1JLAB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
435
structure length
408
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 111
structure length 408
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB03
1R0AA 1S6QA 2XI2A 4IH6A 4EBCA 5KFKA 3RBDA 4IQXA 1T3NA 2OPSB 1IKVB 1XR5A 2JEJA 2CJQA 3LAMA 3T19A 4EYIB 4RW7A 4NLGA 1RT4B 1ZTWA 3KLHA 4NLYA 5EWFA 1TL3A 1SV5A 5F9LA 3QIPB 4H4OA 4ZP9A 4KAIA 4H4MA 4URQU 4ZVGA 1RT7A 1C1BB 2GIRA 2R8GA 1QE1A 1J5OB 3LANA 3KHHA 4PQUB 1TKZA 1C0UA 4MH8A 4B3OA 5I42A 4ECWA 1N6QB 3MECA 2HNZB 2VG7A 2YNIA 4ED8A 3FRZA 3BQ1A 4HKQA 1HQEA 3MECB 4RW4A 1S9GA 3QGIA 5KFAA 2BRKA 3MEGA 4ZHRB 5HROA 2ZKUA 1LW0B 4JV2A 3H59A 3DRPA 1HMVA 1S6PB 4IR1A 4H4MB 3ISND 3I0SB 4ZPAA 4EO8A 4H4OB 4DL3A 1S4FA 1SV5B 4RW8A 3JSMB 4WFXA 4NLXA 3FSIA 4ZP6A 1S9EA 2WK4A 3HVAA 5KFHA 4G1QB 3MEDB 5J2QA 2B5JB 1SH0A 1LWCA 3KK2B 2R2RA 3NKYA 4U7CA 2ASJA 4I2QB 1U09A 3RAQA 5KT3A 4IDKB 3QLHA 1S6QB 2B5JA 1IKWA 5DQHA 3QO9B 1VRTA 1N5YA 2FLPA 5JUMA 2UUTA 3FFIA 5F8IA 4ZVEA 2WTFA 4DL5A 1S1TB 4J9KA 4TLRA 1FKPA 1D0EA 4ZPDA 1JLCA 2XGPA 1QAIA 5J2MA 5HLFB 5KFIA 2IAJA 3I0RB 5KFJA 1S1UB 1W25A 4RNOA 3MR6A 4ED3A 4R0EA 2YNFA 3JYTB 2RDJA 1TVRA 1RTDB 1C0TB 1SUQA 1NHUA 3DMJA 4DL4A 5KFXA 1XR6A 3NAIA 2YNIB 5K14A 4GC7A 3H4DA 3PVXA 3CVKA 2JC1A 5KG1A 5DQIA 4ECVA 2HNZA 3KLFA 3I5AA 1RT5B 3MF5A 3KLVA 2VA2A 4K4SA 2HNDB 2YKMA 5F8LA 1RT2B 4TQSA 2E9TA 1RT7B 2OPPB 5KFPA 4EBDA 1BQMA 1BQMB 3KK1A 3V4IB 3V4IA 3ISNC 2RDIA 2OPPA 5J2NB 2W7PA 5DGAA 3DMJB 3QIPA 3UPFA 1TL1A 4EBEA 2UVWA 5C25A 3V6JA 2R8HA 3MFIA 3I5BA 3LP1B 4ED0A 4RW9B 3I0RA 5K14B 4O3NA 2V4RA 3CIZA 4MKBA 2WONA 2AX1A 2BQRA 1C0TA 5KFDA 4J9SA 3M9NB 2B6AB 2JC0A 4J9QA 5KFWA 1R0AB 5HP1B 3N6MA 4JUZA 4TYAA 3LP0A 3KMSA 2I1RA 4F4YA 3QO9A 4RZRA 3DLKA 5J1EA 3N6NA 4WFYA 4O44A 5J2MB 1RT6A 5HLFA 3MR3A 4TXSA 2AQ4A 3MEDA 5J2QB 4ID5A 2HNYA 3IRXB 5HBMA 1RAJA 4NLSA 3BJYA 1VRTB 1N5YB 4Y34A 1S9EB 2W9BB 4PWDB 1MU2B 1RTHA 2AU0A 2ASLA 2FLNA 5DGBA 4IG3B 2WHOA 2WRMA 4I2QA 2C2DA 1LWCB 3IG1A 3KK2A 5DG9A 3DRPB 1S1XB 4NLOA 2RF2A 3KMQA 4IH5A 3NL0A 3H40A 4WE1B 3JSMA 1K1SA 3BSNA 4NLQA 3GV8B 2R8IA 3I0SA 3QZ8A 3KK3B 4YR0A 3OLBA 4FS1A 5DLFA 1N48A 1S0OA 1C0UB 3N6LA 3H5YA 2FLLA 2UVVA 4FBUA 4EO6A 1K1QA 2ZD1B 1C1CB 4O4GA 1RYSA 2VG6A 5KFUA 4K4YA 2VG7B 4PUOA 2ZE2A 2IA6A 4WE1A 5KFBA 4RNFA 4IOBA 4RW7B 3OSPA 1S1XA 3M8QA 1YVFA 3H5UA 3IG1B 4Q0BB 1JKHB 1RTJA 2FJWA 2ILYA 2EC0A 1TP7A 5KFZA 4YP3A 2J6SA 2OPRA 2FJVA 2UUWA 3GYNA 3QGGA 4ZP8A 4DG1A 5EWGA 2XCAA 3GILA 5DLGA 2DPJA 3T5HA 3T5JA 3UQSA 4IFVA 4TY8B 2HNYB 1RT1B 3SI8A 4NCGB 2WB4A 4NLWA 1JX4A 2R8KA 2W8LA 3OSNA 5F8NA 4ZPBA 3RB3A 4J9MA 4MFBA 3DRRB 3HVTB 1N4LA 2YNGB 2FVRA 4MIBA 2FJXA 2D7SA 2VG5B 5DG8A 3LP2B 1KLMB 4LQ3A 4K4ZA 1TQLA 1JLFB 1JLFA 4IFYA 1NNDA 1HNVB 5I3UB 1RDRA 1KLMA 1HPZB 4RNHA 2B6AA 1EP4A 4NLDA 3Q8PB 3GIJA 4J9LA 1JLBB 1MMLA 1JLGA 4I7FB 2B43A 4XPEA 3IGVA 3M9OB 2V0NA 1TKXB 4EEYA 3RB0A 4ECYA 2OH2A 3KLGA 3DYAB 4XO0A 4ZVFA 4F50A 3PW5A 2IM1A 1FK9B 5KG0A 2BRLA 5KFQA 4WYWA 2XC9A 4O3PA 5J2NA 1REVB 2QE5A 4TY9A 5KFRA 1ZETA 4Q0BA 4KKOA 5L1JA 1NHVA 2WOMB 2VA3A 3D28A 2FVPA 4H54A 1RT5A 3HKWA 4PUOB 4IKAA 3DOLA 1LW2A 3CDWA 4ED7A 1QAJA 1EETB 3V81A 1IKYB 5KT4A 1S1WB 3GQCA 2FVCA 4RW6A 3GV5B 1C2PA 3BQ2A 3GIIA 3M8PA 3JYTA 3PR5B 3KHLA 3UR0A 2GIQA 2J6UA 2YNHB 3KJVB 3RAXA 3QZ7A 3BR9A 3OL6A 1S1UA 3GIMA 1S97A 5C5JA 3C6UA 4RNNA 1RT3B 3C6TB 4GC6A 1LWFB 3OL9A 4M94A 5KFNA 3DM2A 2J6TA 3KLIB 4IR9A 4M95A 3PZPA 4WZQA 4Q45A 2JLEA 3E01B 4ICLA 3RB6A 4K4TA 3IS9B 2HMIA 2F8EX 4MK8A 5D3GA 1JLEB 2HWIA 4IG0A 1RA6A 5KG3A 4ZPCA 4IG0B 2WCXA 4ZP7A 2V9WA 4G3IA 3GV7B 3NGDA 3LALA 1S0NA 