1JLAB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
435
structure length
408
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 408
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB03
2XC9A 2OPRA 1FKOB 3OLAA 5KFLA 2AGOA 2FJVA 5KT6A 1IKWB 2JC1A 3CDEA 4O44B 2IM1A 1TL3A 3V81B 2AX1A 4J9PA 5I3UA 3MEDB 2YNIB 3BGRB 1RTHA 4RUCA 3MR2A 4RW8B 3DLEB 2BQ3A 1C0TA 4RW9A 5J2MA 1JLFA 1S1UA 2EC0A 4RW6B 4EYHB 2W9CB 5KFAA 3OL6A 4J9SA 4FS1A 1JLBB 3GYNA 4RZRA 4ED0A 4ZVGA 3DDKA 3JYTA 1JLCA 4WZMA 5KFIA 4IQXA 1HPZA 4J9RA 3IGVA 4ZP6A 3C6UA 4ED7A 1RT3A 1HMVA 1RYSA 2BQRA 4EEYA 4IRDA 2RKIA 3H5YA 3H5XA 4PUOA 2XCPA 4WXWA 4Q0BB 1C2PA 1D0EA 1MU2A 4WYWA 5KFDA 3V6DB 3KJVA 3DRRA 3QLHA 3V4IA 1RTIB 3CVKA 3DLKA 3UPFA 2HNZA 3LALA 3G6YA 2C22A 2UVVA 4ID5B 4LQ9A 2IJFA 1VRUB 5EWEA 2HMIA 3KHRA 3KLGB 5J2PA 3QZ8A 4O3OA 4ECRA 3PW0A 4K4ZA 3M8PB 2DPIA 1SV5A 4QWDA 3KK1B 2XCAA 2AX0A 2IC3B 1LWFA 1T03A 3H2LA 4EBCA 3NAHA 2ZD1B 4JV0A 2B6AA 3RB0A 1S9EA 5J1EB 3H59A 3T5LA 2ZE2A 1JKHA 3RB4A 2UVUA 2C2EA 4F4XA 3T5JA 4H4MA 4RNOA 2HNDB 3E01A 1S97A 1LW2A 2W9AA 3KLIA 4K4WA 5DQGA 4O4RA 5HBMB 4EO6A 1JLGA 5KFEA 4IRCA 1JLQA 4NLWA 2V4RA 1C0UB 3RAXA 3H98A 2VA2A 2IMWP 2IJNA 5J2NA 4O4GA 3IS9B 5FDLA 4WFZA 3E51A 4MH8A 4G1QB 3NKYA 1TKXA 4IFYB 4IKAA 1LWCB 4JV2A 5KFSA 2OPQB 5I42A 4Y2AA 4J9OA 3RB6A 4XPCA 4K4YA 1N6QA 4X2BA 2ASLA 2R2SA 1RT7A 2I5JB 1IKWA 4KKOB 1BQNB 3UQSA 2JEJA 1TKZB 5KG5A 4YP3A 4K50A 2FVSA 1RT2A 3BSAA 2WONB 3MEDA 3MEEA 1S1XB 1RA6A 3I5BA 1S1TA 4O3PA 1EP4B 5DQIA 5L1IA 4WXOA 4MK8A 3QIPB 3GIJA 2JEFA 3HVWA 4IG3B 3Q8RB 3GIMA 4J9MA 2OH2A 4Q8EA 3MECB 2XI3A 3RAQA 4TN2A 3V6HA 2BE2A 2AGQA 1C1BA 3DOKB 2WOMB 4YR2A 1JLBA 2HNYA 1SH0A 4ZHRA 3CJ2A 5KG2A 2YNGB 4KV8B 3DYAB 3I5CA 3KLFB 5KFJA 4LSNB 4WFXA 5K14A 2ZKUA 4KAIA 1T05A 1YVFA 5KFVA 3BSOA 3PW2A 1DTQB 4M95A 1RT4A 3QGHA 4ZP9A 4DL3A 2GIRA 5EUHA 2VG6B 1DTTB 5KT2A 4EO8A 1HARA 5DGAA 4NRUA 1S9GA 1QAJA 1CSJA 4ED3A 1RT6B 5J2QA 4IR9A 3LP0A 5F8MA 1RTIA 3HVTB 4RU9A 3LAKA 5EDWA 1S6QA 4MIBA 3OL7A 3DMJB 4IG0B 3MEGA 3KLVA 2R8IA 1DLOB 1OS5A 2B43A 3BJYA 4DL5A 4KHRA 4DL4A 5DG8A 5DLFA 4RW7B 5HP1B 2W9BA 3LAMA 4WFYA 4ED6A 3ISND 2D3UA 3QYYA 2JLEA 3FRZA 2ZD1A 1C1CA 1IKXB 2YNFB 1S6PB 3ITHB 4O3QA 5KFMA 5KT7A 3FFIB 5KFRA 2ILYA 4PWDB 3IG1A 4I2PB 4JUZA 1RT5A 1XR7A 2VG7B 4URQU 3TAMB 2AGPA 4TY8A 1LWEB 1XR6A 4RW4A 3H4BA 4ECSA 3EPGA 5C25A 3M8QB 4PQUA 4R0EA 1BQMA 1EETA 1C0UA 2VG5B 5KFFA 2RDIA 3LP1B 3G6XA 2YKNB 1RTJA 2WCXA 4DL6A 1RTDB 5L9XA 4YMEA 3DRPB 4TY9A 4MFBA 1LWCA 1S4FA 2J6TA 5C42B 4ZPDA 4ZMMA 1HYSB 1GX6A 3FSIA 1T3NA 2FVRA 4B3OB 4KKOA 3RBEA 1S1VA 2WHOA 4NLUA 2V9WA 1HNVB 4MKAA 1JLEA 5KFKA 4Q45A 4IDKB 1JXLA 1QE1B 5KFXA 4KO0B 2AWZA 3CJ4A 2GIQA 3KHLA 2OPPA 3KOAA 3QGIA 3MTKA 5C24A 4H54A 1FK9B 1NNDA 1JX4A 2IBKA 3CJ0A 1K1QA 2B5JB 3I0SB 1J5OB 3CIZA 1IKVB 5C5JA 4MK7A 4WYLA 4URGA 4KV8A 3NBPA 4OL8A 4DG1B 1RT1A 4LSNA 5D3GB 5CYMA 4I2QA 1S1WA 1N5YB 3N6MA 3MR3A 3D5MA 3QO9B 3CDUA 5HLFB 1N4LA 3JSMB 4NLTA 5KFWA 4URSA 1K1SA 1DTQA 1HQUB 4MIAA 2JEGA 3DLGA 4H4OA 2VG6A 2UUWA 3M9OB 3DRSB 4WE1A 3IN5A 5KT4A 3M9NB 4NLPA 5KG4A 1R0AA 5DGBA 4IFVA 4Q43A 4QWCA 1TVRB 4ICLA 3KK2B 3KLEB 2R2UA 4IR1A 4F4ZA 3DMJA 4IG0A 2FVPA 3LANA 1S48A 4NYZA 2YNHA 4QWBA 1HQEB 3T5KA 3Q8PB 3QIDA 2W8KA 4GC7A 3H4DA 4RW7A 3CWJA 3DI6B 3IRXA 3I0RA 4J9LA 2FLPA 4O3RA 1TV6A 5T14A 4RNFA 4EYIB 3DOLB 3MR5A 5DG7A 1FKPB 3PW4A 3KK3B 2O5DA 3ITHA 1KHWA 4ZP7A 4WZQA 3BSCA 5KFBA 1HNIB 2BRLA 2BANB 3Q8SB 4I2PA 4IH6A 2FLLA 1REVA 3C6TB 3TAMA 4ECXA 2QE5A 4R8UA 5F9NA 2YKMB 2JC0A 1FKOA 4RNNA 5EWGA 2RF2B 3MR6A 3M8QA 3T5HA 2BQUA 3V6JA 1GX5A 4O44A 3OHAA 3H5SA 4KHMA 2HWIA 4NCGB 3V81A 3N6NA 3OL8A 3OSNA 2YNIA 4ZPBA 3BGRA 4ZVEA 3PJXA 2YKNA 4TXSA 4RW8A 3DLEA 5KFNA 4ECQA 3OSPA 2OPSB 4EBDA 4RW6A 5F8NA 1TL3B 1RAJA 2W9CA 3PZPA 5I3UB 4IOBA 1HYSA 1RTHB 4KE5A 2XWYA 4QWEA 1C0TB 5J2MB 4ZVFA 1JLFB 2XGPA 1S1UB 2QV6A 4MKBA 4QW9A 2IA6A 1QE1A 5EWFA 2W7PA 4XO0A 4U7CA 3DM2B 3T19A 5HROB 5KT3A 4R8UB 3MFHA 4J9QA 2ALZA 1S0NA 3HVAA 3EPIA 3VQSA 3BREA 5KFUA 2B5JA 1S10A 3JYTB 2DPJA 3ISNC 2R8JA 1IKVA 3NL0A 4Q0BA 2XGQA 1UWBB 3V6DA 4RNMA 1S0MA 2R8GA 1RT3B 1HMVB 2IM2A 3GQCA 2RKIB 1TP7A 3NMAA 2VA3A 4ID5A 2UVRA 2IM3A 4MK9A 1MU2B 1VRUA 4ECTA 4TQRA 3KLGA 3KJVB 3QLHB 3V4IB 3M8PA 4RNHA 3KMSA 3DLKB 3DRSA 3GV8B 3G6VA 2ASDA 3KK1A 1TL1B 2IAJB 1W25A 3HKWA 5F8HA 1N56A 2IC3A 3KHGA 4KBIA 1D1UA 4TYBA 5J1EA 3KK2A 4HYKA 4F50A 1LWFB 2HNDA 3RBDA 2B6AB 4YR3A 1S9EB 3GIKA 3FQKA 3V6KA 2ASJA 1JKHB 5HBMA 4Q8FA 1IKYB 4K4TA 4H4MB 5KFPA 3E01B 4JV1A 1U09A 2R8HA 3KLIB 1HNIA 5JXSA 4K4VA 3LP2B 4ECVA 3IS9A 4EBEA 4FS2A 1LW0B 1JLGB 4G1QA 2BRKA 4IFYA 1JLQB 4J9KA 4TYAA 3H40A 2OPQA 4LQ3A 4R5PB 4O4GB 2I5JA 5FDLB 1QAIA 4YR0A 4KFBB 1BQNA 4FBTA 1TKXB 1TKZA 3BSNA 2AQ4A 4ZPCA 5F8LA 2WONA 5I42B 5KFZA 1S1XA 4F4WA 1MMLA 1EP4A 1N6QB 2I1RA 1KLMB 3CDWA 4K4UA 1RT7B 3QIPA 4IG3A 4IH5A 4U6PA 2OPSA 5DLGA 3M9MB 3MECA 3FQLA 3DOKA 1RT2B 2WOMA 4LSLB 3MEEB 4FBUA 3PW7A 1S1TB 4Q44A 2E9TA 2YNGA 3PR5B 3TQ1A 2V4QA 3DYAA 2ATLA 3KLFA 5KFGA 1TKTB 2BE2B 1C1BB 3G86A 1S49A 2HNYB 3DM2A 4I7FB 5HROA 4ZHRB 1JIHA 