1JLAB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
435
structure length
408
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 RT A-chain
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
total genus 111
structure length 408
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB03
2AGOA 5EDWA 1S1UA 3KK2B 2W8KA 3KMQA 3KHGA 2VG7B 1JLEA 4ZVFA 2ZE2B 3G6VA 4GC6A 2OPSB 2YNFB 3MECB 1S6PB 4K4WA 3KLIB 3I5BA 4NLPA 3H98A 4ZPBA 4URGA 3KNAA 2HNDA 3RBDA 4U6PA 4FBUA 2O5DA 3CDUA 1S97A 2JLEA 4ECUA 1RTDB 4QPXA 4YQWA 3FFIA 1HQEA 3I0RB 4TN2A 5F8IA 4F4XA 4NLXA 4XPCA 3N6NA 3EPGA 4ZVHA 3SFGA 3GV7B 4I2QB 2HMIA 4KAIA 4R0EA 5KFIA 4EYHB 2FLNA 1WNEA 1JLBB 3Q8SB 1QUVA 4ZPDA 3FRZA 5FDLA 2C28A 2CKWA 3GV8B 3KLEB 1C0TB 1N5YA 5DGAA 3TVKA 4IG0B 3OHBA 5C25A 1S6QA 1TVRB 3BSCA 1T05B 2OPPB 5C24B 4F50A 2RF2A 2XGQA 2C22A 1HYSA 4Q8EA 1S1TA 3OLAA 3RB3A 2WONA 3T1AA 1Z4UA 4ZP9A 4QWCA 1DLOA 4IQXA 3DOKA 4KSEB 1RT4B 5HBMA 4J9MA 2HNYB 2W7PA 1S9EB 4FS2A 4B3OA 5KT3A 4YP3A 3DRRA 4O4RA 5KFUA 4X2BA 1S1UB 1LW0A 1JLEB 2AGPA 1S1XA 5DG7A 3IS9A 2FJWA 1K1QA 3N6MA 2WK4A 3PW4A 4RW6A 1GX5A 2HNDB 3IRXA 5DLFA 3MEDA 2HWIA 4XO0A 4ED3A 3V4IA 4WYLA 5KT2A 1HNVA 1HQEB 3FFIB 3M9MB 4ED2A 4ZP6A 2YNHA 1EETA 3KHLA 4O3RA 5L1JA 4DL7A 2D3UA 4LSLA 4NLRA 4URQU 2HMIB 1VRTA 4MIBA 3QGHA 2BQ3A 4IRDA 2YKMA 4H54A 1JXLA 5FDLB 3IGNA 5C5JA 1XR7A 4JUZA 3DRSA 5EWFA 5L1IA 1N5YB 2R8JA 3UQSA 4IRKA 3LP0A 2FJVA 2ASJA 1S0OA 4J9PA 1S6QB 5J2MA 5F8NA 1C1BA 1JLCA 2DPIA 1U09A 2D41A 2E9TA 3DYAA 2RF2B 4NRTA 3H40A 5C42A 1HYSB 1W25A 1S1TB 3M9NB 3V6DA 1N56A 2WONB 3FQKA 2HWHA 4K50A 1DLOB 1S9FA 5HBMB 3HVAA 4J9KA 3DRPA 4B3OB 2AX0A 4ED0A 1RT2A 3DRRB 4O3SA 2GC8A 2I5JB 4IH7A 1LW0B 4NLVA 5HP1A 1RT7A 1S1XB 3IS9B 3DI6A 4RW6B 4KB7A 1LWFA 1QAIA 5EUHA 4URSA 4ECVA 3IRXB 2D7SA 4EBDA 4NRUA 5KFEA 3NL0A 4LQ9A 3V4IB 3V6KA 2W9BA 1HNVB 3DLKA 3V81B 3C6TA 4TXSA 2FVCA 1SH3A 5KG4A 3G6YA 2YNHB 4K4XA 1EETB 4J9NA 3PW7A 1N48A 4KHMA 3V6JA 3IGVA 4Y3CA 4U7CA 3OLBA 4M94A 5T14A 2J6UA 5JUMA 3LP0B 3QGGA 5KFFA 5J2MB 1C1BB 1JLCB 4NCGB 1C2PA 1KHVA 4ED8A 1C0TA 1REVB 3DYAB 2E9RX 3PW5A 5C42B 4IG0A 2IM1A 3PR4A 3G86A 2RKIA 1N6QA 1ZTWA 3E01B 3RB4A 3V6DB 3JYTA 4F4WA 3T5KA 4ICLA 4EO6A 4RUCA 3RAXA 2OPPA 3NKYA 3OL8A 2AU0A 1HARA 4ED6A 1XR5A 4WE1A 4DEZA 3LP1A 2XI3A 3CWJA 1UWBA 1RT2B 1S9GA 5J2QA 4RU9A 4RW8A 5HP1B 1RTJA 4I7FA 4KKOA 1RT7B 2ILZA 5KFVA 4QWEA 2FVPA 3H4BA 4FS1A 4OL8A 4Y34A 3DI6B 4KFBA 3KK3A 2HNYA 2GIQA 5L1KA 3RB6A 1LWFB 3PJWA 1D0EA 3E51A 4DL6A 1JLQA 4K4YA 4RW9A 1DTQA 1CSJA 4ECRA 5L9XA 2W9BB 3DLKB 3C6TB 1S49A 2W7OA 4QWBA 5KFSA 5DQIA 1RYSA 3QLHA 3VQSA 1SV5A 2WOMA 1T94A 1DTTA 2ATLA 5KFZA 2V4RA 2BQUA 1YVFA 4ID5A 2OH2A 1BQMA 5K14A 4ECQA 5J1EA 2ALZA 1JLFA 3MFHA 4YMEA 3EPIA 1HQUA 1FK9A 4O3NA 2ZD1A 4ECXA 1LWEA 5I3UA 2RKIB 1N6QB 2IJFA 3JYTB 1RT6A 4Q44A 4ICLB 5KFHA 4DG1A 3LANA 4ECTA 2HAIA 4WE1B 2VA3A 3LP1B 2FLLA 1UWBB 1S9GB 5J2QB 1TKTA 4RW8B 4JV1A 2ASLA 1RA6A 1RTJB 4I7FB 4KKOB 3D5MA 1S1WA 2BRKA 5F8LA 4KFBB 1NHUA 4RW4B 3KK3B 4Q43A 1TL1A 4RNFA 4J9LA 4QW8A 1RDRA 2I5JA 1NHVA 4IOBA 1JLQB 3CJ4A 4ZVEA 4RW9B 1DTQB 2ZKUA 5KFPA 2D3ZA 4IFYB 3SI8A 4ZHRA 2JEIA 3HVTA 1RT1A 3OL6A 4NLTA 3QLHB 3UR0A 2GIRA 1SV5B 2XCPA 2WOMB 3V6HA 3NMAA 4EYIB 1DTTB 4Q45A 3HVWA 3QZ7A 5DQHA 3V81A 5HLFA 5F8GA 4ID5B 4RW7B 4IR9A 4R8UA 2YNGA 2R8KA 1BQMB 5K14B 4M95A 3KOAA 4IH5A 3C6UB 5F9LA 5J1EB 3UPFA 1MU2B 3PHEA 3TQ1A 1JLFB 3H59A 4F4YA 3JSMA 1C0UA 1HQUB 4TY9A 1FK9B 4J9SA 3KJVA 3CO9A 2ZD1B 1LWEB 4NLOA 4DL2A 5I3UB 2V9WA 1FKPA 1RT6B 4NZ0A 4IR1A 1KLMA 4NCGA 4DG1B 3BGRA 1GX6A 5KFJA 1RYRA 1RAJA 1REVA 4R5PA 3IG1A 3RBEA 3E01A 3KK1A 1TKTB 3KLGA 1JX4A 4ZP8A 1JKHA 3H5SA 5KFOA 1S1WB 3G6XA 3BQ0A 4IKAA 1NNDA 1RTHA 4IG3B 4K4VA 3RB0A 3H5XA 1TL1B 3DMJA 4ECZA 1TKXA 5HROA 3M9OB 3BSAA 4F4ZA 4ECYA 2ASDA 4YR0A 3LP2B 1K1SA 2UVRA 4KO0A 4NLSA 3PZPA 4KV8B 5DLGA 2UVWA 5KT6A 2BRLA 2OPRA 4ZHRB 4NYZA 3HVTB 1RT1B 4TQRA 5KG0A 2R8IA 1S1VA 4NLUA 3KMSA 4WZMA 2IMWP 1R0AB 5HLFB 4YR3A 2R2UA 4R8UB 5F8MA 2YNGB 5CYMA 1ZTTA 2W9CA 2AWZA 2BQRA 4ECSA 2C2EA 3T5LA 2UVUA 5EWEA 3JSMB 1C0UB 3OHAA 3MR2A 5KFGA 3KJVB 1S0NA 4NLGA 1JLAA 4RZRA 1FKPB 4MH8A 5CYQA 1KLMB 4K4ZA 1I6JA 3BGRB 3M8PA 2UUWA 3HHKA 4HKQA 5DQGA 3MFIA 4R5PB 2FJXA 3IG1B 2RDJA 3GIMA 4QW9A 4MK8A 4G3IA 5KG1A 3KK1B 4NLYA 1LWCA 3KLGB 2W9AA 3M8QA 2IJNA 3QO9A 3GYNA 1JKHB 2OPQA 2XWYA 3GILA 2JEFA 2E9ZA 1RTHB 1OS5A 5KT5A 2W8LA 4NLWA 3DMJB 2B5JA 1XR6A 1TKXB 5HROB 4QWDA 3MR6A 2B6AA 5DG8A 3KLHA 1TQLA 3T5HA 1JLGA 3PR5B 1HMVA 3DOLA 4KO0B 3FDSA 1TV6B 3H2LA 3T5JA 3TAMA 1HPZA 4RW4A 4H4OA 1EP4A 3CJ3A 2OPRB 4H4MA 4PUOA 4TY8A 4I2PA 2IBKA 3PJXA 1BQNB 1S48A 1S1VB 4TYBA 2YNIA 4O3OA 4NLDA 1J5OA 3CIZA 4TLRA 2J6SA 3D28A 4DL4A 4IFYA 2VG5A 5CYMB 2W9CB 3H5YA 3I0SA 1MMLA 3MR3A 4ZMMA 3IN5A 3DLGA 5L1LA 4RW7A 1RT5A 5KFWA 3RAQA 2BE2B 3GIIA 1JLAB 2CJQA 4J9OA 2IA6A 3FQLA 3C6UA 1QE1A 3OL9A 4MFBA 5CYQB 1MU2A 3MEGA 5J2NA 2AX1A 4ZPCA 3QZ8A 2R8HA 3M8PB 4IFVA 4O3PA 3MR5A 4GC7A 4KBIA 3PW0A 1LWCB 1S4FA 4MIAA 4NLQA 3M8QB 1S10A 3QO9B 1S0MA 2OPQB 3LALA 5KG5A 2ILYA 4O44A 5KFTA 3N6LA 3CJ2A 2B5JB 3GIKA 2JEJA 