1JL9A

Crystal structure of human epidermal growth factor
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
42
structure length
42
Chain Sequence
CPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human epidermal growth factor and its dimerization
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords EPIDERMAL GROWTH FACTOR
total genus 4
structure length 42
sequence length 42
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00008 EGF EGF-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 1jl9A00
3U73A 2P95L 4M11A 2UWLB 4X8UL 2FLGA 1EPGA 5F19A 2Y7ZB 1IOXA 4Y6DB 1DDXA 1MQ5L 2F9BL 2M74A 1HAEA 2BOHA 1PRHA 3NJPC 1ADXA 4JYUL 5KN5C 1IJQA 1NT0A 4CSYA 1CEJA 1MQ6L 1UZJA 1NFWB 2P28B 3KRKA 2B7DL 1CQEA 1URKA 4LORA 1NQLB 3KQEL 5KIRA 3LN1A 1LMJA 2W86A 4JYVL 3ELAL 3OLUA 5JB9E 3TGFA 4YT7L 2D1JB 4BDWA 1WHFA 3NTBA 2ADXA 2BZ6L 3SOQA 2Y38A 2XBWL 5JVZA 3N8WB 2G00L 1ATBA 2WYGB 1LPGA 4BTUA 1IOEL 2BOUA 1W7XL 1APOA 2H9EL 1Z6EL 3M37L 4M10A 2BO2A 4BTIA 3OLTA 3CS7L 2BQ7A 3N8XA 3GISX 3TBDA 1OB1C 2FLBL 2Y80B 3GCWE 2VWNL 1L3YA 1WU1B 1F7MA 2FLRL 2DDUA 2WPME 1IQHL 3HS5A 2Y5FL 1KSNB 4ZAEB 1C5MF 5L30L 1COUA 3HO5A 1YUGA 1HJ7A 3SOVA 2RA0L 5IKRA 2UWPB 4X8VL 1CVWL 1XKAL 4Y79B 4X8TL 4G1MB 2XC4L 4Y71B 2WFXB 4RUTA 4BTTA 2EI6B 1IQJL 3HS6A 1U8CB 1CCVA 5CISA 1EMNA 1M1XB 1BF9A 1EGFA 1IQNL 4LMFA 3N8ZA 1G1RA 3ZYGA 1FFMA 1F7EA 1ATAA 1O5DL 5L2YL 3H5CB 2Q1JB 5IKQA 4X8SL 3CENL 3MDLA 1EPHA 1NPEB 1MOXC 1X7AL 1PGEA 3NTGA 2NPRA 5CKNA 4ZHAB 3SOBB 2BQ6A 3KQBL 1JBUL 1F0RB 1ATEA 1NZIA 1UZPA 2WG4B 2W2OE 1EBVA 3BT1A 1KLIL 2Y5HL 3M36L 1LPKA 2WG3C 1YO8A 4MMXB 5EGMB 4ISHL 4Z0KB 3RR3A 4RRYA 2P16L 3P5BL 1CX2A 2VWLL 2EI7B 3TZIA 1PTHA 4RRZA 3HO4A 2J95B 1LPZA 4Y7BB 1WHEA 1V3XB 2WYJB 2AYLA 2XBVL 1CVUA 2XBYL 1APQA 3N8YB 1K37A 1FAXL 3ZYJB 2Y7XB 3N8YA 3Q7DA 6COXA 1HREA 4Z6AL 3TK5B 1IGZA 2P26A 4XL1A 4E1GA 3NT1A 1P9JA 4D0FA 4MMZB 2VH6B 5COXA 2FD6A 1DIYA 1DVAL 4D90A 2BOKL 1HRFA 3QH0A 3LAQA 1FJSL 4ZXYL 2K2TA 1IQML 2P3FL 4TGFA 1CCFA 2WPKE 2JKHL 1GK5A 4YZUB 1YUKB 1EMOA 2J2UB 3TK6B 1UZKA 1P0SL 4CUDA 3LN0A 1IQFL 4RRWA 1KLJL 1JV2B 3ASIA 4RRXA 1UZQA 3BT2A 3V65B 4AQTA 1HX2A 3F6UL 4CUFA 2Y5GL 2XC0L 3IITB 2WPLE 5JBBE 2W2PE 2OYEP 1AUTL 2PR3B 3MQEA 5L2ZL 1EPIA 1IQIL 5IKVA 1RFNB 5K0HB 2P3TA 2PHBB 2VVCK 1I0UA 2I9BA 5JVYA 3LC3B 2GD4A 4XLWA 2J4IB 4ZXXL 1XKBA 1B9WA 1G1TA 5JW1A 3U7UG 1G2MB 1TPGA 1YUFA 4OTYA 3C9AC 1Z6CA 2KB9A 3FBYA 4CUEA 1PFXL 4PH9A 4O02B 2Y82B 4C16A 3QMOA 5I46L 3ZYIB 1Q4GA 4BXSA 1DX5I 2BQWA 2VWMK 2K2SB 5E8DA 5JBAE 1N7DA 3ENSA 2W2NE 4ISIL 1EQGA 1TLEA 3F1SB 3N8VA 1W8BL 3CFWA 1NFUB 4D0EA 2P94L 2P3FN 2PUQL 2UWOB 4YT6L 2W2QE 1HZ8A 2EI8B 1EZQB 4COXA 2TGFA 1NFYB 3POYA 1F0SB 2VVUL 4RS0A 2OYUP 3LTFB 3KQDL 1LQDA 1YGCL 1ZAQA 1DQBA 1N1IA 2CJIB 5JB8E 2FZZL 4JZFL 2J34B 2KV4A 3KK6A 3R05A 1ATDA 1KLOA 3GCXE 1FF7A 1IQLL 4Z0LA 3DEMA 1G1QA 2J94B 3Q3KB 2WPHE 2Y81B 2VVVL 2BMGA 3KCGL 2W2ME 4JZDL 1IQGL 3IJEB 1FAKL 3HPTA 1TOZA 3EGFA 2MGPA 1HAFA 