3SFGA 2C28A 2WK4A 4Y2CA 4NLOA 1ZETA 1SUQB 2GC8A 3QZ7A 1DTTA 2HWHA 3KMQA 4ECUA 2W7OA 4G3IA 5K14B 1JLAB 1T05B 3UDLA 1RT6A 5F9LA 1UWBA 1RDRA 1RT4B 2R2TA 3HVTA 3Q8QB 3CJ5A 5F8GA 1Z4UA 1S9GB 2FVCA 2FJWA 1DLOA 5J2QB 4TLRA 4DEZA 3LP0B 3BQ0A 2E9ZA 2BR0A 4KB7A 5HP1A 1WNEA 5KFYA 1S6QB 4ECWA 3PR4A 2UUTA 1TL1A 2IAJA 3MEGB 4NLDA 4M94A 2J6UA 2YNFA 1IKXA 5CYQB 1S6PA 3PJWA 4DL2A 2J6SA 3D28A 3QGGA 3FFIA 2ILZA 2W9BB 4PWDA 3OL9A 5JUMA 4Y34A 3OLBA 3CJ3A 2WB4A 3T1AA 2VG7A 1ZTTA 1LWEA 1VRTB 3KLHB 4J9NA 1C1CB 4K4SA 2CKWA 5KT5A 3IG1B 3PVXA 1IKYA 2D3ZA 1RT5B 4NLVA 2VG5A 2FVQA 5KFHA 4ECYA 3LP1A 3NAIA 4TY8B 4RW4B 2OPRB 1TQLA 4O3NA 3LP2A 3PHEA 4ZPAA 5L1LA 5L1JA 1S0OA 1LW0A 5C25B 4PQUB 1RTDA 1I6JA 1BQMB 3DRPA 4NLYA 1EETB 5C42A 3KHHA 4ED8A 4GC6A 4HKQA 2V0NA 5KFQA 1S9FA 4R5PA 1RTJB 3N6LA 4KFBA 4B3OA 4RW9B 3GILA 1HNVA 4MFBB 1NHVA 3MFIA 4IDKA 1XR5A 3GV5B 4F4YA 4ED1A 4KO0A 5KG0A 1KLMA 2R2RA 1S1VB 1FK9A 4TQSA 1JLEB 2F8EX 3I0SA 4LSLA 5KG6A 1J5OA 1JLCB 1IM4A 3SI8A 1RYRA 2FLNA 4NLGA 2OPPB 1HPZB 3BR9A 4QW8A 2RDJA 5L1KA 4ECZA 4ED2A 5C24B 4DG1A 3TVKA 3C6UB 1TKTA 5D3GA 5KG1A 2D41A 5KFTA 3MF5A 1N5YA 3KNAA 4I7FA 4PUOB 3CO9A 3QO9A 4NLSA 5HLFA 3RB3A 3JSMA 1HQUA 4IH7A 3NBPB 1SH3A 1SUQA 4QWAA 1RT1B 3DRRB 2UVWA 5CYMB 4I2QB 1S1WB 4K4XA 5KFOA 4XPEA 2HNZB 2D7SA 1JLAA 3PW5A 2WTFA 3NGDA 4NLXA 2CJQA 2HMIB 2HAIA 2W8LA 5J2PB 3DLGB 4H4OB 1TVRA 1RA7A 3EZUA 3I5AA 1SV5B 2WRMA 4DL7A 3FDSA 4WE1B 3KLEA 3BQ2A 4QPXA 5F8JA 1R0AB 1KHVA 3GV7B 1HQEA 4IFVB 5KG3A 1T03B 4NRTA 2C2RA 4ZP8A 4ICLB 3DI6A 4RUAA 1NHUA 2R8KA 4NZ0A 5DG9A 1N48A 3H5UA 2ZE2B 5DQHA 2C2DA 3DOLA 4Y3CA 4IRKA 1FKPA 2YNHB 3KK3A 4YQWA 4O3SA 5CYQA 2XI2A 1LW2B 4KSEB 2FJXA 2E9RX 4ZVHA 3IRXB 2JEIA 2BANA 3I0RB 3SFUA 5KFCA 1TV6B 5KG7A 3IGNA 3C6TA 1QUVA 3GIIA 3OHBA 2AU0A 2IM0A 1VRTA 3KLHA 2YKMA 3ICLA 4NLQA 3UR0A 1SH2A 5F8IA 1T94A 5J2NB 1ZTWA 2RF2A 3HHKA 3BQ1A 1REVB 4NLRA 4NCGA
chains in the Genus database with same CATH superfamily
2FJVA 2UZAA 2IHR1 5GAEU 4RW8B 1AFJA 3RW6A 2JOQA 1M1KT 2LLZA 2BE7D 3R5AA 2RQCA 2LA6A 3ULHA 1DY3A 2R7QA 1HLWA 4M1KA 1CULB 4QIEA 3J7A1 4DV1J 2XCPA 4CLFA 3RR7A 1MU2A 1R0BG 3DRRA 2K3IA 2CVEA 2BX6A 2O1PA 2W01A 4K5SA 3KLGB 2GZOA 2XCAA 1TK8A 4EBCA 4DBQA 4JV0A 1WORA 2ZE2A 1W7WA 2CXEA 1JNRB 2HNDB 3GMGA 2VBYA 2F5GA 3AH6A 1UA0A 3V2UC 2OI2A 1C0UB 3VAGA 2UUAJ 3FBEA 4O4GA 3I96A 4IFYB 3K57A 2CJBA 4J9OA 3AA9A 4ZLLA 1T7PA 2HBYB 1RU2A 1WC4A 4N8NA 3GIMA 1FNOA 1XEZA 4TU9A 4DSFA 3OD2A 1OSDA 2WSCC 4USWA 2M9KA 1IUJA 2KO1A 1HNWF 2RVJA 3NMRA 4DI6A 4CLUA 5LXYA 5J1PA 3HVTB 1QUPA 4LF7J 2HHHF 3KLVA 2J7UA 1N36J 2MSTA 4FYWB 5HP1B 1B3TA 2F4FA 3QYYA 1C1CA 2EBEA 2RMLA 2UUCF 4QIFA 2YBVA 2DJWA 4K5RA 1EETA 5KFFA 2MKHA 2YKNB 1R3NA 1WKKA 3Q2TC 1TL4A 1S7HA 1S1VA 3C66A 4DSJA 2F4VJ 1K47A 3LW5C 2R7VA 3CJ4A 3KHLA 2MY8A 2VICA 5LM7E 3VF0B 1X5PA 1S12A 1YKWA 2HGLA 1NK7A 3NBPA 1DJ0A 2ADBA 2F63A 2VG6A 2KVQE 1H3DA 1R8HA 3F56A 4KH1B 2R2UA 3KLEB 2FVPA 5HO4A 4GC7A 4RW7A 2CIMA 1NRKA 1JXVA 4UF4A 1N5SA 5DG7A 3BM7A 1XIQA 4WZQA 1VBKA 2VKRA 1FXDA 2MEWA 3R5CA 3UN2A 4ECQA 4ZLPA 2EKYA 1HWLA 2YX1A 3QJJA 2AW0A 2FQQB 3PZPA 2MXYA 1KQFB 1VOMA 4HR2A 3DOMA 1FX2A 1PYSB 1GFWB 1S0MA 1HMVB 1A6LA 2FUG9 3HMJG 1TL1B 4BC9A 2L9NA 1FFGB 1RE1B 4P73A 2UV8A 1FCAA 2RRAA 4CO1A 2HRUA 3HT3A 3GIRA 2M2BA 3T6JA 2CPJA 2PE8A 3IXQA 4X4TA 4K4VA 2DH8A 4LT6A 4LF9J 3IS9A 2K8GA 4FS2A 4CT9A 3CCES 4ZS6A 2FZGB 2E7XA 4YS2A 4OYPA 4F4WA 2HG4A 1RT7B 2A3JA 4NCAA 4LSLB 2ZBPA 4FBUA 3LGHA 2PFDA 1TKTB 6FDRA 4BC7A 4ZCIA 4G3IA 2W7OA 2FGOA 1VR6A 1T05B 3UDLA 1UWBA 5CCLA 1Y3JA 4UQGA 1Z4UA 3PEHA 3H25A 2DY9A 4FXWA 3D28A 3QGGA 2PGCA 4UUXA 3CJ3A 4B9MA 3BH6B 1W2BR 4DQPA 1XNQF 4EMDA 4TY8B 2B7CB 4I1TA 4FPIA 4NLYA 1IR2A 2EG2A 1S9FA 1SJ1A 1N34J 3GV5B 1XR5A 2NXEA 1X5TA 1NXIA 2LYVA 3KNAA 2M5YA 3JSMA 2A18A 1FRKA 1UWAA 3X3UA 2ERRA 3MD3A 4ICLB 4XK8C 2XY6A 2CNOB 5A6PA 3AOCA 3IP0A 3P4UB 4KSEB 4ALZA 2BANA 3IGNA 1SJQA 4AYBD 5GAGI 3HHEA 2YKAA 1ZTWA 2GVZA 1WHXA 3BN7A 5HQ8A 4EBDA 4CLWA 1Q4RA 2V5HG 3PIOQ 1NJIT 3AOBA 1RTHA 3MR2A 3DLEB 1SC1B 1S1UA 2ZM6J 4P2MA 4FZVA 2B9WA 3FCVA 1HPZA 2ZVIA 1S7IA 2QJ3A 4ED7A 1RYSA 1HHQA 3R5JB 4OX8A 3UPFA 3CXCR 3Q8VA 2CPEA 5ETSA 1RBLA 3VAKA 4DCOB 1SV5A 2RS8A 5D0HA 1LWFA 1T9TA 2FD2A 4MMOA 1HI8A 3EGZA 1R8PA 1LW2A 1PO6A 2R7RA 3WX4A 3BGLA 2O01C 5LMNJ 1VQKS 1LWCB 4JV2A 2DR7A 4QCLA 2AP6A 1XQIA 3MMJA 4C48A 3V6HA 2EK6A 3NCPA 2B3TB 1X4DA 4F67A 4U95A 4DWIA 1RU1A 1SC3B 3VV2B 1SKSA 4LSNB 1YVFA 1DTQB 5EUHA 1RAOA 3MMBA 4ZVPB 3MHYA 1ZAWA 1KKHA 3CCTA 3EXCX 1RT6B 3LP0A 1B4SA 2W2NP 5F8MA 4WPAA 2R7TA 3E2EA 3ZZZA 5A76A 3JB9k 1CS4A 2IRXA 2MQOA 4QOTA 1RWVB 4O3QA 1H98A 2IBOA 1N52B 2VASA 2VPYB 3W5XA 3K59A 5C25A 3CPWR 2C3YA 3TI0A 4JI7J 4ELTA 1JJCB 1VRQC 2QMWA 2IRYA 3QT8A 3OVSA 1RWXB 3KUGA 1HNZF 2CWKA 4NZ6A 3MTKA 1CJKA 4WK1A 3I0SB 3R2CJ 1VBXA 4DG1B 4DS5A 1FI4A 3EJMA 4I2QA 2A2DA 2EWHA 2UUWA 3HJFA 2QL9B 3M9NB 2GNKA 4NLPA 1OJ4A 1K73T 1R31A 4IG0A 3IRXA 1WG5A 3CJ8A 1I3OB 2ZFHA 4ZJLA 2J8SA 4I2PA 1YRTA 5F9NA 2WW4A 3OFEA 1VQ7S 5A0YA 2Z2ZA 3N6NA 3OL8A 3DGVA 1GXLA 1I1GA 1RADB 4UY8T 5F8NA 1RAJA 2H5EA 3GG1A 