3DDKA 2B6AB 3NAHA 3KLHB 2V0NA 2YKNB 3BQ1A 3EZUA 3I5AA 3ITHA 5I42A 4IRCA 4FBTA 1JLGB 1HMVB 3DOLB 3CVKA 4RNOA 1IKYA 4IG3A 3TAMB 1HPZB 4H4OB 1EP4B 3OL7A 4TY8B 4PUOB 4H4MB 2IC3B 2VG6A 2EC0A 4I2PB 5KFQA 2QV6A 3FSIA 3QIDA 2YNIB 2UVVA 3LP2A 4KHRA 4WFYA 1J5OB 4KV8A 2XI2A 4DL5A 3CJ5A 1TKZB 3KLVA 4WXOA 2R2RA 2VG5B 4IH6A 2IM3A 3LAKA 3KLFA 2WRMA 4WYWA 3SFUA 3I0SB 5D3GA 2F8EX 4MKBA 1TP7A 1VRUA 1R0AA 3DLGB 4RNNA 1RT5B 3GQCA 5KFCA 5F8JA 3MF5A 4O4GA 2R8GA 4IDKB 3CDWA 3MTKA 2FVQA 1QE1B 4MFBB 3MEGB 5J2NB 2FVSA 2IM2A 3CJ0A 1SH2A 3OSPA 4IFVB 1IKVA 4G1QA 3Q8PB 3GIJA 4TQSA 2FLPA 4ZVGA 3KHRA 3T19A 3PVXA 3PW2A 3DM2A 2IM0A 4O3QA 5KFDA 5F8HA 1RTIA 3BQ2A 3MEEA 1T03A 2HNZA 4LQ3A 4O44B 4Q8FA 5DGBA 5KT7A 4TYAA 1D1UA 3H4DA 3NGDA 3ITHB 5I42B 5KG7A 4MKAA 3DLEA 4RNHA 1IKYB 4K4TA 2UUTA 4JV2A 1LW2A 4DL3A 1TL3A 2VG6B 3KHHA 3NBPA 4PQUA 3BSOA 4ED1A 1SUQA 1IKWA 4YR2A 1QAJA 4WFZA 1N4LA 1TV6A 5C25B 3I5CA 3QGIA 4ZP7A 5KFRA 2AQ4A 3QIPA 4JV0A 1RA7A 1BQNA 3KLFB 3BSNA 3GV5B 2JC1A 5D3GB 2AGQA 2BANA 4WXWA 4XPEA 1VRUB 5KG3A 2I1RA 4EBCA 4EO8A 4O4GB 4WZQA 4LSNA 3DOKB 1SH0A 5KT4A 1KHWA 3OSNA 1FKOA 4KE5A 4EBEA 1RT3A 1IKVB 4G1QB 2J6TA 2BE2A 3HKWA 1C1CA 2FVRA 5J2PA 4PWDA 3DM2B 4ED7A 2C2DA 4MK9A 3BREA 4K4SA 1IKXA 1RTIB 2IAJA 1HNIA 3MEEB 1T03B 2HNZB 4Q0BA 1JIHA 2WB4A 3KK2A 3UDLA 2C2RA 2VG7A 3MEDB 4ZPAA 5KG6A 2ZE2A 4MK7A 2OPSA 2YNFA 3MECA 1T3NA 1S6PA 3ICLA 3KLIA 2DPJA 3LAMA 2XC9A 3DLEB 4Y2AA 5KFYA 1ZETA 5KFNA 4J9RA 1LW2B 4LSLB 2B43A 3Q8RB 5KFAA 1VRTB 3CDEA 1TL3B 2YKMB 2WCXA 3ISND 3NBPB 1RTDA 4PQUB 2YKNA 3NAIA 4WFXA 3I0RA 5KFLA 4RUAA 1SUQB 1IKWB 3DRSB 4K4UA 5KG2A 3ISNC 4I2QA 2R2SA 2RDIA 2VA2A 2JC0A 2IC3A 1JLBA 3QIPB 2WHOA 2V4QA 2WTFA 2XCAA 4J9QA 3KLEA 2R2TA 2BANB 3Q8QB 4QWAA 5KFXA 5KFBA 4HYKA 2BR0A 1TKZA 1TVRA 4ECWA 1T05A 4LSNB 5C24A 4RNMA 5JXSA 3QYYA 1FKOB 3DRPB 5F9NA 5KFKA 5KFMA 1RT3B 2QE5A 3H5UA 2JEGA 5EWGA 1C1CB 4PWDB 5J2PB 4IDKA 1IM4A 5DG9A 3BJYA 4EEYA 2XGPA 1RT4A 3BR9A 1IKXB 1S9EA 4Y2CA 2IAJB 1HNIB 4Q0BB
chains in the Genus database with same CATH superfamily
5DM7Q 1N54B 4QZVB 3H98A 2HSEB 4RX6A 3UNYA 2CNKB 4AE5A 3PY8A 2IVYA 4WTOB 1NU4A 3SSRA 4DPYA 4PPDA 1TTHB 2VFUA 4B3RJ 2DRAA 1QUVA 3FRZA 1C0TB 3W65A 1PBUA 2RS2A 2Z2YB 5CCLA 3RB3A 2IYIA 3H25A 4O4RA 2FTRA 1JLEB 3JAMY 4RBUA 2KHDA 4FVMA 2QEXS 3MMBB 4ED3A 4GVBB 4BC9A 4WJBA 5MAOA 1RHKB 5ETRA 1VIOA 2D3UA 3ULHA 3D6HB 4B3SF 2M5YA 1QD1A 5F8NA 3OR2B 3R6LB 5G4DA 4JV5F 1NJYA 2G0CA 1EX8A 3RRHA 1BMQB 4NRUA 3BDPA 1I1GA 3V6KA 1I94F 1HNVB 1H0HB 1W26A 3OLBA 4ZVSB 5T14A 4KT0C 1NB2A 2ZKTA 3PYDA 2C3UA 1C2PA 4HACA 1REVB 2RE1A 2XHCA 2IM1A 3E01B 2Q3PA 2AU0A 1S0VA 1XR5A 2PEHA 1RT2B 2B9EA 2E29A 3CMAS 3CJKB 1VQMS 4MYTA 4LBPA 2FLOA 4RW9A 3WBZA 1HR0J 2UXBJ 1WF2A 4FNHA 3PTWA 5HN0A 3MCMA 2C2ZB 4RWXA 4DXLA 2RD5C 3NG8A 3GIRA 2G13A 4M5LA 1Y4ZB 2Y9HA 3ZNUA 1RA6A 2BOPA 5F8LA 1QAYA 2A6OA 1ZS6A 2I5JA 2OAUA 2V6AA 4FDFA 4C3KA 1N5TA 3IBWA 5DETA 3P49B 1RE1B 3FEYB 2E66A 3W62A 1PJ5A 5CCMA 1I5OB 2CQ0A 2GFFA 2Y1IA 1KS2A 3KLGA 4QU7A 3G6XA 4ILMA 5G0RB 1TL1B 3M6UA 1FVSA 4C98A 5HROA 4ECYA 2K06A 5ITHA 3L3CA 4OYBA 3J7ZT 3NGUA 2XQCA 2CDRB 2E1AA 3Q8UA 1U2FA 4JI4J 1I6JA 3D0IE 1OSCA 3FC9A 2NPFA 2RDJA 5B0AA 4G3IA 1M5PC 1JKHB 3VGSA 1S4EA 2W8LA 4NLWA 4QWDA 3SMZA 3PNIA 4L3KA 3T5HA 4A8KA 2E5JA 3CJ3A 3T9NA 2HW3A 4O3OA 2RRBA 2XYHB 5CYMB 2LQ5A 2VODA 5M2PA 1KOHA 2QA4S 4ZPVR 4O3PA 3KYLA 4FZVA 1XMQF 4LRBA 4G1PA 2PI4A 5AXMA 2W2NP 1J5OB 2XI2A 3CJ5A 2PIIA 2F8EX 2MZSA 1Q86T 2JHEA 1PSDA 4IFVB 3QQCD 4G1QA 2E5LJ 4ZDNA 4TQSA 3KHRA 1WF1A 1CJVA 1WJ9A 4L74A 1PYOB 2I0XA 5I42B 1V6HA 3PIPQ 3SIPB 5D4PA 2JDJA 2BJ8A 4DR4F 3O5TB 3HZGA 3KLFB 2KB2A 3ENQA 4KGKA 2DISA 4WPAA 4MKYA 2XMVA 1WORA 1ZAVA 2ZH2A 4CQ1A 4JI7J 4X62F 1SH0A 3HO1A 3LPYA 1RT3A 1IKVB 2LECA 2NCKL 1WOOA 2RHQB 5HJYA 4LRFA 1M0SA 2VJUA 1HBOB 2QLFB 2OPSA 4FXDA 3QRPA 3DLEB 2WCXA 2A3JA 5DZ6A 2HKEA 1LQ9A 4V1Ak 2R2TA 1NDPA 3TA0A 4K8RA 1D8ZA 4F7VA 1UEVA 1Y3JA 2EK1A 3D1HA 3R5DA 1F9EB 4KY3A 1E6VA 1N0VC 3DOMA 4LR7A 2YNFB 1QAXA 9ATCB 2NSBA 2HNDA 3RBDA 5J1NA 4FBUA 1VJWA 4YQWA 4NLXA 2HHPA 3GV7B 4U8YA 3KLEB 5C25A 2XYPB 3CSKA 3RR8A 3D68A 1Q95G 1J5EJ 5AE3A 2XGQA 4LREA 2PO4A 1IQZA 3T1AA 1TUVA 1RBLA 1YBUA 2LLZA 4NA2A 5KFUA 4ED4A 2P8IA 1M5SA 4YB7A 2DNLA 4EI2A 2V2KA 4QBUA 1T11A 2UXDF 2VQEF 3FFIB 3KHLA 3ZZPA 5D0GA 1HHQA 2YKMA 4CLPA 8RUCA 4HDHA 4WBFA 4XAKA 2IY5B 3L09A 2QMUB 1N56A 1GNKA 2XY6A 1UVJA 2JOQA 4B3TJ 4O3SA 2VPZB 3IS9B 4I6AA 2QA4G 4CLWA 4CH0S 3GFHA 3NL0A 4LQ9A 4HT5A 3QJPA 2WSCC 1L3SA 3T1YF 5HI7A 3MPWA 4OX6A 3QGPA 3AJDA 1O5JA 4A8XA 3DYAB 3PW5A 3PFEA 3KDOA 3T5KA 2OPPA 1XMOF 3EGNA 5IXUA 1WC0A 5B08A 1SJ1A 4Y34A 1EQ0A 4DX5A 2W9BB 3TVZA 1RYSA 3FCVA 4C11B 2HZAA 2YKAA 3W60A 5DDQC 1F9HA 4OZNA 4DFMA 2Q6BA 4DUZF 1SKSA 2CJ9A 3LWLA 4XDDA 3LANA 2G0JA 1KKHA 4WE1B 2AZ3A 2UUCF 3Q2SC 4RW4B 4K0KJ 4KHPF 1SQFA 3JQMA 2WVDA 4ETZA 2AZ1A 1FO1A 5U47A 3NMAA 1DTTB 1B99A 4UY85 3QZ7A 3MM6B 4OJ1A 1VQNS 2F8MA 2XZWA 4YDXA 1WWHA 4AFFA 3UPFA 3JSMA 5HMWA 1HQUB 4IQMA 3KJVA 2UUBJ 2JSXA 2W4DA 2HQIA 3BGRA 2AYMA 1RYRA 4R5PA 2Z2ZA 5CYJA 2J5AA 4B9LA 3DMJA 1UZHA 1Y5NB 1X5OA 1JWWA 