPSA 4DU3A 2YNFA 4LH4A 1U4BA 1RT7A 3CQ8A 3HYFA 4FM1A 3T19A 4CFAA 2IC3A 1X9WA 3DLGA 4KHUA 1NK0A 1JLCA 2ATQA 2Q3SA 4CGIA 1XHZA 1HQUA 3PO4A 4I9QA 4KO0A 4HUFA 4CF8A 5DK5A 2HNZA 3HPGA 4FM0A 4CEOA 4FK0A 3OS0A 4LY7A 3AA5X 3KLHA 4KI4A 5HLFA 3ZSYA 1WN7A 1IKYA 1VSHA 1KLNA 2WONA 1RT5A 4KB0A 4AHVA 1HNVA 3AO3A 3SQ4A 1IO2A 2B6AA 3DRSA 5HRPA 3SUPA 3OYCA 3KD1E 3LZJA 1BIUA 1L3UA 4LSLA 1BIZA 1W0HA 1VK0A 2NUBA 2OPQA 4QOZB 1S1VA 3T3FA 4N47A 1QE1A 3G0ZA 4Y1DA 3HP6A 5HRSA 4CEAA 2G8UA 1TAQA 4FK4A 1NOZA 2EHGA 3VQDA 3LWLA 3RMDA 1NK6A 2IAJA 4EP4A 4DF8A 1UA0A 1NJWA 2OZMA 3L2WA 1HMVA 4QCLA 2KZZA 4I9LA 4CJSA 1BQNA 1YT3A 3ZCMA 4FVMA 2XHBA 4J2BA 3HPOA 4B9MA 4AHTA 4RW7A 2VWJA 4F8RA 3NGYA 2QK9A 3ASMA 4NCAA 3RR8A 4FLXA 3CYMA 1S6PA 3SCXA 2OZSA 4BE1A 2B4JA 1U48A 4HVJA 3SNNA 3K5NA 2AJQA 2ZD1A 3VQ4A 2BDPA 2XRIA 4CFCA 3HXMA 2IOCA 3SPZA 4NCGA 2BGGA 4FZXC 2R7YA 3WNFA 3NH2A 3DOLA 3ZSOA 4KI6A 3L3UA 3LWMA 4CHNA 4I2QA 4HHTA 3RRHA 5HBMA 1RDBA 2E6LA 4CJRA 4O0IA 3QNOA 4DFPA 4L8RB 2KFZA 4CEZA 1RT3A 5HRRA 3RMCA 5KRSA 2BANA 3MXIA 1D9DA 1RT1A 4CJ5A 1LAWA 2ZE2A 1LV5A 5CYMA 3PY8A 4DTJA 4CGGA 4O44A 2JGUA 4F2SA 3OYGA 4FJ8A 1KTQA 1BI4B 1JLBA 1S1UA 3ZSQA 3TAGA 1U45A 3QLHA 1KLMA 4M41A 4W5QA 3C95A 3DLHA 1BI4A 5J2NA 2HVHA 1HYSA 1C1BA 5J2QA 4B08A 3SPYA 1N5YA 4C8LA 4FJ9A 2ITGA 3AVIA 3V81A 1DTTA 3M8RA 2KZMA 5HROA 1TV6A 4DQSA 1G15A 4Z4EA 1TKZA 5KGWA 3DLKA 4HCBA 3AA2A 4FCYA 2OA8A 3F9KA 1CZBA 1DLOA 4Z4CA 1BCMA 2EX3A 4W5RA 4OGCA 4DTPA 4Z4GA 3KD5E 3PX6A 3B6OA 2A1SA 4AHSA 3FFIA 1KRPA 1RBVA 3DM2A 4CJVA 1JXBA 4E89A 1SL1A 2DFHA 4FJIA 4NCBA 3M8SA 3NAEA 3TWHA 3CG7A 3TANA 3DI6A 4E7IA 3LAKA 2DFFA 1JLFA 1REVA 1C0MA 4O4GA 2DTUA 1WSEA 3OYLA 1GOCA 1TK0A 4N5SA 4E1MA 1QQCA 3RMBA 4MFBA 3OYEA 2HHTA 3IS9A 4RW8A 4N56A 4BDZA 1Z25A 1TKTA 3ZT1A 3SJJA 3CM6A 4KHSA 3RTVA 4CGHA 3K59A 4FLWA 5JS2A 3M8QA 1SV5A 2Y1IA 4QAGA 1YTUA 3TI0A 2OPRA 3QEIA 4I7FA 4JLHA 3WNGA 3MEEA 4DTMA 4B3OA 4DWIA 2D0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJV A;  3RR7 A;  3HK2 A;  2E6M A;  3QIO A;  1S1W A;  3QNN A;  1HPZ A;  1RDC A;  3BGR A;  4KRF A;  4C8M A;  4ZHR A;  1UA1 A;  1K6Y A;  4E0D A;  3AVC A;  3KK3 A;  4DMN A;  3OYF A;  3EZ5 A;  1IKW A;  1QSY A;  1VSI A;  4FW2 A;  1A5W A;  3L2U A;  2BE2 A;  2XY8 A;  4KFB A;  2B5J A;  2VWK A;  5CYQ A;  3V1R A;  4BWM A;  1IKV A;  1T7P A;  4YFU A;  1A5X A;  1TVR A;  3AO1 A;  3AVM A;  2ZQB A;  5FRO A;  3VA0 A;  4DTO A;  3QEV A;  2YNI A;  3OY9 A;  3OYM A;  4FXD A;  4OPJ A;  1HJR A;  4O0J A;  3KK2 A;  2KW4 A;  4FLY A;  1CXQ A;  4E7H A;  4CIG A;  4CGJ A;  3V9S A;  1FKO A;  4FJK A;  5FRN A;  3AVG A;  3D0P A;  1S6Q A;  1A5V A;  4C8K A;  1RCH A;  4W5T A;  1RT6 A;  1ASV A;  1KCF A;  3IAY A;  3O3G A;  3O3H A;  4DQI A;  3DYA A;  1WLJ A;  4E3S A;  4W5O A;  3RMA A;  3JYT A;  2XO7 A;  3NHG A;  3OYA A;  1T03 A;  3VQ8 A;  1QTM A;  4PQU A;  2IS3 A;  1CZ9 A;  1EX4 A;  4Q5V A;  3KLG A;  1RT2 A;  3WNH A;  1U47 A;  1T05 A;  2PYJ A;  4CJL A;  3VQP A;  2KQ2 A;  1HNI A;  3QES A;  2P1J A;  3BDP A;  3AA3 A;  3K57 A;  3PX0 A;  1ASW A;  4AHC A;  3C6T A;  1UAX A;  4OKJ A;  1HRH A;  3ZSV A;  4AH9 A;  3ZT3 A;  4CJE A;  1NKE A;  2Z1H A;  1VSE A;  2X78 A;  1U49 A;  5C25 A;  3VQ7 A;  1J9A A;  4J2D A;  2F8T A;  4OLA A;  4AHU A;  2IDO A;  4DS5 A;  4M3T A;  2YV0 X;  1S9G A;  2I5J A;  3I0S A;  4DTS A;  2FC0 A;  2PYL A;  1QSL A;  3L3V A;  4DFM A;  2DY4 A;  4DSF A;  1VSM A;  2YHA A;  3TAR A;  5CZ1 A;  1O1W A;  4K8Z A;  3ITH A;  1QHT A;  4NYF A;  3S3N A;  4UQG A;  1WAF A;  4Z4I A;  3I8D A;  1SKR A;  4FJG A;  4FJN A;  3V6D A;  1ZBF A;  3NF8 A;  3TAF A;  4KHW A;  4DSE A;  2G8W A;  3NF6 A;  5FDL A;  4M45 A;  3TAQ A;  3DLE A;  1TAU A;  3LAL A;  2KFN A;  1L3V A;  2G8K A;  5C24 A;  2HB5 A;  1D9F A;  3AVL A;  1JKH A;  4BWJ A;  4EP5 A;  3L2R A;  3SV4 A;  3DRR A;  3AV9 A;  4LD0 A;  4FJX A;  4KKO A;  4RG8 A;  2PZS A;  3NH0 A;  4OKK A;  1SKW A;  2GUI A;  4KPY A;  1RBU A;  3G10 A;  3ALY A;  4CER A;  1EXQ A;  3LP1 A;  3WNE A;  1Y97 A;  5DMR A;  4DFJ A;  5D3G A;  2HNY A;  4CF9 A;  4OLB A;  3CFP A;  4OPK A;  5J2M A;  3HPH A;  4DTU A;  2HHW A;  3CFR A;  1C0U A;  4PY5 A;  1C6V A;  2RKI A;  1VRT A;  1TL1 A;  5C42 A;  4B9L A;  5I3U A;  3NGI A;  4Y1C A;  1EP4 A;  4CJT A;  1JXE A;  1WSJ A;  3AA4 A;  4CF1 A;  3K5L A;  3PV8 A;  4C8O A;  2O4I A;  4H4M A;  2WOM A;  1LW0 A;  4FJ5 A;  4CHZ A;  1CLQ A;  4CGD A;  2YKN A;  1WSF A;  4GVM A;  4CES A;  3K5M A;  4ELT A;  4F2R A;  3L8B A;  3K58 A;  3QET A;  4CCH A;  1KVA A;  4YNQ A;  3EYZ A;  4DU1 A;  3P5J A;  1D5A A;  4IDK A;  4FJL A;  5J2P A;  3V1Q A;  3U3G A;  3PO5 A;  4M3U A;  4CJQ A;  1S5J A;  2G8V A;  1NK9 A;  1BHL A;  3VQ6 A;  4CHQ A;  4FLZ A;  3QIP A;  3C6U A;  3ZT2 A;  4RW6 A;  4KTW A;  3SQ0 A;  3TAM A;  3OYJ A;  4JS4 A;  4CE9 A;  2Z1G A;  4KV8 A;  3S9H A;  3PX4 A;  4CK1 A;  1RIL A;  4B8A B;  1VSK A;  2VG5 A;  3ZSZ A;  3EY1 A;  3V9W A;  3ISN C;  1SUQ A;  1UOC A;  4CJ4 A;  2GBZ A;  1EET A;  5JS1 A;  1SKS A;  3LP0 A;  2D5R A;  3AO2 A;  1FK9 A;  3V9Z A;  3ZT0 A;  1X9M A;  2HHX A;  2RPI A;  1ZBI A;  4CF2 A;  4E7K A;  3OJU A;  1RNH A;  2X74 A;  3HST B;  1RBS A;  4Z4H A;  1T8E A;  4N41 A;  4CED A;  3DLB A;  4DQP A;  4FLT A;  1RDD A;  3OS2 A;  2HW3 A;  2HHQ A;  3AVF A;  3QEW A;  3NE6 A;  1FKP A;  3AVN A;  4AHR A;  3RWU A;  2HHV A;  3LP3 A;  3KLF A;  1VRU A;  1WAJ A;  3P1G A;  4M3X A;  1CXU A;  4DSI A;  4FJM A;  4CK2 A;  2HND A;  4OVL A;  1S1X A;  3DLR A;  4LSN A;  3O3F A;  4KHN A;  4DU4 A;  1NJZ A;  4I2P A;  3E01 A;  3HT3 A;  1RBR A;  