2R2UA 3IRXA 5HBMB 3BSOA 1IKXB 4RU9A 5KFYA 5KFFA 3DRSA 3KHGA 3T5LA 4Q44A 3DM2B 1JLAB 3H98A 1LWFA 1RT6B 5KFEA 2AWZA 1HMVB 1S6PA 2IBKA 3HHKA 3IS9A 1LW0A 4ICLB 3E01A 3Q8SB 3LP0B 2XCPA 2AX0A 3KLIA 3DI6B 1T03A 1UWBA 3KHRA 2R2TA 1S1WA 4KFBB 2W9CA 3MR5A 4NRUA 4O3SA 4WFZA 4ECXA 3LP1A 4ZMMA 4R5PB 2XGQA 5C42B 4B3OB 2W7OA 5C25B 3QGHA 3EPGA 2FVSA 3M8PB 4PQUA 4J9PA 1TL1B 4R8UB 4KO0A 4RW6B 2W9AA 1DTTB 3CJ3A 3TAMA 3CJ5A 2YKNB 1REVA 5EDWA 4KHMA 4KO0B 3T5KA 1BQNB 1TL3B 5KFSA 2HNDA 1DLOA 2YKMB 3CDUA 4NLVA 3FDSA 2ILZA 1RTIB 4EYHB 1TKXA 3CWJA 3IGNA 4KV8B 3SFGA 1JLGB 4I7FA 4KE5A 4KB7A 3ITHB 4JV0A 1JLBA 1SUQB 4MK7A 1HNIA 3DOKB 4Y2CA 1TVRB 4RUAA 4FS2A 1TV6A 3TVKA 1HPZA 3QYYA 4QWEA 5F8MA 4DL2A 4MIAA 3G86A 3LP2A 2YNGA 2JEGA 1WNEA 4WYLA 4DEZA 1I6JA 4F4XA 3DRSB 3BSCA 4YR3A 2GC8A 4KSEB 4Y3CA 1RT1A 3FFIB 4U6PA 1HNVA 1HYSA 2CKWA 3PW4A 2VG5A 1TV6B 3QLHB 3H5XA 1HNIB 3DOKA 1LWEA 5KG2A 3DLEA 4I2PB 4ECUA 5C24B 4URGA 3LAKA 2OPQB 1JKHA 5KFGA 1S48A 1VRUA 4NRTA 5FDLA 5KFLA 3M8QB 5KT5A 3OL7A 3OHBA 5F8JA 1JLQB 3OL8A 1HARA 3V6DA 3PHEA 3MFHA 2AGOA 5EUHA 3M9MB 2BE2A 5L1LA 2D3ZA 3C6UB 3HVWA 1DTTA 4TYBA 2ZD1A 5KT7A 3MEGB 4ZHRA 3KJVA 3PJWA 2C28A 4J9NA 2UVRA 4FBTA 1S49A 2HAIA 2XI3A 5L1IA 1D1UA 3QIDA 3KK3A 2VG6B 4KFBA 5CYQA 5CYQB 1EETA 1UWBB 3E51A 4RUCA 3DOLB 2BE2B 2IM3A 3OLAA 3BQ0A 1N6QA 1IM4A 2IM2A 3OHAA 4QWCA 5I42B 3V6DB 3BSAA 5KG6A 5F8HA 4LSNB 4IRDA 1TKZB 1JLQA 1Z4UA 4ED2A 4K4UA 1QE1B 3T1AA 1J5OA 1XR7A 2D41A 1VRUB 4KKOB 3RBEA 5KFOA 1JLAA 3DLEB 4I2PA 1KHVA 2QV6A 2IC3B 5KG7A 2O5DA 1IKXA 1RT4A 4NLTA 4ECSA 5L1KA 2IJNA 5KT6A 5FDLB 4ED6A 2OPQA 1IKVA 4O3RA 5T14A 3KLEA 5C24A 3EPIA 2BQUA 3KOAA 4IH7A 1LWEB 5F8GA 5KFMA 3EZUA 5J1EB 2HMIB 4QW8A 2W9BA 2D3UA 4Y2AA 5I3UA 3RB4A 3DLGB 3FQLA 4ID5B 4KBIA 4YR2A 3FQKA 1TKTB 4MKAA 4MFBB 2IJFA 4NYZA 4HYKA 4XPCA 1RT3A 3C6TA 4O44B 2W8KA 4RW9A 4NCGA 3NMAA 4Q8EA 4IFVB 4TY8A 4WXWA 2RKIA 3I5CA 2JEIA 5HP1A 4ED1A 1HQUB 1DLOB 4DG1B 1T05A 1DTQA 1FKOB 2OPRB 1GX5A 2HWHA 2BANA 3ITHA 5KFTA 2BQ3A 4NLUA 2IM0A 1N56A 4KV8A 3KK1B 4YMEA 3V81B 1RTIA 4YQWA 1LW2B 4R8UA 2I5JA 1JIHA 4QWAA 5C42A 2I5JB 1BQNA 3D5MA 4NLPA 2ZE2B 4ECTA 2YKNA 3BGRB 5DQGA 4O4GB 3NAHA 4TN2A 3TAMB 3Q8RB 3CJ0A 4NZ0A 1T03B 4F4WA 2C2EA 2BANB 5CYMA 3TQ1A 1T05B 2UVUA 1HQUA 4URSA 2RKIB 4R5PA 2E9ZA 3KLFB 3DYAA 3GIKA 3BREA 2W9CB 3UDLA 1JLCB 5F9NA 3ICLA 3DI6A 2BR0A 3NBPA 4DL7A 1RTDA 4JV1A 3CO9A 3V6KA 1RYRA 2YNFB 4QWBA 3PW2A 1S10A 2ASDA 2RF2B 4OL8A 4X2BA 1IKWB 4J9RA 2XWYA 3DRRA 3HVTA 1CSJA 4IDKA 2AGQA 4O4RA 3KLEB 4RNMA 4Q8FA 1S1TA 4LSLA 1MU2A 1RTHB 5D3GB 1ZTTA 1OS5A 4G1QA 2DPIA 3SFUA 1S1VB 3MEEA 1S1VA 3MEEB 1S0MA 5KG5A 2IC3A 1RA7A 4LSLB 3G6VA 2ALZA 4IRCA 3G6YA 4ECZA 4K4VA 4K50A 3Q8QB 1RTJB 3MTKA 1JLEA 4J9OA 5KT2A 2YNHA 4NLRA 4K4WA 4LSNA 4QPXA 4IRKA 4RW8B 3NBPB 1HQEB 2WONB 5EWEA 4KHRA 1KHWA 3VQSA 1C1CA 5JXSA 1JXLA 2IMWP 5HROB 3H5SA 2C2RA 4O3OA 5KG4A 1S9GB 1T94A 2FVQA 4RW4B 5CYMB 3PW0A 5KFVA 5L9XA 3PR4A 1IKYA 3BGRA 3H4BA 4K4XA 5KFCA 2ATLA 4ZVHA 4WXOA 3PW7A 1RT2A 3DDKA 3G6XA 2V4QA 1FK9A 2JEFA 4WZMA 2WOMA 3KLGB 1C1BA 1GX6A 4LQ9A 4MK9A 4ECQA 4ECRA 2OPSA 1SH2A 2AGPA 2C22A 4IG3A 3KNAA 3H2LA 1DTQB 1FKOA 3CDEA 3IN5A 4PWDA 3KLHB 1SH3A 4Q43A 4IFYB 3MR2A 1HYSB 3CJ4A 2E9RX 5DG7A 3CJ2A 5J2PA 4QWDA 2IAJB 1S9FA 2R2SA 2R8JA 4TQRA 4DL6A 1FKPB 1TKTA 1EP4B 3PJXA 5J2PB 4O3QA 3DLKB 1QUVA 4QW9A 3DLGA 4F4ZA 3V6HA
chains in the Genus database with same CATH superfamily