4QU6A 3NOCA 1KDNA 2GQCA 3ZTQA 3S7RA 4QIGA 3QT5A 1HNWJ 3LPEA 4JYAF 5C7PA 1VBYA 1H7WA 4Q5VA 2FPHX 3I9V9 2FJXA 1FFSB 1TKDA 2IJNA 4HH0A 2GHVC 3CCTA 2B5JA 5DG8A 3GFYA 3IA0A 2X3DA 2DY9A 4DFJA 1EP4A 3W5ZA 2OPRB 4H4MA 2RB7A 1S48A 4ZLLA 1VOMA 3H5YA 1H3DA 3I0SA 2VC0A 4DBQA 4ZN1A 2V2ZA 2O01C 4B9VA 2CQCA 3LW5C 2NXUA 3M8QB 2BVZA 3DDKA 2B6AB 5AXNA 1UA1A 1Q53A 1DFDA 1PAUB 2CIMA 4DR1F 4KV8A 1FHTA 4A48A 4WYWA 4CTAA 2DXDA 4LJMA 4LF6J 2R8GA 4MFBB 4LRCA 3SCLE 1UTAA 3J7A1 1XK8A 3VCDA 1LW2A 1JMTA 4LFAJ 1TL3A 3BSOA 5T41A 4WFZA 3TP2A 4ANEA 3SDEA 3Q2TC 2IVMA 4XDCA 3SCIE 3KWMA 1Q4RA 2MQNA 5HANA 2ZBPA 3DLJA 2LYVA 3OTOJ 4JI2F 5KG6A 2HLTA 1VC5A 4TU7A 4J9RA 3VGVA 3Q8RB 1VRTB 3TWZA 1SI9A 3E8OA 5KG2A 3VAKA 4BLGA 1CPZA 4CLKA 2JC0A 4NPOA 1A6LA 3QAUA 3CCWA 3AQOA 4DX8H 1HQ2A 3DRPB 2Y0BB 3GSIA 3MM5B 2V94A 2NPIA 2HGLA 1EB0A 4DQPA 1SBRA 3GU0A 4DR2F 4DQRA 2NUUG 2VFTA 4ZPBA 1FXLA 2MQMA 2B4UA 3CMQA 2E7XA 3EGWB 3HT0A 1FD2A 5GAGI 3QJLA 3JXOA 5B09A 4ZLNA 5KFIA 5E3RA 4N8NA 2U1AA 1QDUB 2NR0A 1GXUA 4ZLPA 1TVRB 2EFVA 5C24B 2RF2A 3TO8A 3OBIA 1YX2A 4W98A 3HKZD 3RBXA 4D3GA 4QPTA 3W5XA 4DPXA 3EM1A 1ZOTA 3N5BA 2OEKA 4RW6A 2AJ2A 3FK4A 3I31A 5A8KA 3EWGA 1F5CA 1VISA 1EETA 5ETQA 2Z8QA 2QSWA 4CT8A 4IRDA 1JXLA 1D9FA 5L1IA 1XR7A 4IRKA 3MM9A 2QRRA 1DJ0A 2XBPA 2PN6A 4DR5J 2FDNA 5DRKA 5A0YA 3R7SB 3H7HB 2YQ1A 2YQ3A 4NXMF 3TX8A 1LW0B 4P7TA 1S1XB 3TZWA 2GQ2A 1Q7YT 3DI6A 4KYZA 3M2VB 4M5DA 1YRUA 5AT1B 4JI5F 3KJFB 4KGVB 3TOQA 1OJ4A 3V6JA 5IV3A 1FTRA 1C1BB 4RL1A 3NGKA 5C42B 3OL8A 2Q66A 4JOUA 2YTCA 2KZZA 2FVPA 4LR8A 1LFWA 3NXZA 2GIQA 2GMLA 3RB6A 4ZJLA 4OI4A 3DLKB 1A9NB 2F65A 4HHJA 2H65B 1T94A 4OFZA 5IOLA 4DLGA 1KWMA 4ID5A 4W92B 1L3KA 1H7XA 2ZJPQ 3N01A 1X7VA 3C14B 5K5MA 3Q24A 5LMNF 2HPUA 1RZMA 1RAHB 1TKTA 3EDRB 1CBKA 1S1WA 4QR1A 1KFSA 2YKPA 3HSDA 1RDRA 1Q8IA 2BKOA 1GMVA 1K44A 2D3ZA 3K5MA 3SI8A 5H9FK 2H4YB 1F5AA 1NKEA 1VQ7S 3C6UB 1XIQA 1JB0C 4H4KA 2AJ1A 3GWCA 3CCSS 3CO9A 4CI0B 4NCGA 3TZYA 3M8SA 3UDVA 2WW8A 4ZKAA 1NNDA 4ECZA 2E5IA 3R3TA 1NJIT 1WHXA 1ZM2A 2JX2A 3GYGA 4UOFA 4WKYA 5HLFB 5E3CA 2F9JA 3GG1A 4QIWD 3BKUA 2W9CA 4PWWA 2AWZA 4CLFA 4BWMA 5D0RA 2VV5A 4DN0A 5LXYA 3M7VA 4WFNQ 3D9BA 2PT0A 1C4AA 5B7WA 1GH8A 1WEYA 3GYNA 4NA1A 1UFLA 3W64A 3ZZTA 4OYXA 4TY8A 3W1YC 3W9HA 3MAQA 2R7UA 2YNIA 1PYSB 4A8YA 2G0IA 2WVBA 4YY3J 2UU9J 1WHWA 2YKOA 2EBEA 1ZM3A 2R7RA 4GRSA 2XWXA 2CQDA 5KFWA 2BJ7A 5HVHA 3ET6B 4B3MF 1MU2A 2R8HA 3K89A 1X8DA 1FI4A 4O44A 3F44A 3KG4A 1FT8A 2YKNB 1HMVB 1IKYA 4OX8A 1WC6A 1N8RT 3MMAB 1AW0A 2V8VA 3BZQA 4LF1A 3MF5A 3VVUA 3MTKA 2ZH7A 3R5JB 5ETNA 2A2DA 2FLPA 1EZZB 2W25A 4LF5J 1RUSA 4LQ3A 1CJTB 1CC7A 4HR2A 3H4DA 3D3CJ 1SC4B 2MGZB 1YG0A 3UD3P 4CO3A 4YR2A 5KFRA 1PC4A 2M8DB 3FBFA 1FDBA 2GJIA 2XMWA 4RU2A 3HXMA 1MNEA 1PBAA 4DS4A 3DM2B 3S01A 1MWZA 1IQTA 2DNPA 3CIMA 3UVJB 1S7IA 2ACMA 5HK4A 1ZM9A 3DRSB 1RHRB 3BKFA 2LQBA 3PG9A 4OV6A 3AXMA 2HVIA 1L3VA 4PG7A 1YK9A 2JNJA 5F9NA 2EEYA 5KFMA 2QE5A 2JEGA 2MQLA 1YJ9S 1R7IA 5LSRA 4NYOA 1RT4A 4I67A 1RJJA 3HPOA 3PACA 3THPA 3GMGA 3K17A 2Y0SD 5HO4A 2DNHA 3F56A 2VF3A 2EBGA 2DY1A 1NK7A 1HWUA 2YX1A 4DCOB 1U02A 3TQEA 1SC6A 4PG6A 2GHPA 4OJGA 2MZRA 1HYSA 1DLOA 3IBCB 4WWSA 3GJTB 3MD3A 1WC5A 4LRAA 4AL5A 1K1QA 5AJ3J 3O1LA 2P9EA 3I9ZA 4ZJOA 4PAAA 4RKUC 3CDBA 3NOGA 5FDLB 5EWFA 2DGQA 1AFJA 2I9SA 4ZVTB 4A8FA 5CZXA 2AJ0A 2GO9A 3DFEA 3HFVA 3DXSX 3RW6A 3JQJA 1HL6A 2AX0A 4NLVA 1NK6A 1RT7A 3L7UA 1SKUB 4OLOA 5EUHA 4LBHA 1BWVA 2MZ1A 5KFEA 1NAQA 3HMJG 5L8RC 4N47A 1U6BA 1N48A 2DIVA 1CLFA 3IGVA 1R27B 1UPMB 4LT6A 4TLQA 2J6UA 2ERRA 1Y10A 2DCUB 5E7OB 5KFFA 1JLCB 5L38A 2LKZA 2RIJA 1C0TA 1R8HA 3G86A 3AFGA 1HFEL 4QR2A 3V6DB 4ICLA 3ETMA 1T02A 1U1KA 3W9JA 1NHKL 3W2WB 2DITA 2YXLA 2IPOB 1RTJA 2YWGA 3M30B 3I56S 3SSQA 4X84A 1PJ6A 4NZ6A 4QIVA 4ECRA 4DL0C 1SV5A 2ZDPA 3T6BA 2ZH5A 2M88A 3T3FA 2ZBRA 5F0WA 1S76D 2AIRB 2RKIB 4LFCF 5GAHU 5ADZA 5LT5A 1T9YA 3CF5Q 1YLXA 9RUBA 4I7FB 1TZ0A 1FXDA 3A12A 4UOCA 1FD8A 2JJ4D 1ROFA 2Z2LA 3THVA 1RHMB 2HAFA 3OL6A 2CJAA 4R8UA 4OMFG 4EZ9A 1K9MT 5JVHQ 1CQNA 1FK9B 4K5RA 2Y8WA 3Q8VA 1RT6B 7FD1A 1IJFB 1XERA 1MW7A 1REVA 3E01A 3KK1A 2RHSB 4K4VA 3M9OB 2AEJA 3UN3A 2VDIA 2BUNA 3T6JA 3ONQA 4PCQA 4ILLA 1R0AB 2RRNA 1RWPB 4M5HA 1CJKA 3M32B 2XMUA 2UVUA 3OR1B 3RTVA 4DV6J 1KLMB 2ZHBA 1NO8A 3MFIA 2LXUA 4QW9A 4W90B 5KG1A 4NLYA 2IRYA 3IR6B 2XWYA 2FJEB 4M63A 2LEPA 3BH7B 4O0IA 1YQHA 4KO0B 1TV6B 4PUOA 4JI0F 1BQNB 3O8WA 5ETOA 3DLHA 4U7UD 3QATA 2ZEJA 4TKTA 2ROPA 1QE1A 2HG4A 3NCPA 3B54A 4F4AA 2CPEA 4MIAA 5KFTA 2J8SA 4KPYA 3CW2C 2LEBA 1HBMB 5B0GA 3MAHA 3O44A 1VHFA 3U7JA 2HHWA 4LF9F 3US5A 1RCOB 1LOUA 3RR7A 1V3ZA 1Q8BA 2OI2A 3MEEA 4C0OC 1OMSA 2GMJA 2HRUA 4DR6J 1RCXB 4OZJA 5FLXY 4DV5F 3QJJA 1FFGB 4QQBA 4ED1A 4B9UA 2RQ4A 4OHYA 3VGUA 2C1EB 2BE9B 4UUXA 3MDFA 4UQTA 2O66A 2I1RA 4B9MA 1N5QA 3ZZOA 4BC7A 3MEKA 1C1CA 2L9NA 3VAIA 1N52B 2NZCA 3BREA 2CA9A 2L9DA 2DEJA 2DXFA 4CZCA 5D0HA 5GMDA 4GKKJ 2DPJA 3HK2A 2XC9A 1YZ6A 2POKA 3ISNC 1ZA1B 3GPAA 2CPFA 3V2UC 4NCAA 1JLBA 2GS8A 2BANB 1MROA 3EXCX 4LSNB 3LF0A 2GVZA 3H5UA 4OV1A 5EWGA 4PWDB 3P3DA 2IAJB 1HNIB 3KMQA 5ETVA 2F4VJ 2CXEA 2MSTA 3CDUA 