2W9CA 2CPZA 1H72C 3I82A 4HLBA 2DGOA 4FP9A 5J2MB 4GRSA 3HSZA 1Z2ZA 3B54A 1S76D 2EVZA 1Q95G 1Y11A 4NASA 2BUNA 5BJRA 5HMZA 4XAKA 1VRUA 5CD4H 1HNXF 3WIUA 2ASDA 3HKWA 5AE3A 2IC3A 1FF2A 4M5DA 4JI5F 3MOZA 3IMQJ 4HT5A 3QSIA 2PC6A 4DV0F 4P9SA 1AROP 4NYOA 1EHWA 2DK2A 1IKYB 3OBIA 2NZCA 4BHQA 2E5JA 2UV8G 4FXVA 4BBYA 4X66J 4CTAA 2KFNA 3W2WA 2FC8A 5DETA 3H40A 5FDLB 3BSNA 5F8LA 3LGMA 5I42B 5KFZA 4G1IA 3AJ2A 2DGTA 5DLGA 2UU9F 1CQNA 1FO1A 3DYAA 2D1CA 1YLXA 4DX8H 4DFPA 4FKYA 2C28A 1KSPA 2JLGA 1DTTA 4X64F 2V6AA 1RT4B 5M2RA 1KVKA 1B7FA 5HJXA 4X4OA 3SCLE 1WNEA 5KFYA 4ECWA 3MEGB 5CZXA 4G1PA 4NWBA 5KAKA 1UKUA 4ZN3A 1NM2A 1NJYA 2UXBF 4UZBA 1NK5A 3DGPB 3HLUA 4OJ3A 5BYSA 1R89A 1LK7A 4OYXA 2DNLA 2ZUAA 4WJBA 1WDTA 3QWPA 4ZPWR 3QT7A 4NLGA 1UEKA 1HWIA 3C6UB 2D41A 1HQUA 4IH7A 1R6VA 1F5AA 5H1SV 5CQGA 1SL1A 3K58A 1RCXB 4OI0A 4WE1B 3FUYA 3PX0A 3IFEA 1BY9A 4EK2A 1KFSA 1X9WA 2MZJA 4PWWA 3HZEA 3KK3A 2QA2A 1UVKA 1YK9A 5HSPA 2IM0A 3SQGA 1YWXA 2V8HA 1T94A 4R8UB 1PAEX 2OPRA 2V63A 4DFJA 3MM5B 3IBFB 3F73A 4J9PA 3NOGA 2FGCA 1G3OA 4L72B 4NI2B 4ZVGA 3MAAA 3N28A 4ATNA 4EFAC 1NSKL 4N56A 2HZCA 3G82A 4DL0C 2E44A 1HFEL 2Q6CA 2V2KA 5IWAF 4DR6J 4B08A 1HWJA 2ABYA 4ZOSA 2RAQA 1MROB 4PKDB 1U0SA 1N36F 3D9BA 4OZ5A 4RNOA 2C3OA 4ER8A 1S97A 4WP8A 3I56S 3CC7S 3KLIA 4M63A 1FDBA 1N5VA 2DCUB 1FNMA 4B3SJ 1RAFB 2AJ0A 3RR8A 2NPIA 4DFMA 4YOEA 3RB6A 1Q53A 2FVSA 1RT2A 1S1XB 1EP4B 2C2MB 1NJZA 1UTAA 2BE2A 4YR2A 2F4VF 3NY0A 1F60B 1GQEA 3RRKA 4NMXA 2JDJA 3GFZA 4DX7A 3HX9A 1LFWA 1WI8A 1CJTA 2FJBB 2W9BA 2XS7A 1MWYA 4DU8A 2D3UA 5D77A 1P9QC 4OZNA 2W2MP 1V5VA 1RWMB 1NH8A 3C8YA 3BO2A 1Q8LA 2J9CA 2W24A 1C0UA 1TK5A 3KUEA 4OHWA 3LA0A 4CLSA 2G2OA 4MFBA 1S4FA 5LT5A 2VONA 4B3OB 4KO0B 2E5GA 2RHQB 1SIZA 2HZAA 1FTRA 1XBWA 4C2MA 3CCLS 4DZ6A 5AXLA 3D1QA 2WSFC 4URGA 4HI1A 4MYUA 1FVQA 1WELA 3CDUA 2BZ2A 1LXNA 2CAJA 1NZ8A 3DN9A 4V19X 1YJ7A 2HURA 5KT4A 1JMTA 2ASYA 1S48A 4M5KA 2LP4A 4QWBA 2Z57B 3UNYA 3PEJA 2Q6BA 1QTMA 4QZVB 1TV6A 4RNFA 2K7JA 2VJUA 1REVA 3S8SA 3R5DA 3OHAA 3UN5A 1TL7B 3PJXA 2YKNA 2MTLA 2I0XA 5GAGU 2W7PA 1WEXA 3DM2B 4RU2A 4C8OA 2DPJA 4RNMA 1GXUA 3DFEA 4Y2MA 4RNHA 5GADI 3HZGA 3KK1A 1QD1A 1W25A 5F8HA 2ZDPA 2FJEB 1N0VC 3SIPB 1HI1A 2CADA 2HRYA 4GKKJ 3AAWB 2ZHAA 5E5NA 2XYPB 1QJHA 5IV3A 2N3LA 2R8HA 1BGXT 2HHWA 3K17A 3JXOA 4I56A 4UTGA 4YR0A 5MAOA 3GLJA 1NB2A 3MMAB 1IBMF 3BBFA 3QIPA 5AXKA 4CH7A 2QA4S 1CQMA 4DV3F 2UXDF 2WB1D 4DUZJ 4I7FB 1NUEA 4ZHRB 1JIHA 4LRFA 5K14B 4DLGA 1PIEA 2EKNA 3PCOB 1IWAA 3CJ5A 2DEJA 2E9ZA 1TL1A 2QG9B 4MKVA 2OO4A 3PJWA 1S6OA 3VAJA 2WB4A 1ZTTA 1B99A 3CB4A 1KN6A 3PKYA 5KOWA 2X3GA 4ILMA 3ELHA 2WSEC 4O3NA 4ZPAA 1FTCA 3OTOF 1YRUA 4FN5A 2HVIA 4RW9B 5FIIA 3VZIA 2Q79A 2XZTB 3BS9A 3W8PA 4LFCJ 2R2RA 5GAHI 2RU3A 1JLEB 2F8EX 4LSLA 1M5SA 5B0FA 5DRKA 1RYRA 4QW8A 5C24B 1TKTA 5KFTA 3EM1A 3AQOA 2HVZA 4J7CA 2WTFA 2V8VA 3X1LB 5J2PB 4FYYB 2NS1B 4DL7A 2R3VA 3MM9A 5DO2A 4ZCLA 4CYUB 2HZVA 1IVZA 1FKPA 2BJ8A 1FRMA 4LVNP 4A47A 3M8YA 4UUWA 2JZ5A 1U4BA 4KR0B 1REGX 4ED5A 5BXIA 3FCWA 1FKOB 1F5BA 3V81B 4NX9A 5MLCV 3BO4A 1RXOB 3ET6A 3ZXWA 5KFAA 4Y2IA 2VIHA 4CCHA 1YRXA 5AE1A 2IVYA 1V3RA 5A8KB 4RPFA 2CRLA 3M2UB 5L39A 1MWQA 4DR5F 4WXWA 3ZC4A 4AUKA 4B9LA 3G6YA 2C22A 2M88A 1VQ4S 5JVHQ 1MNEA 3DRXA 2ZOMA 3PRBA 4DR2J 2HHQA 2VA2A 3H98A 4C11A 5B0BA 1FHTA 2U2FA 2DNGA 1N33F 4G1QB 2XO6A 1XNRF 3OXLA 3PYDA 2DISA 3CCSS 1CLFA 1PYTA 4YP3A 4X4PA 2JEFA 2AT1B 3Q8RB 1K8AT 1C1BA 4X65F 1YITS 3FRYA 3AB2B 2WVFA 3KLFB 3TX8A 3L09A 2ZJRQ 2MZ1A 2VOOA 1S6QA 2R8IA 1SL2A 3PNIA 4IQMA 4ED6A 2VFVA 3C46A 2IPOB 3GYXB 2HHPA 3AXKA 4ZLJA 1HKAA 2QL5B 2VG7B 2HQIA 5J1NA 1LWEB 3HDSA 3U7JA 3UVJB 3H4BA 3G8TA 5DM7Q 3AJDA 4OI3A 4M5MA 2KG1A 2LQ5A 4LR8A 3SSQA 1LWCA 2XO7A 3TZZA 4ZMMA 3NOCA 3RBEA 3HCXA 3TAPA 3AB4B 1HNVB 3T1YF 4OYZA 2DVIA 2GIQA 3BBCA 3ZZTA 1NK6A 3VTIA 2Q3PA 2J0XA 4OMFG 1J5OB 4WYLA 4OL8A 4LSNA 3R27A 3MR3A 1HD0A 2H9ZA 4NLTA 1DTQA 5FD1A 4H4OA 3Q24A 3W8GA 2ZH1A 2BJ7A 4I0WA 4DOZA 2LA4A 2LEBA 3Q8PB 3TWZA 3CWJA 3DI6B 2ZBQA 2ZWOA 5AJ3F 2NYIA 1WSRA 1WF0A 4U7UD 5K8PA 4HDGA 1RBAA 1OQ6A 2IIHA 2OEKA 2IDEA 3CCJS 2RUSA 3OTBA 3GWCA 3K89A 2YH0A 1NDPA 2QGFB 3U1LA 1S0NA 2QC3A 3SSRA 1FRIA 2Z2MA 1S10A 1NEEA 1YJNS 3M6VA 1V3ZA 5IT4A 2JLFA 2RQMA 4F0MA 3G87A 4USMA 1Q1KA 2IM3A 4ECTA 1D9DA 1IBLJ 3G6VA 3MD1A 3TQEA 2FJAB 4KBIA 3M30B 4HYKA 2I9SA 4KGVB 1T8EA 1A9NB 2GO8A 2YQ1A 3OPKA 2EK1A 2BRKA 3T1HJ 1F9FA 2GJFA 2OIHA 3PO5A 4KFBB 3A12A 3UFCX 1MMLA 2CWXA 2D3OR 4FYVB 2XULA 2WAQD 4USTA 1M1GA 4JBCA 4JV5F 3SQOP 2ATLA 2E1RA 3QRQA 2QSFA 4A8KA 1JWWA 1E6VA 3QZ7A 1VLYA 3D6FB 5IQQA 2FZKB 4J90A 4S0MA 4X4RA 1VK8A 3C15B 4Y6IA 5J2QB 4HT7A 3ENWA 1WJ9A 3W5YA 2UUTA 3PR4A 1UPMB 2GVDB 4OHYA 3BF4A 3Q89A 3FFIA 4Y34A 2VKZG 3C16B 1VRTB 2HQFA 3QGPA 2ZH4A 1IKYA 1RTDA 1I6JA 1FRJA 1MG7A 4TU8A 3KHHA 5B7WA 1EQMA 2HBZB 2WBRA 1RAEB 2FLNA 1IM4A 4ECZA 1QY7A 3MF5A 3POTB 1N5YA 3QFHA 1RK8A 4F0HA 1HBMA 3TJ9A 4P6QA 1VQ9S 2HNZB 4NLXA 4C8KA 3I5AA 2WRMA 4QYZJ 4QPXA 1TFYA 5F8JA 4NRTA 2DGVA 2QYGA 3PJ9A 4DSLA 4DUYJ 1GMWA 3ZZUA 2ZH3A 1VC5A 3R7SB 2MLXA 2MGZB 4P10A 2A6OA 2AU0A 3CCQS 2MKJA 2R7OA 