2VJ3A 1IQEL 5CKMA 1K36A 2KL7A 1EPJA 2YGOA 1IGXA 2RNLA 2VWOL 2MGRA 3KL6B 2I9AA 1G1SA 1A3PA 1FSBA 3BPSE 3FCSB 4A7IA 2WPIE 3SW2A 1PXXA 2WFTA 2J38B 3V64C 1EAIC 1KIGL 3TH3L 4Y76B 1HT5A 2P3UA 2MHPA 3QCWA 4BXWA 4XBMA 1EQHA 4Y7AB 4FM5A 5CKQA 2YGPA 4NGAL 2RHPA 2XBXL 4JZEL 5F1AA 3LC5B 1HCGB 1XDTR 2P93L 4OTJA 3N8WA 4MMYB 2XC5L 5FDQA 2W26B 1JL9A 3K9XA 3LTGD 2WPJE 2W3IB 2W3KB 1U67A 3HS7A 2BOXA 4NG9L 1HT8A 5JBCE 2VH0B 1J9CL 4O1ZA 3KQCL 4BDXA 1NFXB 1FE2A 5IKTA 1IP0A 4NA9L 3HO3A 1IVOC 1IQKL 3PGHA 1L5GB 1QFKL 1G2LB 1XFEA 1SZBA 4ZH8B 3CA7A 3FFGL 3LIWB
chains in the Genus database with same CATH superfamily
3U73A 2P95L 4M11A 2UWLB 4X8UL 2FLGA 1EPGA 5F19A 2Y7ZB 1IOXA 4Y6DB 1DDXA 1MQ5L 2F9BL 2M74A 1HAEA 2BOHA 1PRHA 3NJPC 1V1IA 1ADXA 4JYUL 5KN5C 1IJQA 1NT0A 4CSYA 1CEJA 1MQ6L 1UZJA 1NFWB 2BSFA 2P28B 3KRKA 2B7DL 1CQEA 1URKA 4LORA 1NQLB 3KQEL 5KIRA 3LN1A 1LMJA 2W86A 4JYVL 3ELAL 3OLUA 5JB9E 3TGFA 4YT7L 2D1JB 4BDWA 1WHFA 3NTBA 2ADXA 2BZ6L 3SOQA 2Y38A 2XBWL 5JVZA 3N8WB 2G00L 1ATBA 2WYGB 1LPGA 4BTUA 1IOEL 2BOUA 1W7XL 1APOA 2H9EL 1Z6EL 3M37L 4M10A 2BO2A 4BTIA 3OLTA 3CS7L 2BT7A 2BQ7A 3N8XA 3GISX 3TBDA 1OB1C 2FLBL 2Y80B 3GCWE 2VWNL 1L3YA 1WU1B 1F7MA 2FLRL 2DDUA 2WPME 1IQHL 4GU4A 3HS5A 2Y5FL 1KSNB 4ZAEB 1C5MF 5L30L 1COUA 3HO5A 1YUGA 1HJ7A 3SOVA 2RA0L 5IKRA 2UWPB 4X8VL 1CVWL 1XKAL 4Y79B 2BT8A 4X8TL 4G1MB 2XC4L 4Y71B 2WFXB 4RUTA 4BTTA 2EI6B 1IQJL 3HS6A 1U8CB 1CCVA 5CISA 1EMNA 1M1XB 1BF9A 1EGFA 1IQNL 4LMFA 3N8ZA 1G1RA 3ZYGA 1FFMA 1F7EA 1ATAA 1O5DL 5L2YL 3H5CB 2Q1JB 5IKQA 4X8SL 3CENL 3MDLA 1EPHA 1NPEB 1LMMA 1MOXC 2WZPP 1X7AL 1PGEA 3NTGA 2NPRA 5CKNA 4ZHAB 3SOBB 2BQ6A 3KQBL 1JBUL 1F0RB 1ATEA 1NZIA 1UZPA 2WG4B 2W2OE 1EBVA 3BT1A 1KLIL 2Y5HL 3M36L 1LPKA 2WG3C 1YO8A 4MMXB 5EGMB 4ISHL 4Z0KB 3RR3A 4RRYA 2P16L 3P5BL 1CX2A 2VWLL 2EI7B 3TZIA 1PTHA 4RRZA 3HO4A 2J95B 1LPZA 4Y7BB 1WHEA 1V3XB 2WYJB 2AYLA 2XBVL 1CVUA 2XBYL 1APQA 3N8YB 1K37A 1FAXL 3ZYJB 2Y7XB 3N8YA 3Q7DA 6COXA 1HREA 4Z6AL 3TK5B 1IGZA 2P26A 4XL1A 3S6XA 4E1GA 3NT1A 1LK9A 1P9JA 4D0FA 4MMZB 2VH6B 5COXA 2FD6A 1DIYA 1DVAL 4D90A 2HOXA 2BOKL 1HRFA 3QH0A 3LAQA 1FJSL 4ZXYL 2K2TA 1IQML 2P3FL 4TGFA 1CCFA 2WPKE 2JKHL 1GK5A 4YZUB 1YUKB 1EMOA 2J2UB 3TK6B 1UZKA 1P0SL 4CUDA 3LN0A 1IQFL 4RRWA 1KLJL 1JV2B 3ASIA 4RRXA 1UZQA 3BT2A 3V65B 4AQTA 1HX2A 3F6UL 4CUFA 2Y5GL 2XC0L 3IITB 2WPLE 5JBBE 2W2PE 2OYEP 1AUTL 2PR3B 3MQEA 5L2ZL 1EPIA 1IQIL 5IKVA 1RFNB 5K0HB 2P3TA 2PHBB 2VVCK 1I0UA 2I9BA 5JVYA 3LC3B 2GD4A 4XLWA 2J4IB 4ZXXL 1XKBA 1B9WA 1G1TA 5JW1A 3U7UG 1G2MB 1TPGA 1YUFA 4OTYA 3C9AC 1Z6CA 2KB9A 3FBYA 4CUEA 1PFXL 4PH9A 4O02B 2Y82B 4C16A 3QMOA 5I46L 3ZYIB 1Q4GA 4BXSA 1DX5I 2BQWA 2VWMK 2K2SB 5E8DA 5JBAE 1N7DA 3ENSA 2W2NE 4ISIL 1EQGA 1TLEA 3F1SB 3N8VA 1W8BL 3CFWA 1NFUB 4D0EA 2P94L 2P3FN 2PUQL 2UWOB 4YT6L 2W2QE 1HZ8A 2EI8B 1EZQB 4COXA 2TGFA 4GU3A 1NFYB 3POYA 1F0SB 2VVUL 2JJLA 4RS0A 2OYUP 3LTFB 3KQDL 1LQDA 1KKEA 1YGCL 1ZAQA 1DQBA 1N1IA 2CJIB 5JB8E 2FZZL 4JZFL 2J34B 2KV4A 3KK6A 