1R0AA 2PFFB 1S6QA 4P73A 3UN5A 3ZZUA 4LT6A 1RKJA 5KFKA 2B9YA 1UAWA 4Q5VA 4X65F 2UUAF 4DPXA 2JEJA 1SKUB 2F4VF 3EMTA 3MXHP 2CJQA 3LA0A 3LAMA 1GH8A 3T19A 1UEVA 4B3RF 1RT4B 4CO0A 1RBAA 2LU1A 2CYYA 4NLYA 4WIIA 2VFTA 1IBCB 3BGFA 4BC9A 2HHHJ 4R25A 5B0BA 4H4MA 1R6YA 3P6YC 2B4OA 4GO7X 1RT7A 1SQFA 2AEFA 2K1RA 1QE1A 4Q2MA 1VQKS 2CQIA 3KHHA 1JJ2R 1H2VZ 4IYQA 2JZ5A 4JI8J 5I42A 2ZOGA 2GVZA 2HNZB 2B3TB 2VG7A 2HPUA 2HS4A 2KVIA 1FFGB 1RAEB 2OMLA 1WHWA 2PC6A 4PG4A 5C2GA 5L38A 3EM1A 3HT3A 3TNVA 3PO4A 4Q8FA 4K4ZA 4NZ6A 2XQCA 2UZAA 2QZ8A 3FUYA 4ZHRB 3MMCB 1ZM3A 2ZKUA 1BD6A 3LF0A 3S01A 4YY3J 1HMVA 4DR5F 3B4MA 2V4JB 1S72S 1T3OA 5F41A 3CD7A 3CD0A 3MMAA 1DRZA 2IDLA 3E8OA 3MTJA 2WBMA 3BDEA 4ETXA 2VIHA 5I4MA 4U7CA 2MQPA 2B5JB 3LGHA 2R2RA 3OUYB 2UXCF 1P1TA 1HIYA 4I2QB 1U09A 5CH7B 4YDDB 5DDPC 3RAQA 4IDKB 6FDRA 2GQQA 3R5GA 4QIEA 3NMRA 2R7UA 1EJ7L 3R5AA 4X66F 2AJ0A 1TR0A 5DQHA 3IFEA 2CQBA 3FFIA 3GJQB 4C97A 2UXDF 4ZVEA 1VGYA 2Z30B 4CIOA 1YBTA 4USWA 1D0EA 2W2MP 2XGPA 2BW7A 4LF1A 5KFJA 2HHQA 4CLWA 5HVHA 2YNFA 4RU2A 3IBWA 3NGSA 4PPZA 1TVRA 3R3TA 2IYGA 1CVJA 4AL5A 3DMJA 1NZAA 5KFXA 3NAIA 3AOBA 3TO8A 2DGSA 2M9KA 5HI7A 3PEHA 3LQVA 3J7YU 5KG1A 1LXJA 3TA1A 1FRHA 3MF5A 5GMDA 3D68A 1PYTA 4CLPA 3KLVA 3IWNC 2CVEA 1FXLA 4K4SA 2LA6A 2HNDB 1LNQA 4ATNA 3N79A 3HVRA 1U6BA 2HQ3A 1CJKB 3MPDA 4CNYA 1ZA1B 5KFPA 4EBDA 5IC6B 3ZZZA 1XEZA 3V4IB 3ENQA 3KK1A 1UZDA 1NK5A 3ISNC 2HBRB 3SEOA 3DMJB 3QIPA 2IYIA 3GB0A 2UVWA 1IXKA 1ZPVA 3V6JA 4DLGA 2UV8A 4DS4A 2LEBA 2HRUA 2VFUA 4DQQA 3AA9A 1H38A 2O67A 3RG6A 2VQFJ 5DZ6A 2V4RA 1R31A 1PJ5A 5B09A 1XNRJ 4YB6A 4J9SA 3M9NB 1LQ9A 3OR1A 2B6AB 2GO9A 2VDHA 1D9AA 3K17A 3O6QA 2BJDA 4DR3F 3TAPA 2OD6A 4A8OA 2I1RA 3CCWA 2L48A 3CSKA 3QO9A 3J81U 3G6ES 3DLKA 1OPIA 2PEBA 1OJ4A 4KTQA 4O44A 2YXLA 5J2MB 5HLFA 3NOGA 3PM9A 4I4BA 4J90A 3MR3A 3OTOF 1GMVA 3H0PA 3QSIA 4DL0C 3L3CA 2J7WA 4GKJF 2QLXA 4OX9J 3IRXB 1YJ9S 3PCOB 4Y34A 5HMZA 2FLOA 3MPWA 1KFSA 2ACYA 2B4VA 2AU0A 5CAAA 5DGBA 4ZPTR 4JI1F 2IA0A 1B7YB 4A8YA 3IG1A 4NL5A 2C3OA 5E41A 1S1XB 1IBLF 1V3ZA 1WHVA 4HT7A 4IH5A 4O0IA 5EN1A 3CCQS 1VFJA 3NS6A 4YN3B 1ULRA 3JSMA 1X4AA 2LKZA 1CULA 1URRA 2YWHA 3HSZA 3M4XA 3K89A 3SCLE 3ZZTA 3GV8B 4A48A 3KK3B 4YDXA 2V50A 3U7JA 1UW4A 1O8BA 3K5OA 1BHNA 1Q8KA 1WF1A 3CEDA 4WF9Q 1NH8A 1RBLA 4DQIA 2ZC3A 2QYCA 2DRBA 3N6LA 2ZUGA 1FKAF 2FLLA 1UPPA 1HHQA 4FBUA 2DGXA 1K1QA 4ERDA 2H1YA 1H7WA 3I6PA 4O4GA 1RYSA 3Q0AA 4P6QA 2HVIA 3AB4B 3J80U 3M2RA 2JRSA 2DO4A 4OHWA 2RU9A 2KHDA 5E3PA 7FDRA 1JNRB 2H54B 1WDTA 2ZVSA 3M8QA 1X5SA 3KKFA 3OSPA 2C3YA 2RJZA 5ETKA 3DNCA 1D8YA 3OFEA 4WP9A 2OPRA 2FJVA 3JTPA 2D3OR 5EWGA 1K73T 1PAUB 6AT1B 2HBZB 2HNYB 3Q2SC 4WIQA 4DSJA 2WB4A 3P49B 1SC4B 1MWYA 2KXHA 3BS9A 1JX4A 1T9VA 4ZPBA 4CTAB 3NNHA 3HT0A 1MWQA 1SCJB 3DC2A 3HVTB 5DG8A 2A0FB 2XHCA 4MIBA 1IN0A 2HZCA 3KJFB 3TWZA 3VVUA 2GJFA 2VQEJ 2XY7A 4LBHA 4C8YA 2JFDA 1S0NA 1JLFA 4RNHA 5I3UB 1HNVB 3TEGA 3AODA 3CPWR 2QLFB 3NGRA 3MPVA 5CQGA 4DUYF 1VHIA 1MMDA 4GKKJ 4P2FA 3P3DA 4QR2A 2CZ4A 1VQPS 3J7A1 3K5LA 2K7JA 2V8PA 4B17A 3DYAB 4XO0A 1M5OC 3FKBA 4ZPVR 1FK9B 1S99A 3ET6A 5IQ6A 5KG0A 2RS2A 1EAYC 2BRLA 2HLTA 2W24A 4O3PA 4DU8A 2K8GA 1S7IA 1ZETA 1R3NA 2OO4A 2DGTA 2DCUB 3MURP 2WOMB 1T95A 3F56A 3WQPA 1T7PA 4NA1A 4DPUA 1S0VA 4OX9F 3HKZD 3DOLA 4HI2A 4N8NA 4NYPA 1HBUB 3NOCA 2HQIA 2PO4A 5KT4A 1S1WB 2HG4A 2HRYA 2R7SA 4RW6A 1WKKA 1YZ7A 3Q83A 3BQ2A 4DUTA 5FJ4A 2W2NP 3OFFA 3PR5B 2G0CA 5C7PA 4WCEQ 2NUHA 3RAXA 3UNGC 4JB8B 5ETVA 1S1UA 4DMZA 3GIMA 1F9FA 3EYZA 1WC6A 1RT3B 4GC6A 3OL9A 1LWFB 1PYSB 1WKLA 1WORA 2AJ4A 2A6OA 4OHXA 5MLCV 2DJWA 2JLFA 1RAIB 2H4YB 2RRAA 2EFVA 3M2VA 3PTWA 4K4TA 3IS9B 3AOAA 4MK8A 1SC1B 2KG0A 4DXLA 1GXTA 1QAXA 4IG0A 1RA6A 2HWIA 4ILLA 2F8MA 2DIVA 2UXCJ 4CM0A 4CZCA 1NKCA 1P9QC 2DR6A 2VOOA 4UW2A 3GSDA 3PJ9A 2KHCA 2ZBPA 3PFOA 1VMBA 2OMOA 4L74A 4ZS6A 3FRYA 5LM7E 2HEKA 