3CDBA 2RQ4A 1M1HA 5HQMA 1LV5A 4NLRA 4QR1A 1TZ0A 5H9EK 5K8OA 2R7SA 1IKWB 1VS3A 3M2RA 4RUCA 3CJKB 4A8WA 2XYHB 1FESA 5GMDA 1UJ4A 3BO3A 3TYTA 4WZMA 1N32F 4I64A 2OTJS 3C6UA 3THVA 5IZHA 5A6WA 4A48A 3V4IA 1HW9A 2XLKA 4PQAA 4WIIA 5T7LB 2Y1LB 3QZ8A 4F2SA 2AHOB 5JVGQ 3MCSA 1S59A 3OJUA 2LXFA 2JX2A 2DRDA 1JKHA 3T5JA 2E1MC 1B0TA 5HBMB 2NYHA 1HBNA 5GADU 2IJNA 4FDFA 4CM0A 2NPFA 4X4UA 4Y2AA 4X4SA 3B8HA 2WVEA 6AT1B 1C4AA 3MEEA 3I5BA 5DQIA 4RJVA 2YKPA 1ZBTA 2ZUGA 2GV1A 3CJ2A 2LDIA 2E1AA 3VAHA 5DZ6A 3J7Z5 3DLHA 1GAOA 3GONA 1Z1ZA 3WC2A 2NXJA 2G1HA 2MZTA 1QAJA 4NL5A 4IR9A 4DR4F 2KKHA 4MIBA 2W2OP 4UOFA 3PX6A 5DLFA 2CQBA 4LF6F 1KRPA 1I94J 4YY3J 4B3RF 3FSYA 4CP5A 4PG5A 1VI7A 4QYZK 4A8XA 2GHWA 1B0VA 3KKFA 3OXGA 4JI8F 1LXJA 3N0VA 4DDFA 1F3FA 1PCAA 3UW1A 2IBKA 2QYCA 1IKVB 1RT1A 3DU5A 1RLCL 2PSZA 1T0TV 4KGZB 5GAHU 2JJ4D 5DGBA 2DGWA 3LOUA 1PGZA 2XMUA 4OHXA 1HQEB 3QIDA 4O3RA 4DV6F 3TO8A 3BSCA 1HNIB 3Q8SB 4DQRA 2GHPA 1HIYA 2L08A 3BKTA 1MW7A 5EWGA 3T5HA 2PA8D 3BH7B 1R8BA 4O44A 2ZH6A 1L3TA 3CTRA 3BGRA 3M8RA 4CNZA 1Q81T 5CHCB 5CXTA 2J9DA 2QV6A 3PXGa 3QRPA 4YDDB 2VJVA 1Q7YT 2NZ4A 1S4EA 5IT9U 2UUBJ 1MU2B 5ETOA 5LXRA 5G0RA 5DJBA 3ZNJ1 1FJGJ 2MJNA 4C97A 5BYRA 2KM8C 1FNXH 4DR3J 1RAGB 2MQLA 3RW7A 4ECVA 3W62A 3M1VA 2XMKA 3M05A 4O4GB 1QAIA 2M4MA 3JQJA 4LF1A 1TL7A 2GMLA 4ZN1A 3A1YG 1XMQF 2FC9A 2BJEA 2WZ1A 2V4QA 1D8YA 3DM2A 4PG4A 3KMQA 3CMAS 2BYCA 2EEYA 2HFSA 1AB8A 2W25A 1ZM3A 3Q8QB 5LOQA 3M6UA 4L75A 2P9CA 1YI2S 4M94A 2HQ3A 3GG0A 2G9OA 2J6SA 3T6BA 4OZ2A 1C1CB 2MZRA 4PXCA 1RHRB 1B0PA 3QQCD 4ZVUB 4B3MF 1EETB 4FYDA 1DQ9A 1VDHA 2KDOA 1S1VB 5LJ5Y 1PKUA 5HQLA 2YWHA 2E29A 2A6MA 4AQYF 4I7FA 3RB3A 4DQQA 3NBPB 1N5TA 1KS2A 1RWWB 1U26A 1VQYA 2W8LA 2GX8A 3EICA 3EZUA 3DNCA 5B0CA 5L8RC 2YY3A 5FLXU 2IYGA 4KY3A 2CJ9A 3GIIA 1QUVA 3SDEA 2ZC4A 3ICLA 1P6TA 2DB1A 4CH0S 4DR2F 1Q8BA 5KFLA 2IMOA 4E98A 2R9LA 3CDEA 4IOAQ 1FJ7A 2GGPA 4I6AA 3ZZOA 1VQNS 4RW9A 4HHJA 5F41A 3WHIA 4LJMA 2HS4A 4DCJB 3HSJA 2CNKB 1M5OC 3DOMB 3OQ2A 3CO0P 1HNWJ 2XMJA 3U1MA 2UXCF 2Y1RI 3HP6A 4GVBA 2GAGC 5J2PA 2HHHJ 5ETTA 2HHUA 1OYDA 1S57A 3H2LA 3PFEA 2B6AA 3H59A 3TVYA 1W2IA 2LQJA 2UVUA 3IWXA 2UUCJ 2C3UA 2CPYA 1UVLA 1MN9A 3CD7A 2V67A 2CQ2A 4C7QA 1Q8IA 3IS9B 1NJXA 1F9EB 1TKXA 5E3AA 3IR6B 4K50A 1RA6A 1KWMA 2L9WA 1ZM9A 1WF1A 4AFFA 4UY85 5IC4B 2NXCA 2HHTA 2V8GA 2ZKUA 5AT1B 2H65B 1WWHA 2ZJQQ 2KFZA 1Q82T 3DMJB 1WC1A 1OS5A 3LAMA 4OJGA 3D6TB 3FRZA 1SKWA 2ZOGA 1PC5A 3KG1A 5IM0B 3Q22A 2J76E 4ECSA 1VBYA 2DRAA 4OX7A 5D4NA 3CIMA 4N41A 2WCXA 4DX5A 3TJ8A 5CZVA 2C42A 1B70B 1YJRA 2DY1A 4MKAA 4FF4A 4PG7A 4HDHA 3RJMB 2OPPA 3J7YI 2ZJPQ 3Q2SC 3CULA 2E66A 3H8YA 4CRJA 3JSMB 3CMES 1T9VA 1U48A 2CYYA 1LFPA 2J7KA 4ZVSB 2KXNB 1SJ3P 3UCUP 1O5JA 1WD6A 1M5KC 2EFQA 2J0QD 2BANB 4IH6A 4ECXA 2MLYA 2FY1A 1UP1A 4F36A 1GX5A 4DN9A 1U0HA 2HWIA 3U27A 3I55S 4TXSA 1S79A 1N0UA 1IBKF 4DLEA 1RTHB 1F1BB 1VGYA 4N5SA 3H20A 1S1UB 5KT3A 2EXUA 3BREA 2R8JA 3M6XA 4Q0BA 1CC8A 2IDLA 2WBMA 4L73A 4JI1F 3DCAA 3WIVA 4TNOA 1GTEA 2FB0A 3KMSA 3HSDA 1Y4ZB 1URRA 1H73A 1NSPA 2OSQA 3KHGA 2F3JA 4TYBA 1VIOA 1M5HA 1U6FA 3D6HB 3ENVA 1LWFB 1X31C 2HHVA 2KVIA 1F0XA 5KFPA 1XNQJ 5KTQA 2MKYA 5L46A 2V69A 3R5GA 3HFVA 1BQNA 4A4JA 1L3VA 1GXTA 4DPUA 4IG3A 2YQ0A 3FQLA 2B0GA 3DOKA 4UW2A 1BXNA 4A8QA 4OLPA 5HATA 4M5IA 1NCLA 5AXMA 1F2HA 2DHAA 3EYZA 1MMNA 4DQSA 2XNRA 1AUSL 3Q8UA 1IXKA 3MMBB 3NWGA 3LP0B 1ULRA 5ETNA 3KFWX 2W2PP 2YPZA 2J6UA 1IKXA 3SCJE 3M7VA 2BOPA 4ETZA 2H5IB 3TUZC 2MQPA 5C25B 3KJQB 1DFDA 1BMQB 3FMBA 4ED8A 4GC6A 2KZZA 3MXHP 4KFBA 4P75A 5IT9Y 3IR5B 3KJFB 2GQCA 4IDKA 4DXLA 2QX0A 3ILOA 3VAFA 1JLCB 4OHVA 3DDNA 2CQ0A 1CJKB 2JRSA 1Y00A 1K44A 4I2QB 4PYAA 1WC0A 3S7RA 3GU0A 1SBRA 2NREA 3RZAA 3VQTA 1RA7A 3FDSA 3BQ2A 3EZOA 1JNZB 4N8OA 2LU1A 1N48A 5HVGA 1R8AA 2E1CA 4XIUA 3IRXB 2LECA 5ETQA 5IXUA 1VRTA 4PXDA 5M2UA 2X1FA 1ZPWX 2MKSA 2KJWA 3D6MB 5K8MA 3ILLA 3G2XA 3MCOA 2XC9A 1QSYA 3AY0A 5A0YB 1TL3A 5I3UA 2DEIA 5E0OA 1SC6A 3CJRA 5IC6B 4NYPA 2W9CB 4ED0A 3RRGA 2NUHA 3RRHA 2RS2A 1EZZB 3IGVA 3POTA 5BR8F 3I9ZA 1SC4B 2HNZA 2UVVA 4G6VB 1VRUB 3PW0A 2CJYB 1SPBP 2IC3B 5F0UA 4M5DB 2CZ4A 4A8FA 2EBGA 1U45A 7FD1A 4FYXB 2SXLA 1X9SA 4NXNF 2XSFA 1JLGA 3CC2S 1JLQA 1VQ8S 1X4FA 1HHTP 4CTAB 1VJWA 2P9GA 2IFXA 3K8WA 4YUDA 2Y1JA 1NSAA 2V94A 1IKWA 4RKUC 5KG5A 1WTFA 1S1TA 3RU0A 3EZ5A 1HNZJ 1BHNA 1QSLA 1ITPA 2HNYA 1SH0A 2OMOA 4RX6A 1QAXA 3DYAB 5FLXY 4YB1P 2AJ1A 2Y0SD 2A0FB 5KFVA 1TR0A 2NLWA 1DTTB 5KT2A 4NRUA 3F41A 3W64A 3NEKA 1NB7A 1VQPS 5T7LA 3CDAA 2XY5A 1IJEB 1FERA 4I6YA 5KFMA 3ILJA 2ILYA 2D9OA 1TAQA 2HQCA 3TAMB 2QRRA 1UJ5A 1J27A 2I8EA 4V19J 4CO5A 2FVRA 3VWSA 3PHTA 3CD5A 4Z2XA 1J2VA 2HQDA 3KOAA 3MAHA 1H2TZ 3OFFA 3TEGA 3N6MA 1HQUB 3DLGA 1HNXJ 1BWEA 1K9MT 4KQZA 3UNGC 3KK2B 4JI5J 2YNHA 3G4SS 4ANCA 1ZM2A 3C2PA 3KK3B 4P71A 3K8VA 3I31A 2VPXB 4WP9A 1TELA 5G4DA 1LKZA 4OJ1A 1IR1A 2HHXA 5RUBA 3MPUB 3OJSA 2UU9J 4KE5A 2GFFA 1NK9A 3MAAB 4ILLA 3ISNC 1KD1T 1IKVA 3NS6A 4X64J 2R8GA 1N8RT 4F7VA 4ZK7M 4LSZB 4ID5A 3BGOP 3TEHB 4USUA 4ANDA 3GCWP 1D1UA 1RLDA 1YBTA 4GKJJ 1P1TA 1J5EF 1NDLA 1TMJA 2UXBJ 3KLIB 1HNIA 3A13A 