3R05A 1ATDA 1KLOA 3GCXE 1FF7A 1IQLL 4Z0LA 3DEMA 1G1QA 2J94B 3Q3KB 2WPHE 2Y81B 2VVVL 2BMGA 3KCGL 2W2ME 4JZDL 1IQGL 3IJEB 1FAKL 3HPTA 1TOZA 3EGFA 2MGPA 1HAFA 2VJ3A 1IQEL 5CKMA 1K36A 2KL7A 1EPJA 2YGOA 1IGXA 2RNLA 2VWOL 2MGRA 2VRSA 3KL6B 2I9AA 1G1SA 1A3PA 1FSBA 3BPSE 3FCSB 4A7IA 2WPIE 3SW2A 1PXXA 2WFTA 2J38B 3V64C 1EAIC 1KIGL 3TH3L 4Y76B 1HT5A 2P3UA 2MHPA 3QCWA 4BXWA 1QIUA 1V1HA 4XBMA 1EQHA 4Y7AB 4FM5A 5CKQA 2YGPA 4NGAL 2RHPA 2XBXL 4A94C 4JZEL 5F1AA 3LC5B 2HORA 1HCGB 1XDTR 2P93L 4OTJA 3N8WA 4MMYB 2XC5L 5FDQA 2W26B 1JL9A 3K9XA 3LTGD 2WPJE 2W3IB 2W3KB 1U67A 3HS7A 2BOXA 4NG9L 1HT8A 5JBCE 2KNIA 2VH0B 1J9CL 2H9EC 4O1ZA 3KQCL 4BDXA 1NFXB 1FE2A 5IKTA 1IP0A 4NA9L 3HO3A 1IVOC 1IQKL 3PGHA 1L5GB 1QFKL 1G2LB 1XFEA 2YGQA 1SZBA 4ZH8B 3CA7A 3FFGL 3LIWB
chains in the Genus database with same CATH topology
3U73A 2P95L 4M11A 2UWLB 4X8UL 2FLGA 1EPGA 5F19A 2Y7ZB 1IOXA 4Y6DB 1DDXA 1MQ5L 2F9BL 2M74A 1HAEA 2BOHA 1PRHA 3NJPC 1ADXA 4JYUL 5KN5C 1IJQA 1NT0A 4CSYA 1CEJA 1MQ6L 1UZJA 1NFWB 2P28B 3KRKA 2B7DL 1CQEA 1URKA 4LORA 1NQLB 3KQEL 5KIRA 3LN1A 1LMJA 2W86A 4JYVL 3ELAL 3OLUA 5JB9E 3TGFA 4YT7L 2D1JB 4BDWA 1WHFA 3NTBA 2ADXA 2BZ6L 3SOQA 2Y38A 2XBWL 5JVZA 3N8WB 2G00L 1ATBA 2WYGB 1LPGA 4BTUA 1IOEL 2BOUA 1W7XL 1APOA 2H9EL 1Z6EL 3M37L 4M10A 2BO2A 4BTIA 3OLTA 3CS7L 2BQ7A 3N8XA 3GISX 3TBDA 1OB1C 2FLBL 2Y80B 3GCWE 2VWNL 1L3YA 1WU1B 1F7MA 2FLRL 2DDUA 2WPME 1IQHL 3HS5A 2Y5FL 1KSNB 4ZAEB 1C5MF 5L30L 1COUA 3HO5A 1YUGA 1HJ7A 3SOVA 2RA0L 5IKRA 2UWPB 4X8VL 1CVWL 1XKAL 4Y79B 4X8TL 4G1MB 2XC4L 4Y71B 2WFXB 4RUTA 4BTTA 2EI6B 1IQJL 3HS6A 1U8CB 1CCVA 5CISA 1EMNA 1M1XB 1BF9A 1EGFA 1IQNL 4LMFA 3N8ZA 1G1RA 3ZYGA 1FFMA 1F7EA 1ATAA 1O5DL 5L2YL 3H5CB 2Q1JB 5IKQA 4X8SL 3CENL 3MDLA 1EPHA 1NPEB 1LMMA 1MOXC 2WZPP 1X7AL 1PGEA 3NTGA 2NPRA 5CKNA 4ZHAB 3SOBB 2BQ6A 3KQBL 1JBUL 1F0RB 1ATEA 1NZIA 1UZPA 2WG4B 2W2OE 1EBVA 3BT1A 1KLIL 2Y5HL 3M36L 1LPKA 2WG3C 1YO8A 4MMXB 5EGMB 4ISHL 4Z0KB 3RR3A 4RRYA 2P16L 3P5BL 1CX2A 2VWLL 2EI7B 3TZIA 1PTHA 4RRZA 3HO4A 2J95B 1LPZA 4Y7BB 1WHEA 1V3XB 2WYJB 2AYLA 2XBVL 1CVUA 2XBYL 1APQA 3N8YB 1K37A 1FAXL 3ZYJB 2Y7XB 3N8YA 3Q7DA 6COXA 1HREA 4Z6AL 3TK5B 1IGZA 2P26A 4XL1A 3S6XA 4E1GA 3NT1A 1P9JA 4D0FA 4MMZB 2VH6B 5COXA 2FD6A 1DIYA 1DVAL 4D90A 2BOKL 1HRFA 3QH0A 3LAQA 1FJSL 4ZXYL 2K2TA 1IQML 2P3FL 4TGFA 1CCFA 2WPKE 2JKHL 1GK5A 4YZUB 1YUKB 1EMOA 2J2UB 3TK6B 1UZKA 1P0SL 4CUDA 3LN0A 1IQFL 4RRWA 1KLJL 1JV2B 3ASIA 4RRXA 1UZQA 3BT2A 3V65B 4AQTA 1HX2A 3F6UL 4CUFA 2Y5GL 2XC0L 3IITB 2WPLE 5JBBE 2W2PE 2OYEP 1AUTL 2PR3B 3MQEA 5L2ZL 1EPIA 1IQIL 5IKVA 1RFNB 5K0HB 2P3TA 2PHBB 2VVCK 1I0UA 2I9BA 5JVYA 3LC3B 2GD4A 4XLWA 2J4IB 4ZXXL 1XKBA 1B9WA 1G1TA 5JW1A 3U7UG 1G2MB 1TPGA 1YUFA 4OTYA 3C9AC 1Z6CA 2KB9A 3FBYA 4CUEA 1PFXL 4PH9A 4O02B 2Y82B 4C16A 3QMOA 5I46L 3ZYIB 1Q4GA 4BXSA 1DX5I 2BQWA 2VWMK 2K2SB 5E8DA 5JBAE 1N7DA 3ENSA 2W2NE 4ISIL 1EQGA 1TLEA 3F1SB 3N8VA 1W8BL 3CFWA 1NFUB 4D0EA 2P94L 2P3FN 2PUQL 2UWOB 4YT6L 2W2QE 1HZ8A 2EI8B 