1M1HA 1RTDB 4CLUA 4TN2A 1WOSA 3C16B 2C2KB 4CO1A 2HMIA 2V34A 2ZH8A 1VQ4S 5HQLA 2C28A 1TL7A 2J8AA 1Q81T 1H38A 3ADAC 2X1GA 3JSRA 2QL9B 1ITPA 1D9AA 4ZP9A 4C7QA 4IQXA 3BGLA 2E44A 3D0GE 3N6MA 2YH1A 1GX5A 3UD4P 2CQ1A 4AXIA 4NLRA 1Z2ZA 5E3AA 4EWTA 3LP0A 3LUYA 4OQJA 2FJVA 1MSWD 4LF7J 2ZBQA 2VPWB 2XULA 4NRTA 1HBNB 2WONB 3BH6B 2ZOGA 1TL4A 4GKJF 4MTPA 4ZITA 4PXEA 2OO4A 3V4IB 1WTBA 2GVDA 2FVCA 2HQFA 1F3FA 3K5LA 3DU5A 2CZ9A 2ZH9A 1UJ5A 1OIAA 2XLKA 4ZCMA 3NNHA 1SJ3P 2WAQD 1FA0A 4USUA 3UR3C 1OY6A 4EO6A 3NKYA 4WK1A 3OFGA 1HARA 4IO9Q 5J2QA 3IXQA 2ILZA 1YRTA 3PJWA 4AQYF 3C6TB 1DARA 2R3VA 5E2QA 2CPYA 1M5HA 3QLHA 2EKYA 3WX4A 1LXNA 3ISZA 2ATLA 1N0UA 5K14A 2HQ3A 2B4VA 1WDTA 3ILLA 2OD4A 1KEKA 2XZDB 3HP6A 5HSPA 2XLIA 2F63A 5D6GA 2AJFE 4P9SA 1VQPS 3CXCR 1WD6A 4IOBA 3B78A 4KR0B 4LF4F 4IO1A 5KFPA 5CAAA 2UXCJ 2Y1RI 4I6WA 2JEIA 3I32A 1X5TA 4AXJA 2M2BA 4XIUA 4X4OA 2YNGA 2R7VA 2QMXA 3R27A 3AD7C 2WVFA 4RBTA 5I3UB 1HD0A 3OUYB 2DR8A 1APSA 2LDYA 3H5SA 4CO5A 1Y3KA 1RTHA 3RB0A 1G4CA 2V50A 3TUIC 6AT1B 4NLSA 5DLGA 1RT1B 1NEEA 2HHUA 2DBBA 4WZMA 4OX9J 1N32F 2DNOA 1X4FA 3ZZYA 1H2VZ 1CULB 5ETKA 5I3PA 1FKPB 2OEMA 2A2CA 5K20B 3M8PA 3IG1B 3MPUB 5KT5A 3AB2B 3MZIA 3MR6A 1AZSA 2Q6CA 4Z2XA 1JLGA 3IRWP 3DOLA 3LGNA 2W01A 1WC1A 4RW4A 4H4OA 4NZ7A 2VZ9A 4TLRA 1IWGA 2F40A 2BMBA 2DYAA 3CTRA 2DR9A 3MM6A 3IN5A 3RAQA 4DV3F 2HBRB 4AL6A 3JTPA 1BD6A 3QO9B 3HD2A 2ILYA 3RZAA 1N36J 3HHLB 4W4MA 3ILOA 3TANA 2DGSA 3NAHA 3TAMB 2VQFJ 1F2HA 2WB1D 3BBBA 3EYZA 2KI2A 2XLJA 1UEKA 2VG5B 4IH6A 3POTB 2XEXA 3ZZ0A 1NH8A 3UO0A 3K2YA 3N28A 1V5VA 3K0JA 2VD3A 1H73A 1N34F 3BBFA 5ETLA 3VQTA 3CEDA 1VC0A 1T03A 2HNZA 4Q8FA 5KT7A 4OYMA 4KGZB 5LMUJ 1PO6A 4MKAA 2UUTA 3CULA 2HK2A 2VG6B 3DRYA 2BJ9A 1PILA 3GV5B 4XPEA 3W3SA 1I51B 2W2QP 2Z58B 3CCES 4ZVPB 3OSNA 1RWVB 4KE5A 3IO1A 1XMQJ 3D67A 2WB4A 3J7Z5 1V3SA 2ZE2A 4EU0A 3UNGC 5CH7B 4NI2B 3HSJA 4JI1F 4J9UE 5CQGA 2ZBIA 4QIEA 3MGJA 2KL8A 1RLCL 5CD4A 3R7BB 4OIXA 4DPUA 4I0WA 4OJHA 4C48A 3BR9A 1IKXB 2RMLA 4LBIA 1S79A 2AGOA 5EDWA 3KK2B 3KHGA 4B9SA 1YBAA 3FMBA 4GC6A 2W2MP 3OXGA 2EVZA 1S97A 3Q23A 2CJBA 4DR3J 4DFPA 4UW2A 4DR4J 1U0HA 2OELA 3BYRA 4M5NA 3G71S 1S57A 3UFCX 2DGUA 2QYGA 2AT1B 3GZ7A 2EFPA 2B9WA 4QWCA 2Z2MA 3RRKA 4CM0A 1BC6A 4J90A 5KT3A 2R7OA 4BS2A 5BYSA 1LFPA 2FJWA 3Q86A 2HWIA 4XTTA 5L1JA 5JJBA 1VRTA 2VFSA 5FJ4A 3E2EA 3J81Y 2WW4A 3BB5A 3ZO7A 4DV7F 2DPIA 3PV8A 1U09A 1UKUA 2GMHA 1KQFB 4B3RF 2ZUAA 1KNZA 4PRFA 1VQ9S 1S9FA 3DRPA 3DRRB 1NK0A 3ZXWA 4F0MA 1Q7LB 4KB7A 2DD8S 6FD1A 5K8PA 1FRIA 2FHOB 4C8OA 1HW9A 1Y5LB 4J9NA 2N82B 5ETPA 3CC4S 3MI7X 1KHVA 1Q16B 3JYTA 2XY5A 4ED5A 1RWMB 2DHGA 3LP1A 1UWBA 4KKOA 2RQKA 5A8RA 3ZZRA 2VQEJ 1D0EA 1E6YB 1RWNB 1ZPWX 2NREA 1VIXA 1UVNA 4QWBA 4U95A 2ZZNA 5GMKa 3DKDA 2KG1A 3CD5A 1NK9A 1BQMA 4WFAQ 5J1EA 1N6QB 5I4MA 3C8YA 3VGTA 2LA4A 1VQ6S 2FLLA 4K2JA 4RW8B 5HQ8A 4OI0A 4EFAC 2V8GA 1UCNA 4DV2J 4KFBB 3KK3B 4RNFA 1XWLA 1FESA 4LF8F 1R3NA 4DSLA 4PZVA 3HDSA 2CDQA 1IBMJ 5A6PA 1B64A 1ZA2B 2UXBF 2KZMA 1Z1ZA 2QFIA 4DL2A 4Z7CA 1T0TV 3J81j 3FZBA 4DG1B 2ASYA 1SJFA 3RBEA 5KFOA 2PFFB 2CPXA 4OHZA 1S72S 3LP2B 3KMSA 3QFHA 1C4CA 1GT8A 1QUPA 4DUZJ 1HBUB 4MKVA 4P73A 1JLAA 2M70A 5CYQA 2FHKA 3D54A 1YJVA 2R42A 2OPQA 1RGVA 4KHPJ 3G96A 2X1AA 4UUWA 1QSLA 2IBKA 4IOAQ 4DL4A 1FXRA 1QJHA 2C2NA 1WI8A 2JWNA 1GK8A 2IA6A 2MTLA 3C6UA 1U1OA 2HURA 4OLPA 3MR5A 1LWCB 1VDHA 1S0MA 4DV0F 2OIHA 2JEJA 4B08A 3LGMA 2VJVA 2VUGA 4RNOA 2AW0A 4I2PB 1DQAA 2HVZA 4MYUA 2HWTA 2FJBB 1U1PA 4F67A 2HHHJ 1UMJA 1TP7A 3CT9A 3DLGB 2KG0A 2UV8A 3IWLA 5K9FA 2FVQA 1UPPA 1UW9A 3G4SS 3MEGB 2FVSA 2D1CA 1AUDA 4DQQA 1U25A 3TUPA 3K58A 4P52A 4O3QA 4X4RA 3OTDA 1KSPA 3KJNB 1G3OA 3ITHB 1R31A 2XS2A 4KC5A 4ILRA 1FJEB 1RK8A 3SV3A 3VAFA 2F1FA 2H5JB 3GTYX 3KG0A 2R7SA 2IVFB 5KOWA 2FVRA 4Q0BA 2VG7A 2DHAA 1RTZA 4G6VB 2P9CA 3M2UA 3J7YU 4DR1J 4K4YA 3ISND 2YKNA 1IKWB 3M2RA 4I2QA 5M2RA 3WX8A 4USKA 1IBLF 2MHNA 1MWYA 2FZKB 3M6XA 1ZAWA 4TVAB 1Y00A 5J2PB 4FXVA 3BJYA 3GYXB 1S1UA 2BYCA 1H72C 4K4WA 3AA8A 2CG4A 2JLEA 1HQEA 3I0RB 4PG4A 4ZVHA 2HRYA 2RU9A 4ETXA 3B6BA 1RHUB 3PYGA 1RABB 1RKIA 1S1TA 3BN4A 3BGOP 4KIAA 4X65J 3M8YA 5HJXA 1KR4A 4OYAA 2ROEA 3VTIA 3W9IA 2AGPA 2BJ3A 3NGTA 2WK4A 1HW8A 4R25A 3VAJA 2QMWA 3DRSA 4F0HA 4J9PA 2XHWA 4F3QA 2EFOA 3M9NB 2E5GA 2HHXA 2VASA 2FB0A 1WG5A 2KU7A 4DR2J 1VGYA 1XMBA 2KJWA 3QSIA 3I4HX 3EUNA 3PJ9A 3PRBA 2BOAA 4KHMA 1RADB 2SXLA 4U7CA 1BXNA 4LR9A 2F9DA 1JXEA 2PA8D 4ENOA 4HLBA 4CCHA 1Q0NA 1YSJA 1ZTWA 2RQCA 3AH6A 1BGXT 4DEZA 1YZ7A 1S9GA 2OTLS 2J9EA 4O0NA 3E51A 2C3YA 2V8PA 5DQIA 3VAHA 5KFZA 3BPDA 4C8NA 2EK6A 4CYUA 5IC4B 3MFHA 4QCLA 1M5VC 1QY7A 3EXYA 3O6QA 3TARA 3R9LA 2B0GA 3D5MA 2MHEA 3R8YA 2OEJA 5H9FJ 4USJC 4RW9B 2VBYA 3HVTA 4Y2MA 2DB1A 2GIRA 3S6EA 3NCQA 2CNOB 2HVEA 4M95A 5GAGU 3PHEA 3NCRA 3G82B 3PO4A 4TY9A 2DHSA 3AAWB 2I2YA 2GIFA 1VBKA 3KUHA 3P5TL 3EVMA 1O51A 4YR0A 3QT8A 2MKCA 2FHJD 1K1SA 3W2VA 1X5PA 5KT6A 3QAEA 5J1PA 2R8IA 2HEKA 2OFHX 2COLA 2IMWP 3SQGA 3UCZP 3W66A 4UF4A 4NLGA 1GMUA 5LMNJ 3TYTA 3D2WA 3KLGB 3IP0A 5HROB 1RWOB 2MJUA 1HPZA 4NWBA 2DIUA 8AT1B 1U8SA 4CIOA 4OI3A 3N79A 1YJUA 