2W4DA 1WC5A 1X7VA 3D4JA 3KTQA 3CD6S 2VC0A 4K4UA 1RT2B 4KPCA 3TQ1A 3J80U 2BE2B 3G86A 2Z56B 4Y2CA 2HFZA 1Y5IB 1LNQA 4PABA 2AD9A 3C3LA 1PBAA 4B17A 2FJWA 2CQ3A 1ZPVA 4NLDA 4L3KA 4A46A 5CYQB 1S6PA 4F3QA 1CJTB 2W9BB 4LF8F 3D66A 1FFSB 2W1BA 1HWKA 4HACA 2DNMA 2LXIA 1S77D 5L1JA 4NPOA 4NXMF 1DARA 5C42A 2KT2A 4HKQA 2V0NA 4ES3A 4MFBB 4RWXA 5HMXA 2A2CA 5KG0A 2DXDA 3JTPA 4HVZA 4K4ZA 2HIYA 3SI8A 3OTEA 3OUYA 5L1KA 4ED2A 1IJFB 5D3GA 1VC0A 1O6XA 1SI9A 5K9FA 5KFOA 2E5LF 5IWAJ 2B8PA 3NGDA 2MYFA 2D74B 3J7YU 1T03B 3R7NB 1KEKA 2C2DA 3L7UA 4X4QA 3BYPA 2OJ3A 4JI2F 1UFWA 4WFAQ 1TV6B 5J2NB 3HHKA 3TRGA 4FVCA 4DSKA 1REVB 3GYGA 3SV4A 5KT6A 3MEDB 3JAMU 4ZVRB 1EAYC 2EC0A 2V4JA 5DZ7A 3AOAA 3VZHA 3ZZ0A 1AZSA 3DXBA 4IQXA 3KDNA 2Y8YA 1PYOB 2ZH7A 2E5IA 3W5ZA 1YQHA 3B78A 2ZOFA 1RWKB 5D4PA 1F5CA 4YB7A 3CVKA 3DLKA 3BR8A 4F8RA 2HRTA 3HT0A 1YG0A 1HBOA 3KK1B 3H2VE 1UAWA 1S9EA 4W98A 1UETA 2GMJA 3TUPA 4NLWA 2BV3A 2DXEA 1SQFA 3E51A 3HI9A 5E3RA 2ZZMA 1NMEB 1T3OA 3M8WA 4XDDA 3PFOA 2OMLA 3K2YA 2EFNA 3QIPB 4Y28C 4J9MA 4Q8EA 2NSCA 3DC2A 5ETRA 4N47A 4XDCA 2P5VA 3F0NA 3J7ZT 3THTA 2QN6B 1PJ7A 3BSOA 4TLQA 4ZP9A 4DMZA 1VIXA 5DGAA 3CSKA 3SCKE 1RAIB 3UDCA 2RB7A 3LAKA 5K8NA 5E33A 3NNHA 2W2QP 2ZHBA 4M8LA 3ISND 1YHQS 4WTOB 2VQFF 1BQMA 1NK4A 2KZMA 2N82B 1WHYA 5LSLA 1Y0HA 5C2GA 3J81j 1PBUA 4DR1J 3TNVA 2ADCA 4TKTA 3LH2S 1S1WA 4F0KA 2ZBCA 3D5MA 1N4LA 1D3WA 4MIAA 1U1KA 1WG4A 2Z8QA 2DR6A 3HPOA 3MM9B 4PZVA 3DMJA 3M2VB 3H4DA 3I0RA 2H1YA 2MY7A 1Q79A 1FKPB 4C8LA 2L48A 5IM0A 3L9ZA 1OPZA 2ZBRA 3MR6A 4ZKAA 1LQ9A 3PDNA 1IBMJ 2YNIA 4ZPBA 1IQZA 3TX0A 2BKOA 1U1PA 1OPIA 2AZ1A 4DV3J 2UXDJ 1PG5B 3ET6B 4QW9A 1TK0A 3QRRA 5FJ4A 4XO0A 1O51A 2IJRA 5EX3A 3T19A 5HROB 4ZITA 2HWTA 3FEXB 2HVEA 5CYJA 3MPWA 2XGQA 2NR0A 2ACMA 1ZM4A 5CAAA 4K2JA 3NMAA 2E5HA 3EXYA 2C2KB 2CNLB 1TUWA 5J1EA 2XMAA 1NK0A 4ZDNA 1KFDA 2XTJP 1P27B 4K4TA 2I6WA 3TZXA 3OTOJ 4C11B 4Q7AA 4CNYA 2VFUA 1IN0A 2AQ4A 4F3OA 4ZPCA 4NA2A 3HO1A 3CDWA 1KLMB 4QPTA 3D2WA 2EFGA 2WOMA 4NEZA 3I4PA 2DNHA 4F25A 1CBKA 5KFGA 1C1BB 3FBFA 1S49A 4OI4A 4DHVA 3QAUA 2PEBA 3GSIA 1U49A 1WOSA 2J0SD 2Q1LA 1EKRA 1ZYQA 1U8WA 4WKRA 1G6BA 3EDRB 3OW2R 2BR0A 1S6QB 2YNFA 2ILZA 4PWDA 2XEXA 4OYAA 3A8JA 2MQ8A 2EFOA 1Q0NA 3DU6A 2VG5A 1HBUA 1NO8A 2M52A 1WSVA 3DRPA 3NCQA 2RQKA 4ENOA 3Q83A 3CJTA 3IAM9 4ED1A 1RCOB 4A8YA 1U1OA 2BJ1A 3D54A 2VB6A 3N9UC 1CG2A 5KG1A 2LKZA 4DR7F 4DR5J 2HBRB 4OYIA 4I67A 2BVZA 1FJCA 4RUBA 4H4OB 4GMKA 4LFAF 3TZWA 2Z0GA 4MJKA 2XMTA 1SL0A 1E6YA 3GV7B 2PN6A 2C2RA 1YJUA 2DHGA 3VALA 2GQQA 3D0IE 2E9RX 1M5VC 3SFUA 5KFCA 2K2PA 5ETPA 3LUYA 3J80Y 1S99A 2RF2A 3BQ1A 4NCGA 1N33J 5E7OB 1R27B 2E7VA 5IFMA 1XNRJ 3CJQA 3MM7A 1BQXA 1X0FA 1YJTA 4MAKA 2YWGA 3TZYA 5IS2A 1QM9A 1U1RA 4X65J 2DHSA 1W26A 3JYTA 1JLCA 3HFZB 3VGVA 2POKA 2RKIA 3SBMA 4L74A 2R7WA 3KHRA 2DPIA 2CQ1A 4H4KC 3DLLQ 2AX0A 3HHNB 4AL5A 3S6EA 4EO6A 2BABA 4LF4F 3RAXA 2ZZTA 1BLUA 2EFPA 1U1LA 3RYLA 3GSDA 1N6QA 1YIJS 2CPFA 2R2SA 1L3SA 3EGVA 4O3PA 3T1YJ 3VAIA 1O0PA 3B4DA 2C2OB 5DDQC 5KFJA 3L95X 1FT8A 2YH1A 5ETKA 3PW2A 4M95A 1E6VB 4U7UK 3UD5A 2DH7A 2Y9HA 1BC6A 4NA1A 3BBBA 4CM2A 3MPVA 2HW3A 3JAMY 4OJHA 5AJ3J 3ITHB 4RLEA 5KT7A 3FFIB 5HK4A 4LRAA 1RT5A 4CLYA 1RHKB 3PKMA 2LQ9A 2MB0B 2OAUA 1UVMA 1V3SA 4Y2KA 4O0NA 2JSXA 1RTDB 4TY9A 1X9MA 2MDAA 3M32B 1SQEA 2WHOA 1JJHA 4Q45A 1Q86T 2FHJD 3L7PA 1G2EA 3ENAA 1X8DA 2KG0A 5CYMA 2WW8A 1N5YB 4RO0A 3EWGA 3CF5Q 1DZ5A 1HBMB 4DPXA 3R5BA 3JSRA 4IFVA 1MMDA 4KYZA 4EI2A 4IR1A 1CPZA 5T14A 5LMUF 4ZP7A 4N7TA 2BRLA 4OX9F 4GKJF 3TAMA 3MM8A 4RNNA 3US5A 4F04B 2OD6A 5B0EA 5KFNA 3OSPA 2COLA 2M0GB 3M2RB 4IOBA 5I4MA 2DR5A 1XK8A 4DPWA 3VVUA 3DHXA 4JV5J 1IR0A 1X4EA 3MMCA 5B0DA 2YWWA 1VLOA 4KPYA 3FBCA 2OUGA 1RHJB 5E41A 3KUHA 1RWUA 2X1AA 1HR0F 4LF5F 2LEAA 3ENQA 4ELVA 2UVRA 1NKCA 1AFIA 3V4IB 4CLPA 4I6WA 3KK2A 2QLWA 3K5LA 2HIQA 3V6KA 3MM6A 5E3CA 1JKHB 8AT1B 3PYFA 2DNOA 1FRXA 2F65A 1HBNB 4TYAA 1TL5A 3BKUA 1WKLA 3CT9A 4CIOA 2J9EA 2WONA 1RP5A 2VD3A 3PX4A 1YBAA 3HHLC 3MEEB 1KR4A 1VHIA 2HHSA 4R0JA 5B09A 2B56A 1NPPA 3SFGA 4KHPF 2QMXA 2GC8A 4OV6A 5LL6d 2ZDOA 2PIIA 2XHCA 1UPPA 4ELUA 1IBCB 3RTVA 2F40A 3OLBA 3FCHA 3SXLA 4IOCQ 4CLLA 2LXUA 2FYXA 3NAIA 1ZZNA 4J37A 2E7WA 3SSSA 2VPZB 4C3KA 1SKUB 1DURA 2HS3A 3TW0A 3OXFA 1FK9A 1N32J 1KQSR 3TVKA 3BDPA 3CC4S 4JI3F 4DN0A 3EE3A 1RT1B 1GK8A 2KM8B 4K4XA 4L3NA 3MEKA 4Y65A 3W66A 4JYAF 1OY8A 1FFWB 1Y9OA 2YWKA 2B51A 1QTNB 2BEFA 2HVHA 5CYQA 1PILA 3I9V9 1WEYA 2QFIA 4USIA 2Y1IA 3C6TA 3OHBA 3UR0A 2BW7A 5F8IA 3A3OB 4CLZA 1KVJA 2DNQA 1UL3A 3PO4A 3NGUA 2AGOA 2VHGA 4O44B 3CEDA 3BGRB 3AFGA 4D3HA 1WEZA 1X4AA 2EW9A 4EYHB 4J9SA 4NOHA 3UDVA 1VISA 1RUSA 2ALYB 4ES2A 4J9RA 3A8EA 5E2QA 4C8ZA 4KC5A 1RT3A 4J9UE 4QIWD 4HTIA 1KTQA 4DR4J 3FBBA 4YB5A 1U1QA 1AW0A 2VQEF 1WI6A 2LQBA 4E8UA 5EN1A 1T03A 2F7VA 5G0RB 4LF6J 1VFJA 4C3LA 4LBIA 4F2RA 4B3RJ 4H4MA 3NS7B 1VQSA 1U2RA 1X60A 2RH3A 4IRCA 1F6TA 2QLBB 5H9FJ 1FE0A 5J2NA 3M1VB 2XMMA 2YKOA 4JI8J 1YZ7A 2F9DA 2GHVC 3MEDA 1RWPB 1MWZA 3EUNA 5D8HB 3W1YC 3N5BA 4PR6A 3UD4P 2OD4A 4BCAA 1H2UX 4LRCA 4KV8B 2RRNA 4IO1A 4YB6A 4DR1F 2KRRA 1H6KX 