1EZQB 4COXA 2TGFA 1NFYB 3POYA 1F0SB 2VVUL 4RS0A 2OYUP 3LTFB 3KQDL 1LQDA 1YGCL 1ZAQA 1DQBA 1N1IA 2CJIB 5JB8E 2FZZL 4JZFL 2J34B 2KV4A 3KK6A 3R05A 1ATDA 1KLOA 3GCXE 1FF7A 1IQLL 4Z0LA 3DEMA 1G1QA 2J94B 3Q3KB 2WPHE 2Y81B 2VVVL 2BMGA 3KCGL 2W2ME 4JZDL 1IQGL 3IJEB 1FAKL 3HPTA 1TOZA 3EGFA 2MGPA 1HAFA 2VJ3A 1IQEL 5CKMA 1K36A 2KL7A 1EPJA 2YGOA 1IGXA 2RNLA 2VWOL 2MGRA 3KL6B 2I9AA 1G1SA 1A3PA 1FSBA 3BPSE 3FCSB 4A7IA 2WPIE 3SW2A 1PXXA 2WFTA 2J38B 3V64C 1EAIC 1KIGL 3TH3L 4Y76B 1HT5A 2P3UA 2MHPA 3QCWA 4BXWA 4XBMA 1EQHA 4Y7AB 4FM5A 5CKQA 2YGPA 4NGAL 2RHPA 2XBXL 4A94C 4JZEL 5F1AA 3LC5B 1HCGB 1XDTR 2P93L 4OTJA 3N8WA 4MMYB 2XC5L 5FDQA 2W26B 1JL9A 3K9XA 3LTGD 2WPJE 2W3IB 2W3KB 1U67A 3HS7A 2BOXA 4NG9L 1HT8A 5JBCE 2KNIA 2VH0B 1J9CL 2H9EC 4O1ZA 3KQCL 4BDXA 1NFXB 1FE2A 5IKTA 1IP0A 4NA9L 3HO3A 1IVOC 1IQKL 3PGHA 1L5GB 1QFKL 1G2LB 1XFEA 2YGQA 1SZBA 4ZH8B 3CA7A 3FFGL 3LIWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U73 A;  2P95 L;  4M11 A;  2UWL B;  4X8U L;  2FLG A;  1EPG A;  5F19 A;  2Y7Z B;  1IOX A;  4Y6D B;  1DDX A;  1MQ5 L;  2F9B L;  2M74 A;  1HAE A;  2BOH A;  1PRH A;  3NJP C;  1ADX A;  4JYU L;  5KN5 C;  1IJQ A;  1NT0 A;  4CSY A;  1CEJ A;  1MQ6 L;  1UZJ A;  1NFW B;  2P28 B;  3KRK A;  2B7D L;  1CQE A;  1URK A;  4LOR A;  1NQL B;  3KQE L;  5KIR A;  3LN1 A;  1LMJ A;  2W86 A;  4JYV L;  3ELA L;  3OLU A;  5JB9 E;  3TGF A;  4YT7 L;  2D1J B;  4BDW A;  1WHF A;  3NTB A;  2ADX A;  2BZ6 L;  3SOQ A;  2Y38 A;  2XBW L;  5JVZ A;  3N8W B;  2G00 L;  1ATB A;  2WYG B;  1LPG A;  4BTU A;  1IOE L;  2BOU A;  1W7X L;  1APO A;  2H9E L;  1Z6E L;  3M37 L;  4M10 A;  2BO2 A;  4BTI A;  3OLT A;  3CS7 L;  2BQ7 A;  3N8X A;  3GIS X;  3TBD A;  1OB1 C;  2FLB L;  2Y80 B;  3GCW E;  2VWN L;  1L3Y A;  1WU1 B;  1F7M A;  2FLR L;  2DDU A;  2WPM E;  1IQH L;  3HS5 A;  2Y5F L;  1KSN B;  4ZAE B;  1C5M F;  5L30 L;  1COU A;  3HO5 A;  1YUG A;  1HJ7 A;  3SOV A;  2RA0 L;  5IKR A;  2UWP B;  4X8V L;  1CVW L;  1XKA L;  4Y79 B;  4X8T L;  4G1M B;  2XC4 L;  4Y71 B;  2WFX B;  4RUT A;  4BTT A;  2EI6 B;  1IQJ L;  3HS6 A;  1U8C B;  1CCV A;  5CIS A;  1EMN A;  1M1X B;  1BF9 A;  1EGF A;  1IQN L;  4LMF A;  3N8Z A;  1G1R A;  3ZYG A;  1FFM A;  1F7E A;  1ATA A;  1O5D L;  5L2Y L;  3H5C B;  2Q1J B;  5IKQ A;  4X8S L;  3CEN L;  3MDL A;  1EPH A;  1NPE B;  1MOX C;  1X7A L;  1PGE A;  3NTG A;  2NPR A;  5CKN A;  4ZHA B;  3SOB B;  2BQ6 A;  3KQB L;  1JBU L;  1F0R B;  1ATE A;  1NZI A;  1UZP A;  2WG4 B;  2W2O E;  1EBV A;  3BT1 A;  1KLI L;  2Y5H L;  3M36 L;  1LPK A;  2WG3 C;  1YO8 A;  4MMX B;  5EGM B;  4ISH L;  4Z0K B;  3RR3 A;  4RRY A;  2P16 L;  3P5B L;  1CX2 A;  2VWL L;  2EI7 B;  3TZI A;  1PTH A;  4RRZ A;  3HO4 A;  2J95 B;  1LPZ A;  4Y7B B;  1WHE A;  1V3X B;  2WYJ B;  2AYL A;  2XBV L;  1CVU A;  2XBY L;  1APQ A;  3N8Y B;  1K37 A;  1FAX L;  3ZYJ B;  2Y7X B;  3N8Y A;  3Q7D A;  6COX A;  1HRE A;  4Z6A L;  3TK5 B;  1IGZ A;  2P26 A;  4XL1 A;  4E1G A;  3NT1 A;  1P9J A;  