5E5NA 1OSDA 2QSWA 3H8YA 5CA5A 3W8PA 1NEEA 5KFYA 5KFFA 3DRSA 4C48A 4RU9A 2XSJB 3T5LA 3GR1A 4DOZA 4DFMA 1ZYQA 3C2PA 1RT6B 2Y1LB 1YSJA 2XYPB 1N0UA 2MJUA 4F04B 2IBKA 1NJYA 4ICLB 2XEXA 4M5HA 4YB5A 2Q43A 4DF4A 1TMMA 4F0KA 4D3GA 1KOOA 3FNNA 2AYMA 2P2CB 4ZK7M 2M0GB 4UOCA 4Z7YA 5ETQA 4QBUA 1R0BG 1Q16B 2WSFC 2ZZMA 3NLCA 4ZCKA 3GYXB 1N34J 4O3SA 3ILJA 3O8WA 4WFZA 3BEGB 5DRKA 4R5PB 5G0RB 2XGQA 4DV5F 1Q7LB 2C2NA 3DLJA 3KG4A 4PG6A 3OXLA 3M2UB 3EPGA 4I67A 4PQUA 1Q8IA 4R8UB 4GVBA 4RW6B 2RHSB 3MPUB 2DNOA 1D09B 5EDWA 4U7UK 4DV4J 2J5AA 4KO0B 3WZ0A 3JAMY 5D4PA 2HAFA 4TU8A 3CCJS 3CDUA 2XS2A 2KXNB 4HR2A 5IM0A 4NLVA 1V3RA 1ZS6A 3FDSA 4YHHJ 1ICEB 3UVJA 3CWJA 4KV8B 4JV0A 4KB7A 4CO1A 3ITHB 4DPTA 1JLBA 4PXEA 1HNIA 2QX0A 4V19X 4RUAA 2MKCA 1TV6A 3ET6B 1FRLA 5F8MA 3L7OA 3HDSA 1U1NA 1UEUA 1U4BA 4ELUA 1UTAA 1Y7PA 3C15B 1U0HB 4MAKA 2YNGA 2JEGA 2DGOA 5CHCB 2GC8A 3DGPA 3I4HX 3LUYA 1RT1A 4UQTA 2CPXA 2MSTA 2AD9A 1YJWS 1SJQA 4GMKA 2QJ3A 2Z2MA 3LPEA 3S7RA 3H5XA 3DOKA 2OKQA 1HBMB 2LXIA 2LQBA 2RDDA 4OI2A 4N47A 5C24B 3M6UA 4FVCA 3OT9A 2OPQB 4ZJLA 2L9DA 5KT5A 1XC9A 3QBCA 2PA8D 1EKSA 4C7QA 3OL8A 4Z37A 3UCGA 3V6DA 5D78A 2HHPA 3DOMB 3LO3A 3KDOA 4ZN1A 2XZWA 4WU2A 2VBZA 4AL7A 3TI0A 2RVJA 2B51A 3TZXA 3C6UB 3HVWA 3H7HB 2LLZA 1U8SA 2XMWA 3KG0A 3MEGB 1S6OA 1E6YB 2EWHA 2XMAA 1XJWB 4J9NA 2VBWA 3I4PA 1S49A 2XI3A 2BABA 4CH0S 2ZH9A 1HNXF 2DGUA 2P6SA 2CG4A 3QIDA 4OHVA 2ZHOA 4M5LA 1FJEB 1NK7A 2GHWA 3ETMA 2YX7A 3E51A 3ZZYA 2FZCB 2D9OA 2IM3A 4UOFA 3ZZOA 2XLKA 2Y8WA 3BV8A 4X62F 2R7OA 3MGJA 2FTRA 2X3GA 4LSNB 1RZMA 1TKZB 1Z4UA 3D1OA 3IR5B 3MM7B 3P5TL 4HHJA 2RQCA 3G4SS 4BS2A 5KFOA 1W2BR 4HI1A 4DCJB 3AD8C 5KG7A 1IKXA 4GO5X 3FGVA 4IOCQ 1H6KX 4USTA 4ENOA 3E2EA 1G2EA 3THTA 5KT6A 2DTJA 5J1PA 3TJAA 4FYVB 1SJ4P 2OPQA 1IKVA 3EGVA 3I9V9 1N33F 1N0VC 4P2SA 3RZAA 3DU5A 1X7VA 4L73A 5A8KA 2HK3A 2KI2A 2HMIB 3L95X 2D3UA 4Y2AA 3QRQA 2HHVA 3A4TA 4XTTA 3RW7A 1Q5YA 4KBIA 4NA3A 5CABA 1XN9A 3HPOA 1X9WA 2V69A 2MKKA 1HBNB 3MM9A 3RGIA 2VBXA 2W8KA 4O44B 2HVEA 4DU7A 4RW9A 4NCGA 3TP2A 3HSDA 2RKIA 4HACA 1NM2A 1YZ6A 1P8GA 1UA0A 3EGZA 1EHWA 2BXJA 3PACA 3MAAB 4DG1B 4I69A 1RLCL 1NU4A 3GCWP 2BANA 3ITHA 2I6WA 4NLUA 3CJRA 5HJXA 3KYLA 4JI3J 3MM6B 5CCLA 1RTIA 1HNZJ 3FZBA 2DIUA 3J81j 4EZ9A 2V8VA 4A8KA 2FGCA 2NS1B 4NASA 3TUPA 4EWTA 1JIHA 5BR8F 1BGXT 2I5JB 1R8PA 2A6MA 4C3KA 2ZH1A 4UY85 4LFBJ 2YKNA 2Y0BB 1FD8A 4I6YA 1MSWD 3NAHA 2GMHA 4NYOA 4NZ0A 1T03B 2VFSA 5DDRC 4I64A 3DRYA 3T6JA 3HMJG 1XQIA 4CO4A 5LSOA 1T8EA 2OJ3A 2IJRA 1WTBA 1F5CA 4R5PA 1OSCA 2QMWA 3GIKA 2K7KA 3BREA 3BKFA 2KJWA 3MM5B 1VK8A 2BR0A 5IWAJ 2L3MA 1RTDA 1WD6A 3JQJA 1RYRA 2RRBA 3QT5A 1U1QA 1RWUA 1HWIA 2CJ9A 3FMWA 2XMVA 3SXLA 2DRDA 4CO5A 4P72A 2CQGA 3HJFA 1U49A 3IWXA 4X2BA 4J9RA 1HHTP 4KH1B 3KJQB 2BE9B 2VC0A 1T9WA 2J8AA 3D4JA 1IWGA 1HD0A 3EVOA 3V5RA 2KM8B 2ZJRQ 5JMNA 1RTHB 1WEXA 1GAOA 1G7CB 1GMWD 1NMEB 2V63A 4QIGA 2FC8A 4QR1A 3MEEA 1S1VA 3DDIA 4LF6F 2HHXA 3T9ZA 4YFUA 2IC3A 1HNWF 5CZVA 4M5JA 2BOAA 2APOA 2MZSA 4DV3J 4FN5A 1U1OA 4YEAA 4JI6F 3Q8QB 3HHLB 3M32B 1JLEA 3T1YJ 9RUBA 1E6VA 3CDBA 4J9OA 1OY6A 2YPZA 3M2VB 4PG8A 4AFFA 4OJHA 2HVZA 5HQ8A 2RT3A 2YTCA 2I8EA 3OTOJ 2ACMA 2WONB 2FB0A 2CRLA 4A8FA 1P6TA 5E3AA 4KHRA 1KHWA 5I3QA 1FTRA 1L3KA 3HHEA 3WX8A 1U0SA 5FLXY 2IMWP 2FGOA 4F3OA 1FERA 2C2RA 2FJAB 1J27A 1WG5A 5HMYA 1IBMJ 5KFVA 3O1LA 3A13A 3CCLS 3M6XA 1FXDA 4PPDA 1NSKL 3F0NA 1QM9A 3PW7A 1TK0A 3X1LB 3QWPA 3UCZP 2JEFA 2F4FA 3HSGA 3HX9A 4BDPA 2WOMA 3MZIA 2RE1A 3KLGB 2UU9J 3Q22A 1AUDA 4MK9A 5IV4A 4KR0B 3J81Y 3PV8A 2V2KA 1SH2A 3PEJA 4DCOB 2Z2LA 1ZM4A 4IG3A 2C22A 3AXKA 1FKOA 2EEYA 3W9JA 4PWDA 3EZOA 2HW3A 1HYSB 