4BCAA 2G2ZA 3EJMA 5L1LA 1RT5A 2J9DE 1FDAA 3FZ2A 3MAAA 5IWAF 2F7VA 3MMCA 1S4FA 2VKRA 1U4BA 4IRCA 1HNXJ 3OL7A 2RJZA 2QV6A 3GFXA 2UVVA 3A8EA 4ITSA 1IWAA 3GJQB 4Y0FA 4GMKA 4X64F 2HZVA 3LAKA 1B70B 1R0AA 4AL7A 2R7QA 2HHQA 1RLDA 1NJXA 4WU3A 5F8HA 2YPYA 4FF4A 1P6TA 4U8VA 2CNLB 1U7LA 2GQQA 1L5UA 5IM0A 3NBPA 1TV6A 3VVTA 4JV0A 1BQNA 3SEOA 4WXWA 5EN1A 4B3MJ 2MYFA 4WZQA 3DOKB 2BZ2A 1FKOA 2RILA 2J6TA 4G1QB 3IAM9 4FYVB 4LF6F 2YQ0A 1CJVB 1KONA 4P72A 3KLIA 3GR0A 4KH0B 3LOUA 4NX9A 3PEJA 2B43A 3ZTSA 2NXEA 2VBZA 2R2SA 3JQKA 2VOPA 2DHHA 1GAOA 2QX0A 3BYPA 5KFBA 4EMDA 1RT3B 4EEYA 2QL5B 1YRXA 2CJKA 2HBQB 2OPSB 3W7BA 1YJNS 5HATA 3QT7A 3OTOF 3HZEA 1N5VA 2AYEA 3FKBA 2QYCA 3Q8SB 4ZPDA 1S77D 1N33J 1NSKL 2FHJA 1U1RA 4K59A 1HKAA 3CCVS 2FC8A 1YHQS 1FDNA 2B7BB 2D3OR 2ALYB 4L6V3 1X4DA 2W7PA 1U2CA 1H98A 1E6VB 4FYXB 3DOMB 5C2GA 2HQDA 2IBOA 5IS2A 4CLYA 2LA6A 5A6WA 2HNDB 2BX6A 1UFKA 3PYEA 4Y28C 4ED2A 2YNHA 5DDPC 2AKWB 3VF0B 4WIQA 2UUAJ 1X0PA 5LSLA 3V4MA 4P2SA 2NYHA 3A8IA 2HWHA 2ADBA 4PXDA 4B17A 2N7CA 2JVOA 4F36A 1D9DA 3D4JA 2Y1JA 4AYBD 1WC4A 4YHHF 1ULRA 2VOOA 1RBAA 1O0PA 4E0DA 3AA9A 2CZVC 2EFNA 4P74A 3PR4A 3RB4A 2WSEC 4A4JA 4QWEA 5HMYA 4OL8A 2LQ8A 3TJAA 4RO0A 1G6BA 1HD1A 1LXJA 3K5OA 2MMYA 3JS9A 1CSJA 4USWA 2MQOA 4CO0A 4PR6A 4F26A 4P2XA 4G65A 1FWKA 2HFSA 3L7OA 5EX3A 3J80U 1JLFA 2CPDA 5T7LB 3CC7S 2MKSA 1PJ7A 3GR1A 5AXLA 4Q44A 1FNMA 2QZ8A 1OQ6A 2H9ZA 1U8WA 3A8KA 3IR5B 2DNNA 2GGPA 3MUVP 5CXTA 4DHVA 5F3ZA 4IFYB 1WG4A 3UR0A 1B0PA 1R0CB 2B9XA 4FF2A 1X9MA 2R8KA 3UN5A 1JJ4A 2YH0A 4JI8J 4Y2IA 1C0UA 1UETA 1B0VA 2V9WA 3NMRA 5KFJA 3VAGA 3CGIA 2A1BA 1UL3A 3TJ8A 2KT3A 4IG3B 2FQQB 3KXDA 2ASDA 1VMBA 2UVWA 3PZPA 3GFZA 3BKTA 2EI5A 3KUEA 3RUBL 2C3OA 2DVIA 2BE7D 3JSMB 3BF4A 3KJVB 4NEYA 1JJHA 1KQSR 3BGRB 3HHKA 4HKQA 4ZOSA 1T95A 4R5PB 2FJAB 3GIMA 3MD1A 3AODA 5DZ7A 6FDRA 3DMJB 3RGIA 2MZTA 4JB8B 1SL1A 3CIZA 2J6SA 1NK8A 3HHEA 3M6WA 1ZPVA 3A1YG 3QFWA 4J9OA 3BO2A 3CMES 2E1PA 3R6GB 5B0FA 4UOGA 4ZS6A 1T3OA 2HS0A 3N6LA 2B5JB 3GIKA 3MM7A 3MPVA 2V63A 1FRLA 3TX0A 1EP4B 1U1NA 4H4MB 3QIDA 2WSFC 4ELTA 2PD1A 2CNNB 2MZJA 3I0SB 5D3GA 4MKBA 1VRUA 2JZ5A 2LDIA 2MPUA 4YY3F 4O4GA 1KLNA 2F5GA 1SH2A 4HTJA 3R5AA 1WI6A 2DRDA 3BQ2A 1FRHA 4YB6A 3FUYA 4HT7A 4D3HA 4OZ3A 2JFKA 4L75A 1V9OA 4RNHA 4K4TA 3MXHP 3I5CA 4ZP7A 3QIPA 2YBVA 4IUFA 4ZVRB 3P5BP 1FE4A 5KG3A 1P8GA 3T41A 2CQHA 3AXKA 1WEZA 3DRXA 4DSFA 3PRDA 3UDLA 2N3LA 3CCJS 3MECA 1AXQA 3RYLA 1S6PA 1ZETA 1LW2B 1FNOA 2OD6A 1TL3B 4LF5F 5KFLA 4WFXA 1FRMA 2BM0A 3ZTRA 3BO3A 4HHUA 1U6ZA 4C8KA 3SDEB 3Q8QB 1TK5A 1KQGB 1TFWA 3GLJA 5JXSA 3DNCA 2UV8G 1AT1B 1F2GA 2W8KA 4ZVFA 4NLPA 4ZK7M 1PGZA 3CD6S 2K3IA 5F8IA 1X60A 2H54B 3CO0P 1PC5A 3I82A 5DDOC 3FSXA 1N5YA 1S6QA 2QN6B 1S7HA 2A10A 3BSCA 2O67A 3DGPB 2EXUA 4P10A 2ZWPA 1Y11A 2B9YA 3OLAA 3UDEA 2NS1B 5HBMA 1FCAA 4X2BA 5IV4A 1I3OB 2MLXA 2OFGX 3IRXA 3PXGa 5JMNA 4O3RA 3NEKA 4MIBA 3M6VA 3DHWC 2R8JA 2ZM6F 3N9UC 2MXYA 5FIIA 5J2MA 2D41A 2E9TA 2RF2B 1MG7A 1U49A 3J7YI 1R6YA 4LIRA 4IH7A 2ZITA 4CLSA 2ZH1A 5L9NA 3HVRA 2RQMA 1DAXA 4RW6B 1LWFA 2HZCA 3RU0A 2VFVA 4C8LA 3PYFA 4X66J 4NYPA 3G6YA 1S99A 4TXSA 1SH3A 4K4XA 2RRAA 1EETB 1XNQF 1HI0P 2DR7A 3D1OA 4M94A 1VQ5S 3WIVA 3MM9B 4OZ5A 3OJUA 1IJEB 1PYTA 3BGUA 4DV4J 4RLEA 5A0YB 1WACA 4BHQA 1HWJA 2NXNA 3G2XA 5A8WA 4ZCIA 3T1HF 3DI6B 2ZNZA 2VL1A 4M5DB 4O23A 1JLQA 1QM9A 1RHJB 1FJGF 4X4TA 5DS7A 5KFSA 2WOMA 5D77A 4P2MA 2BQUA 3HHNB 1Q5VA 2AD9A 2ZD1A 1LWEA 5D78A 3IM9A 4M5JA 2QA1A 4GKJJ 2ASLA 3C15A 2J7WA 3E3XA 2WBRA 4QW8A 2HFNA 2ZKUA 2H3EB 4ZHRA 2F8HA 5L46A 3AOAA 5F8GA 4ID5B 4NCBA 3PEHA 3HI9A 1HHSA 4F4YA 4N5SA 3EVWA 4CO4A 4C8YA 5D15A 5DO2A 1TKTB 4F4KA 2VC1A 4ZP8A 1S1WB 3H5XA 1KRPA 4UZCA 3CCQS 4YOEA 4OYIA 2KFNA 4X4SA 2P2CB 1S1VA 4C8MA 2HYIB 2W2OP 3KKFA 2WZ1A 4ECSA 4MT1A 5EWEA 2AYGA 3OHAA 5HL7Q 4GO5X 4RR5A 1RWUA 4JI3F 3HLUA 1NLKL 4OI2A 3OTCA 4OZLA 2ZBCA 5D4OA 3PJXA 4TYBA 4P2FA 2L48A 4NMLA 2YY3A 2W9CB 3GIIA 2CJQA 3WIUA 5J2NA 2H5IB 3DXBA 2XNQA 4CNYA 4DI6A 1NSAA 2V0NA 1YJ7A 1DRZA 4TY8B 3OTBA 4U67Q 2K8GA 2YNIB 3LP2A 3MM8A 1N32J 1BY9A 1DQ8A 3R5BA 1B3TA 4P7VA 1RAEB 3B8HA 3QSYB 1Y0HA 4RNNA 1F9FA 2L3MA 5MLCV 5CHCB 2CPJA 2KFYA 2V2QA 4JI6J 2KTQA 5D4NA 3B4MA 4O44B 4E2FB 3L7PA 4UZBA 3A8JA 3OW2R 4F8RA 1IKYB 3VALA 1NPRA 1FEHA 1XNRF 1SJ4P 3HFKA 1RA7A 3KG1A 3MCNA 3BSNA 1ZZNA 3HSGA 1NK5A 1Q82T 4A8QA 4YFUA 2ACYA 4WFBQ 5B0EA 4X4NA 2E1MC 1H74A 2W24A 1PG5B 3TUJC 1FX4A 4K7QA 4ED8A 3MEDB 1T3NA 4Y2AA 1WHVA 4LSLB 2BW7A 1CS4A 2G9OA 2K1RA 4DR7J 4HYKA 5KFXA 2XMKA 1T05A 2CPHA 3P96A 1N5SA 1N34J 5H1SV 2CUYA 1NUEA 2H5EA 5DG9A 1S9EA 2B56A 2M4MA 4C8ZA 4ZIWA 3I5BA 1GFWB 4MIWA 3FCWA 3UE2A 2J76E 1RB0A 4XPCA 4GKKF 2RS8A 3H90A 4XK8C 4CH7A 3FBBA 1Y9OA 2J0XA 5B0DA 3OHBA 2IFXA 2B7CB 4Z7YA 3SV4A 2JFDA 4Q2MA 4KSEB 1RT4B 3OXFA 4B3OA 1NDLA 3AQPA 3IC1A 4ZVOB 1A7GE 4L3NA 3PW4A 3R7NB 3MWBA 4XO0A 1HA1A 5DM6Q 1CG2A 2BV3A 4WTYA 2BQ3A 2DT9A 3QGHA 2Q1LA 2C2OB 2Q79A 4M1KA 2CFXA 3GONA 5IQ6A 1JXVA 1HYSB 1O6XA 1DLOB 1GEHA 4N56A 2ZUGA 2BACA 4MMOA 3HVAA 4J9KA 2V69A 5HP1A 2XNRA 4YEAA 3EX7B 2MQPA 4EBDA 5BR8J 3OFHA 5KG4A 4DSKA 5SUHA 4WP8A 1TK0A 