5KGX A;  2F8S A;  4DS4 A;  4KTQ A;  1F21 A;  1J53 A;  3T1A A;  5SZT A;  1C1A A;  3AVH A;  3S3O A;  3I0R A;  1R0A A;  1ASU A;  1I3A A;  4B8C A;  4BE0 A;  1LWC A;  4CEQ A;  2A1R A;  1L3T A;  4AIL C;  4WE1 A;  4PA1 A;  4FJJ A;  4DTN A;  2Z1J A;  3SQ1 A;  1NK7 A;  2QKK A;  2Y1J A;  4ID5 A;  1BGX T;  1LWF A;  4IG3 A;  1ZBU A;  2DFE A;  5HP1 A;  4IFY A;  3CM5 A;  3MED A;  3MAQ A;  3V4I A;  1KFD A;  1WNS A;  1Z26 A;  5CY4 A;  3LDS A;  1ZBL A;  4KHY A;  4XIU A;  1N6Q A;  3NBP A;  3AO4 A;  1NK4 A;  1LAV A;  1GOB A;  4HTU A;  3P83 D;  4H8K A;  4CJ3 A;  2IGI A;  3B6P A;  1KFS A;  2HHS A;  1B9D A;  3VQB A;  2W42 A;  4CFB A;  3SYZ A;  3KKS A;  1NJY A;  4O5B A;  3SUN A;  3OS1 A;  1Q9X A;  4O55 A;  4FZZ A;  3NFA A;  3PUF A;  4FK2 A;  1NKC A;  1Q9Y A;  3V1O A;  3OYI A;  2P5O A;  3MEC A;  4LH5 A;  3HP9 A;  3NH1 A;  4BAC A;  3OYK A;  2RN2 A;  5CZ2 A;  1XWL A;  1JL1 A;  1B9F A;  4MQ3 A;  5KTQ A;  3HM9 A;  2VG7 A;  3HJF A;  1YTA A;  1RTD A;  4CIE A;  4CHY A;  1YVU A;  4G1Q A;  3ULD A;  3OYB A;  2X6N A;  2LSN A;  3VN5 A;  3AVK A;  2Z1I A;  3DMJ A;  3NDK A;  5I42 A;  1XI1 A;  3IG1 A;  1SL0 A;  3SI6 A;  1NJX A;  3NGZ A;  4H4O A;  1WSI A;  2D0B A;  4JRP A;  1B92 A;  1TK8 A;  1NK5 A;  3QER A;  3RRG A;  3SUQ A;  4CIF A;  1X1P A;  4R5P A;  1VSF A;  1W9H A;  1J54 A;  4ID1 A;  4TSX A;  3O4Q A;  3NF7 A;  1JLA A;  4Q0B A;  3KKR A;  4FM2 A;  5EU7 A;  1KVB A;  1TGO A;  1ZYQ A;  1NOY A;  2VG6 A;  3HVT A;  3O4N A;  2GV9 A;  1BL3 A;  2JLE A;  4CJK A;  4CEC A;  5KI6 A;  2HVI A;  1QS4 A;  2E4L A;  3L2Q A;  4BDY A;  2RF2 A;  2G8H A;  4DSL A;  2QKB A;  4DG1 A;  2HHU A;  4JRQ A;  3U6F A;  1HYZ A;  4OGE A;  4DSK A;  2YNH A;  4M3Z A;  3QIN A;  4M3R A;  1BCO A;  5E41 A;  2X6S A;  4BE2 A;  4F3T A;  3ZSR A;  4EZ9 A;  1RBT A;  3HVR A;  3UIQ A;  4E7J A;  2PY5 A;  2O4G A;  3ZT4 A;  3V9U A;  4KB1 A;  1JLE A;  1RTI A;  4GW6 A;  2XY7 A;  1ZBH A;  4E1N A;  1TKX A;  4KHQ A;  3HL8 A;  1JLQ A;  4EZ6 A;  1EKE A;  1IH7 A;  1HYV A;  4B9T A;  5KRT A;  4KRE A;  4CGF A;  2D0C A;  3OYH A;  4ELU A;  3VQQ A;  5HRN A;  4Z4F A;  4ZTF A;  3C94 A;  4FLV A;  4B9S A;  2FBT A;  3NCI A;  4CJW A;  5T7B A;  4GMJ B;  3VQ9 A;  3SQ2 A;  2P51 A;  2OYQ A;  3K2P A;  1SL2 A;  4E7L A;  3KTQ A;  3DRP A;  2XY5 A;  4KTZ A;  4CHO A;  3AVB A;  1IG9 A;  4F3O A;  1RTH A;  3VA3 A;  2G8F A;  5K14 A;  4FJ7 A;  4BDP A;  3QO9 A;  4HUE A;  4DTX A;  3SV3 A;  3M8P A;  4CEE A;  1GOA A;  4CEF A;  3VQE A;  1KSP A;  3KK1 A;  4ELV A;  3A2F A;  3D45 A;  1NK8 A;  3VQA A;  4DFK A;  1IKX A;  4Z0U A;  3LAM A;  4DQQ A;  4C8N A;  1VSJ A;  3V9X A;  1ITG A;  3OYD A;  1XC9 A;  4HCC A;  1JL2 A;  4FZY A;  1I39 A;  1TK5 A;  2P5G A;  4CK3 A;  4JS5 A;  4B9V A;  4DF4 A;  4FLU A;  3SZ2 A;  1C0T A;  3AVA A;  4DQR A;  3KIO A;  1LWE A;  3ZSX A;  2YHB A;  4OKE A;  4E19 A;  1C1C A;  1X9S A;  1RDA A;  3QEP A;  2XY6 A;  1WSH A;  1LW2 A;  1U04 A;  3CFO A;  5SWM A;  1L3S A;  1J5O A;  1HQE A;  1Q8I A;  1VSD A;  2OPP A;  4IFV A;  4M3W A;  1QSS A;  4FYD A;  4DSJ A;  2KTQ A;  1MU2 A;  4CHP A;  3TAB A;  4CJF A;  4DTR A;  2F96 A;  3LPU A;  4RW9 A;  4ZTJ A;  4IKF A;  1L5U A;  3ZSW A;  3TR8 A;  5FRM A;  1WSG A;  2QXF A;  3K5O A;  3LAN A;  2G8I A;  3VQC A;  4CJU A;  4CF0 A;  1DTQ A;  4PUO A;  4B9U A;  4M42 A;  3OYN A;  4DLG A;  1S1T A;  1XHX A;  2FBX A;  1RTJ A;  4CFD A;  1KVC A;  5J1E A;  1BIS A;  4CJP A;  4FW1 A;  3OVN A;  4K8X A;  4B9N A;  4J2E A;  4CEB A;  3H08 A;  3AO5 A;  2ETJ A;  4HUG A;  3NF9 A;  4N76 A;  3MXJ A;  4J2A A;  1TL3 A;  4KAZ A;  4W5N A;  2FBV A;  3TAE A;  3QEX A;  1FXX A;  3AVJ A;  4PWD A;  3IRX A;  3S3M A;  4FJH A;  3KLE A;  3LPT A;  2FBY A;  3DOK A;  4IBN A;  3KLI A;  3JSM A;  1BQM A;  1VSL A;  3VQ5 A;  3MXM A;  3L2V A;  3MEG A;  2HMI A;  4OJR A;  4M3Y A;  3F73 A;  3TAP A;  4IG0 A;  4DLE A;  1S9E A;  3U3Y A;  4RW4 A;  3LZI A;  2YNG A;  4F4K A;  3OJS A;  3THV A;  3HO1 A;  1UWB A;  3SUO A;  1NKB A;  1RT4 A;  3LP2 A;  1TKD A;  2YKM A;  1D8Y A;  4NYN A;  1JLG A;  4ICL A;  2OPS A;  4DU3 A;  2YNF A;  4LH4 A;  1U4B A;  1RT7 A;  3CQ8 A;  3HYF A;  4FM1 A;  3T19 A;  4CFA A;  2IC3 A;  1X9W A;  3DLG A;  4KHU A;  1NK0 A;  1JLC A;  2ATQ A;  2Q3S A;  4CGI A;  1XHZ A;  1HQU A;  3PO4 A;  4I9Q A;  4KO0 A;  4HUF A;  4CF8 A;  5DK5 A;  2HNZ A;  3HPG A;  4FM0 A;  4CEO A;  4FK0 A;  3OS0 A;  4LY7 A;  3AA5 X;  3KLH A;  4KI4 A;  5HLF A;  3ZSY A;  1WN7 A;  1IKY A;  1VSH A;  1KLN A;  2WON A;  1RT5 A;  4KB0 A;  4AHV A;  1HNV A;  3AO3 A;  3SQ4 A;  1IO2 A;  2B6A A;  3DRS A;  5HRP A;  3SUP A;  3OYC A;  3KD1 E;  3LZJ A;  1BIU A;  1L3U A;  4LSL A;  1BIZ A;  1W0H A;  1VK0 A;  2NUB A;  2OPQ A;  4QOZ B;  1S1V A;  3T3F A;  4N47 A;  1QE1 A;  3G0Z A;  4Y1D A;  3HP6 A;  5HRS A;  4CEA A;  2G8U A;  1TAQ A;  4FK4 A;  1NOZ A;  2EHG A;  3VQD A;  3LWL A;  3RMD A;  1NK6 A;  2IAJ A;  4EP4 A;  4DF8 A;  1UA0 A;  1NJW A;  2OZM A;  3L2W A;  1HMV A;  4QCL A;  2KZZ A;  4I9L A;  4CJS A;  1BQN A;  1YT3 A;  3ZCM A;  4FVM A;  2XHB A;  4J2B A;  3HPO A;  4B9M A;  4AHT A;  4RW7 A;  2VWJ A;  4F8R A;  3NGY A;  2QK9 A;  3ASM A;  4NCA A;  3RR8 A;  4FLX A;  3CYM A;  1S6P A;  3SCX A;  2OZS A;  4BE1 A;  2B4J A;  1U48 A;  4HVJ A;  3SNN A;  3K5N A;  2AJQ A;  2ZD1 A;  3VQ4 A;  2BDP A;  2XRI A;  4CFC A;  3HXM A;  2IOC A;  3SPZ A;  4NCG A;  2BGG A;  4FZX C;  2R7Y A;  3WNF A;  3NH2 A;  3DOL A;  3ZSO A;  4KI6 A;  3L3U A;  3LWM A;  4CHN A;  4I2Q A;  4HHT A;  3RRH A;  5HBM A;  1RDB A;  2E6L A;  4CJR A;  4O0I A;  3QNO A;  4DFP A;  