1FDNA 2J9DA 3DCAA 1DBDA 1FDAA 1WOOA 3ZTQA 3CJ2A 2E9RX 1NK9A 3AOCA 2L08A 3PRVA 3QNWB 2DGQA 2ALYB 2KZZA 4DL6A 3PKMA 3EVWA 1TKTA 2ZZTA 2YKOA 1EP4B 3PJXA 3SDEB 3CE8A 3T41A 2LQJA 1J2VA 2IDEA 2Y8YA 4OIXA 3RRHA 3HFVA 3K5NA 3DDNA 3R7BB 4Z2XA 2XI2A 1N5QA 2GVDA 3GP9A 3VZIA 5F3TA 2KYZA 2ZH4A 1JJHA 1IKVB 3AT1B 2R7TA 3BGUA 2CXEA 4BWMA 4C3MA 2RD5C 1SBRA 4EYIB 4RW7A 2GCFA 4NLGA 1NBEB 2XMJA 4U95A 3MOZA 4LVOP 3CW2C 1SV5A 4H4OA 2F4VJ 5GADI 4HL9A 4ZVGA 2KFZA 4PKDB 1NDPA 3SCJE 4DPWA 2GIRA 3W2VA 4RPFA 3JXOA 3N5BA 3QPIA 3LANA 3R7NB 1TKZA 2C3UA 4NMXA 1FJCA 4MH8A 4B3OA 3PX4A 1LK5A 3A1YG 3SV4A 3DLLQ 2Z2YB 2DR5A 3KUGA 4QJVA 4M5NA 1HWLA 3MECB 1FVSA 1S9GA 1WC1A 4FKXA 3SQGB 1SXLA 4CRJA 1DZ5A 1BWVA 1TL5A 5ETSA 5IFMA 5HROA 4CH1A 1LW0B 4DR1J 4JV2A 5DS7A 1S6PB 4HTJA 4ZVSB 4M5GA 4PXBA 1HW8A 3JTOA 2ZH5A 3I0SB 4H4OB 1H2TZ 1FT8A 3FCVA 3JSMB 3MDFA 4NLXA 4WFXA 1CQMA 4OZ3A 3FSIA 2ZFHA 1V9OA 3D7SB 4WK3A 2WK4A 2P9CA 6FD1A 2HURA 3V2UC 5KFHA 3SZ2A 2F40A 1RABB 2OEJA 3NKYA 5J2QA 2EBEA 5HO4A 2ASJA 5GAGI 3VR1A 1HNZF 4DV1J 5D4NA 5BYQA 3TJ8A 4LF9J 2Q1LA 2X7IA 1Q1KA 3M6VA 1IQTA 1RUSA 4PG5A 1Q95G 3PYFA 3TJ9A 4KQZA 1OO0B 3BZQA 2EG2A 4QIVA 1S1TB 1N88A 4J9KA 1FKPA 2I38A 3FEZA 4G6VB 4ZPDA 1KQFB 3FEYB 4JI2F 5KFIA 4S0MA 5GAEI 2LQ9A 1W25A 2EFGA 2RQ4A 5L8RC 4RNOA 1UVJA 1X4FA 1HWKA 2X1FA 2CUYA 1EIYB 2GAGC 1S6UA 3FBEA 1RTDB 4TNOA 2Q6BA 1Q5VA 1SVDA 4DL4A 2KFYA 1IUJA 1XR6A 3EZ5A 2YNIB 5K14A 2QA2A 2QRRA 3H4DA 3CVKA 4GC7A 3O5TB 5DQIA 1WC0A 3S8SA 1FFSB 1IBKJ 4ID8A 4FF3A 2DHAA 3J7ZT 2VPZB 4DLEA 4UY8T 4LFBF 2B9XA 4CT9A 3CMQA 1U26A 1RT2B 1VC0A 4OYPA 5SUHA 2HQGA 3W2VB 4OI4A 2LQ8A 3HD2A 4F25A 1F5BA 3UW1A 3TA0A 3V4IA 3U1LA 2EC0A 3UFCX 4OYIA 4OZ5A 2XS5A 1TL1A 4EBEA 1T0TV 3DGVA 1VQ8S 3K2YA 3VTIA 2VPYB 3UE2A 1YHQS 4NE9C 4PR6A 4HHUA 3MFIA 2J0SD 1WC3A 1S79A 3ENWA 3I0RA 5K14B 2NLWA 5HN0A 4O3NA 1SB6A 5KFDA 1PBUA 2JVOA 4DQSA 2KXFA 3BKUA 3CT9A 4C8MA 3PYDA 2VF3A 1VJQA 3F44A 4A47A 5J1EA 3N6NA 1QSLA 2MKJA 1U1PA 1UVLA 1U25A 4P7TA 5HATA 4HDGA 1N8RT 2G0IA 2MXYA 2MEWA 1Y5IB 1RAJA 2EXUA 1PO6A 2BJEA 4PWDB 2EKNA 1RTHA 4A8WA 4JBCA 2ASLA 2XB2D 1KQGB 2E7XA 1R8CA 3I32A 5K8PA 2WHOA 2WRMA 4ES1A 2BUNA 4J7CA 4BC7A 5AXNA 4JI3F 1PCAA 2W01A 1TZ0A 3DRPB 3MM8B 1WSRA 5DG9A 3RTVA 1XMOJ 3NL0A 3HHDA 5LJ5Y 3FBBA 1RWNB 4WE1B 3BSNA 5AE3A 1DHMA 3MWBA 1XMQJ 1PIEA 4ZVTB 3I0SA 3FCWA 3QT6A 2RAQA 3C3LA 1ZM2A 1S0OA 1U6ZA 1C0UB 1XTZA 2YWEA 4CQ1A 2SXLA 4YS2A 2UVVA 2KZMA 4DWIA 1V6HA 1RBOB 1VDHA 2HQCA 1C1CB 2HSEB 2XY6A 3I96A 1NPRA 4KT0C 2Z58B 1HI1A 1SQEA 1OYEA 2VBYA 3AJ1A 3ULHA 5L46A 4K4YA 4PUOA 3KFWX 2GVZB 4L75A 3ZTPA 4JI2J 3FEXB 1VRQC 1CS4B 1RB0A 2E5HA 3D6HB 2PN6A 3CC2S 1R89A 2IY5B 1YVFA 1LV5A 2H51B 3QRPA 3MM6A 3HHLA 3M32A 4LRAA 2FPHX 2ILYA 4NEZA 2J6SA 4CNZA 2GMJA 4KH0B 4P2MA 3VCDA 4DG1A 3GILA 3ZTRA 4F3QA 2ZHBA 2QFJA 3T5HA 4DFPA 3T5JA 1EB0A 4TY8B 3SI8A 4NCGB 4NLWA 2NCKL 2RMLA 1JNZB 5AXMA 3OSNA 4B02A 4J9MA 4GKJJ 2EFQA 3GPAA 1VIOA 1HBNA 3G8SA 2GVDB 4BLGA 2VG5B 3ONQA 2AZ3A 2DXDA 1TQLA 1G3OA 1JLFB 5HMWA 4IFYA 1RDRA 3T9NA 1P9YA 3A8EA 4P52A 4W4MA 1EP4A 1Y5NB 4NLDA 3OR2A 2MHNA 2KN4A 2VU5A 5ETLA 3Q8PB 4J9LA 3IA0A 4I7FB 1ELOA 2B43A 1U6FA 3IGVA 1YX2A 2V0NA 1TKXB 3I31A 3CXCR 3T1HF 4LR7A 3RB0A 1U47A 1IBLJ 3HZGA 4OI0A 2K3IA 4DV0J 1XNQJ 5LT5A 2ZUAA 1SJ3P 2UUCJ 3CB4A 1YDLA 2IIHA 3L7UA 5J2NA 4F67A 1REVB 2QE5A 1Y11A 5IS2A 4J9QA 2HBYB 4P2XA 5L1JA 1KRPA 2VOPA 2JOQA 1TAUA 4ZVQB 1PKUA 1H72C 4ZLLA 2FVPA 2KVQE 3B82A 1SJRA 3GFXA 3M2RB 2LCWA 1Y5LB 2V68A 3HKWA 4PUOB 4NOHA 4P9SA 4WP3A 1LW2A 2BEFA 1T11A 1QAJA 1NO8A 3BPDA 4ED7A 1IKYB 3CC7S 3KUEA 2R7QA 2ZNYA 2B9EA 2K06A 1C2PA 2YBVA 4IO1A 4M5IA 3UO0A 3GV5B 