4F2RA 4CNZA 3AOCA 5E3QA 3CJQA 2CVEA 4RUCA 4KQZA 2FHMA 3TA1A 4LF7F 3M1VA 2HK3A 1RT7B 2AF6A 3ZTPA 1DTQA 3D66A 3RAMA 1O8BA 3SBMA 2W1BA 1OY8A 4M5IA 4DV7J 1TK8A 1KD1T 1FRJA 5CA5A 4K5SA 1P1TA 2JLGA 4O3NA 1SIWB 5D0EA 3GJSB 4P71A 4LVNP 1VC6A 4ICLB 3MPDA 2VA3A 4NL5A 1RTJB 1NHUA 1PIEA 1HIYA 3N5FA 4LFBF 2NQPA 3LGHA 2KN4A 3F41A 4C97A 1SV5B 2D69A 4Q45A 3OVBA 2NYIA 2FIUA 4IH5A 1IBKJ 2BM1A 3TQ1A 2NLWA 2PGCA 1RU2A 1F60B 4USHA 4C0HA 1W2IA 2CWXA 2DKOB 2DR5A 2M7SA 1TKXA 2Z56B 3HJVA 3BSAA 2HFVA 2XSJA 3CDAA 4NYZA 4DU7A 2IA0A 1R8CA 1J2VA 1YIJS 4ZIVA 4R8UB 2UXCF 4FNIA 4DPOA 4OJ3A 5IT9U 2APOA 5EGYA 2J7KA 2UUWA 4OI6A 2CQ4A 3K8VA 3KK1B 4DN9A 4HI2A 4LF8J 4C3MA 3KLHA 2IYGA 3QRRA 1REGX 3D28A 2CJXB 3FGVA 4N76A 1CJKB 1OPIA 3TAQA 2BJ1A 2EW9A 3W63A 2I38A 1TAQA 4OX9F 1XC9A 1T9TA 3G82A 2DEIA 3BS9A 2K7KA 4USMA 1IR1A 4NLQA 1GXLA 3JSBA 1FFWB 3VR1A 4YUDA 3CJ2A 1K0TA 2FZGB 3FJ2A 1K8AT 4FBTA 3CVKA 3WC0A 4LF2A 3EGZA 4USIA 1VLOA 4PUOB 3FSIA 3ILIA 4P6QA 2NUHA 2CRLA 3I6PA 1AYEA 5KFCA 4U7UK 2DRBA 2UP1A 2FUG9 1QE1B 2CYYA 3Q0AA 3PW2A 3OV7A 2IM0A 5KFDA 1FNXH 1RTIA 5BJRA 4TYAA 1D1UA 1GTEA 3SYZA 2YWWA 1GTHA 2OJ3A 1U1MA 5GMEA 3EGVA 4PQUA 1N36F 4N41A 1SUQA 1QAJA 2ZHOA 4DMZA 3QGIA 3PRVA 1XQIA 2VQFF 1VK3A 3D0HE 2ZH6A 2VFRA 1Z2LA 1RHQB 4DV0J 2FGOA 2ZZTA 3MEEB 2A18A 3OT9A 2ZOFA 4QR0A 3ICLA 3DLBA 4PXBA 1KFDA 5LMUF 4RUHA 2VBXA 3LO3A 3R5CA 2EWHA 2ZJRQ 2PMHA 2BR0A 3I4PA 2K7JA 1U26A 2X1FA 1C1CB 3M8RA 2GZOA 1JLEA 2RUGA 4HL9A 3MMBA 3K57A 4GVBA 2QL7B 2GCFA 3SFGA 1EIYB 4Q7AA 1AB8A 1JLBB 3DCAA 3FMWA 1NZAA 2CKWA 4OYOA 5DGAA 4IG0B 1FWLA 2DCLA 1MROB 3OR2A 4F02A 2BA9A 3HULA 2GVZB 2X3GA 4J37A 2YX4A 3DOKA 1X0FA 4NEZA 4QYRA 4C3LA 2J0SD 1OPZA 3U1MA 2KKHA 3W5YA 4AT1B 5THWA 2RVJA 3H2UB 2KVIA 1HNVA 3M9MB 2KO1A 2HMIB 4OZ1A 1SKRA 3G9CA 4A8SA 3OD2A 1TL7B 2DO0A 4JUZA 2VU5A 1UVKA 1IBLJ 4NXNF 2GX8A 4DR3F 3ZFVA 2GW8A 2PMZD 1SC3B 1RAGB 2XY7A 1VR6A 1VI7A 4K50A 4UOHA 3HD1A 1RT2A 2GC8A 5A2QU 3I96A 3CJKA 2C42A 1QAIA 4URSA 2D7SA 2BABA 1R0BG 3PW7A 1FEEA 1M5KC 3LP0B 2KYXA 1FWPA 4DUYF 3RAXA 3PFOA 3FVYA 1Q5YA 4RWWA 4RU9A 4FS1A 3H4BA 5L1KA 2WVCA 2H4WB 1OWXA 4FKYA 2VONA 3X3UA 2GVDB 1S49A 2QO3A 5A76A 1VQOS 1YVFA 4PG5A 1NXIA 2D3O1 2ALZA 4YMEA 1Y5IB 3CCLS 3AJ1A 1SC1B 2HAIA 2MLYA 1XBWA 5J2QB 2XB2D 2LU2A 1MMNA 4Q43A 5G0RA 1TL1A 1LV5A 3MR7A 3QLHB 1RWXB 2YVSA 1T9UA 4RW7B 3ENAA 4IR9A 3GP9A 3OVSA 5K14B 1TR0A 1TMJA 4Q2LA 5LOQA 2QA2A 1R8AA 4HI1A 4NASA 4ID8A 1JKHA 4WP3A 4IKAA 2ZZMA 1U0SA 1R89A 4DV1J 1XTZA 1RKJA 4DV2F 2BJEA 3DU6A 1D3WA 5M2UA 5AXKA 4OHVA 2R2UA 2YNGB 2H48B 5CYMA 1DURA 2AMCB 1BLUA 3KFWX 2Z57B 1HWIA 3EMTA 1IBMF 3RRGA 5T7LA 1CEZA 2BKNA 3CCRS 4MK8A 3QWPA 3U1LA 1RTHB 3IFEA 3ILJA 3MCOA 2DNMA 3FDSA 2QLWA 3CJ8A 2XS7A 4KGMA 4BDPA 1J5OA 1QVGR 1FERA 1OO0B 4IFYA 1WOPA 3M8ZA 3Q22A 1UFWA 3OXLA 3KDNA 3PKMA 2IIHA 3NWGA 1URNA 1F5BA 4ZPCA 3QZ8A 3M8PB 3PCOB 4IFVA 4DQSA 4DF4A 1QSYA 3BQ1A 1AZSB 1TMMA 5I42A 3OQ2A 1JLGB 3DOLB 4IG3A 5GVQA 4H4OB 4V19X 1K73T 2EC0A 4PWUA 2QT7A 2PDAA 3RW7A 4FPIA 4DS5A 5FD1A 5L39A 3KLFA 2L08A 3K8WA 5CD4H 3UCGA 4YN3B 3CDWA 5KTQA 3CJ0A 3JAMU 1IKVA 4F0KA 2YWEA 1HI8A 1HBOA 3A3OB 1FDDA 1UEUA 3DLEA 1NJZA 1Q8LA 2HBYB 3KHHA 2L41A 2OUGA 3H2VE 4ERDA 3MTJA 1YWXA 1BHNA 1FJCA 1S5ZA 5HMZA 2B8QA 3VAMA 5IWAJ 3QT6A 2HHHF 4HHHA 4ED7A 1JIHA 1T03B 2HNZB 3M05A 4CH1A 2YNFA 5E0OA 4KRWA 3MCSA 2NSCA 3LAMA 1LNQA 2OSRA 2GNKA 2DJWA 2EG2A 1YBTA 4X64J 3KLEA 4ZVUB 4F2SA 2FY1A 2FY8A 1VRQC 2CQPA 1VQSA 4N8OA 4OZ0A 2XGPA 3R97A 3MOZA 2DTJA 2DNGA 2ZE2B 1YJRA 4Y65A 3UCUP 4B3SJ 5GADI 3KNAA 4URGA 5D8HB 1X4CA 4NOHA 4ECUA 3FFIA 2VPYB 1HWKA 3N6NA 2NXJA 2HS3A 1AUSL 1WNEA 3W8PA 4JV5J 2DH8A 1XN9A 2HS4A 3NY0A 4PEOA 3BR8A 4E8UA 4UTGA 1SIZA 2XO7A 4B9TA 3SCJE 2HNYB 1V3RA 1I94J 2VICA 2XSFA 3IS9A 4HEA9 1U1LA 3UW1A 2K2PA 3KUGA 3CNQP 4WYLA 2CG8A 1U0HB 5HMXA 4ES2A 3IGNA 1WSVA 4M8LA 3AD9C 3UI3A 1WG1A 3DYAA 4L72B 2FZCB 1SB6A 3DDIA 1WC3A 3UN2A 2V8HA 2V5HG 2VB6A 4ECVA 4X65F 2C2MB 5BYQA 2FJDB 2W9BA 3V81B 3MUMP 1SQGA 1XJWB 4C11A 5JUMA 1U45A 1DQ9A 1NJWA 4RUBA 4OX7A 2GV1A 3NRBA 3DGPA 4WE1A 4CO2A 1BQXA 5HAOA 2MY8A 1RAOA 1BUXA 3DC2A 2DGWA 1W7WA 1ZAXA 2DH7A 2W4CA 2CPZA 1RAFB 1NSPA 1DTTA 2OP5A 2ZHAA 2RT3A 1LKZA 3HJFA 3CE8A 1HQUA 2IJFA 3JYTB 2G1HA 4ECTA 2DGVA 2XMTA 3LP1B 3Q83A 1UWBB 1RU1A 3OTEA 4JV1A 3H42A 5IT0A 4KKOB 5A8RB 4ZCLA 4HVZA 4ZVEA 1KOOA 4YHHJ 2X51A 1KVJA 1OY9A 3C46A 4J9VA 1RWWB 4M5KA 2XCPA 1JJ2R 1VJQA 4C0BA 2ZWOA 7FDRA 1BQMB 3VZHA 3KOAA 5F9LA 1R8PA 5J1EB 3PKYA 3BN7A 2V9KA 1NCLA 4NLOA 1SXLA 1LWXA 4IR1A 4DUTA 2RSQA 3VWSA 3QWUA 1OYDA 1HNZF 1X9WA 2YPZA 1NKCA 2LMIA 2UVRA 2QG9B 3G8SA 2OPRA 5AE1A 4EGLA 1A0OB 1UVLA 3T5LA 5KFGA 1S0NA 4CRJA 2CZ4A 2B4PA 4RZRA 1H2TZ 4BWJA 3MURP 3K5NA 3M8QA 3VHQA 4U9RA 1XR6A 2B6AA 1S12A 5IFMA 5B0CA 2HHSA 1TELA 2YKQA 1WELA 4RBVA 2ZJQQ 1WF0A 3MR3A 5BXIA 1JLAB 4OI1A 4MFBA 5CYQB 5K8OA 4KBIA 2P6SA 2OPQB 1MWQA 2V4JB 2HFZA 1UZDA 1IR2A 1QVFR 3CC2S 3AB4B 1VQYA 1TKZB 1HLWA 4X62J 4WXOA 1Q78A 3OJSA 4R0JA 5H9EK 3GQCA 5F8JA 3Q8PB 3PVXA 5LJ3Y 1M1KT 2LCWA 3A13A 3KNGA 4FN5A 1CJUB 3LQVA 4ANDA 4PPZA 1UA0A 3GSDA 2LXFA 2E7WA 2GAHC 3SXLA 