4L8R B;  2KFZ A;  4CEZ A;  1RT3 A;  5HRR A;  3RMC A;  5KRS A;  2BAN A;  3MXI A;  1D9D A;  1RT1 A;  4CJ5 A;  1LAW A;  2ZE2 A;  1LV5 A;  5CYM A;  3PY8 A;  4DTJ A;  4CGG A;  4O44 A;  2JGU A;  4F2S A;  3OYG A;  4FJ8 A;  1KTQ A;  1BI4 B;  1JLB A;  1S1U A;  3ZSQ A;  3TAG A;  1U45 A;  3QLH A;  1KLM A;  4M41 A;  4W5Q A;  3C95 A;  3DLH A;  1BI4 A;  5J2N A;  2HVH A;  1HYS A;  1C1B A;  5J2Q A;  4B08 A;  3SPY A;  1N5Y A;  4C8L A;  4FJ9 A;  2ITG A;  3AVI A;  3V81 A;  1DTT A;  3M8R A;  2KZM A;  5HRO A;  1TV6 A;  4DQS A;  1G15 A;  4Z4E A;  1TKZ A;  5KGW A;  3DLK A;  4HCB A;  3AA2 A;  4FCY A;  2OA8 A;  3F9K A;  1CZB A;  1DLO A;  4Z4C A;  1BCM A;  2EX3 A;  4W5R A;  4OGC A;  4DTP A;  4Z4G A;  3KD5 E;  3PX6 A;  3B6O A;  2A1S A;  4AHS A;  3FFI A;  1KRP A;  1RBV A;  3DM2 A;  4CJV A;  1JXB A;  4E89 A;  1SL1 A;  2DFH A;  4FJI A;  4NCB A;  3M8S A;  3NAE A;  3TWH A;  3CG7 A;  3TAN A;  3DI6 A;  4E7I A;  3LAK A;  2DFF A;  1JLF A;  1REV A;  1C0M A;  4O4G A;  2DTU A;  1WSE A;  3OYL A;  1GOC A;  1TK0 A;  4N5S A;  4E1M A;  1QQC A;  3RMB A;  4MFB A;  3OYE A;  2HHT A;  3IS9 A;  4RW8 A;  4N56 A;  4BDZ A;  1Z25 A;  1TKT A;  3ZT1 A;  3SJJ A;  3CM6 A;  4KHS A;  3RTV A;  4CGH A;  3K59 A;  4FLW A;  5JS2 A;  3M8Q A;  1SV5 A;  2Y1I A;  4QAG A;  1YTU A;  3TI0 A;  2OPR A;  3QEI A;  4I7F A;  4JLH A;  3WNG A;  3MEE A;  4DTM A;  4B3O A;  4DWI A;  2D0A A; 
#chains in the Genus database with same CATH topology
 3HK2 A;  3QIO A;  1S1W A;  3H6E A;  3QNN A;  1HPZ A;  3CIP A;  3BGR A;  4B1V A;  4C8M A;  1H1V A;  2CGL A;  2P9I A;  4DMN A;  3EZ5 A;  2P9P B;  3GBT A;  2XY8 A;  2P9P A;  4KFB A;  5AQY A;  3V1R A;  1IKV A;  4IO8 A;  4YFU A;  1TVR A;  4NXN K;  3AO1 A;  3AVM A;  4DTO A;  1VHX A;  4JI4 K;  3QEV A;  3CXC M;  1KXP A;  4CIG A;  3D0P A;  2FF6 A;  3O9S A;  3O3G A;  5KPT A;  1T03 A;  2GEM A;  3JYT A;  4PQU A;  2IS3 A;  3KLG A;  1RT2 A;  1RGI A;  1T05 A;  4CJL A;  1HNI A;  2YX6 A;  3VF6 A;  4AH9 A;  1UAX A;  4OKJ A;  3HI0 A;  4FWR A;  2Z1H A;  3DLL L;  1VSE A;  3K9K A;  2X78 A;  4AHU A;  2IDO A;  1QVG M;  5C2F A;  3L4Q A;  2I5J A;  1QZ5 A;  3R9P A;  4DQ8 A;  2DY4 A;  4DSF A;  4K8Z A;  1BWF O;  4UQG A;  1WAF A;  4FJG A;  4JHD B;  4DR7 K;  3NF8 A;  1YJW N;  4OPA A;  3WXJ A;  3NF6 A;  5ELZ A;  3DLE A;  2Q2R A;  4YOX A;  2KFN A;  1T6C A;  2QW9 A;  3AVL A;  4BWJ A;  3L2R A;  3SV4 A;  4FJX A;  4NLC A;  3IFR A;  5LY3 A;  4KPY A;  4FWO A;  3WEE A;  3G10 A;  3ZX0 A;  1TUY A;  5D3G A;  3M1F A;  1T44 A;  1HKG A;  4YOW A;  3PLA A;  4OPK A;  3H45 C;  5J2M A;  5AQK A;  5LJW A;  3IUC A;  1S3X A;  1LOT B;  5I3U A;  3NGI A;  4Y1C A;  3PV8 A;  3AA4 A;  1U6Z A;  2O4I A;  4H4M A;  3A5L C;  2ZGZ A;  4ELT A;  4CZL A;  4F2R A;  3L8B A;  4BGA A;  4YNQ A;  4DU1 A;  2P9L B;  3CCQ N;  1D5A A;  4FJL A;  5J2P A;  2P9L A;  3PO5 A;  4CJQ A;  4C1N I;  3NVK A;  3GE1 A;  3QIP A;  3ZT2 A;  3SQ0 A;  3VEN A;  4BGB A;  2Z1G A;  3S9H A;  3PX4 A;  2VG5 A;  1N33 K;  2O8F A;  2HHX A;  1HJO A;  4E7K A;  3HST B;  5FPN A;  4DQP A;  1EWQ A;  2HHQ A;  3AVF A;  3C65 A;  4WFN L;  3AVN A;  4AHR A;  5BRF A;  3KLF A;  1VRU A;  1CXU A;  3WXK A;  3THY A;  1QVF M;  4DS4 A;  3TTC A;  1YUW A;  3T1A A;  5SZT A;  1C1A A;  1T6D A;  1R0A A;  3FE1 A;  2A1R A;  1ZC6 A;  4WE1 A;  4K41 A;  2DPN A;  4ISG A;  4BRE A;  4O5F A;  5AJ3 K;  1NK7 A;  2W6K A;  1LWF A;  4IG3 A;  4WQ4 C;  1QHA A;  2DFE A;  4IFY A;  4RWT A;  1XC3 A;  3V4I A;  5CY4 A;  4DV6 K;  1EWR A;  4BRM A;  3DXK B;  3GG4 A;  3MDQ A;  1LAV A;  4JK7 A;  5AQZ A;  3JXU A;  4CJ3 A;  3DXK A;  3B6P A;  3SYZ A;  4CFB A;  1NJY A;  2F7T A;  5FPE A;  2O8C B;  3OS1 A;  1Q9X A;  3UB5 A;  2O8B A;  2O8C A;  2P5O A;  2WBN A;  5CZ2 A;  4MQ3 A;  4DCH A;  3CJ1 A;  1RTD A;  4CIE A;  1SQK A;  4G1Q A;  3OYB A;  2KLA A;  3VN5 A;  3AVK A;  2D0O A;  4H4O A;  1TK8 A;  4LC9 B;  5TKY A;  4CIF A;  1X1P A;  3G4S N;  1JLA A;  3T7Z A;  1HX1 A;  4FM2 A;  5E26 A;  5AQN A;  1ZYQ A;  2GV9 A;  3MWT A;  4CJK A;  2Q36 A;  4JRQ A;  4OGE A;  2YNH A;  4M3Z A;  3QIN A;  2YHY A;  3C7N B;  1BCO A;  5E41 A;  1J5E K;  3C7N A;  1RBT A;  3HVR A;  4E7J A;  3ZT4 A;  3LM9 A;  3MN5 A;  1JLE A;  1RTI A;  4GW6 A;  4CJ7 A;  1ZBH A;  4E1N A;  1TKX A;  3JAM O;  4DUY K;  4XH5 A;  1IH7 A;  5KRT A;  3OYH A;  4Z4F A;  4JD2 B;  1NMD A;  4DV3 K;  4YHH K;  1P8Z A;  3NCI A;  4JKA A;  4GV6 A;  3ATU A;  2P9K B;  4E7L A;  3KTQ A;  3H1V X;  4KTZ A;  4CHO A;  1IG9 A;  3RSE A;  1VQN N;  1T3V A;  4FJ7 A;  4HUE A;  3M8P A;  3WUH A;  1GOA A;  3O5B A;  4JK9 A;  1NK8 A;  4JI0 K;  3VQA A;  3CF5 L;  4BG8 A;  4Z0U A;  3LAM A;  4HCC A;  1JL2 A;  3SZ2 A;  1VQ4 N;  2UXB K;  4DQR A;  2D1K A;  3KIO A;  4DB3 A;  1P90 A;  3TTD A;  4OKE A;  4XEI A;  5F0X A;  1WSH A;  2W41 A;  1Q8I A;  2OPP A;  1QSS A;  4CHP A;  3LPU A;  4HWI A;  3TR8 A;  4YOV A;  1WSG A;  1VQ6 N;  2G8I A;  4PUO A;  4YDU A;  2UXD K;  4DLG A;  2FBX A;  1KVC A;  5J1E A;  3ZET B;  1M1K O;  5M1P A;  4B1U B;  4CBU A;  3ZET A;  2YCH A;  3DXM A;  3O4W A;  4N76 A;  3MXJ A;  1TL3 A;  4W5N A;  4GKK K;  5AQT A;  2FBY A;  3CJ7 A;  2PBD A;  4JKH A;  3VQ5 A;  5AQV A;  1BDG A;  4M3Y A;  1ESV A;  3TAP A;  4BQL A;  4GNI A;  3TSQ A;  1S9E A;  3U3Y A;  2CH6 A;  2CH5 A;  3LZI A;  1E3M A;  3HSC A;  3CC4 N;  4AM7 A;  2UXC K;  1XNQ K;  1RT4 A;  2YKM A;  4LFA K;  1JLG A;  4GV9 A;  4LH4 A;  4FWL A;  1RT7 A;  1U4B A;  4YOU A;  4GVE A;  3T19 A;  4JI5 K;  3DLG A;  3VF4 A;  3I56 N;  1NK0 A;  1JLC A;  2Q3S A;  2VQE K;  1XHZ A;  4FM0 A;  1NGJ A;  