4D0F A;  4MMZ B;  2VH6 B;  5COX A;  2FD6 A;  1DIY A;  1DVA L;  4D90 A;  2BOK L;  1HRF A;  3QH0 A;  3LAQ A;  1FJS L;  4ZXY L;  2K2T A;  1IQM L;  2P3F L;  4TGF A;  1CCF A;  2WPK E;  2JKH L;  1GK5 A;  4YZU B;  1YUK B;  1EMO A;  2J2U B;  3TK6 B;  1UZK A;  1P0S L;  4CUD A;  3LN0 A;  1IQF L;  4RRW A;  1KLJ L;  1JV2 B;  3ASI A;  4RRX A;  1UZQ A;  3BT2 A;  3V65 B;  4AQT A;  1HX2 A;  3F6U L;  4CUF A;  2Y5G L;  2XC0 L;  3IIT B;  2WPL E;  5JBB E;  2W2P E;  2OYE P;  1AUT L;  2PR3 B;  3MQE A;  5L2Z L;  1EPI A;  1IQI L;  5IKV A;  1RFN B;  5K0H B;  2P3T A;  2PHB B;  2VVC K;  1I0U A;  2I9B A;  5JVY A;  3LC3 B;  2GD4 A;  4XLW A;  2J4I B;  4ZXX L;  1XKB A;  1B9W A;  1G1T A;  5JW1 A;  3U7U G;  1G2M B;  1TPG A;  1YUF A;  4OTY A;  3C9A C;  1Z6C A;  2KB9 A;  3FBY A;  4CUE A;  1PFX L;  4PH9 A;  4O02 B;  2Y82 B;  4C16 A;  3QMO A;  5I46 L;  3ZYI B;  1Q4G A;  4BXS A;  1DX5 I;  2BQW A;  2VWM K;  2K2S B;  5E8D A;  5JBA E;  1N7D A;  3ENS A;  2W2N E;  4ISI L;  1EQG A;  1TLE A;  3F1S B;  3N8V A;  1W8B L;  3CFW A;  1NFU B;  4D0E A;  2P94 L;  2P3F N;  2PUQ L;  2UWO B;  4YT6 L;  2W2Q E;  1HZ8 A;  2EI8 B;  1EZQ B;  4COX A;  2TGF A;  1NFY B;  3POY A;  1F0S B;  2VVU L;  4RS0 A;  2OYU P;  3LTF B;  3KQD L;  1LQD A;  1YGC L;  1ZAQ A;  1DQB A;  1N1I A;  2CJI B;  5JB8 E;  2FZZ L;  4JZF L;  2J34 B;  2KV4 A;  3KK6 A;  3R05 A;  1ATD A;  1KLO A;  3GCX E;  1FF7 A;  1IQL L;  4Z0L A;  3DEM A;  1G1Q A;  2J94 B;  3Q3K B;  2WPH E;  2Y81 B;  2VVV L;  2BMG A;  3KCG L;  2W2M E;  4JZD L;  1IQG L;  3IJE B;  1FAK L;  3HPT A;  1TOZ A;  3EGF A;  2MGP A;  1HAF A;  2VJ3 A;  1IQE L;  5CKM A;  1K36 A;  2KL7 A;  1EPJ A;  2YGO A;  1IGX A;  2RNL A;  2VWO L;  2MGR A;  3KL6 B;  2I9A A;  1G1S A;  1A3P A;  1FSB A;  3BPS E;  3FCS B;  4A7I A;  2WPI E;  3SW2 A;  1PXX A;  2WFT A;  2J38 B;  3V64 C;  1EAI C;  1KIG L;  3TH3 L;  4Y76 B;  1HT5 A;  2P3U A;  2MHP A;  3QCW A;  4BXW A;  4XBM A;  1EQH A;  4Y7A B;  4FM5 A;  5CKQ A;  2YGP A;  4NGA L;  2RHP A;  2XBX L;  4JZE L;  5F1A A;  3LC5 B;  1HCG B;  1XDT R;  2P93 L;  4OTJ A;  3N8W A;  4MMY B;  2XC5 L;  5FDQ A;  2W26 B;  1JL9 A;  3K9X A;  3LTG D;  2WPJ E;  2W3I B;  2W3K B;  1U67 A;  3HS7 A;  2BOX A;  4NG9 L;  1HT8 A;  5JBC E;  2VH0 B;  1J9C L;  4O1Z A;  3KQC L;  4BDX A;  1NFX B;  1FE2 A;  5IKT A;  1IP0 A;  4NA9 L;  3HO3 A;  1IVO C;  1IQK L;  3PGH A;  1L5G B;  1QFK L;  1G2L B;  1XFE A;  1SZB A;  4ZH8 B;  3CA7 A;  3FFG L;  3LIW B; 
#chains in the Genus database with same CATH topology