1SIWB 4OYBA 2HQGA 1S9GA 1CSJA 4C6AA 2RNEA 3WQPA 3FGVA 1FJEB 1FX4A 2HSEB 2IVFB 1EIYB 2AKWB 2B43A 1LEOA 4CLTA 4DV6J 4FF2A 4LR7A 5KFRA 3GPAA 3D1OA 4RBUA 4PQUA 3M8QB 3QSYB 3OR2B 2CDRB 1OO0B 3BDEA 2KT5A 4OI6A 4QQBA 3L3CA 2CQ4A 3FSIA 4P74A 2V9WA 1L3KA 1UJ6A 3P5TL 4WU3A 1NNDA 1JX4A 3CJ0A 3BV8A 4PRFA 4MK7A 2K3KA 4OYMA 3HFKA 4URSA 4GO5X 3HHLD 3O44A 2AJFE 1DAXA 3AD7C 3CCUS 3W60A 3MCNA 3MI7X 2Y0BB 3LANA 1RKJA 4JI6F 3CD0A 1SB6A 4CWBA 3GFXA 3MR5A 1S0VA 4IYQA 1T02A 1NSQA 2VODA 3SDEB 4QR0A 1UW9A 4PEOA 2VDIA 3D7SB 2MKIA 1D09B 2EFVA 2QIFA 3K5NA 1Y10A 4RW6A 3IBCB 2GGPB 1T9WA 1XMQJ 1XN9A 5HANA 4ANEA 4CLKA 2AJ2A 4ZVFA 5H9FK 2XNQA 2DXFA 2DCLA 2VL1A 3ZTOA 3NL0A 1GNKA 2ATCB 4USKA 2XWXA 1KONA 1T95A 3C14A 2D3O1 2IM2A 1LK5A 1XTZA 3GFHA 3M8PA 2XSJA 4GVBB 3FZ2A 5C2CA 2YKQA 3M2VA 2B6AB 3Q0AA 3GIKA 2MMYA 3MUTP 2ASJA 4M5JA 4JV1A 4JI0F 2RJZA 3FK4A 2FHKA 5D0RA 2X1GA 2PEHA 4B3MJ 5A8RB 2OPQA 1Q7LB 4R5PB 4DV7F 2I5JA 2QLFB 1YJ9S 1TKXB 1TKZA 1O8BA 5B0GA 3WDOA 4IH5A 4U6PA 3MECA 4A8OA 3CUNA 5L9NA 2YNGA 2V9KA 2L41A 1SJRA 3FEYB 5HL7Q 3HXMA 4AQYJ 5HROA 3JS9A 4Q2LA 1ZETA 1SUQB 1P1LA 4OHZA 1VJQA 3ZTRA 4PAAA 1JLAB 4YEAA 2C3MA 2R2TA 1Q5VA 1YBUA 1KTVA 2A10A 4TLRA 4AXIA 2HBQB 2DBBA 4CO3A 2VH7A 4B02A 3D67A 2KHCA 4U8VA 4DU7A 1ZZFA 3H0PA 3UO0A 2N3OA 3MPDA 1OYEA 4DUTA 2NSBA 3MCMA 4ES1A 3B4MA 1KLMA 1OWXA 2OPPB 1UVNA 2JFKA 2HKEA 1VQMS 4PUOB 3QO9A 4JB8B 5HLFA 5A8WA 4QR2A 2UXCJ 2RD5C 3T9NA 2BKPA 3S1TA 1TVRA 1KHVA 5KG3A 4K0KF 2YPYA 4Z37A 3DOLA 2C2ZB 4ZVTB 2YKMA 2RE1A 4NLQA 3B6BA 2EG1A 3W9IA 4DQIA 1U0HB 2PA3A 2GO9A 2BKNA 1C0TA 4U67Q 1ROFA 5JJBA 3OL6A 1JLBB 2F9JA 4RZRA 2ZEJA 3EGNA 2FJDB 1RZMA 1H7WA 9ATCB 4QJVA 3CMQA 1UEUA 3M8SA 2BQRA 2BBEA 4EEYA 4Q0BB 3GP9A 2IY5B 4WKYA 2PT0A 2B9EA 3NNAA 5ADZA 3QBCA 1HA1A 4IUFA 2ZD1B 2CFXA 4MTPA 3E01A 3M6WA 2K06A 4O4RA 4ZIWA 2DRBA 1XMOF 4HI2A 4IKAA 2CG4A 3MPYA 1PSDA 4WF9Q 1BQNB 2W4PA 3O1LA 2CG8A 1R8CA 3HVWA 4IG3B 3J81U 3RAQA 3QAEA 3DOKB 5KG2A 2QA1A 1EARA 4DS4A 2BJ9A 4KGKA 4DL3A 2MLZA 2OLWA 3OR1A 3BGUA 1EB0A 4RU9A 1UA1A 3OFHA 4KHRA 4C0OC 3WC0A 4USVA 3R7BB 1IKXB 2PI4A 4PXBA 3IG1A 5H9EJ 2XYGB 2KT3A 1KOHA 1Y3KA 4RW4A 4KGMA 3EPGA 2KJVA 1Y7PA 1X4HA 1ZH5A 1RHMB 4YMEA 1VQ6S 1KP6A 3W65A 5LSOA 1IBKJ 1HYSB 1GX6A 2X7IA 5HMYA 3NG8A 4QU7A 4O0IA 5KFKA 4IDKB 2WVCA 1FD8A 3HD1A 4YDXA 1K1QA 2N7YA 3VGUA 4B3TF 1FD2A 1BWVA 4Q2MA 2AIRB 1ZA2B 2ZVSA 4JI1J 2JEGA 2V2ZA 1U2FA 4QWCA 4YHHF 2AYGA 3KJNB 3T3FA 3CGIA 4NYZA 1YSJA 1N88A 2G0JA 3RG6A 3B82A 3NGTA 4BWMA 4WFBQ 2QA4G 3ITHA 4AL6A 1XJWB 1TFWA 2MHNA 3FZBA 3V4MA 5ITHA 3O6QA 2QE5A 2RT3A 2AZ3A 1S6UA 4Y00A 4DFKA 1TAUA 4B9TA 4KHMA 4DV5F 3OSNA 4ZVEA 4DPYA 1TL3B 3NP5A 3MUVP 5I3UB 1FEHA 1JB0C 3M32A 1AA1B 1KOOA 4QWEA 4B9NA 1FRHA 2H4WB 4DV4F 4C8NA 3HVAA 3KG0A 2DITA 4E0DA 3V6DA 1U1NA 4N76A 2BJ3A 4MK9A 3GV8B 2IAJB 2QTWA 3O3LA 4F50A 3PIPQ 1HWUA 1LW0B 1JLGB 3OVBA 1JLQB 4DPOA 4J9KA 1ACMB 1RISA 4RWWA 5T41A 4LFBF 1YGYA 3IR7B 3PW7A 1S1TB 1KC8T 4BS2A 1Q78A 4PG6A 2JL9A 1TU0B 2HNYB 2ZBIA 2XMWA 4I4BA 4JI4F 4KGXB 3AHPA 2VFRA 2GA7A 2CQCA 1TUGB 2VBXA 1DLOA 3WBZA 3PY8A 1FWPA 3OTDA 8ATCB 1WTBA 4NMLA 3ETMA 4A8SA 3TA2A 3KLHB 2RILA 2CKWA 5KT5A 4PCQA 1FKAF 4RUHA 5KFHA 3SYZA 3LP1A 1TUVA 1KNZA 2KYZA 4FVMA 2L9DA 2BOAA 4F4YA 1R0CB 4AE5A 4LRBA 2MHEA 1OY9A 2MKCA 4EWTA 1F2GA 4KJIA 1WC3A 3EVWA 3A4TA 4NLSA 5BR8J 2EI5A 2D7SA 1FXRA 2V8PA 2HMIB 2HAIA 3DLGB 4USJC 2DTJA 3NCRA 1Q16B 3JTNA 3D68A 2YNHB 1UMJA 2BM0A 2P6TA 4NXNJ 2L3MA 1SH2A 4PG8A 3EMTA 1VBZA 4LVOP 1U6BA 2BQ3A 1S5ZA 1VHFA 1JLFA 2KYXA 4NZ7A 1FWLA 3GYNA 2HFOA 4J5OA 1RTZA 2IVMA 1A7GE 2HAFA 3HKZD 2JH3A 3TOQA 2ROGA 4ZIVA 4IRDA 3BKFA 3DLJA 1D0EA 1RJJA 1V5IB 5KFDA 3KJVA 3QLHA 2DGQA 1X5SA 4C8MA 4ID5B 2VV5A 2VPWB 1NLKL 4ECRA 4DV2F 3VCDA 3MOJB 3JSYA 2NUUG 2IRUA 3GFYA 3QT6A 5I3QA 2B9YA 3PG9A 2DNZA 2V4RA 4MH8A 3HJVA 3NKYA 4NCBA 4XPCA 1UZDA 2ASLA 2OEJA 2R4FA 2N4DA 4KKOB 2JEJA 4UT4A 3HSGA 2Y3YA 4MK8A 2N7CA 2DNPA 1HL6A 4WFXA 1EQ0A 4DV1F 2GIRA 4EO8A 1JQGA 4X84A 5EDWA 5HI7A 3BJYA 4DL5A 2G0IA 4DX6A 2K1RA 3AODA 1S6PB 1RABB 3W2VB 3QATA 1CVJA 4URQU 4AL7A 2BDPA 4FPRA 1XR6A 4HACB 2UUAF 2NXUA 2F8HA 2LCWA 1RTJA 3ZZYA 2Z58B 2J6TA 5C42B 1CJVA 1H2VZ 3RAMA 2HGMA 5HN0A 1RAHB 2DR8A 2Z30B 5F3TA 4FF3A 3OVAA 3QGIA 3LPEA 4H54A 3RBZA 1AYEA 3OUYB 3EDQB 2XLIA 2MKKA 4KV8A 2PFFB 5IOLA 5D3GB 1KQGB 1UFKA 2M7SA 4U96A 4O23A 2PMHA 3DRSB 2AYEA 2CQIA 3IN5A 2W4CA 5KG4A 3MAQA 1R0AA 4L76A 4LF7F 2QFJA 2B7BB 4KH0B 1J5EJ 4EYIB 3GZ7A 1ICEB 2Q66A 3J81Y 3PW4A 4GVLA 3BB5A 3NLCA 2FLLA 2AEFA 1WOPA 2KHDA 2HLTA 3M8QA 4IO9Q 3OR2A 4W90B 4RW8A 2O66A 4ETXA 2E1PA 3ZTQA 1U2CA 2DO4A 4WFNQ 2XWYA 1NBEB 2XGPA 3HVRA 4ZA1A 2V4JB 4UOGA 1CULA 1SQGA 4U7CA 3GJQB 4J9QA 3EPIA 1AZSB 3VQSA 2JNJA 2OSRA 5D78A 3T9ZA 2OTLS 3WX8A 3K5OA 2PI5A 3KLGA 3DLKB 3KNGA 2UP1A 4DJBA 2JFDA 4ILRA 1HBOB 4LF8J 3J7AN 1UVIA 2HNDA 1D9AA 2DT9A 2NCKL 1HI0P 2AMCB 1S9EB 2ZNZA 4WP3A 4IFYA 4NXMJ 4JOUA 3NRBA 1FXLA 4TVAB 2G2YA 1MN7A 2BJDA 3M8ZA 3TANA 2QMUB 2NQPA 3LO3A 4UZCA 4CO0A 1DHMA 1Y5LB 2BA9A 1WF2A 2HWHA 4OLOA 1H74A 1FWKA 2E5LJ 4Z7YA 3HVTA 1ELOA 3FC9A 5F8GA 4W92B 2FVCA 1VQOS 