4FK0 A;  4CD3 A;  3KLH A;  3ZSY A;  3FZF A;  1IKY A;  1VSH A;  5AQQ A;  1KLN A;  4KB0 A;  4DR2 K;  3SQ4 A;  5HRP A;  3LZJ A;  4CZH A;  1W0H A;  1QE1 A;  2A41 A;  4CEA A;  3J7Z O;  4Y0W A;  1NOZ A;  1NJW A;  5GIP A;  3AAQ A;  1HMV A;  4BR4 A;  4QCL A;  1BA1 A;  1YT3 A;  3ZCM A;  4KH4 A;  3HPO A;  4AHT A;  4JYA K;  3T1H K;  3RR8 A;  4FLX A;  2OZS A;  5AQW A;  3ZLJ A;  2BDP A;  2OCE A;  2XRI A;  3HXM A;  4NCG A;  3QBX A;  2R7Y A;  3WNF A;  3ZSO A;  4KHP K;  3L3U A;  4HHT A;  4I2Q A;  1XMQ K;  4DFP A;  2E6L A;  4EAH D;  2A6A A;  2BAN A;  1RT1 A;  4JI1 K;  2ZE2 A;  1ATR A;  1XMO K;  1KAY A;  4F2S A;  3PSI A;  3VTH A;  3TAG A;  2Q0R A;  3ZSQ A;  1U45 A;  1KLM A;  3C95 A;  1HYS A;  1C1B A;  3VEV A;  3QFP A;  4X65 K;  5BR8 K;  1N5Y A;  1VAZ A;  3EE8 A;  3V81 A;  4FJ9 A;  3FFK B;  4DQS A;  2E1Z A;  1G15 A;  3OTO K;  4Z4E A;  4HCB A;  4BR9 A;  5AQH A;  4BR2 A;  3CCV N;  5KPR A;  1CZB A;  5AQJ A;  5EX5 A;  5CR4 A;  4BRA A;  3FFI A;  1S72 N;  1KRP A;  1RBV A;  4ISF A;  1JXB A;  4E89 A;  2FSJ A;  3M8S A;  3NAE A;  2CGK A;  3TWH A;  1JLF A;  4L3Q A;  2V52 B;  4O4G A;  2DTU A;  4H0Y B;  4E1M A;  3G25 A;  1QQC A;  3RMB A;  4MFB A;  3OYE A;  2HHT A;  2PAV A;  1TUU A;  2F9W A;  1Z25 A;  2ZGY A;  4N56 A;  4DV0 K;  3CM6 A;  3SJJ A;  4KHS A;  1SV5 A;  2E88 A;  3E1Y A;  3TI0 A;  3K9J A;  4JLH A;  3WNG A;  3MEE A;  1HKB A;  2ITM A;  2Q1N A;  3SAF A;  4B3R K;  2QM1 A;  4KRF A;  1RDC A;  5AQP A;  4H0V B;  3AVC A;  4QS9 A;  2P9N B;  3BP8 A;  3VPZ A;  2BE2 A;  4PKH A;  2B5J A;  2VWK A;  3UKR B;  2E2N A;  4BWM A;  1JCG A;  3UKR A;  5FRO A;  2YNI A;  4FXD A;  4OPJ A;  1HJR A;  2KW4 A;  3R3L A;  4CGJ A;  1GLE G;  4X64 K;  4FJK A;  5FRN A;  1S6Q A;  1A5V A;  4BRI A;  4C8K A;  4W5T A;  4DQI A;  3CMA N;  1WLJ A;  4E3S A;  3FR0 A;  3RMA A;  3NHG A;  2XO7 A;  3OYA A;  1QTM A;  3VQ8 A;  1GLL O;  4A62 A;  3UE5 A;  3DWL A;  3WNH A;  3M3Z A;  3P31 A;  2QTD A;  5HL7 L;  3K57 A;  3PX0 A;  4AHC A;  3ZSV A;  3ZT3 A;  3QML A;  2GTD A;  4BRK A;  1J9A A;  4LF9 K;  2F8T A;  1NGH A;  4M3T A;  2VGM A;  2FC0 A;  4FWQ A;  5AQI A;  2PYL A;  5DM6 L;  3L3V A;  4DFM A;  4CW7 B;  2YHA A;  1OVY A;  1V4T A;  3ITH A;  3FZM A;  1YIJ N;  4IO9 L;  3VTI A;  4KHW A;  3EEQ A;  4FWS A;  5FDL A;  4M45 A;  2BUP A;  4DHY A;  4JKB A;  3LDO A;  4AM6 A;  1TAU A;  3DRR A;  3EE9 A;  4KKO A;  4RG8 A;  4LFC K;  3CJ9 A;  4XH4 A;  3ALY A;  5GIN A;  4WQ5 A;  1HLU A;  1Y97 A;  4CF9 A;  4MLH A;  2KKZ A;  1SZ2 A;  1LCU A;  4I6M B;  5AR0 A;  3LL3 A;  1S22 A;  3HPH A;  4DTU A;  2HHW A;  4PY5 A;  4H0X B;  5C42 A;  1EP4 A;  4CJT A;  4C8O A;  5BR9 A;  1YVN A;  1LW0 A;  2WOM A;  2OTL N;  5JMV A;  2RE2 A;  3MN9 A;  3K5M A;  1YAG A;  1NGG A;  2ASM A;  3K58 A;  4JNE A;  3P5J A;  3V1Q A;  2GWK A;  3UKU B;  1S5J A;  2G8V A;  4BRG A;  3UKU A;  3VQ6 A;  3C6U A;  3ENH A;  5MLC Q;  3OYJ A;  1DGK N;  4JS4 A;  5GIO A;  4CE9 A;  4DR5 K;  5M1Q A;  4CK1 A;  4B8A B;  1VSK A;  5KQ8 A;  3OW2 M;  1UOC A;  1EET A;  5JS1 A;  3W3D A;  2D5R A;  1FK9 A;  1X9M A;  2X74 A;  3CJA A;  5C2D A;  2HW3 A;  3D7E O;  3A5N C;  3R8E A;  5AFU A;  1S1X A;  3DLR A;  4LSN A;  4KHN A;  1NJZ A;  3CC2 N;  2F8S A;  2HBM A;  3N4Q A;  3SMP A;  1OKJ A;  3AVH A;  1ASU A;  1I3A A;  4BE0 A;  3U4L A;  3SAG A;  4CEQ A;  1HUX A;  1L3T A;  4AIL C;  4IEI A;  4DTN A;  5AZI B;  2YJF A;  3SQ1 A;  3OBW A;  2Y1J A;  5AZI A;  5HP1 A;  1NM1 A;  5M1N A;  3MN7 A;  1N6Q A;  3NBP A;  3G6E N;  1GOB A;  4H8K A;  1KFS A;  3VQB A;  4WCE L;  4FZZ A;  3PUF A;  4FK2 A;  3V1O A;  5M1F A;  2D4W A;  3OYK A;  5KTQ A;  3HM9 A;  1B9F A;  1YTA A;  3HBT A;  1OVQ A;  1EQY A;  4EHT A;  3A8Y A;  2LSN A;  1JCF A;  1V4S A;  3HOS A;  2Z1I A;  3NDK A;  1XI1 A;  5BPM A;  3IG1 A;  4BC5 A;  1WSI A;  3ZEU B;  4U7B A;  3RRG A;  3ZEU A;  4TSX A;  5AQL A;  3O6W A;  3O4N A;  4JHD A;  1RDW X;  2JLE A;  3VOV A;  2HHU A;  3L2Q A;  2QKB A;  3L0Q A;  1HNX K;  1OH6 A;  3SJH A;  3U8X A;  4M63 C;  3ZSR A;  1Q7Y O;  2PY5 A;  2O4G A;  4CVN E;  5JLH A;  3V9U A;  1ATN A;  2HST A;  2XY7 A;  3A5O C;  1JLQ A;  1HYV A;  3ULE B;  4CGF A;  4ELU A;  3VGL A;  3C94 A;  4R79 A;  2FBT A;  3K2P A;  1SL2 A;  1CZA N;  4B3S K;  4F3O A;  3CPE A;  3H46 O;  1RTH A;  3VA3 A;  3J8A A;  1JJ2 M;  4CZK A;  2FXU A;  3SV3 A;  4CEE A;  3VQE A;  3D45 A;  3WXI A;  4DFK A;  1SS6 A;  3F9M A;  4FO0 A;  3V9X A;  1I39 A;  3Q7B A;  4CK3 A;  3BF3 A;  4DF4 A;  2IVP A;  1C0T A;  3AVA A;  4E19 A;  3PIO L;  1LW2 A;  5SWM A;  4FYD A;  3F5T A;  3VGK A;  3HOT A;  2F96 A;  3C6H A;  4ZTJ A;  4H5R A;  1GLF O;  4A61 A;  3VQC A;  3VER A;  3OVN A;  4CEB A;  2I7N A;  4BQZ A;  5GAH P;  4HUG A;  4BRC A;  4J2A A;  2FBV A;  3TAE A;  3QEX A;  4IXC A;  3IRX A;  3S3M A;  4FPB A;  4FJH A;  3DOK A;  4IBN A;  3JSM A;  4A2B A;  2HMI A;  3VMF B;  4UY8 O;  3OJS A;  1UWB A;  3SUO A;  1NBW A;  1D8Y A;  4NYN A;  5FPD A;  1TYQ B;  5C10 A;  1QQM A;  1HQU A;  4KO0 A;  4HUF A;  4CF8 A;  3H1Q A;  1O13 A;  4JI7 K;  4KI4 A;  3WQT A;  1WN7 A;  4IOA L;  3ZX3 A;  1N36 K;  1I94 K;  1KD1 O;  2W6L A;  5C12 A;  2QWP A;  3SUP A;  1BUP A;  1BIU A;  1L3U A;  4LSL A;  4BRF A;  3QB0 A;  4QOZ B;  2G8U A;  4ILH A;  4N47 A;  4M7Y A;  5ADX A;  3HP6 A;  1HKC A;  4C23 A;  1TAQ A;  3VEZ A;  2OZM A;  3CCJ N;  2WUS A;  2HMP A;  4I9L A;  1BQN A;  4M7X A;  5BRH A;  4NO7 A;  4J2B A;  4B9M A;  4OX9 K;  4RW7 A;  4F8R A;  3NGY A;  4NCA A;  2J4R A;  3SCX A;  4BE1 A;  2B4J A;  3K5N A;  5I9E B;  3CC7 N;  3BY5 A;  3KWI A;  4OPH A;  1QZ6 