 3U73 A;  2P95 L;  4M11 A;  2UWL B;  4X8U L;  2FLG A;  1EPG A;  5F19 A;  2Y7Z B;  1IOX A;  4Y6D B;  1DDX A;  1MQ5 L;  2F9B L;  2M74 A;  1HAE A;  2BOH A;  1PRH A;  3NJP C;  1V1I A;  1ADX A;  4JYU L;  5KN5 C;  1IJQ A;  1NT0 A;  4CSY A;  1CEJ A;  1MQ6 L;  1UZJ A;  1NFW B;  2BSF A;  2P28 B;  3KRK A;  2B7D L;  1CQE A;  1URK A;  4LOR A;  1NQL B;  3KQE L;  5KIR A;  3LN1 A;  1LMJ A;  2W86 A;  4JYV L;  3ELA L;  3OLU A;  5JB9 E;  3TGF A;  4YT7 L;  2D1J B;  4BDW A;  1WHF A;  3NTB A;  2ADX A;  2BZ6 L;  3SOQ A;  2Y38 A;  2XBW L;  5JVZ A;  3N8W B;  2G00 L;  1ATB A;  2WYG B;  1LPG A;  4BTU A;  1IOE L;  2BOU A;  1W7X L;  1APO A;  2H9E L;  1Z6E L;  3M37 L;  4M10 A;  2BO2 A;  4BTI A;  3OLT A;  3CS7 L;  2BT7 A;  2BQ7 A;  3N8X A;  3GIS X;  3TBD A;  1OB1 C;  2FLB L;  2Y80 B;  3GCW E;  2VWN L;  1L3Y A;  1WU1 B;  1F7M A;  2FLR L;  2DDU A;  2WPM E;  1IQH L;  4GU4 A;  3HS5 A;  2Y5F L;  1KSN B;  4ZAE B;  1C5M F;  5L30 L;  1COU A;  3HO5 A;  1YUG A;  1HJ7 A;  3SOV A;  2RA0 L;  5IKR A;  2UWP B;  4X8V L;  1CVW L;  1XKA L;  4Y79 B;  2BT8 A;  4X8T L;  4G1M B;  2XC4 L;  4Y71 B;  2WFX B;  4RUT A;  4BTT A;  2EI6 B;  1IQJ L;  3HS6 A;  1U8C B;  1CCV A;  5CIS A;  1EMN A;  1M1X B;  1BF9 A;  1EGF A;  1IQN L;  4LMF A;  3N8Z A;  1G1R A;  3ZYG A;  1FFM A;  1F7E A;  1ATA A;  1O5D L;  5L2Y L;  3H5C B;  2Q1J B;  5IKQ A;  4X8S L;  3CEN L;  3MDL A;  1EPH A;  1NPE B;  1LMM A;  1MOX C;  2WZP P;  1X7A L;  1PGE A;  3NTG A;  2NPR A;  5CKN A;  4ZHA B;  3SOB B;  2BQ6 A;  3KQB L;  1JBU L;  1F0R B;  1ATE A;  1NZI A;  1UZP A;  2WG4 B;  2W2O E;  1EBV A;  3BT1 A;  1KLI L;  2Y5H L;  3M36 L;  1LPK A;  2WG3 C;  1YO8 A;  4MMX B;  5EGM B;  4ISH L;  4Z0K B;  3RR3 A;  4RRY A;  2P16 L;  3P5B L;  1CX2 A;  2VWL L;  2EI7 B;  3TZI A;  1PTH A;  4RRZ A;  3HO4 A;  2J95 B;  1LPZ A;  4Y7B B;  1WHE A;  1V3X B;  2WYJ B;  2AYL A;  2XBV L;  1CVU A;  2XBY L;  1APQ A;  3N8Y B;  1K37 A;  1FAX L;  3ZYJ B;  2Y7X B;  3N8Y A;  3Q7D A;  6COX A;  1HRE A;  4Z6A L;  3TK5 B;  1IGZ A;  2P26 A;  4XL1 A;  3S6X A;  4E1G A;  3NT1 A;  1LK9 A;  1P9J A;  4D0F A;  4MMZ B;  2VH6 B;  5COX A;  2FD6 A;  1DIY A;  1DVA L;  4D90 A;  2HOX A;  2BOK L;  1HRF A;  3QH0 A;  3LAQ A;  1FJS L;  4ZXY L;  2K2T A;  1IQM L;  2P3F L;  4TGF A;  1CCF A;  2WPK E;  2JKH L;  1GK5 A;  4YZU B;  1YUK B;  1EMO A;  2J2U B;  3TK6 B;  1UZK A;  1P0S L;  4CUD A;  3LN0 A;  1IQF L;  4RRW A;  1KLJ L;  1JV2 B;  3ASI A;  4RRX A;  1UZQ A;  3BT2 A;  3V65 B;  4AQT A;  1HX2 A;  3F6U L;  4CUF A;  2Y5G L;  2XC0 L;  3IIT B;  2WPL E;  5JBB E;  2W2P E;  2OYE P;  1AUT L;  2PR3 B;  3MQE A;  5L2Z L;  1EPI A;  1IQI L;  5IKV A;  1RFN B;  5K0H B;  2P3T A;  2PHB B;  2VVC K;  1I0U A;  2I9B A;  5JVY A;  3LC3 B;  2GD4 A;  4XLW A;  2J4I B;  4ZXX L;  1XKB A;  1B9W A;  1G1T A;  5JW1 A;  3U7U G;  1G2M B;  1TPG A;  1YUF A;  4OTY A;  3C9A C;  1Z6C A;  2KB9 A;  3FBY A;  4CUE A;  1PFX L;  4PH9 A;  4O02 B;  2Y82 B;  4C16 A;  3QMO A;  5I46 L;  3ZYI B;  1Q4G A;  4BXS A;  1DX5 I;  2BQW A;  2VWM K;  2K2S B;  5E8D A;  5JBA E;  1N7D A;  3ENS A;  2W2N E;  4ISI L;  1EQG A;  1TLE A;  3F1S B;  3N8V A;  1W8B L;  3CFW A;  1NFU B;  4D0E A;  2P94 L;  2P3F N;  2PUQ L;  2UWO B;  4YT6 L;  2W2Q E;  1HZ8 A;  2EI8 B;  1EZQ B;  4COX A;  2TGF A;  4GU3 A;  1NFY B;  3POY A;  1F0S B;  2VVU L;  2JJL A;  4RS0 A;  2OYU P;  3LTF B;  3KQD L;  1LQD A;  1KKE A;  1YGC