3JYTA 1HW9A 1REGX 1QVGR 4DSKA 4ELVA 3UR0A 3QFHA 3TVYA 2N7CA 2QA4G 3L09A 2KU7A 1K44A 3QZ7A 3BR9A 3C6UA 4OYXA 2R7WA 2M8DB 3J7YI 3DM2A 1WG1A 4DSEA 1HA1A 3KLIB 2CPFA 1TFWA 2OFGX 3D1HA 3NG8A 2DHSA 2HGLA 4M95A 3PZPA 1KVKA 4I1TA 4WZQA 4KPCA 4ICLA 1VBZA 1RHUB 4LR9A 1HI0P 2HMIA 2F8EX 2P5VA 2RQMA 2MHEA 1RP5A 3VGTA 2AYGA 1JLEB 1PG5B 1VR6A 3K5MA 2VJUA 4IUFA 1XNQF 2ZWOA 4DSLA 2BZ2A 4FNIA 2CDQA 4G3IA 1D9DA 2FHJA 1KN6A 3N9UC 1RXOB 3VAIA 2PI4A 1H73A 1IKXB 4ZVRB 4WFNQ 1BC6A 2HHUA 3VQTA 3KHGA 2FHMA 4C8LA 2FY1A 2D74B 1Z2ZA 2QEXS 1FF2A 3E3XA 2AV5A 3IS9A 1VC6A 3R6LB 2BKOA 3Q8SB 3HCXA 2UUBJ 5LMUJ 1OY9A 2YKPA 1Q7YT 5IOLA 4AD6A 4ANEA 2HLUA 2L9WA 2V2VA 4LF7F 3KHRA 1NJWA 2PGCA 4ETZA 3UVJB 4DF8A 3TANA 2CQ0A 3MR5A 4NRUA 4LF5F 3B4DA 3F73A 4CP5A 1IM6A 2DNQA 8RUCA 2N4DA 3WX4A 5FLXU 2CPDA 4J9PA 3PX6A 2FVSA 3M8PB 1T9XA 2E1RA 1TL1B 4X66J 4KO0A 5B0DA 4C8ZA 1CJTA 1DTTB 3CJ3A 3CJ5A 1T9YA 2YKNB 2EFOA 1REVA 1ZAWA 4EMDA 1NPPA 9ATCB 2ABYA 4GVBB 3PIPQ 1TL3B 5KFSA 2HNDA 2WVFA 1T9UA 4QOTA 3UD5A 4X62J 4HVZA 4OHYA 2ILZA 1WF0A 1RTIB 1EARA 1TKXA 1FRJA 4EYHB 3SFGA 1JLGB 3R8YA 5HJYA 1MG7A 4MK7A 4X4UA 3DOKB 4X4OA 3ZTSA 1TVRB 4FS2A 3TVKA 4HH1A 1HPZA 3QYYA 2NUUG 1RAAB 3AJ2A 1UKUA 4MIAA 2ALZA 3LP2A 3GIRA 2BJ1A 1XNRF 2ASYA 2GHPA 3C8YA 4RL1A 1HNXJ 4G65A 4DUYJ 4NMLA 4LRFA 2QGFB 3UD3P 2J9DE 1NSPA 3BPSP 3IMQJ 4YR3A 5IT9Y 2OIHA 4OV1A 1UWAA 1UVKA 3FFIB 1HNVA 2A18A 1HYSA 4DUZJ 2G13A 2GA7A 1F3FA 1IWAA 3ZZRA 3PW4A 3Q89A 4LIRA 2OTJS 4RLEA 1HNIB 4WU3A 3T3FA 2HFOA 3DLEA 4I2PB 3IAS9 4RKUC 4CT8A 4DN0A 4URGA 1BXNA 2QMUB 1JKHA 5KFGA 1YKWA 3OL7A 3SIPB 5CD4H 4RX6A 5T7LB 3NY0A 1GTEA 1HARA 4U8VA 4UQGA 3OD2A 3MFHA 2AGOA 4XIUA 2HIQA 2MKIA 2BE2A 1ZM9A 2NREA 4FF2A 3WDOA 2G2YA 2QIFA 5D0HA 1QUPA 2D3ZA 1DTTA 4TYBA 4CLUA 5KT7A 3G87A 4WBFA 2HQDA 4WPAA 7FD1A 3PJWA 4PZVA 2C28A 2CQCA 5LSLA 1HBOB 2EBGA 2MPUA 4E98A 2XSFA 3CDAA 2DR7A 1SQGA 3OTCA 1LFPA 3BQ0A 2BE2B 3GYGA 3QQCD 3R5BA 3J7AN 2IM2A 3B54A 5DZ7A 3I82A 3CJTA 1APSA 5F8HA 5M2PA 2LECA 1RAHB 2R42A 1QE1B 4K4UA 1XR7A 4LVNP 1NDKA 4B3SJ 5H9EK 2Y1RI 5L9NA 3DLEB 4I2PA 2HHTA 3DOMA 4LFCJ 4FYDA 2CADA 3OVAA 2PA3A 2IC3B 1JXVA 4E0DA 2ZBQA 2PMZD 1RT4A 4ECSA 4DHVA 1WUUA 5L1KA 3IXQA 4O3RA 3CD6S 1WEYA 3HO1A 2Z8QA 5C24A 4RWXA 2FHKA 2BQUA 3MD1A 4IH7A 1HBMA 5F8GA 4LFAF 5KAKA 3OR2B 4X65J 5THWA 2UUAJ 1KNZA 4CM2A 3TOQA 3RB4A 1IR0A 1VQ4S 3FQLA 4ID5B 4YR2A 1NRKA 1RAOA 3FQKA 2L9NA 1TKTB 3R7SB 3AY0A 3L4BC 2BBEA 2J7UA 3QT8A 1RT3A 4HH0A 3GLJA 3NMAA 3DKDA 4DV2J 4RUBA 2A3JA 1F2HA 4TY8A 4WXWA 2KJVA 3I5CA 3LGNA 5DETA 4ED1A 1DLOB 2DHGA 3EICA 1L3TA 1FKOB 1SIZA 2OPRB 1LXNA 3DXBA 5D0EA 1YLXA 1A7GE 1XERA 4KV8A 1VS3A 2IM0A 2IVMA 1X4BA 3EJMA 4YMEA 2ADBA 1N56A 1QSYA 3CCTA 1LW2B 4C98A 2FC9A 2IFXA 1S7HA 1R8BA 4QWAA 4F2SA 2IRUA 5EX0A 3CCZA 3QT7A 2KB2A 1ZZNA 3GR0A 1JJ4A 3GFYA 5DQGA 1IBMF 4X4VA 4U8YA 3TAMB 4B9UA 3CJ0A 5IZHA 2MJNA 3CCRS 4F4WA 4M63A 2C2EA 5CYMA 3PNIA 3PG9A 2UVUA 1M0SA 2CPZA 2LEPA 5IQQA 1UETA 3PHTA 3DYAA 4MMOA 4J91A 4QR0A 1RSCA 4ZA1A 1GK8A 4JI0J 1JLCB 1RCXB 4NA2A 1R8AA 5F9NA 4L76A 2D69A 2VQFF 3NBPA 1OPZA 3NXZA 4DV6F 3CO9A 3FCHA 4A8QA 1UCNA 3D3BJ 4CO3A 4C0OC 2YNFB 3PX0A 1S10A 2BJ8A 2ASDA 3B6BA 2VPWB 2MZ1A 2EI5A 3W62A 3EVMA 2DT9A 2XWYA 3HVTA 2B7CB 1CSJA 4DBQA 1TELA 2DYAA 4O4RA 3LWLA 2AGQA 1O0PA 1WTFA 1RWXB 2Q3PA 3ZZ0A 2WBRA 5EHHA 4RNMA 2Y1IA 4N76A 2IRXA 3P5BP 1ZTTA 4DR6J 4W92B 3FJ2A 2A10A 3HHNB 1S1VB 3MEEB 2H5IB 5KG5A 2IHR1 3G6VA 2G2OA 4K4VA 3D3CJ 3G6YA 4ECZA 1SL1A 1NDLA 4X4NA 1C4AA 1VCTA 4Q2LA 3B8HA 3D0IE 5HQLA 3MTKA 3NGKA 3G96A 3BDPA 5I3PA 4JI7F 3W8GA 1RQ0A 2CJBA 4EZ6A 4YY3F 4DR5J 2DNZA 1VBYA 3BBBA 1UVNA 3GSIA 2O3DA 3EDQB 