A;  1DEJ A;  2NRW A;  3DOL A;  3ID6 A;  4JD2 A;  3EL2 A;  5HBM A;  3MX5 A;  3J80 O;  1RT3 A;  5HRR A;  5KRS A;  3PIP L;  1D9D A;  4CJ5 A;  2P9K A;  3DJC A;  3PY8 A;  3MN6 A;  5FPM A;  2JGU A;  4FJ8 A;  1E4G T;  1YF5 L;  2WC9 A;  3B8A X;  1S1U A;  1NNE A;  3DLH A;  2W40 A;  2HVH A;  1J6Z A;  2BH1 A;  5J2Q A;  2P9U B;  3F2K A;  1YI2 N;  4O8K A;  2P9U A;  3AVI A;  4KH6 A;  1VQ7 N;  4MLE A;  4GKJ K;  4B3M K;  5KGW A;  2AP1 A;  1DLO A;  4W5R A;  5AQG A;  4AHS A;  4NCB A;  4FJI A;  5DM7 L;  2FLO A;  1D4X A;  1WB9 A;  2DFF A;  3QDK A;  1REV A;  1C0M A;  1OH8 A;  2QWL A;  1XQS C;  4DV4 K;  3OYL A;  1TK0 A;  4N5S A;  1IBM K;  4BDZ A;  4B3T K;  3O8M A;  1NLV A;  4DR1 K;  4QAG A;  1NGA A;  2E2O A;  3QEI A;  1MWK A;  4I7F A;  4DTM A;  4DWI A;  2D0A A;  3CCU N;  1K73 O;  3J81 O;  3KJV A;  3RR7 A;  2OTJ N;  3JS6 A;  3BUZ B;  3A0I X;  1X3N A;  2H3G X;  1K6Y A;  1BA0 A;  1IKW A;  4YDU C;  1VSI A;  4FW2 A;  1QSY A;  3L2U A;  5LMU K;  4BC4 A;  5CYQ A;  1WUA A;  3LM2 A;  1T7P A;  3VA0 A;  1DT9 A;  3OY9 A;  3OYM A;  4DV7 K;  2NLX A;  4C1N K;  3AY9 A;  3KK2 A;  1CXQ A;  4LF4 K;  1RCH A;  3RVC A;  4K0K K;  1RT6 A;  1KCF A;  4BVO A;  3O3H A;  3DYA A;  4ILG B;  2GWJ A;  3CET A;  1NG9 A;  1CZ9 A;  1EX4 A;  2BTF A;  4KH5 A;  3SLC A;  3VQP A;  2FF3 B;  3AA3 A;  1ASW A;  3C6T A;  5AZJ B;  4CJE A;  1N32 K;  2FSN A;  5AZJ A;  1U49 A;  3VQ7 A;  4J2D A;  4B1Y B;  4OLA A;  3ENB A;  4FOI A;  3CCR N;  2F4V K;  1E4F T;  1IV0 A;  4FL9 A;  1S9G A;  3I0S A;  4MDB A;  1FW6 A;  1QSL A;  4JN4 A;  3P39 A;  4BR7 A;  5CZ1 A;  1XUP O;  4Z94 A;  4JKC A;  1QHT A;  4K42 A;  1SKR A;  4FJN A;  3H3N O;  1ZBF A;  3TAF A;  4BRO A;  3Q7C A;  5JIC A;  3TAQ A;  3BZC A;  2RHK A;  1L3V A;  3K0S A;  2G8K A;  1ZBS A;  5C24 A;  2HB5 A;  3VEY A;  4GY2 B;  4EP5 A;  4LD0 A;  3AV9 A;  1YJN N;  3SMS A;  2PZS A;  3NH0 A;  4OKK A;  4K43 A;  2GUI A;  2JWL A;  5EOY A;  4CER A;  2ASP A;  3GL1 A;  4CZM A;  4FWP A;  3ATV A;  3LP1 A;  5DMR A;  4DFJ A;  4WYB A;  4IEE A;  5BN9 A;  5GAE P;  3IMX A;  3CFR A;  4YOT A;  1OH7 A;  1VQ5 N;  1K8A O;  2UYT A;  1QQO A;  4B9L A;  3K5L A;  1JXE A;  4CF1 A;  3HZ6 A;  4JI3 K;  4IZ9 A;  1CLQ A;  3VEO A;  4CGD A;  4CES A;  4YOY A;  5C0Y A;  3EYZ A;  3U3G A;  1BHL A;  1YHQ N;  4RW6 A;  3CCS N;  3AO2 A;  2GUP A;  3V9Z A;  2QWR A;  2RPI A;  5AQX A;  3TTF A;  3OJU A;  1RNH A;  4Z4H A;  3I55 N;  1T8E A;  3DLB A;  4FWN A;  4FLT A;  2NRV A;  1FKP A;  2HHV A;  5BN8 A;  3LP3 A;  3OHR A;  2HBJ A;  1WAJ A;  4DSI A;  4JKG B;  2HND A;  4OVL A;  3O3F A;  4JKG A;  3T1Y K;  2ASO A;  4I2P A;  3HT3 A;  5KGX A;  3E9L A;  2P9N A;  4KTQ A;  1W7A A;  3S3O A;  3KZB A;  3WT0 A;  1W97 L;  2WTU A;  1GLA G;  4B8C A;  1LWC A;  3KVG A;  4PA1 A;  4FJJ A;  1NGD A;  4ID5 A;  2VYP A;  5AFU H;  1KFD A;  1WNS A;  4KHY A;  4XIU A;  4AF1 A;  1WBD A;  4RTF D;  2O8D B;  3EKU A;  4U67 L;  2O8D A;  1MWM A;  3ZYY X;  3SUN A;  2V7Z A;  3O9Q A;  4O55 A;  5HOO A;  1NKC A;  4JKF A;  2OAN A;  3MEC A;  4LH5 A;  3HP9 A;  2NRZ A;  4BAC A;  2RN2 A;  3HJF A;  2VG7 A;  3AAR A;  1BU6 O;  4IOC L;  1YVU A;  4BY9 C;  3ULD A;  5H1S Q;  1SL0 A;  3NGZ A;  4JRP A;  3OBY A;  1HR0 K;  1W9H A;  3QBW A;  1J54 A;  4ID1 A;  3O08 A;  3O4Q A;  3NF7 A;  3H3O B;  4JI2 K;  4Q0B A;  3KKR A;  3O1B A;  1KVB A;  4B1X B;  2QI2 A;  5KI6 A;  3CQX A;  4BDY A;  4DSL A;  2A5X A;  3U6F A;  1HYZ A;  3O9T A;  4M3R A;  3R1X A;  4JI8 K;  2V7Y A;  3WXL A;  4BE2 A;  5A2Q O;  4F3T A;  2F9T A;  2HBK A;  4KB1 A;  4LF6 K;  4WF9 L;  2YHX A;  4YOR A;  1NGC A;  1GLJ O;  4H03 B;  5KPZ A;  3SAH A;  4B9T A;  1NGB A;  4KRE A;  4IJN A;  1VQM N;  4I6M A;  4JKD A;  2WFB A;  4CJW A;  5BPL A;  3DAW A;  1OH5 A;  4GMJ B;  3VQ9 A;  3SQ2 A;  2P51 A;  2OYQ A;  3SK3 A;  1U2V B;  2GEL A;  3AVB A;  4DV2 K;  1U2V A;  3I33 A;  1Q86 O;  2GX9 A;  5K14 A;  3QO9 A;  1RFQ A;  3O1W A;  3TSP A;  1GLD G;  4ELV A;  3A2F A;  4WQ5 C;  2UUA K;  4DV1 K;  1IKX A;  3P38 A;  1WOQ A;  2I7P A;  4DQQ A;  4C8N A;  1VSJ A;  5JVH L;  4FZY A;  4BR5 A;  2P5G A;  4JS5 A;  4FWM A;  4B9V A;  4FLU A;  1NJI O;  3SBG A;  1X9S A;  4MO5 A;  1RDA A;  2HOE A;  2XY6 A;  1J5O A;  4M3W A;  4IFV A;  1K8K B;  1K8K A;  2NRH A;  3FZH A;  4CJF A;  4DTR A;  4RW9 A;  4IKF A;  1L5U A;  1C0G A;  3C0B A;  3ZSW A;  3LDN A;  5FRM A;  3K5O A;  3CD6 N;  4BVP A;  3CER A;  3OYN A;  1S1T A;  1XHX A;  4CFD A;  2KHO A;  4K25 A;  1HNW K;  4K8X A;  4OO1 J;  3WQU A;  2ETJ A;  5JVG L;  1VQL N;  1FXX A;  4ISE A;  3LPT A;  4BRL A;  4B1W B;  3KLI A;  2P9I B;  1BQM A;  1VSL A;  3MXM A;  4DUZ K;  3MEG A;  3KWG A;  3PSF A;  4OJR A;  3F73 A;  4DLE A;  4H0O A;  2Q97 A;  3AGR A;  3LDP A;  2A3Z A;  4FPA A;  1NKB A;  3LP2 A;  4IDH A;  3MMV A;  3KK7 A;  4ICL A;  4DU3 A;  1VQO N;  3CQ8 A;  3HYF A;  5FLX O;  3BZK A;  4CFA A;  2IC3 A;  5F2R A;  1X9W A;  1KAZ A;  1BOT O;  2ATQ A;  4CGI A;  2VWB A;  3PO4 A;  5DK5 A;  3HPG A;  4CEO A;  2UUB K;  4LY7 A;  3AA5 X;  4CD1 A;  2QA4 N;  5HLF A;  2WON A;  3L4I A;  1RT5 A;  2E2P A;  1HNV A;  3AO3 A;  4LF7 K;  2B6A A;  4KBO A;  2CGJ A;  2NRR A;  5AQO A;  3T3F A;  4E1J A;  4CZI A;  3CME N;  3RMD A;  3LWL A;  3VEW A;  4PL8 A;  4DF8 A;  3L2W A;  2KZZ A;  4IFE A;  4H5V A;  4FVM A;  2XHB A;  3M6G A;  2ZJP L;  3CJB A;  4V19 S;  3CYM A;  1U48 A;  4H5T A;  4HVJ A;  4B1Z A;  2E5L K;  2ZD1 A;  4CFC A;  2IOC A;  5ADX H;  2BGG A;  3ULE A;  3NH2 A;  4CZF A;  2V51 B;  1NGI A;  3RRH A;  3QNO A;  1RDB A;  4CJR A;  4O0I A;  3L6Q A;  3WEE B;  3MXI A;  