L;  1ZAQ A;  1DQB A;  1N1I A;  2CJI B;  5JB8 E;  2FZZ L;  4JZF L;  2J34 B;  2KV4 A;  3KK6 A;  3R05 A;  1ATD A;  1KLO A;  3GCX E;  1FF7 A;  1IQL L;  4Z0L A;  3DEM A;  1G1Q A;  2J94 B;  3Q3K B;  2WPH E;  2Y81 B;  2VVV L;  2BMG A;  3KCG L;  2W2M E;  4JZD L;  1IQG L;  3IJE B;  1FAK L;  3HPT A;  1TOZ A;  3EGF A;  2MGP A;  1HAF A;  2VJ3 A;  1IQE L;  5CKM A;  1K36 A;  2KL7 A;  1EPJ A;  2YGO A;  1IGX A;  2RNL A;  2VWO L;  2MGR A;  2VRS A;  3KL6 B;  2I9A A;  1G1S A;  1A3P A;  1FSB A;  3BPS E;  3FCS B;  4A7I A;  2WPI E;  3SW2 A;  1PXX A;  2WFT A;  2J38 B;  3V64 C;  1EAI C;  1KIG L;  3TH3 L;  4Y76 B;  1HT5 A;  2P3U A;  2MHP A;  3QCW A;  4BXW A;  1QIU A;  1V1H A;  4XBM A;  1EQH A;  4Y7A B;  4FM5 A;  5CKQ A;  2YGP A;  4NGA L;  2RHP A;  2XBX L;  4A94 C;  4JZE L;  5F1A A;  3LC5 B;  2HOR A;  1HCG B;  1XDT R;  2P93 L;  4OTJ A;  3N8W A;  4MMY B;  2XC5 L;  5FDQ A;  2W26 B;  1JL9 A;  3K9X A;  3LTG D;  2WPJ E;  2W3I B;  2W3K B;  1U67 A;  3HS7 A;  2BOX A;  4NG9 L;  1HT8 A;  5JBC E;  2KNI A;  2VH0 B;  1J9C L;  2H9E C;  4O1Z A;  3KQC L;  4BDX A;  1NFX B;  1FE2 A;  5IKT A;  1IP0 A;  4NA9 L;  3HO3 A;  1IVO C;  1IQK L;  3PGH A;  1L5G B;  1QFK L;  1G2L B;  1XFE A;  2YGQ A;  1SZB A;  4ZH8 B;  3CA7 A;  3FFG L;  3LIW B; 
#chains in the Genus database with same CATH homology
 3U73 A;  2P95 L;  4M11 A;  2UWL B;  4X8U L;  2FLG A;  1EPG A;  5F19 A;  2Y7Z B;  1IOX A;  4Y6D B;  1DDX A;  1MQ5 L;  2F9B L;  2M74 A;  1HAE A;  2BOH A;  1PRH A;  3NJP C;  1ADX A;  4JYU L;  5KN5 C;  1IJQ A;  1NT0 A;  4CSY A;  1CEJ A;  1MQ6 L;  1UZJ A;  1NFW B;  2P28 B;  3KRK A;  2B7D L;  1CQE A;  1URK A;  4LOR A;  1NQL B;  3KQE L;  5KIR A;  3LN1 A;  1LMJ A;  2W86 A;  4JYV L;  3ELA L;  3OLU A;  5JB9 E;  3TGF A;  4YT7 L;  2D1J B;  4BDW A;  1WHF A;  3NTB A;  2ADX A;  2BZ6 L;  3SOQ A;  2Y38 A;  2XBW L;  5JVZ A;  3N8W B;  2G00 L;  1ATB A;  2WYG B;  1LPG A;  4BTU A;  1IOE L;  2BOU A;  1W7X L;  1APO A;  2H9E L;  1Z6E L;  3M37 L;  4M10 A;  2BO2 A;  4BTI A;  3OLT A;  3CS7 L;  2BQ7 A;  3N8X A;  3GIS X;  3TBD A;  1OB1 C;  2FLB L;  2Y80 B;  3GCW E;  2VWN L;  1L3Y A;  1WU1 B;  1F7M A;  2FLR L;  2DDU A;  2WPM E;  1IQH L;  3HS5 A;  2Y5F L;  1KSN B;  4ZAE B;  1C5M F;  5L30 L;  1COU A;  3HO5 A;  1YUG A;  1HJ7 A;  3SOV A;  2RA0 L;  5IKR A;  2UWP B;  4X8V L;  1CVW L;  1XKA L;  4Y79 B;  4X8T L;  4G1M B;  2XC4 L;  4Y71 B;  2WFX B;  4RUT A;  4BTT A;  2EI6 B;  1IQJ L;  3HS6 A;  1U8C B;  1CCV A;  5CIS A;  1EMN A;  1M1X B;  1BF9 A;  1EGF A;  1IQN L;  4LMF A;  3N8Z A;  1G1R A;  3ZYG A;  1FFM A;  1F7E A;  1ATA A;  1O5D L;  5L2Y L;  3H5C B;  2Q1J B;  5IKQ A;  4X8S L;  3CEN L;  3MDL A;  1EPH A;  1NPE B;  1LMM A;  1MOX C;  2WZP P;  1X7A L;  1PGE A;  3NTG A;  2NPR A;  5CKN A;  4ZHA B;  3SOB B;  2BQ6 A;  3KQB L;  1JBU L;  1F0R B;  1ATE A;  1NZI A;  1UZP A;  2WG4 B;  2W2O E;  1EBV A;  3BT1 A;  1KLI L;  2Y5H L;  3M36 L;  1LPK A;  2WG3 C;  1YO8 A;  4MMX B;  