4PPDA 1Q8KA 5HP1A 2JVRA 1GTHA 4JI2J 5JUMA 2KXFA 4DZDA 2YXLA 1I51B 4LF9F 2R42A 4Z7CA 4C98A 3R97A 1BQMB 5A8RA 2LQ8A 3MGJA 4R5PA 4FNIA 1IM6A 4CO2A 4F4AA 1WHVA 3P6YC 4P72A 3QWUA 4WCEQ 1QDUB 4HHHA 4ZPTR 1FA0A 2CVIA 4LF2A 3CO9A 2DR9A 4QWAA 1SUQA 1FE4A 3W63A 1S1WB 1JLAA 4U9RA 3KLEA 3GE9A 3IC1A 5I3PA 4P2FA 1YJWS 2V2VA 2DIVA 2FPHX 5DQHA 3FEZA 2DGXA 2XI2A 4KRWA 3MWBA 3I0RB 3TAQA 1GEHA 1YX2A 3H90A 3P3DA 3FKBA 2AX1A 2YNIB 1UCNA 3VGSA 1N34F 1U47A 2C1EB 2B8QA 4KTQA 1R7IA 3DDKA 1SXLA 3D3CJ 1HMVA 4PUOA 2GJIA 4WYWA 5D4LA 2H48B 2IJFA 2CJAA 2V50A 1HW8A 4QWDA 1OIAA 4QU6A 5J1EB 1CJUB 3CW2C 3T5LA 3RB4A 3G6ES 1B64A 2BE9B 2VQFJ 1WOOA 5SUHA 3KDOA 4WFZA 2HK3A 4ZVOB 2M8HA 1GH8A 1RT7A 2J8AA 4WU2A 4QYRA 3ZTSA 2DGSA 3RUBL 3PM9A 3K0JA 2ZM6F 2OH2A 4TN2A 2P9EA 2WOMB 1JLBA 3LWMA 2GCFA 4LR9A 3A8KA 2FLOA 2M8DB 4QBUA 1T05A 2HK2A 2MZSA 2AJ4A 1MLAA 1XWLA 2FTRA 4K59A 3BEGB 2H51B 3ETOA 1MSWD 3I4HX 4WFYA 1EJ7L 2JLEA 1L3UA 2ZD1A 2YNFB 2VDHA 4PWDB 1G4CA 4JUZA 4UOHA 2R7XA 4TY8A 1OMSA 2VG5B 2XLJA 2M3DA 5LMNF 1HBUB 3DRPB 1RQ0A 4OIXA 4F02A 4P2SA 1JXLA 1QE1B 2MQMA 2AWZA 5K20B 4ID8A 5GMKa 3HULA 4U8YA 4ZJQA 2ZNYA 2LEPA 2B5JB 9RUBA 2VF3A 1GMUA 4ZLNA 1X4BA 3RGIA 3PTWA 1NKEA 1QVGR 1JJ4A 4ICLA 1E6YB 3IBWA 2W8KA 2GS8A 2FLPA 3G8SA 4FF1A 2O5DA 1KHWA 5KFBA 2MQNA 4ZCKA 3H7HB 4Y0FA 2RF2B 2JVOA 3V6JA 4JI7F 1OSCA 4NCGB 3P96A 4KIAA 3DLEA 4P7VA 2OPSB 3MM7B 1ZS6A 3MURP 1HYSA 5AE2A 2ZHOA 3PV8A 2V68A 4I68A 2J9DE 2VFSA 4WIQA 4Q5VA 3JYTB 3GCXP 2P2CB 2PO4A 4AXJA 2YQ3A 3U02A 2RKIB 2HEKA 5HAOA 4RL1A 1FDAA 2G4BA 3TP2A 1N56A 5CH7B 3HHDA 1WC6A 2FIUA 1VQLS 1FRLA 4YR3A 2ZH5A 3FQKA 2R7UA 4MT1A 2OFGX 1V9OA 4OZ3A 1IQTA 3MDFA 3LP2B 1AXQA 2KFYA 3IA0A 5KOXA 5HJYA 4FBTA 4BLGA 1N6QB 5IV4A 2C3PA 2CQDA 1SCJB 3QFWA 3QT5A 1BD6A 3ISZA 1X5OA 5JMNA 4DR7J 2QL7B 4NLOA 1X4GA 1SKRA 2DNRA 2GW8A 1RT6A 4OQJA 1ZAXA 2DNKA 4UQTA 4LFAJ 2QT7A 4QIGA 2ZH8A 4KB7A 2EC2A 1OY6A 4RBVA 2IAJA 4R25A 4C0HA 4ZJOA 4HH1A 1P9YA 4FXDA 4K4SA 2J7WA 2H54B 2D3ZA 1RT5B 4X66F 3PHEA 1LW0A 3TA0A 3UI3A 3ZO7A 1RGVA 3CCZA 3FVYA 3I0SA 3BR9A 2RDJA 4DG1A 1XERA 1GT8A 3JQKA 5D4OA 1KDNA 2KTQA 2UVWA 5CYMB 5DDRC 3D3BJ 4KT0C 4IFVB 3DXSX 3TUJC 2B4PA 2V2QA 2R8KA 4NZ0A 4P52A 3H5UA 4IRKA 4Y3CA 5E3QA 5EHHA 3HHLB 4ZVHA 1WDDA 5BYQA 3NNCA 3KLHA 4LF4J 1LWXA 3VHQA 3O2IA 1ZOTA 3MM8B 3OLAA 3R8YA 1UVJA 2BXJA 3P45B 1AT1B 1VQ5S 4B9SA 2GIFA 5J2MA 1RSCA 3ZNUA 5IQ6A 1KVIA 5C7PA 3G8QA 5DM6Q 3MMCB 3ZFVA 1QSSA 4ZP6A 2VBWA 1RTIB 4HEA9 3EVOA 1VC6A 4OFZA 2HMIA 4X62J 5F0WA 1DBDA 5DS7A 2OKQA 3I32A 3GTYX 4UOCA 1L5UA 2FHOB 4K2XA 1LOUA 4F4XA 2D69A 3TR5A 3A3PB 1M0SA 1T9XA 3MM6B 6FD1A 3QMQA 4EGLA 2M70A 2IMWP 2P8IA 5FDLA 1G1XA 3KYLA 5KFSA 5I42A 4X2BA 4FNHA 5DDPC 2AEJA 2WONB 2VC1A 5L1IA 4F3MA 4CZCA 4WXOA 2AGQA 1NPKA 3I5CA 4RR5A 3WZ0A 1RT4A 3P8BB 1HARA 1B7YB 2DHHA 4P7TA 3R6LB 2G2ZA 3VAMA 4W4MA 1DQ8A 3D1HA 4DR6F 1WACA 3OL7A 1RAAB 3MEGA 1K0VA 4OI1A 5DG8A 2QZ8A 5LMUJ 2WVBA 3W9HA 1HQ2A 2MJUA 4MIWA 4OX9J 2XG8A 1XR7A 4HHUA 3DGPA 1Q5YA 2B9XA 4B3SF 2DKOB 3G6XA 5L9XA 4ZPDA 1T3NA 4KKOA 4M5HA 2P6SA 2KL8A 4CH1A 1FK9B 3OV7A 4J91A 5C5JA 2VU5A 5IT0A 2ROEA 1KBRA 2LU2A 2HFNA 1HR0J 2F1FA 5KFWA 4LF5J 3S01A 2B4VA 4L6V3 4WE1A 4ERDA 4ZCMA 2HVDA 3G71S 5GMEA 3T5KA 1S72S 2ZC3A 4J9LA 1NZAA 5M2PA 4V1Ak 2G0CA 1T9UA 4OYWA 3W2VA 5AXNA 2Z4PA 3C6TB 2G1DA 4R8UA 1H7XA 1NU4A 2O67A 3MM5A 3FNNA 3H5SA 3DHWC 4HTJA 1RKIA 3GJSB 2J0WA 1M5PC 3R1LA 4NI2A 2CPIA 2IA6A 3GJRB 2XB2D 3HD2A 2ALZA 2OHDA 4F4KA 3NGSA 1UW4A 4KHPJ 3M4XA 1KQKA 1RT3B 4G65A 1TP7A 4WWSA 2CJKA 4LIRA 3C19A 3DRSA 1NH7A 4C8YA 2MPUA 5D6GA 2IA0A 1MROA 2XZWA 4I69A 4YFUA 1YDLA 4CI0B 4LBHA 3RBDA 2ZWPA 2ZITA 4Q8FA 4H4MB 2VUGA 3K7RA 1A0OB 1SVDA 2DD8S 4LQ3A 1URNA 3BPSP 3UE2A 4EZ6A 2DIUA 1S1XA 1EP4A 2I1RA 2XS5A 3M9MB 2AYMA 2XBPA 4B9VA 3DDIA 3CE8A 2VFTA 3Q23A 1JJ2R 3IWNC 4LRDA 4JI3J 3SEOA 1Y5NB 2X3DA 4LREA 2PD1A 1S9GB 4JYAJ 1R43A 2ZKTA 1JXEA 1NDKA 4LBPA 2RRBA 3E8OA 4GKKF 5A2QU 2ZH9A 1QVFR 2LMIA 2RSQA 3PVXA 2O3DA 2FVQA 1UZHA 1TTHB 1TQLA 2HPUA 2XY7A 1S0OA 4PQUB 2N4CA 5KFQA 3N6LA 4B3OA 2KRBA 1NHVA 3L4BC 4KO0A 4BDPA 4JP8A 2BMBA 4LMZA 5KG6A 5E3PA 1VMBA 4DUZF 3BZQA 5EX0A 3MZIA 1TKDA 4K7QA 3DRRB 8RUCA 3KWMA 4DSEA 3PW5A 1APSA 3CNQP 3ZZPA 1U25A 2CJQA 3NXZA 2VQEJ 3RBXA 4FKXA 3E3XA 4ZP8A 4RUAA 2YWFA 5DG9A 1NJWA 2ZE2B 5D0GA 3KXDA 3ZTPA 1OQ3A 5KG7A 3JTOA 2B4OA 2HFUA 3CJSA 4X4NA 4OV1A 4TU7A 5HVHA 2BW2A 4K8RA 2MZQA 2GAHC 2JC1A 2Z2LA 1U7LA 2DNNA 4DCPB 1FVSA 3L7OA 1U24A 4RW6B 4LFCF 4FS1A 5THWA 2RIJA 2J5AA 2OEMA 2F8MA 5D0EA 3BPDA 2C2NA 1WKJA 3H5XA 3H5YA 7AT1B 1NDCA 3C14B 1RWOB 2FHJA 4CDIA 3LALA 2GMHA 1RB0A 3R2DJ 2X1BA 3M8PB 2XSJB 3DLBA 4CO4A 4PYDA 3THPA 2MSSA 3RB0A 3QJLA 1XMBA 2C2EA 1RBOB 2W9AA 2W7AA 5DQGA 4EUVA 2G13A 4D3GA 5KFEA 4B9UA 1M90T 2DNYA 2CA9A 3MMAA 2YTCA 3LF0A 2OPQB 3JSBA 2QLJB 4K4YA 2D9PA 2I5JB 2K7KA 2OFHX 2VBZA 1TKZB 3BSAA 3P49B 3GIJA 1HD1A 3MECB 2KB2A 4ZHRA 2CPDA 2YNGB 3GJTB 2HLUA 5K14A 4DPTA 4KAIA 1GMWD 1YTYA 1R6YA 3AQPA 3QGHA 2VG6B 3OFGA 1VCTA 5L38A 4ED3A 2QO3A 3HF5A 2PMZD 3GR0A 4DL4A 4RW7B 4N77A 4JI6J 4DF8A 4DF4A 3IM8A 1CJUA 1BE4A 5ETVA 1Z2LA 