1LAW A;  5CYM A;  4BR0 A;  2IVO A;  4CBX A;  2NRX A;  3IKM A;  1BI4 B;  1Q81 O;  3QLH A;  2IVN A;  4A5B A;  1BI4 A;  5J2N A;  5LMN K;  3D6R A;  3D2F B;  5LJV A;  4C8L A;  3D2F A;  5M1K A;  3M8R A;  5HRO A;  3FGU A;  2D0P A;  2E1Y A;  3AA2 A;  4FCY A;  2OA8 A;  3ID8 A;  4Z4G A;  3KD5 E;  1G99 A;  3B6O A;  3ZX2 A;  3OA9 A;  2O8E B;  4CJV A;  2O8E A;  1Z05 A;  1VQK N;  3CG7 A;  3TAN A;  3DI6 A;  3LAK A;  4JI6 K;  5B8H A;  5GAG P;  5KQD A;  3HRG A;  4FSV A;  2O8F B;  3IS9 A;  4O8U A;  4RW8 A;  2VCP A;  3K59 A;  5JS2 A;  3M8Q A;  1N8R O;  3SBT A;  1ATS A;  2OPR A;  5BRE A;  4B3O A;  2E6M A;  4WQ4 A;  1ZXO A;  3CCL N;  3D2E B;  3BEX A;  4ZHR A;  2AA4 A;  3THY B;  1UA1 A;  3KK3 A;  4E0D A;  3OYF A;  3D2E A;  3P4I A;  1A5W A;  4H5N A;  1A5X A;  2ZQB A;  1IBK K;  4BRD A;  2Q31 A;  4FLY A;  4O0J A;  5M1O A;  4CZJ A;  4E7H A;  1JCE A;  3V9S A;  1FKO A;  1XNR K;  3AVG A;  4PKI A;  4H0T B;  5AQS A;  1TYQ A;  1ASV A;  3IAY A;  4W5O A;  3A5M C;  4BG9 A;  2ZJQ L;  3QIC A;  4Q5V A;  1U47 A;  2PYJ A;  2HF4 A;  2KQ2 A;  3QES A;  2P1J A;  3BDP A;  2E20 A;  2O8B B;  1HRH A;  1NKE A;  2E8A A;  5C25 A;  4DS5 A;  4JKE A;  1X9J A;  2YV0 X;  4DTS A;  3EO3 A;  1N34 K;  2QWO A;  4NB4 A;  1VSM A;  1C0F A;  1BG3 A;  3TAR A;  1O1W A;  4NYF A;  3S3N A;  4Z4I A;  3I8D A;  3V6D A;  1YXQ A;  5IWA K;  1IBL K;  2Q0U A;  4DSE A;  2G8W A;  4CZG A;  4CBW A;  4FWK A;  3LAL A;  3CHW A;  4AQY K;  4LF8 K;  1D9F A;  3CQY A;  1JKH A;  2VGN A;  3FLC O;  2ZM6 K;  4H0P A;  3IDH A;  3LDQ A;  5BRD A;  4BC3 A;  1SKW A;  1RBU A;  1EXQ A;  3WNE A;  2HNY A;  4OLB A;  3CFP A;  5AQU A;  4BRN A;  1Y64 A;  3FZL A;  1C0U A;  1C6V A;  1VRT A;  2RKI A;  1TL1 A;  5AQF A;  3MWP A;  5EVZ A;  4NXM K;  1WSJ A;  3RSE B;  1GLC G;  2P9S B;  3ENO A;  4CHZ A;  4FJ5 A;  2YKN A;  1WSF A;  3KHY A;  4GVM A;  2P9S A;  4IOX A;  3QFU A;  5CHI A;  3QET A;  4CCH A;  1KVA A;  4DR4 K;  3G71 N;  4IDK A;  4M3U A;  4NLB A;  1NK9 A;  4CHQ A;  4FLZ A;  2NZT A;  2QWM A;  4KTW A;  3TAM A;  4KV8 A;  4A5A A;  1RIL A;  3U9Z A;  3EY1 A;  3ZSZ A;  3V9W A;  5TKW A;  3ISN C;  1SUQ A;  4CJ4 A;  2GBZ A;  1SKS A;  3LP0 A;  1W2B M;  3ZT0 A;  1ZBI A;  4CF2 A;  4J8F A;  4N41 A;  1RBS A;  4CED A;  2QEX N;  1RDD A;  3OS2 A;  4X62 K;  4X66 K;  3NE6 A;  3QEW A;  3RWU A;  3TPQ A;  3VET A;  3P1G A;  3MK6 A;  4LFB K;  4FJM A;  4CK2 A;  3AGK A;  3MCA B;  4MO4 A;  4DU4 A;  3E01 A;  1RBR A;  3DXM B;  3EZW A;  1F21 A;  1J53 A;  1M90 O;  3I0R A;  2NNW A;  3HM8 A;  1RDU A;  1FJG K;  2Z1J A;  3U9D A;  2QKK A;  3VF2 A;  1BGX T;  4H5W A;  1NGF A;  1ZBU A;  5F1X A;  1EO1 A;  3CM5 A;  2A40 A;  3MED A;  3MAQ A;  5IT9 O;  1ZBL A;  1Z26 A;  3LDS A;  3AO4 A;  1NK4 A;  4HTU A;  3P83 D;  2IGI A;  2HHS A;  1HNZ K;  1B9D A;  1NGE A;  1BO5 O;  2W42 A;  3KKS A;  3MCP A;  4O5B A;  2HBL A;  4ILJ A;  3NFA A;  1R59 O;  4JAX A;  1Q9Y A;  3OYI A;  1QQN A;  1MDU B;  5C15 A;  3NH1 A;  1XWL A;  1JL1 A;  1SAZ A;  4FVU A;  4CHY A;  2E2Q A;  2X6N A;  3I8B A;  3DMJ A;  5I42 A;  1NJX A;  4M3X A;  2NRT A;  3SI6 A;  2D0B A;  1B92 A;  1NK5 A;  3QER A;  3SUQ A;  4R5P A;  1VSF A;  2EWS A;  4F9O A;  5EU7 A;  1TGO A;  1NOY A;  2VG6 A;  3HVT A;  3THW B;  1BL3 A;  3NVM A;  2VQF K;  4CEC A;  2HVI A;  1QS4 A;  2E4L A;  3FZK A;  2RF2 A;  3THW A;  2G8H A;  4DG1 A;  2YHW A;  4DSK A;  4CZE A;  1IG8 A;  2ZWH A;  2ZJR L;  2X6S A;  3VEX A;  4EZ9 A;  3UIQ A;  4FOE A;  3VES A;  4KHQ A;  3HL8 A;  4EZ6 A;  1EKE A;  5JLF A;  4WFA L;  2D0C A;  3VQQ A;  3TU5 A;  5HRN A;  3GDQ A;  4ZTF A;  4FLV A;  2PFU A;  1YJ9 N;  4B9S A;  4DV5 K;  1VQP N;  5T7B A;  3WXM B;  3BF1 A;  3DRP A;  2XY5 A;  3J7Y P;  1Z6R A;  5GAD P;  2G8F A;  3W0L A;  4BDP A;  4DTX A;  1KSP A;  4CEF A;  3KK1 A;  3O9R A;  3S41 A;  1ITG A;  3OYD A;  1XC9 A;  1TK5 A;  4BRP A;  3CJC A;  5LL6 Z;  4XH1 A;  1Q82 O;  1LWE A;  3ZSX A;  2YHB A;  4DR3 K;  1C1C A;  4MDA A;  3EKS A;  3QEP A;  1U04 A;  3CFO A;  1L3S A;  1HQE A;  1VSD A;  1WBB A;  4DSJ A;  2KTQ A;  1MU2 A;  3TAB A;  2QXF A;  2UUC K;  3LAN A;  4CJU A;  4CF0 A;  1DTQ A;  4B9U A;  3THX B;  4M42 A;  3VGM A;  1RTJ A;  3THX A;  1BIS A;  4CJP A;  4FW1 A;  3CPW M;  4B9N A;  4J2E A;  3H08 A;  3AO5 A;  4QS8 A;  3NF9 A;  4PKG A;  4KAZ A;  3AVJ A;  4PWD A;  1DKG D;  1HPM A;  3KLE A;  1KC8 O;  4GV3 A;  3L2V A;  2HF3 A;  4IG0 A;  2HHH K;  4RW4 A;  5EY4 A;  2YNG A;  4F4K A;  4IJA A;  3THV A;  3HO1 A;  5AQR A;  2FSK A;  1TKD A;  4JV5 K;  2OPS A;  1VQ9 N;  1MA9 B;  2YNF A;  3HTV A;  4FM1 A;  3GOI A;  3E66 A;  4KHU A;  4I9Q A;  4YY3 K;  2HNZ A;  4IWV A;  4A2A A;  3OS0 A;  2ZF5 O;  2UU9 K;  2QXL A;  2YI1 A;  3AAP A;  4JK8 A;  4AHV A;  3MX2 A;  3KD1 E;  1IO2 A;  3DRS A;  3OYC A;  4DR6 K;  2KZM A;  1BIZ A;  1VK0 A;  2IIR A;  2NUB A;  2OPQ A;  1S1V A;  3E9O A;  3G0Z A;  4Y1D A;  5HRS A;  4FK4 A;  2EHG A;  3VQD A;  1NK6 A;  2IAJ A;  4EP4 A;  1UA0 A;  4RCH A;  3J7A P;  1Q18 A;  5EXW A;  4CJS A;  4BRH A;  3TSU A;  2YJE A;  2VWJ A;  4BRQ A;  2QK9 A;  3ASM A;  1K9M O;  3T69 A;  1S6P A;  3LDL A;  4LF5 K;  3SNN A;  2AJQ A;  1IJJ A;  3VQ4 A;  3SPZ A;  1X3M A;  4FZX C;  3O9U A;  3M5R A;  4KI6 A;  1GLB G;  3LWM A;  4PL7 A;  4CHN A;  4JEP A;  3CCE N;  2KFZ A;  4L8R B;  3CI5 A;  4BC2 A;  4CEZ A;  5E84 A;  3RMC A;  2JWK A;  1LV5 A;  3E9P A;  4DKW A;  4A57 A;  4DTJ A;  1YIT N;  4B9Q A;  4CGG A;  3R6M A;  4O44 A;  4EHU A;  3OYG A;  1KTQ A;  3CCM N;  4G9Z A;  4EFH A;  1JLB A;  3EN9 A;  1NWK A;  4M41 A;  4W5Q A;  4WFB L;  4A59 A;  2QWQ A;  4B08 A;  1ILY A;  3SPY A;  5CE3 A;  4CI6 A;  2ITG A;  1DTT A;  4QS7 A;  3N4P A;  1TV6 A;  1NMN A;  1TKZ A;  3DLK A;  3F9K A;  3NMU A;  4Z4C A;  1BCM A;  2EX3 A;  5BPN A;  4OGC A;  4DTP A;  4PHT X;  3PX6 A;  2A1S A;  3C6A A;  1KQS M;  1KAX A;  3DM2 A;  1SL1 A;  2DFH A;  4E7I A;  4EIA A;  1WSE A;  2A42 A;  1GOC A;  1VQ8 N;  4HTL A;  2QWN A;  3ZT1 A;  1TKT A;  3RTV A;  4CGH A;  4FLW A;  2Y1I A;  1YTU A;  5AQM A;  1NU0 A;  3O80 A; 