1PCAA 3W61A 2M8HA 1HNXF 3UDCA 3OVAA 1TU0B 4QOTA 4QJVA 1KHWA 4N77A 3MM5A 3PDNA 1RXOB 1QTMA 4MK9A 3BV8A 5E41A 2MKYA 2KVQE 2C2RA 1Y7PA 4RUAA 4FYDA 2V4QA 1S59A 1UAWA 1TVRA 4ECWA 2LP4A 1M1GA 5C24A 4L73A 1J27A 3TW0A 1IM4A 2CQBA 4KJIA 4OYPA 1VBXA 2YWFA 2UXDJ 4Q0BB 2VG7B 3HCXA 2O1PA 2NZ4A 1TFYA 3M2UB 2QTWA 2LXIA 1RQ0A 3M2RB 4I2QB 1FE0A 4R0EA 5DDRC 2FLNA 1T9XA 2GO8A 4MJKA 3TVKA 3HHLC 4USTA 3DDNA 4ALZA 2PEBA 4FS2A 4CDIA 2HGMA 1S1UB 1LW0A 2AEMA 2X7IA 1S1XA 3U27A 5DG7A 4X4VA 3M2VA 5CABA 3T1YJ 3MEDA 3FNNA 1HQEB 4WKRA 3PO5A 2AEFA 4LSLA 4URQU 1HR0F 2XZTB 3UQSA 3QNWB 5C2CA 3L9ZA 1C1BA 3A3NB 4CLTA 1XMOJ 3AOBA 1PKUA 5C42A 1Q79A 1S1TB 3SQOP 1N33F 4FVCA 1L3TA 2DNQA 2J7UA 2DNRA 3DLKA 3HFZB 2VIHA 4Y3CA 1P1LA 2HQCA 5LM7E 3Q89A 4TU9A 3AJ2A 1X5SA 2UUCJ 2E9RX 1RP5A 3C14A 2OKQA 3TEHB 2UUAF 2XI3A 1JK9B 2B8PA 2XM3A 3SCKE 1V5IB 3QRQA 5EX0A 4PG8A 4DL6A 2XMJA 2MKKA 3VQSA 4FF3A 2ZM6J 1WKLA 1DZ5A 4NMXA 1U6FA 2V2VA 3EPIA 2KFZA 2A6MA 1MLAA 1ZM4A 4JI4F 2MKJA 4FXWA 4CLLA 3NGSA 4ZA1A 1S9GB 2K3KA 1IN0A 1ZH5A 3IMQJ 2OMOA 4DZ6A 3BEGB 3LWMA 1NHVA 1FTCA 3FRYA 1XNQJ 2EFQA 2KT5A 3HVWA 4JYAJ 5HLFA 4C9DA 4PKDB 2CQGA 3CJRA 4CYUB 3P45B 3JSYA 4YB1P 4NZ0A 2CQ2A 3G87A 1AFIA 3T1HJ 2OSQA 3P4UB 1VQKS 1X4EA 4KH1B 3F73A 5KOXA 2R7TA 1ELOA 3UWTA 1AA1B 1NM2A 4OHWA 1FJGJ 2ABYA 3HVTB 1VQ8S 1H2UX 2MKIA 2F3JA 1ZTTA 3D7SB 2BQRA 2D74B 2CJYB 3MR2A 3ET6A 1NPKA 1PAEX 1IXKA 3QPIA 3IR7B 4IYQA 1IVZA 4JI8F 4DX7A 2E5LF 2JL9A 3GILA 1K0VA 2AYBA 4N7TA 1G7CB 3W2VB 1HMVA 3H2LA 2VPXB 5SZTA 1ZYQA 3MMAA 4J91A 3SQGB 2KHCA 1MMLA 3ZTOA 2BE2B 1IM6A 3FQLA 3ZZZA 3OL9A 1TUGB 3HM9A 4JI7F 2L9WA 5JVGQ 3PM9A 2DH9A 3J80Y 3C3LA 1S10A 3LALA 5KG5A 1CJTA 3EZUA 3I5AA 2BKPA 2MGZA 2DK2A 1HPZB 1VYAA 2IC3B 4LRDA 2J0WA 2MLZA 2PSZA 3J7AN 2IM3A 4WIIA 2DNZA 2IJRA 2Y1LB 5KAKA 1RT5B 1B7FA 4IDKB 4JI2J 2DNYA 1RAAB 4JI3J 2IM2A 3MAAB 3T19A 3DM2A 4Y00A 3MMCB 4KTQA 2UZAA 2Z0GA 3UVJA 3X1LB 1EQMA 2KYZA 4PXCA 4UQGA 2XTJP 1KQKA 1T7PA 1FRKA 2IDLA 4DLEA 4WU2A 4A8WA 3ENVA 4C2MA 1UVMA 1J5EF 3EZOA 2ZC3A 2M9KA 4HH1A 3M8WA 3JTNA 4ZPAA 1KTVA 4MK7A 1G2EA 3TNVA 3D3BJ 5KFAA 1OQ3A 5IM0B 3NAIA 3NBPB 3BBCA 4DDFA 2QJ3A 1R6VA 3OPKA 2R4FA 2XCAA 1CC8A 1BWEA 4LVOP 5LXRA 4C4WA 2G2YA 3TZZA 3MHYA 4RNMA 2Y3YA 3QMQA 1FKOB 2CQIA 2Q43A 1JNZB 4DF8A 1D09B 2IMOA 4G1IA 4DZDA 4B3TF 3G6VA 3KLIB 3NNCA 2EFGA 1XNRJ 2MDAA 2O5DA 4F4XA 4DSJA 4X4UA 4F25A 4L76A 3G8TA 2QLJB 1YJTA 5FDLA 4FYYB 4HACB 1EHWA 4P75A 3V5RA 1FRXA 1B0TA 4NXMJ 4CLZA 2EKNA 4PYAA 3WC2A 4UY8T 2ZDOA 4DSIA 1OSDA 4M5MA 3AY0A 4YP3A 1WKKA 4JI5J 1CQMA 2VH7A 1EJ7L 1SKWA 5DLFA 1RAIB 2PI5A 4ZP6A 1U24A 2EPIA 3NS5A 1NH7A 4H54A 4I69A 2CVIA 3FBEA 1S0OA 1HHTP 4RPFA 1JLCA 3P6YC 1IR0A 3V6DA 3FQKA 4A8MP 2DO4A 1NSQA 4NA3A 3W2WA 2I5JB 3M30A 1NK4A 3WHIA 4K0KF 1X4GA 2YNHB 2MB0B 1VS3A 1KTQA 2HGNA 1SPBP 4ELUA 4U96A 3L4BC 4IG0A 2RKIA 1VHIA 2UUBF 2BJDA 3UD5A 4QYZJ 2HHVA 2N3OA 4I7FA 2G4BA 3A3PB 3DLLQ 7AT1B 1RACB 1UW4A 2RUSA 2AJ4A 1KVKA 2V4RA 4X66F 2XS5A 1FK9A 2IDEA 3ZNJ1 1RT6A 1HNWF 1YGYA 2GJ2A 4J7CA 1KP6A 4DV4F 3IAS9 2J9CA 1VFJA 3GG0A 2H51B 2BRKA 4LMZA 3ELHA 4NLTA 2P9GA 5DQHA 4WP9A 2M52A 2D9PA 2MSSA 3TJ9A 1SL2A 3M32A 2I6WA 1JLFB 3OR1A 4X4PA 3O2IA 1KLMA 1YITS 4ZPTR 2BEFA 1KBRA 1X4BA 1K47A 2GGPB 2AV5A 2PA3A 2KDOA 4KO0A 3Q8YA 2HQGA 5KG0A 3MPYA 2MQ8A 5GAEU 3EE3A 3S1TA 1KVIA 1WEXA 3WDOA 2C2EA 2R9LA 1C0UB 1YKWA 4B02A 4DJBA 4Y2KA 1H6KX 1HI1A 4K4ZA 1LK7A 2W9AA 2E9ZA 1P9YA 4LFBJ 1NBEB 3OFFA 2DGOA 1FVQA 2Y8YA 1HBMA 2JVRA 1ZZFA 1RISA 4BBYA 2DHXA 2YWHA 4LFAF 2KRRA 2KRBA 2X1BA 3G6ES 4YB5A 1B4SA 4ZMMA 4ES3A 2W7AA 5HQMA 3EZ5A 4RW7A 1QLNA 4A8OA 2OLWA 3KTQA 4OYWA 2ADCA 3K59A 3PHTA 4GC7A 2ATCB 5K8NA 2FD2A 3NGRA 2JLFA 2HRTA 1X4HA 1NB7A 3C19A 2KXNB 2Z30B 2HIYA 2XMMA 4DL5A 3TR5A 3I55S 4HTIA 1W2BR 3OSPA 3GIJA 4ZVGA 3U02A 1TAUA 2O3DA 3MM7B 3NGDA 3DN9A 4ZLJA 1TL5A 2GHWA 2RDDA 3TUZC 2LQ9A 5C25B 3QBCA 2LVWA 2PE8A 2JC1A 5D3GB 2BANA 1VRUB 4EBCA 5D4LA 4O4GB 4LSNA 1VBZA 1DBDA 4Y6IA 1U2RA 3D6MB 4PWDA 2IAJA 1HNIA 3EVOA 4CWBA 4HDGA 3BPSP 4JI6F 5KFYA 4TNOA 3PX6A 3CDEA 2YKMB 1RTDA 3C16A 4K4UA 4ER8A 3PX0A 2VA2A 4AUKA 2WVEA 3QIPB 1YI2S 1RSCA 2DGXA 4J5OA 2NXCA 4DR5F 1WTFA 1RBOB 5HVFA 4F3MA 5B0BA 1IUJA 4CT9A 3CPWR 5E5NA 3MECB 1S6PB 5I3QA 2OMLA 2AP6A 2PMWA 4U6PA 2CPIA 2QLBB 2BBEA 3A4TA 4F04B 4WCEQ 5ETMA 5AE2A 2N4CA 2F4FA 2G2OA 3TI0A 4JBCA 2HLUA 3HHLD 4KGXB 1WDDA 1X31C 2OPPB 2MEWA 4DWIA 2C22A 1HBNA 3MUTP 4Q8EA 2WONA 1Z4UA 4DR7F 2CADA 3CJSA 1RI7A 2LEAA 2OTJS 3R5GA 4FYWB 1YDLA 1L3UA 4CP5A 2C3MA 2QIFA 3V4IA 5KT2A 3HSZA 4DPTA 2KM8B 1N5YB 1G1XA 2ASJA 1U47A 1S6QB 5CZVA 3N0VA 4V19J 3IWNC 3NS6A 2W2PP 1W25A 1GQEA 3HF5A 5HBMB 1OYEA 1F6TA 3VV2B 3BDEA 3R2DJ 1YTYA 2HVHA 4PQAA 3CD7A 4USVA 3I87A 3IRXB 3VZIA 1T9WA 2ZH3A 2CAJA 4J9MA 3C6TA 4PYDA 3THTA 3ZZUA 2GJFA 3GCWP 4A46A 4LSZB 4ZJQA 4LFCJ 1T9VA 3QGGA 5J2MB 4IOCQ 1UP1A 4F4WA 2AHOB 3L95X 2GA7A 2KJVA 4KPCA 4WF9Q 3NWRA 2HNYA 2XG8A 1LWFB 4OYZA 2LU1A 5LJ5Y 1U1QA 3NLCA 1ZBTA 1NRKA 3AD8C 3FCHA 3D6FB 1ACMB 4NXNJ 3B82A 5BR8F 3EDQB 2OH2A 4FF1A 4ECQA 1URRA 5RUBA 5I3UA 3OUYA 5A8WB 2MKHA 2B4OA 2XMAA 4J9LA 3WQPA 1NDKA 2HFOA 