1P8GA 3PACA 4ZPVR 1U6ZA 1PJ6A 4R0EA 4DL6A 7FDRA 2FY8A 3R6GB 1F9HA 4NLUA 3R9LA 1JLEA 2QEXS 4USHA 2GJ2A 5C24A 4C9DA 3G9CA 3BN4A 1RHQB 3IM9A 3AXMA 5A8WB 3QO9B 5HLFB 3H42A 4MKYA 2HGNA 3M9OB 5EGYA 3TVZA 1TVRB 2RHSB 4CYUA 2KN4A 4DSIA 5GAEI 3DOLB 4JI0J 4GO7X 1NHKL 2YKMB 2RDDA 3AT1B 1FKOA 2BQUA 4DV7J 3V81A 5ETMA 2OP5A 2OGUA 1C0TB 5CCMA 1QE1A 5A8KA 3LQVA 2XZDB 3M2UA 3MFHA 4H4KA 2XS2A 5KFUA 2B5JA 3CCRS 1DRZA 4RBTA 3FJ2A 1UWBB 5LJ3Y 3QPIA 3A8IA 2I38A 2VA3A 1YJVA 5D15A 5HVFA 2CQHA 2YVSA 2B4UA 4A8MP 1PC4A 2OELA 2A1BA 3NS5A 3N79A 3OTCA 3PRVA 3E01B 1U09A 2DGUA 1NPRA 3IAS9 4EBEA 4G1QA 3BGFA 1QLNA 2CDQA 2FHMA 2YX7A 3CCWA 3W3SA 2JHEA 2OPSA 3ILIA 3SMZA 1WUUA 3TA1A 2E9TA 3PR5B 3KLFA 4AT1B 4HH0A 2U1AA 2ROPA 3R1HA 2WK4A 4AD6A 2V34A 5GVQA 1U02A 4ECUA 1T11A 3I87A 2YX4A 1C4CA 2PMWA 2WVDA 4BWJA 3TARA 3OR1B 1XC9A 4DEZA 1IBLF 3BQ0A 5SZTA 4K0KJ 1FDDA 4OX6A 1N5QA 3NGKA 2VG7A 3KG4A 3UVJA 1LWEA 1H0HB 3LGNA 3NWRA 4C3MA 4X4VA 2ZH2A 2GVZB 1RWNB 3IG1B 3UWTA 4OZ0A 4ECYA 2H3EB 2RU9A 4RW4B 3MR7A 3TJAA 3LP2A 3V5RA 4LIWA 3T1HF 2NXNA 2QLXA 2LFVA 2GQ2A 1HNVA 3O5TB 1GMVA 2VOPA 1TMMA 2AF6A 4TQSA 4XTTA 1I5OB 1J5OA 1HPZB 1QAYA 2DYAA 1NK8A 2AEMA 2CNNB 3HM9A 4XPEA 1K0TA 1SV5B 4C0BA 2JWNA 1D9FA 4EZ9A 3DI6A 1NHUA 3PYGA 3ZZRA 2BM1A 4X62F 3FMWA 4PWUA 4QIVA 4YQWA 1LW2B 2FJXA 3AD9C 3UCZP 4YN3B 2AV5A 1VYAA 2YWEA 2EPIA 1JK9B 5CA5A 1XMOJ 3IWLA 3A3NB 4EU0A 2KI2A 3EVMA 1UFLA 2IM1A 2FDNA 2LDYA 5HMWA 2KH9A 4HL9A 2MQQA 1CEZA 3PYEA 1HHSA 5KFIA 5A2QY 1C2PA 4OZLA 3V6DB 1FEEA 4LQ9A 5EWEA 4O3OA 3DRYA 3M30A 3UCGA 1CS4B 3Q86A 4DUYF 3NAHA 2CPHA 2ZZNA 3DKDA 3HHLA 4K4WA 3U1NA 4P2XA 2APOA 4WTYA 3GB0A 5B0AA 3QNWB 1RACB 1RHUB 3UDEA 3UQSA 3CCVS 1X4CA 2QSWA 2BACA 3AA8A 2XHWA 2XI3A 2XM3A 1ZA1B 5U47A 4F26A 4B3TJ 4J9VA 3AJ1A 3LWLA 5CD4A 3C15A 3SCIE 3AD8C 5J2QA 3PRDA 3SZ2A 1RTIA 3T41A 3K5MA 3BYRA 1V6HA 4IG0B 4YHHJ 2GVDA 1DLOB 2HS0A 3N4WA 3C16A 2PDAA 4I2PB 3VGTA 3OT9A 2AGPA 3IRWP 2RDIA 3LP1B 3QJPA 4DV5J 4E2FB 2DHXA 3F44A 2HYIB 3NGRA 5KFXA 1AUDA 1EKSA 4M5NA 4DV4J 3CCMS 1RI7A 3IO1A 3CIZA 4CQ1A 3O8WA 1K1SA 3W7BA 1WG1A 1H38A 1NAQA 4Q43A 4F4ZA 2MGZA 3UN3A 1I94F 3JQMA 4YY3F 1N54B 1ZAVA 3W2WB 4LUBA 2CUYA 2V8DA 2JC0A 3UD3P 2LVWA 5F3ZA 4M5GA 3CJKA 2CJXB 2FZCB 5LSRA 1BUXA 4LFBJ 2H5JB 5CABA 4M5LA 4ZVQB 1JLFB 4MKBA 5EWFA 2CQPA 2Z2YB 3EX7B 3GR1A 2DO0A 2VZ9A 4JI4J 1F3VA 1PJ5A 3GQCA 3VR1A 1NKBA 2DH9A 4TQRA 3KJVB 4WK3A 3QLHB 3P5BP 5K5MA 4PPZA 4ITSA 5HBMA 1PAUB 3Q8YA 2X51A 5JXSA 1VK3A 1UEVA 3LTOA 4NE9C 2CPXA 4NEYA 3D0GE 1X0PA 4OYOA 2KXHA 1U8SA 2AJQA 1CC7A 3ONQA 4Q44A 1SJ4P 3FSXA 1D8ZA 2ACYA 4NA3A 2XMVA 3MTJA 1KLNA 2RUGA 5F9LA 1YZ6A 1RDRA 3W9JA 1EX8A 5B08A 2UUBF 2KU7A 3R3TA 3ADAC 3N5FA 4C4WA 4DV0J 3K5PA 3HK2A 1FJGF 4DL2A 3OL9A 3MUMP 3T1AA 3SQGB 2K1RB 4J9NA 4PXEA 4NLVA 4DR3F 4OZJA 2OPRB 3D0HE 4CT8A 5L1LA 2Q43A 2AYBA 1RTJB 2I2YA 3LPYA 1U1MA 3VVTA 3GILA 3MFIA 1CJVB 2CZVC 3I6PA 1WHWA 1G7CB 3TUIC 2XQCA 1IWGA 2HFVA 2H4YB 3G82B 3W61A 1SH3A 2IYIA 3SV3A 1T9YA 4DV2J 4MYTA 1R0AB 1HQEA 4ED4A 1FDNA 3UR3C 1DQAA 4OZ1A 4O3SA 2JEIA 2CQGA 4OI2A 5DDOC 1SJFA 3EGWB 2Y8WA 5ETLA 3N01A 2CZ9A 3G96A 3H2UB 4WBFA
chains in the Genus database with same CATH topology
5E7OB 1TZ0A 1R27B 5IFMA 5K8OA 2R7SA 2FJVA 2UZAA 1IKWB 1VS3A 2IHR1 3M2RA 3MM7A 1BQXA 1X0FA 1YJTA 2AX1A 4MAKA 2YNIB 5GAEU 4RUCA 3CJKB 1N34F 4RW8B 4A8WA 2YWGA 1U47A 1AFJA 3RW6A 2JOQA 1M1KT 2LLZA 3R5AA 1FESA 2RQCA 5IS2A 1QM9A 4KTQA 1U1RA 2LA6A 2DHSA 1UJ4A 3ULHA 2R7QA 1R7IA 3DDKA 3BO3A 1SXLA 4M1KA 3TYTA 3JYTA 1JLCA 4WZMA 1N32F 4I64A 2OTJS 4QIEA 3J7A1 3C6UA 2POKA 1HMVA 3THVA 5IZHA 2RKIA 4PUOA 2XCPA 2GJIA 5A6WA 3RR7A 1MU2A 4WYWA 5D4LA 3DRRA 2K3IA 3V4IA 1HW9A 4A48A 2XLKA 2R7WA 4PQAA 2CVEA 4WIIA 4PXDA 5T7LB 2O1PA 4K5SA 2IJFA 2CJAA 3KHRA 3KLGB 3QZ8A 4F2SA 2DPIA 2CQ1A 1HW8A 4H4KC 4QWDA 5JVGQ 3MCSA 2XCAA 1OIAA 3DLLQ 2AX0A 3OJUA 3HHNB 2LXFA 1TK8A 4EBCA 2JX2A 4DBQA 4JV0A 4QU6A 5J1EB 3T5LA 2ZE2A 1JKHA 3RB4A 3G6ES 3T5JA 1B64A 1JNRB 2E1MC 2HNDB 3GMGA 1B0TA 2VBYA 4AL5A 3AH6A 1UA0A 3S6EA 3V2UC 5HBMB 4EO6A 2BABA 4LF4F 1HBNA 5GADU 1C0UB 5SUHA 3VAGA 3RAXA 1BLUA 2IJNA 2EFPA 4O4GA 4WFZA 1U1LA 3RYLA 3I96A 4IFYB 2M8HA 2NPFA 4X4UA 3K57A 2CJBA 4Y2AA 4J9OA 3GSDA 1N6QA 4X4SA 2CPFA 1YIJS 1GH8A 2R2SA 1RT7A 3AA9A 3B8HA 1L3SA 2J8AA 1T7PA 4WU2A 4QYRA 1C4AA 3MEEA 2DGSA 3I5BA 4O3PA 5DQIA 3VAIA 3PM9A 3K0JA 4N8NA 2ZM6F 3GIMA 2OH2A 2YKPA 1ZBTA 4TN2A 1O0PA 1FNOA 2P9EA 2WOMB 2ZUGA 1JLBA 1XEZA 4TU9A 2GV1A 3B4DA 3CJ2A 3LWMA 2GCFA 2LDIA 2E1AA 5DDQC 3VAHA 5KFJA 3L95X 3J7Z5 4DSFA 3DLHA 1FT8A 2YH1A 1GAOA 2FLOA 2M8DB 1OSDA 2WSCC 4QBUA 1T05A 1Z1ZA 3WC2A 2MZSA 3PW2A 4M95A 1IUJA 2M9KA 1E6VB 2KO1A 1HNWF 2RVJA 4U7UK 3NMRA 2AJ4A 2DH7A 2MZTA 1QAJA 4NL5A 5LXYA 4IR9A 1BC6A 5J1PA 4NA1A 4DR4F 1XWLA 3HVTB 2FTRA 2KKHA 4K59A 1QUPA 4MIBA 3MPVA 2HW3A 3BEGB 2HHHF 3ETOA 3KLVA 1MSWD 2J7UA 3PX6A 3I4HX 5DLFA 2MSTA 5HP1B 4WFYA 2CQBA 3JAMY 4OJHA 4LF6F 1KRPA 3QYYA 2JLEA 1L3UA 2ZD1A 1C1CA 2YNFB 3ITHB 4RLEA 5KT7A 3FFIB 4B3RF 4PWDB 2EBEA 3FSYA 4JUZA 2RMLA 1RT5A 2UUCF 4PG5A 1VI7A 2R7XA 4QIFA 4TY8A 3PKMA 2LQ9A 2MB0B 2DJWA