#chains in the Genus database with same CATH homology
 3KJV A;  3RR7 A;  3HK2 A;  2E6M A;  3QIO A;  1S1W A;  3QNN A;  1HPZ A;  1RDC A;  3BGR A;  4KRF A;  4C8M A;  4ZHR A;  1UA1 A;  1K6Y A;  4E0D A;  3AVC A;  3KK3 A;  4DMN A;  3OYF A;  3EZ5 A;  1IKW A;  1QSY A;  1VSI A;  4FW2 A;  1A5W A;  3L2U A;  2BE2 A;  2XY8 A;  4KFB A;  2B5J A;  2VWK A;  5CYQ A;  3V1R A;  4BWM A;  1IKV A;  1T7P A;  4YFU A;  1A5X A;  1TVR A;  3AO1 A;  3AVM A;  2ZQB A;  5FRO A;  3VA0 A;  4DTO A;  3QEV A;  2YNI A;  3OY9 A;  3OYM A;  4FXD A;  4OPJ A;  1HJR A;  4O0J A;  3KK2 A;  2KW4 A;  4FLY A;  1CXQ A;  4E7H A;  4CIG A;  4CGJ A;  3V9S A;  1FKO A;  4FJK A;  5FRN A;  3AVG A;  3D0P A;  1S6Q A;  1A5V A;  4C8K A;  1RCH A;  4W5T A;  1RT6 A;  1ASV A;  1KCF A;  3IAY A;  3O3G A;  3O3H A;  4DQI A;  3DYA A;  1WLJ A;  4E3S A;  4W5O A;  3RMA A;  3JYT A;  2XO7 A;  3NHG A;  3OYA A;  1T03 A;  3VQ8 A;  1QTM A;  4PQU A;  2IS3 A;  1CZ9 A;  1EX4 A;  4Q5V A;  3KLG A;  1RT2 A;  3WNH A;  1U47 A;  1T05 A;  2PYJ A;  4CJL A;  3VQP A;  2KQ2 A;  1HNI A;  3QES A;  2P1J A;  3BDP A;  3AA3 A;  3K57 A;  3PX0 A;  1ASW A;  4AHC A;  3C6T A;  1UAX A;  4OKJ A;  1HRH A;  3ZSV A;  4AH9 A;  3ZT3 A;  4CJE A;  1NKE A;  2Z1H A;  1VSE A;  2X78 A;  1U49 A;  5C25 A;  3VQ7 A;  1J9A A;  4J2D A;  2F8T A;  4OLA A;  4AHU A;  2IDO A;  4DS5 A;  4M3T A;  2YV0 X;  1S9G A;  2I5J A;  3I0S A;  4DTS A;  2FC0 A;  2PYL A;  1QSL A;  3L3V A;  4DFM A;  2DY4 A;  4DSF A;  1VSM A;  2YHA A;  3TAR A;  5CZ1 A;  1O1W A;  4K8Z A;  3ITH A;  1QHT A;  4NYF A;  3S3N A;  4UQG A;  1WAF A;  4Z4I A;  3I8D A;  1SKR A;  4FJG A;  4FJN A;  3V6D A;  1ZBF A;  3NF8 A;  3TAF A;  4KHW A;  4DSE A;  2G8W A;  3NF6 A;  5FDL A;  4M45 A;  3TAQ A;  3DLE A;  1TAU A;  3LAL A;  2KFN A;  1L3V A;  2G8K A;  5C24 A;  2HB5 A;  1D9F A;  3AVL A;  1JKH A;  4BWJ A;  4EP5 A;  3L2R A;  3SV4 A;  3DRR A;  3AV9 A;  4LD0 A;  4FJX A;  4KKO A;  4RG8 A;  2PZS A;  3NH0 A;  4OKK A;  1SKW A;  2GUI A;  4KPY A;  1RBU A;  3G10 A;  3ALY A;  4CER A;  1EXQ A;  3LP1 A;  3WNE A;  1Y97 A;  5DMR A;  4DFJ A;  5D3G A;  2HNY A;  4CF9 A;  4OLB A;  3CFP A;  4OPK A;  5J2M A;  3HPH A;  4DTU A;  2HHW A;  3CFR A;  1C0U A;  4PY5 A;  1C6V A;  2RKI A;  1VRT A;  1TL1 A;  5C42 A;  4B9L A;  5I3U A;  3NGI A;  4Y1C A;  1EP4 A;  4CJT A;  1JXE A;  1WSJ A;  3AA4 A;  4CF1 A;  3K5L A;  3PV8 A;  4C8O A;  2O4I A;  4H4M A;  2WOM A;  1LW0 A;  4FJ5 A;  4CHZ A;  1CLQ A;  4CGD A;  2YKN A;  1WSF A;  4GVM A;  4CES A;  3K5M A;  4ELT A;  4F2R A;  3L8B A;  3K58 A;  3QET A;  4CCH A;  1KVA A;  4YNQ A;  3EYZ A;  4DU1 A;  3P5J A;  1D5A A;  4IDK A;  4FJL A;  5J2P A;  3V1Q A;  3U3G A;  3PO5 A;  4M3U A;  4CJQ A;  1S5J A;  2G8V A;  1NK9 A;  1BHL A;  3VQ6 A;  4CHQ A;  4FLZ A;  3QIP A;  3C6U A;  3ZT2 A;  4RW6 A;  4KTW A;  3SQ0 A;  3TAM A;  3OYJ A;  4JS4 A;  4CE9 A;  2Z1G A;  4KV8 A;  3S9H A;  3PX4 A;  4CK1 A;  1RIL A;  4B8A B;  1VSK A;  2VG5 A;  3ZSZ A;  3EY1 A;  3V9W A;  3ISN C;  1SUQ A;  1UOC A;  4CJ4 A;  2GBZ A;  1EET A;  5JS1 A;  1SKS A;  3LP0 A;  2D5R A;  3AO2 A;  1FK9 A;  3V9Z A;  3ZT0 A;  1X9M A;  2HHX A;  2RPI A;  1ZBI A;  4CF2 A;  4E7K A;  3OJU A;  1RNH A;  2X74 A;  3HST B;  1RBS A;  4Z4H A;  1T8E A;  4N41 A;  4CED A;  3DLB A;  4DQP A;  4FLT A;  1RDD A;  3OS2 A;  2HW3 A;  2HHQ A;  3AVF A;  3QEW A;  3NE6 A;  1FKP A;  3AVN A;  4AHR A;  3RWU A;  2HHV A;  3LP3 A;  3KLF A;  1VRU A;  1WAJ A;  3P1G A;  4M3X A;  1CXU A;  4DSI A;  4FJM A;  4CK2 A;  2HND A;  4OVL A;  1S1X A;  3DLR A;  4LSN A;  3O3F A;  4KHN A;  4DU4 A;  1NJZ A;  4I2P A;  3E01 A;  3HT3 A;  1RBR A;  5KGX A;  2F8S A;  4DS4 A;  4KTQ A;  1F21 A;  1J53 A;  3T1A A;  5SZT A;  1C1A A;  3AVH A;  3S3O A;  3I0R A;  1R0A A;  1ASU A;  1I3A A;  4B8C A;  4BE0 A;  1LWC A;  4CEQ A;  2A1R A;  1L3T A;  4AIL C;  4WE1 A;  4PA1 A;  4FJJ A;  4DTN A;  2Z1J A;  3SQ1 A;  1NK7 A;  2QKK A;  2Y1J A;  4ID5 A;  1BGX T;  1LWF A;  4IG3 A;  1ZBU A;  2DFE A;  5HP1 A;  4IFY A;  3CM5 A;  3MED A;  3MAQ A;  3V4I A;  1KFD A;  1WNS A;  1Z26 A;  5CY4 A;  3LDS A;  1ZBL A;  4KHY A;  4XIU A;  1N6Q A;  3NBP A;  3AO4 A;  1NK4 A;  1LAV A;  1GOB A;  4HTU A;  3P83 D;  4H8K A;  4CJ3 A;  2IGI A;  3B6P A;  1KFS A;  2HHS A;  1B9D A;  3VQB A;  2W42 A;  4CFB A;  3SYZ A;  3KKS A;  1NJY A;  4O5B A;  3SUN A;  3OS1 A;  1Q9X A;  4O55 A;  4FZZ A;  3NFA A;  3PUF A;  4FK2 A;  1NKC A;  1Q9Y A;  3V1O A;  3OYI A;  2P5O A;  3MEC A;  4LH5 A;  3HP9 A;  3NH1 A;  4BAC A;  3OYK A;  2RN2 A;  5CZ2 A;  1XWL A;  1JL1 A;  1B9F A;  4MQ3 A;  5KTQ A;  3HM9 A;  2VG7 A;  3HJF A;  1YTA A;  1RTD A;  4CIE A;  4CHY A;  1YVU A;  4G1Q A;  3ULD A;  3OYB A;  2X6N A;  2LSN A;  3VN5 A;  3AVK A;  2Z1I A;  3DMJ A;  3NDK A;  5I42 A;  1XI1 A;  3IG1 A;  1SL0 A;  3SI6 A;  1NJX A;  3NGZ A;  4H4O A;  1WSI A;  2D0B A;  4JRP A;  1B92 A;  1TK8 A;  1NK5 A;  3QER A;  3RRG A;  3SUQ A;  4CIF A;  1X1P A;  4R5P A;  1VSF A;  1W9H A;  1J54 A;  4ID1 A;  4TSX A;  3O4Q A;  3NF7 A;  1JLA A;  4Q0B A;  3KKR A;  4FM2 A;  5EU7 A;  1KVB A;  1TGO A;  1ZYQ A;  1NOY A;  