1JLQB 1SJQA 2VDHA 3M4XA 2PFDA 1RT1A 4I1TA 2WOMB 4EYIB 3V81A 1KC8T 2RAQA 2HBZB 2UU9F 3H8YA 4DUYJ 4YDDB 3H59A 1CULA 2ZD1B 1LWEB 1X4AA 2V68A 3MOJB 1FKPA 1WUUA 1RWKB 3BO4A 1EAYC 3IG1A 5FLXU 1NDCA 2MZQA 4JI0J 3TA2A 3C15B 2MY7A 4KV8B 2DGTA 1FX2A 2BRLA 4ZHRB 2V8DA 4NLUA 4CTAB 3JB9k 4YR3A 4DFKA 4YS2A 2YX7A 4MH8A 1IBKF 5DQGA 3WZ0A 2VHGA 1VCTA 3QO9A 3IM8A 3U1NA 1OS5A 3HHLA 4OZ2A 1TQLA 3TVYA 3TAMA 4UT4A 3CB4A 2EG1A 2LQJA 1S1VB 4NLDA 3AHPA 2HIQA 4C6AA 1GMWD 2VG5A 3POTA 4LF9J 3CUNA 3S8SA 4QIFA 1MMDA 2AX1A 1P9QC 1R43A 1EKRA 4DV5J 1VLYA 2MJNA 3HT3A 1DY3A 3O3LA 2VG6A 2VKZG 5ETTA 2IRUA 4KHRA 4WFYA 4M5GA 3KLVA 2WRMA 3IBFB 3GJRB 5BYRA 3CCZA 4ES1A 3G8QA 1D8YA 5J2NB 1SVDA 2HFUA 2GAGC 2VBWA 4DCJB 4JP8A 2QC3A 2N4DA 1JJCB 3TEGA 5DGBA 2MQQA 1AROP 1WKJA 2QFJA 5KG7A 3F0NA 3SSSA 2P6TA 1WSRA 3ZC4A 2KM8C 2R7XA 2QLXA 3MM8B 4NI2A 3R2CJ 2H1YA 3H20A 2AGQA 1MN7A 4WK3A 4EO8A 1SL0A 4EBEA 3RBZA 3HKWA 4S0MA 5IT9Y 2C3PA 5F3TA 1IKXA 5K8MA 3KK2A 5A8KB 1S6UA 5KFNA 5AJ3F 3P8BB 2V4JA 1FJ7A 3FBCA 2KXFA 2FC9A 4DX6A 2RDIA 2WHOA 2D9OA 4J9QA 4I68A 5GAHI 1TKZA 3NNAA 1UJ6A 5KFKA 3C66A 2G1DA 4I6YA 5LSOA 3KJQB 1SJRA 1B7YB 2J9DA 2IRXA 4QPXA 1MN9A 1CJUA 3EPGA 1CS4B 4KAIA 4EYHB 1T8EA 3HX9A 4GVLA 3R1LA 3GV8B 3FSYA 2K1RB 2ZNYA 5HVGA 4EK2A 4K2XA 1T05B 3LH2S 2BW2A 3W8GA 4F50A 1NMEB 1NKBA 4GO7X 2I8EA 5F0UA 1P27B 2U2FA 1S9EB 4AD6A 3DRRA 3FEZA 4I64A 4DPWA 3CCMS 1FF2A 1U48A 3NS7B 4DL7A 4Z37A 5ETSA 4DCPB 2ZFHA 5C5JA 1SCJB 1NPPA 3RG6A 3FEXB 3SZ2A 3H40A 3LA0A 1F3VA 3D1QA 4AQYJ 4B9NA 4B3OB 1GMWA 4ED0A 2N7YA 2HHTA 5IQQA 2CWKA 1UJ4A 2HVDA 2B51A 1UVIA 1E6YA 2ROGA 4F3OA 2ZH4A 4A47A 1NZ8A 4ZCKA 1X9SA 5LL6d 3BM7A 2OHDA 4NCGB 3HHDA 2WBMA 1N6QA 4FPRA 3B4DA 4ED6A 3CWJA 3CCUS 4LF4J 4RW8A 5HP1B 1HWLA 5EHHA 5KFVA 2Z4PA 4KFBA 3KK3A 2ZC4A 4CM2A 4OHXA 1SQEA 1VK8A 3JTOA 5L9XA 2BDPA 2W7OA 3OFEA 4I4BA 2BXJA 4NE9C 1BE4A 4ECXA 2JH3A 3H0PA 5KFHA 4DG1A 2R7WA 2RNEA 3M1VB 1M90T 1LK5A 2DXEA 4ZVQB 4DV6F 3NP5A 2XO6A 4DSEA 1EARA 1M5OC 4LUBA 1LEOA 3K5PA 3CJ4A 1DTQB 2E5HA 5GADU 3V6HA 2FGCA 3DGVA 1MU2B 1HBUA 4RJVA 4J9SA 2FYXA 2M0GB 4DOZA 1GX6A 1QTNB 1RAJA 3PIOQ 1FKAF 4ZPWR 2JRSA 3TZXA 3AT1B 1JX4A 4ANCA 3BQ0A 4EZ6A 5IC6B 2E1RA 4F4ZA 8ATCB 5IT4A 2RU3A 1UWAA 5A2QY 4TQRA 3ETOA 5IZHA 4DV3J 1N88A 5F8MA 2PC6A 4E98A 2LFVA 5DJBA 1Q1KA 3K7RA 2W4PA 1LWCA 1F1BB 2JEFA 2KH9A 3GB0A 3IWXA 2ZVSA 1TKXB 2XSJB 3R1HA 3PR5B 2KT2A 3T5JA 4DR6F 4I2PA 3C2PA 3TRGA 2J0QD 4DV1F 2IHR1 3GCXP 4MAKA 3DLGA 2V67A 3EICA 1EKSA 4LIWA 3MEGA 2A0FB 3MMJA 1R8BA 3LTOA 3PW0A 1DHMA 1HNZJ 3D6TB 3GE9A 1IBCB 3KLHB 3ITHA 2EC2A 2RH3A 5KFQA 4TU8A 5H9EJ 1ICEB 2R2RA 1JNRB 3SFUA 2E7VA 1CVJA 5E33A 2QSFA 4X4QA 2M3DA 2KXHA 2B3TB 4DU8A 3T9ZA 4I56A 4DQIA 3CD0A 5GAEI 4JI1J 3RJMB 2F4VF 2DNKA 3N4WA 4JV2A 4FKXA 3J81U 4DL3A 2YWKA 4PABA 1IKWA 1N4LA 4ZN3A 3TAPA 2AQ4A 1QSSA 1F0XA 2AJQA 4FP9A 5KT4A 3DHXA 5F41A 2DR6A 2BE2A 1JQGA 2C2DA 5J2PA 3ENWA 4K4SA 2ZVIA 1RTIB 4EUVA 2E1CA 2OGUA 1WHYA 1VQLS 2ZOMA 3PX4A 4H4KC 4PQUB 1XEZA 3I0RA 1SUQB 2QGFB 3BGFA 1Q8KA 2IC3A 1KN6A 2WTFA 2XYGB 4ATNA 4QWAA 4ELVA 1TUWA 5E3PA 2CQ3A 1S6OA 3QYYA 3CJTA 1GXTA 1YJWS 4IDKA 2P5VA 4QYZK 4Y2CA
chains in the Genus database with same CATH topology
5DM7Q 3KMQA 2W8KA 2VG7B 4ZVFA 1N54B 4QZVB 2O1PA 2MSTA 2NZ4A 4NLPA 3H98A 1TFYA 3M2UB 4ZK7M 3CDUA 1PGZA 3CD6S 2LXIA 4RX6A 2K3IA 1RTDB 1RQ0A 4TN2A 5F8IA 4AE5A 3PY8A 1PC5A 3M2RB 2IVYA 3I82A 4I2QB 1FE0A 1NU4A 4PPDA 2HMIA 3SSRA 4R0EA 4CO1A 5DDRC 2VFUA 5DDOC 2ZH8A 1VQ4S 2FLNA 2DRAA 1QUVA 2C28A 3FRZA 2GO8A 3FSXA 2J8AA 4MJKA 1C0TB 1N5YA 2RS2A 3TVKA 1Q81T 1H38A 1S6QA 1S7HA 2A10A 3BSCA 5CCLA 2O67A 2X1GA 3HHLC 3DDNA 3JSRA 1D9AA 2B9YA 3OLAA 4ALZA 3RB3A 4ZP9A 4C7QA 2IYIA 4IQXA 2NS1B 3BGLA 5HBMA 1FCAA 3H25A 4FS2A 2HGMA 4O4RA 4X2BA 1S1UB 1LW0A 2E44A 2FTRA 1JLEB 1S1XA 3U27A 5DG7A 3D0GE 3JAMY 4RBUA 3N6MA 2OFGX 2YH1A 2KHDA 4FVMA 4X4VA 1GX5A 3M2VA 3IRXA 2QEXS 3MEDA 3UD4P 3MMBB 2CQ1A 4ED3A 3FNNA 1HQEB 3PXGa 4WJBA 4AXIA 4BC9A 4WKRA 3PO5A 5MAOA 4O3RA 1VIOA 4LSLA 2D3UA 1Z2ZA 4NLRA 4URQU 3ULHA 4MIBA 3M6VA 1HR0F 4B3SF 2M5YA 3DHWC 5E3AA 2R8JA 4EWTA 2ZM6F 3UQSA 3LP0A 3LUYA 3N9UC 4OQJA 2FJVA 2MXYA 5FIIA 1MSWD 5J2MA 5F8NA 1C1BA 3OR2B 2D41A 2VPWB 2E9TA 2XULA 2RF2B 4NRTA 5G4DA 5C42A 4JV5F 1Q79A 1HBNB 1NJYA 1S1TB 2WONB 1N33F 1U49A 2G0CA 3J7YI 2ZOGA 1R6YA 1TL4A 4LIRA 4FVCA 4IH7A 2ZITA 2ZH1A 5L9NA 1L3TA 2DNQA 3HVRA 4GKJF 4MTPA 2RQMA 2J7UA 1DAXA 4RW6B 1LWFA 2HZCA 3RU0A 3RRHA 2VFVA 4PXEA 4NRUA 3BDPA 2OO4A 1I1GA 4C8LA 3V4IB 4NYPA 3V6KA 2DNRA 1I94F 1HNVB 3DLKA 3G6YA 1WTBA 1S99A 2FVCA 1SH3A 4TXSA 4K4XA 2RRAA 1EETB 1H0HB 1XNQF 1HI0P 3K5LA 2DR7A 4Y3CA 3D1OA 3DU5A 3OLBA 1P1LA 4M94A 5T14A 2ZH9A 4TU9A 1UJ5A 4KT0C 1VQ5S 1OIAA 2XLKA 4ZCMA 3MM9B 4OZ5A 2ZKTA 3OJUA 3AJ2A 1IJEB 3NNHA 1SJ3P 3BGUA 2C3UA 1X5SA 2WAQD 1C2PA 1FA0A 1REVB 2RE1A 2E9RX 2IM1A 3UR3C 4RLEA 5A0YB 3E01B 1RP5A 2Q3PA 4EO6A 2OKQA 1WACA 4BHQA 3NKYA 1HWJA 4WK1A 2AU0A 3OFGA 1HARA 4IO9Q 1S0VA 1XR5A 2UUAF 2XI3A 2PEHA 1RT2B 5J2QA 1JK9B 5A8WA 2E29A 3IXQA 3CJKB 3CMAS 4ZCIA 3T1HF 2ILZA 1VQMS 3SCKE 3DI6B 1YRTA 2ZNZA 2VL1A 3PJWA 5EX0A 4MYTA