2IRYA 2MZRA 3A8IA 1SIWB 2VUGA 5MAOA 3S6EA 1C1CA 4LF7J 2ZOFA 3EGNA 1SL2A 4FF1A 1JXLA 3ADAC 3H5SA 3TYTA 4NPOA 5E3CA 4JI5J 2Y3YA 4NXMJ 5D4LA 4UZCA 2ZH6A 2HS3A 2JFKA 3AQPA 2LA4A 4H4KA 4LRBA 4F7VA 2VHGA 4RBVA 4U7UD 1N32J 3MCOA 2WZ1A 2ATLA 1M5VC 5KFCA 4UOGA 2NXEA 1CJKA 4ZVHA 3UN3A 5C2CA 4WXOA 5D0RA 3VAJA 1RT2A 3DDKA 3AD7C 4WZMA 3JQMA 3BH6B 1C1BA 1NLKL 1NDCA 3H2VE 1D3WA 4U9RA 3NS7B 1ZH5A 3IR7B 3HP6A 2OPSA 3PYEA 1MWZA 5E2QA 4CLKA 2ZM6F 1AT1B 1FE0A 2WAQD 3H2UB 1RISA 2MYFA 5L39A 3MUTP 1FWKA 2HWTA 5D77A 2MLYA 4Q43A 1U1LA 2EK1A 3BN4A 1NB2A 3GCXP 4ZCLA 5DM6Q 4B3SF 4WKRA 2QO3A 4L3KA 1AXQA 4LF5J 1FKPB 1UZHA 3MPYA 1VQ6S 4O3QA 2O01C 3CJQA 3DU6A 1O6XA 3VVTA 4X4TA 3GMGA 3R1HA 3ILLA 2VQEF 2OI2A 1XK8A 3EXCX 3FMBA 1CQNA 3SCIE 5LXRA 5A8KB 4EBCA 3T1YF 4ZITA 3RBDA 4IQXA 2ZZNA 2OPSB 2GO8A 2BYCA 2KO1A 2ZNZA 2AW0A 2MZTA 4F4KA 1SC3B 1U1MA 4CCHA 1S76D 3KLHA 1RAGB 4M5MA 5EWFA 1UEKA 3HZEA 1TL3A 2QSFA 3BB5A 5LSRA 5F9LA 2KT3A 2YX1A 4UOHA 4URQU 2AKWB 2BJ3A 2ZH8A 1J5OB 2OFHX 3MMCA 2HVDA 4PQUB 3AQOA 3NCRA 2QA4S 1N5VA 4FYWB 3BO4A 4ECWA 3K5PA 1N6QB 3MECA 1XBWA 4DS5A 2CNKB 4OLOA 3R9LA 4F36A 5GMKa 4DR2J 2C3PA 2YNIA 3FRZA 4HHHA 3GTYX 1WHYA 2IMOA 3L7PA 1VQOS 4RW4A 1X60A 3BGOP 4KGVB 4A8XA 2AJFE 2IVYA 5KFAA 8ATCB 3TAQA 1Q82T 3ZNUA 1Q8LA 3MEGA 1X0PA 5HVGA 3H59A 3DRPA 3MM8A 1FE4A 3AJDA 2XMKA 3DN9A 3RJMB 3CCVS 4H4MB 3ISND 4I56A 4OI3A 2ZHAA 3K7RA 2VKRA 2XSJA 2F9DA 1NCLA 1SV5B 3HFKA 4RW8A 4Y0FA 2HGNA 2Z57B 2LMIA 1I3OB 1S9EA 4ZP6A 4CYUB 3HVAA 1CEZA 2DR8A 2E5JA 2MGZB 4LF6J 3MEDB 2HZVA 3H25A 2M2BA 3W9HA 1U7LA 3VGSA 3FBCA 4J9UE 1GQEA 1DURA 2B7BB 1VJWA 2E7VA 5KT3A 2XM3A 2KG1A 4B3MJ 4DN9A 3QLHA 1S6QB 2RUSA 3L9ZA 4J9VA 3H42A 4DX8H 4L6V3 2UU9F 1N5YA 1B0PA 3CD5A 1FVQA 1MN7A 5ETNA 1QVFR 2YQ3A 4B3TJ 4DL5A 3N28A 4TLRA 1ZAXA 2QFIA 2EG1A 1JLCA 3Q23A 4F8RA 2DRAA 5J2MA 5HLFB 1PC4A 3MCMA 3QJPA 1S1UB 4X4QA 3C15A 3CF5Q 1UFKA 4R0EA 3J80Y 1N5TA 4K0KF 3JYTB 2M5YA 1PILA 2DO0A 3OR1B 1C0TB 2OELA 4YB1P 2RUGA 1NB7A 1NJZA 3PVXA 1VQ9S 2DNPA 2OSRA 2D9PA 3LOUA 3Q86A 4C8KA 4JI7J 2HNZA 3KLFA 1N33J 2KYXA 1GTHA 1UFLA 1GXUA 2POKA 2YKMA 2JWNA 4FP9A 1VYAA 3SSRA 4TQSA 4ILMA 1X4EA 2AYBA 4TLQA 1RT7B 5ETOA 2H9ZA 2M52A 1BQMA 5J1NA 3SSQA 2KTQA 5DGAA 2RDIA 2DY9A 5J2NB 2MQQA 4LUBA 5A0YB 3UPFA 4ED4A 3J7Z5 4FPRA 5C25A 2NXUA 4QU6A 2R8HA 1EX8A 2ROGA 4OZ0A 3I5BA 1PBAA 2DBBA 4ED0A 3QRRA 4QYZJ 1KBRA 1N32F 4RW9B 4LF8F 3PKYA 2XLIA 3CIZA 2D3O1 2WONA 2RSQA 2BQRA 3R2CJ 5H9FK 1RAFB 2MQNA 2V8DA 3BO2A 1I1GA 2JC0A 2QT7A 5HAOA 5KFWA 1PAEX 3N6MA 4K8RA 1UL3A 4O0NA 4JUZA 4ZLPA 1EZZB 3K57A 4RZRA 1VHFA 3G71S 1RT6A 4WTYA 4TXSA 1RHMB 2W25A 4TU7A 1FESA 2ZKTA 3OTDA 4OFZA 3MEDA 2HNYA 3WIUA 2HHWA 3BJYA 4NLSA 5CZXA 1VRTB 3ENAA 1S9EB 2YQ0A 3M8ZA 2W9BB 3W64A 1MU2B 3QAUA 1N5SA 2FLNA 1NH7A 2MKSA 5IV3A 4IG3B 3C19A 2DCLA 3M8WA 2B4PA 2CJAA 2H4WB 2KM8C 2XLJA 4I2QA 1KONA 2WSEC 2CG8A 3EDRB 2I2YA 1LWCB 3KK2A 2M7SA 1NHKL 3POTB 3OTEA 4L3NA 3KMQA 1BWEA 1B0TA 4WP8A 1HQ2A 3H40A 1V5VA 1CS4A 3VAGA 2GJIA 5M2RA 4OZ1A 1K1SA 2RILA 3IC1A 3MMAB 2JL9A 4NLQA 2R8IA 3R5DA 2LXFA 3QZ8A 1MROB 3H90A 2F63A 3OLBA 2DGWA 2PSZA 3PIOQ 4FS1A 2MLXA 4OLPA 4I0WA 5DLFA 2EVZA 1N48A 3ISZA 1WOPA 4GKKF 2DXFA 1FO1A 1YRXA 5DM7Q 1QTNB 1YIJS 1AFJA 2C3MA 1RADB 2E1MC 2VG6A 5KFUA 3P96A 1VQSA 2VG7B 4LRDA 4EFAC 2IA6A 4WE1A 1NPKA 5KFBA 4LRCA 4RJVA 1PJ7A 3ZFVA 4RNFA 1NXIA 4F02A 1YJUA 4RW7B 3HJVA 1E6VB 3IG1B 3MMBA 4OX7A 1JKHB 1RTJA 2FJWA 3BBCA 4OJGA 3QGGA 2BKNA 2MQLA 3GYNA 2CQHA 3AXMA 4PAAA 4ZP8A 2XCAA 1DQAA 5DLGA 4TKTA 3D0HE 1X5PA 3I56S 3CCMS 4JI1J 1IVZA 2A1BA 4DCPB 3UQSA 2KT5A 2H5JB 2W8LA 1X5OA 5LMUF 3RB3A 4QCLA 1DARA 1G1XA 3DRRB 1N4LA 