2VG6 A;  3HVT A;  3O4N A;  2GV9 A;  1BL3 A;  2JLE A;  4CJK A;  4CEC A;  5KI6 A;  2HVI A;  1QS4 A;  2E4L A;  3L2Q A;  4BDY A;  2RF2 A;  2G8H A;  4DSL A;  2QKB A;  4DG1 A;  2HHU A;  4JRQ A;  3U6F A;  1HYZ A;  4OGE A;  4DSK A;  2YNH A;  4M3Z A;  3QIN A;  4M3R A;  1BCO A;  5E41 A;  2X6S A;  4BE2 A;  4F3T A;  3ZSR A;  4EZ9 A;  1RBT A;  3HVR A;  3UIQ A;  4E7J A;  2PY5 A;  2O4G A;  3ZT4 A;  3V9U A;  4KB1 A;  1JLE A;  1RTI A;  4GW6 A;  2XY7 A;  1ZBH A;  4E1N A;  1TKX A;  4KHQ A;  3HL8 A;  1JLQ A;  4EZ6 A;  1EKE A;  1IH7 A;  1HYV A;  4B9T A;  5KRT A;  4KRE A;  4CGF A;  2D0C A;  3OYH A;  4ELU A;  3VQQ A;  5HRN A;  4Z4F A;  4ZTF A;  3C94 A;  4FLV A;  4B9S A;  2FBT A;  3NCI A;  4CJW A;  5T7B A;  4GMJ B;  3VQ9 A;  3SQ2 A;  2P51 A;  2OYQ A;  3K2P A;  1SL2 A;  4E7L A;  3KTQ A;  3DRP A;  2XY5 A;  4KTZ A;  4CHO A;  3AVB A;  1IG9 A;  4F3O A;  1RTH A;  3VA3 A;  2G8F A;  5K14 A;  4FJ7 A;  4BDP A;  3QO9 A;  4HUE A;  4DTX A;  3SV3 A;  3M8P A;  4CEE A;  1GOA A;  4CEF A;  3VQE A;  1KSP A;  3KK1 A;  4ELV A;  3A2F A;  3D45 A;  1NK8 A;  3VQA A;  4DFK A;  1IKX A;  4Z0U A;  3LAM A;  4DQQ A;  4C8N A;  1VSJ A;  3V9X A;  1ITG A;  3OYD A;  1XC9 A;  4HCC A;  1JL2 A;  4FZY A;  1I39 A;  1TK5 A;  2P5G A;  4CK3 A;  4JS5 A;  4B9V A;  4DF4 A;  4FLU A;  3SZ2 A;  1C0T A;  3AVA A;  4DQR A;  3KIO A;  1LWE A;  3ZSX A;  2YHB A;  4OKE A;  4E19 A;  1C1C A;  1X9S A;  1RDA A;  3QEP A;  2XY6 A;  1WSH A;  1LW2 A;  1U04 A;  3CFO A;  5SWM A;  1L3S A;  1J5O A;  1HQE A;  1Q8I A;  1VSD A;  2OPP A;  4IFV A;  4M3W A;  1QSS A;  4FYD A;  4DSJ A;  2KTQ A;  1MU2 A;  4CHP A;  3TAB A;  4CJF A;  4DTR A;  2F96 A;  3LPU A;  4RW9 A;  4ZTJ A;  4IKF A;  1L5U A;  3ZSW A;  3TR8 A;  5FRM A;  1WSG A;  2QXF A;  3K5O A;  3LAN A;  2G8I A;  3VQC A;  4CJU A;  4CF0 A;  1DTQ A;  4PUO A;  4B9U A;  4M42 A;  3OYN A;  4DLG A;  1S1T A;  1XHX A;  2FBX A;  1RTJ A;  4CFD A;  1KVC A;  5J1E A;  1BIS A;  4CJP A;  4FW1 A;  3OVN A;  4K8X A;  4B9N A;  4J2E A;  4CEB A;  3H08 A;  3AO5 A;  2ETJ A;  4HUG A;  3NF9 A;  4N76 A;  3MXJ A;  4J2A A;  1TL3 A;  4KAZ A;  4W5N A;  2FBV A;  3TAE A;  3QEX A;  1FXX A;  3AVJ A;  4PWD A;  3IRX A;  3S3M A;  4FJH A;  3KLE A;  3LPT A;  2FBY A;  3DOK A;  4IBN A;  3KLI A;  3JSM A;  1BQM A;  1VSL A;  3VQ5 A;  3MXM A;  3L2V A;  3MEG A;  2HMI A;  4OJR A;  4M3Y A;  3F73 A;  3TAP A;  4IG0 A;  4DLE A;  1S9E A;  3U3Y A;  4RW4 A;  3LZI A;  2YNG A;  4F4K A;  3OJS A;  3THV A;  3HO1 A;  1UWB A;  3SUO A;  1NKB A;  1RT4 A;  3LP2 A;  1TKD A;  2YKM A;  1D8Y A;  4NYN A;  1JLG A;  4ICL A;  2OPS A;  4DU3 A;  2YNF A;  4LH4 A;  1U4B A;  1RT7 A;  3CQ8 A;  3HYF A;  4FM1 A;  3T19 A;  4CFA A;  2IC3 A;  1X9W A;  3DLG A;  4KHU A;  1NK0 A;  1JLC A;  2ATQ A;  2Q3S A;  4CGI A;  1XHZ A;  1HQU A;  3PO4 A;  4I9Q A;  4KO0 A;  4HUF A;  4CF8 A;  5DK5 A;  2HNZ A;  3HPG A;  4FM0 A;  4CEO A;  4FK0 A;  3OS0 A;  4LY7 A;  3AA5 X;  3KLH A;  4KI4 A;  5HLF A;  3ZSY A;  1WN7 A;  1IKY A;  1VSH A;  1KLN A;  2WON A;  1RT5 A;  4KB0 A;  4AHV A;  1HNV A;  3AO3 A;  3SQ4 A;  1IO2 A;  2B6A A;  3DRS A;  5HRP A;  3SUP A;  3OYC A;  3KD1 E;  3LZJ A;  1BIU A;  1L3U A;  4LSL A;  1BIZ A;  1W0H A;  1VK0 A;  2NUB A;  2OPQ A;  4QOZ B;  1S1V A;  3T3F A;  4N47 A;  1QE1 A;  3G0Z A;  4Y1D A;  3HP6 A;  5HRS A;  4CEA A;  2G8U A;  1TAQ A;  4FK4 A;  1NOZ A;  2EHG A;  3VQD A;  3LWL A;  3RMD A;  1NK6 A;  2IAJ A;  4EP4 A;  4DF8 A;  1UA0 A;  1NJW A;  2OZM A;  3L2W A;  1HMV A;  4QCL A;  2KZZ A;  4I9L A;  4CJS A;  1BQN A;  1YT3 A;  3ZCM A;  4FVM A;  2XHB A;  4J2B A;  3HPO A;  4B9M A;  4AHT A;  4RW7 A;  2VWJ A;  4F8R A;  3NGY A;  2QK9 A;  3ASM A;  4NCA A;  3RR8 A;  4FLX A;  3CYM A;  1S6P A;  3SCX A;  2OZS A;  4BE1 A;  2B4J A;  1U48 A;  4HVJ A;  3SNN A;  3K5N A;  2AJQ A;  2ZD1 A;  3VQ4 A;  2BDP A;  2XRI A;  4CFC A;  3HXM A;  2IOC A;  3SPZ A;  4NCG A;  2BGG A;  4FZX C;  2R7Y A;  3WNF A;  3NH2 A;  3DOL A;  3ZSO A;  4KI6 A;  3L3U A;  3LWM A;  4CHN A;  4I2Q A;  4HHT A;  3RRH A;  5HBM A;  1RDB A;  2E6L A;  4CJR A;  4O0I A;  3QNO A;  4DFP A;  4L8R B;  2KFZ A;  4CEZ A;  1RT3 A;  5HRR A;  3RMC A;  5KRS A;  2BAN A;  3MXI A;  1D9D A;  1RT1 A;  4CJ5 A;  1LAW A;  2ZE2 A;  1LV5 A;  5CYM A;  3PY8 A;  4DTJ A;  4CGG A;  4O44 A;  2JGU A;  4F2S A;  3OYG A;  4FJ8 A;  1KTQ A;  1BI4 B;  1JLB A;  1S1U A;  3ZSQ A;  3TAG A;  1U45 A;  3QLH A;  1KLM A;  4M41 A;  4W5Q A;  3C95 A;  3DLH A;  1BI4 A;  5J2N A;  2HVH A;  1HYS A;  1C1B A;  5J2Q A;  4B08 A;  3SPY A;  1N5Y A;  4C8L A;  4FJ9 A;  2ITG A;  3AVI A;  3V81 A;  1DTT A;  3M8R A;  2KZM A;  5HRO A;  1TV6 A;  4DQS A;  1G15 A;  4Z4E A;  1TKZ A;  5KGW A;  3DLK A;  4HCB A;  3AA2 A;  4FCY A;  2OA8 A;  3F9K A;  1CZB A;  1DLO A;  4Z4C A;  1BCM A;  2EX3 A;  4W5R A;  4OGC A;  4DTP A;  4Z4G A;  3KD5 E;  3PX6 A;  3B6O A;  2A1S A;  4AHS A;  3FFI A;  1KRP A;  1RBV A;  3DM2 A;  4CJV A;  1JXB A;  4E89 A;  1SL1 A;  2DFH A;  4FJI A;  4NCB A;  3M8S A;  3NAE A;  3TWH A;  3CG7 A;  3TAN A;  3DI6 A;  4E7I A;  3LAK A;  2DFF A;  1JLF A;  1REV A;  1C0M A;  4O4G A;  2DTU A;  1WSE A;  3OYL A;  1GOC A;  1TK0 A;  4N5S A;  4E1M A;  1QQC A;  3RMB A;  4MFB A;  3OYE A;  2HHT A;  3IS9 A;  4RW8 A;  4N56 A;  4BDZ A;  1Z25 A;  1TKT A;  3ZT1 A;  3SJJ A;  3CM6 A;  4KHS A;  3RTV A;  4CGH A;  3K59 A;  4FLW A;  5JS2 A;  3M8Q A;  1SV5 A;  2Y1I A;  4QAG A;  1YTU A;  3TI0 A;  2OPR A;  3QEI A;  4I7F A;  4JLH A;  3WNG A;  3MEE A;  4DTM A;  4B3O A;  4DWI A;  2D0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...