5EGM B;  4ISH L;  4Z0K B;  3RR3 A;  4RRY A;  2P16 L;  3P5B L;  1CX2 A;  2VWL L;  2EI7 B;  3TZI A;  1PTH A;  4RRZ A;  3HO4 A;  2J95 B;  1LPZ A;  4Y7B B;  1WHE A;  1V3X B;  2WYJ B;  2AYL A;  2XBV L;  1CVU A;  2XBY L;  1APQ A;  3N8Y B;  1K37 A;  1FAX L;  3ZYJ B;  2Y7X B;  3N8Y A;  3Q7D A;  6COX A;  1HRE A;  4Z6A L;  3TK5 B;  1IGZ A;  2P26 A;  4XL1 A;  3S6X A;  4E1G A;  3NT1 A;  1P9J A;  4D0F A;  4MMZ B;  2VH6 B;  5COX A;  2FD6 A;  1DIY A;  1DVA L;  4D90 A;  2BOK L;  1HRF A;  3QH0 A;  3LAQ A;  1FJS L;  4ZXY L;  2K2T A;  1IQM L;  2P3F L;  4TGF A;  1CCF A;  2WPK E;  2JKH L;  1GK5 A;  4YZU B;  1YUK B;  1EMO A;  2J2U B;  3TK6 B;  1UZK A;  1P0S L;  4CUD A;  3LN0 A;  1IQF L;  4RRW A;  1KLJ L;  1JV2 B;  3ASI A;  4RRX A;  1UZQ A;  3BT2 A;  3V65 B;  4AQT A;  1HX2 A;  3F6U L;  4CUF A;  2Y5G L;  2XC0 L;  3IIT B;  2WPL E;  5JBB E;  2W2P E;  2OYE P;  1AUT L;  2PR3 B;  3MQE A;  5L2Z L;  1EPI A;  1IQI L;  5IKV A;  1RFN B;  5K0H B;  2P3T A;  2PHB B;  2VVC K;  1I0U A;  2I9B A;  5JVY A;  3LC3 B;  2GD4 A;  4XLW A;  2J4I B;  4ZXX L;  1XKB A;  1B9W A;  1G1T A;  5JW1 A;  3U7U G;  1G2M B;  1TPG A;  1YUF A;  4OTY A;  3C9A C;  1Z6C A;  2KB9 A;  3FBY A;  4CUE A;  1PFX L;  4PH9 A;  4O02 B;  2Y82 B;  4C16 A;  3QMO A;  5I46 L;  3ZYI B;  1Q4G A;  4BXS A;  1DX5 I;  2BQW A;  2VWM K;  2K2S B;  5E8D A;  5JBA E;  1N7D A;  3ENS A;  2W2N E;  4ISI L;  1EQG A;  1TLE A;  3F1S B;  3N8V A;  1W8B L;  3CFW A;  1NFU B;  4D0E A;  2P94 L;  2P3F N;  2PUQ L;  2UWO B;  4YT6 L;  2W2Q E;  1HZ8 A;  2EI8 B;  1EZQ B;  4COX A;  2TGF A;  1NFY B;  3POY A;  1F0S B;  2VVU L;  4RS0 A;  2OYU P;  3LTF B;  3KQD L;  1LQD A;  1YGC L;  1ZAQ A;  1DQB A;  1N1I A;  2CJI B;  5JB8 E;  2FZZ L;  4JZF L;  2J34 B;  2KV4 A;  3KK6 A;  3R05 A;  1ATD A;  1KLO A;  3GCX E;  1FF7 A;  1IQL L;  4Z0L A;  3DEM A;  1G1Q A;  2J94 B;  3Q3K B;  2WPH E;  2Y81 B;  2VVV L;  2BMG A;  3KCG L;  2W2M E;  4JZD L;  1IQG L;  3IJE B;  1FAK L;  3HPT A;  1TOZ A;  3EGF A;  2MGP A;  1HAF A;  2VJ3 A;  1IQE L;  5CKM A;  1K36 A;  2KL7 A;  1EPJ A;  2YGO A;  1IGX A;  2RNL A;  2VWO L;  2MGR A;  3KL6 B;  2I9A A;  1G1S A;  1A3P A;  1FSB A;  3BPS E;  3FCS B;  4A7I A;  2WPI E;  3SW2 A;  1PXX A;  2WFT A;  2J38 B;  3V64 C;  1EAI C;  1KIG L;  3TH3 L;  4Y76 B;  1HT5 A;  2P3U A;  2MHP A;  3QCW A;  4BXW A;  4XBM A;  1EQH A;  4Y7A B;  4FM5 A;  5CKQ A;  2YGP A;  4NGA L;  2RHP A;  2XBX L;  4A94 C;  4JZE L;  5F1A A;  3LC5 B;  1HCG B;  1XDT R;  2P93 L;  4OTJ A;  3N8W A;  4MMY B;  2XC5 L;  5FDQ A;  2W26 B;  1JL9 A;  3K9X A;  3LTG D;  2WPJ E;  2W3I B;  2W3K B;  1U67 A;  3HS7 A;  2BOX A;  4NG9 L;  1HT8 A;  5JBC E;  2KNI A;  2VH0 B;  1J9C L;  2H9E C;  4O1Z A;  3KQC L;  4BDX A;  1NFX B;  1FE2 A;  5IKT A;  1IP0 A;  4NA9 L;  3HO3 A;  1IVO C;  1IQK L;  3PGH A;  1L5G B;  1QFK L;  1G2L B;  1XFE A;  2YGQ A;  1SZB A;  4ZH8 B;  3CA7 A;  3FFG L;  3LIW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...