1RWMB 2YNGB 2FVRA 1Q53A 1SPBP 1VQYA 2XZDB 3RBZA 3LP2B 2EW9A 4QYRA 4JV5J 1S12A 2R3VA 2VPXB 3Q8UA 1HPZB 4DJBA 4X4PA 1VBXA 1WI8A 3GIJA 3N01A 1TUGB 1N54B 1CJUB 1Q4RA 1JLGA 4OZLA 3VHQA 4XPEA 4ANCA 3FC9A 3VZHA 5HSPA 3M9OB 1FRXA 2ZITA 3JQKA 1FDBA 2OH2A 3KLGA 2I9SA 4ITSA 4F50A 3PW5A 2VJVA 2CNOB 2XHWA 1VOMA 2IM1A 2KT2A 2N3LA 3RW6A 4NWBA 4ZDNA 5GAGU 2WVDA 3D67A 3WC0A 5KFRA 2LYVA 2J76E 2BJ9A 2HK2A 4USIA 5K9FA 4M5KA 4AYBD 3MM7A 2VA3A 5LJ3Y 4H54A 4XDCA 3G8QA 2E5LJ 2HHSA 1K9MT 3W61A 4PEOA 1UW9A 4F3MA 4DR6F 1RHQB 2NSBA 1P27B 1RWPB 1RACB 2I0XA 3RR7A 2FVCA 1P1LA 5A8WB 4MTPA 4NXNJ 5GAEU 4NCBA 1FHTA 3ZNJ1 3KHLA 2J6UA 3UDEA 2LDIA 2W1BA 4P74A 3QGPA 4K5SA 2HRTA 1JMTA 3D66A 3OL6A 3C6TB 2UUBF 1HLWA 3O44A 2J6TA 5BYRA 4IR9A 4NEYA 2FJEB 1EKRA 5DO2A 2VL1A 1U45A 5HANA 4QZVB 1IJFB 3E01B 2VC1A 2ZBRA 4AXIA 1OY8A 3ZO7A 4Y2MA 3RB6A 1NK0A 3M6WA 4YHHF 2YH1A 1IJEB 3D2WA 3GG1A 4C0BA 2G1HA 4LFCF 3BN7A 4ZPCA 4IG0B 2WCXA 2V9WA 3GV7B 1A6LA 4FF4A 1UVMA 1RU1A 1VQMS 3NGDA 3LALA 4AE5A 2C1EB 2R2UA 3IRXA 4LF4F 3BSOA 1W26A 4B9VA 1LFWA 4KHPF 1Q8BA 4JOUA 1Q81T 4DX6A 2HFNA 1SKSA 3DM2B 1JLAB 1YI2S 1LWFA 3THPA 5KTQA 5KFEA 2AWZA 3W2WB 1S6PA 2RIJA 1LW0A 2DNHA 4F0MA 4K0KJ 3E01A 1ACMB 2F65A 2IBOA 2XCPA 3D54A 3G2XA 3SQGA 4NXNF 1FRIA 2U1AA 1X8DA 2O66A 3A8JA 3DI6B 2V8GA 1T03A 3D6MB 4U96A 1J5EJ 3VAHA 5CYJA 3SV3A 4KFBB 1NK4A 2QLJB 4ECXA 4ZMMA 2DITA 3MD3A 4M5DA 4B3OB 4JYAJ 1LEOA 3QGHA 1I94F 3LWMA 3GJSB 4OYOA 3SCKE 3HK2A 1S59A 1JWWA 5A8WA 4ED5A 1AUSL 1VQ5S 4Q7AA 1WOSA 2QLBB 4DV0F 4AL6A 4NZ7A 3T5KA 2KDOA 1DLOA 4FNHA 2F9JA 3GE9A 4DFJA 4ZIWA 4OMFG 5B7WA 2N82B 5A2QY 1DY3A 2DNRA 3IRWP 4OI1A 4HTIA 4UZBA 2P9EA 1FNXH 3VGVA 2RRNA 2UV8G 4B9NA 4I7FA 4KE5A 1GMWA 5H1SV 5LL6d 1RLDA 1SUQB 2W4DA 4KC5A 1WDDA 4M8LA 3Q8YA 5F0WA 3T6BA 3ETOA 3PFEA 4DL2A 1IBKF 2ZBIA 4PWUA 3OVBA 1V3SA 1KEKA 3G86A 1H2UX 2XMUA 3QAEA 2IVFB 1TAQA 3BYPA 4TU9A 3KTQA 1R43A 2NXJA 4CH7A 1MLAA 1RHJB 2CDRB 3OW2R 4DQPA 4WYLA 3X3UA 1I6JA 4CTAA 3DRSB 3BSCA 4F4XA 4ZCMA 2DNGA 5B08A 4Y3CA 2AT1B 3BBFA 3RUBL 1VK3A 4U6PA 2CIMA 1WC4A 3LGMA 2CKWA 4HDHA 3OXGA 1TV6B 2HKEA 3M8RA 3GFZA 1LWEA 1X4DA 2ZBCA 1NKBA 2F8HA 4KHPJ 2C2MB 1FA0A 4ZVUB 3LAKA 2CPHA 2D1CA 4FYYB 1S48A 5D6GA 3OHBA 3OUYA 3M8QB 4ELTA 2PFDA 3PO5A 2RS8A 1CG2A 4XK8C 2Z4PA 3PHEA 2E5IA 1DQ9A 1F5AA 1S57A 5EUHA 4LSZB 2GIFA 2JNJA 4C3LA 1KOHA 5D0GA 4X4RA 3NNAA 1RKIA 3KXDA 2NQPA 3VAKA 5L1LA 5IT9U 4DR7J 5H9FJ 2XO6A 3VAMA 3OJSA 4ZHRA 3KJVA 1HWJA 2W2QP 4C2MA 2GAHC 1NJIT 1HBOA 1I5OB 3ZXWA 4FBTA 2FDNA 4JI4J 4WK1A 5L1IA 1D1UA 1GNKA 1FI4A 1F2GA 2VG6B 5CYQA 2KKHA 3W65A 2FHOB 4RUCA 3DOLB 2MMYA 3JTNA 5A8RB 1CJVB 2HIYA 3OHAA 1M1KT 5I42B 3BSAA 3DLBA 4G1PA 4IRDA 4ED2A 3TUJC 4MIWA 4QIFA 1F9HA 1KTQA 1VIXA 4JI6J 2D41A 2DNYA 4KKOB 1G6BA 1HHSA 4LBIA 3W63A 2L41A 1SJFA 2NXNA 3FZ2A 1KLNA 1VISA 1KHVA 3R5JB 2QV6A 4UF4A 5IXUA 4F4AA 4N41A 4MKYA 2UXBJ 1B64A 3KDNA 1YQHA 2BW2A 3MCNA 7AT1B 1M5PC 1WC5A 5B0FA 4C11B 5IT0A 1LKZA 1RGVA 3R5CA 5FDLB 1UJ6A 3DGPB 4ED6A 1SKRA 2MZJA 3UR3C 3EPIA 4XAKA 1ZZFA 1GEHA 3KOAA 5KFMA 4OZ2A 3MCSA 3MAQA 5J1EB 3C14A 4C8NA 5I3UA 1AZSA 3DLGB 1AYEA 4RO0A 2V34A 4MFBB 1H0HB 2IJFA 3GFHA 4NYZA 4WWSA 4HYKA 2MB0B 1AROP 4IQMA 4YB7A 2AP6A 2RU3A 2GFFA 1S5ZA 2WW4A 3JSYA 4K2JA 5K8MA 2AZ1A 4HEA9 3NCPA 4Y00A 4RWWA 2XS7A 5HP1A 1TUVA 1HQUB 4V19J 2JEIA 4FYXB 3H20A 5U47A 1O51A 2DR9A 1DTQA 5B0AA 3TZZA 2HWHA 3DRXA 3D6TB 5IC4B 2BQ3A 3W5XA 3B78A 2W2PP 3V81B 2WSCC 4RR5A 1CJTB 1ZAVA 4USVA 5BJRA 4YQWA 4R8UA 1HFEL 2BV3A 2I5JA 2CA9A 2WVEA 3FVYA 1D8ZA 4MKVA 4CLZA 2ADCA 1FCAA 4ECTA 1BQNA 4NLPA 5G0RA 4C6AA 1MN9A 2LEAA 2YPYA 2BKPA 3BGRB 3EGWB 4O4GB 4TN2A 4PXCA 1N34F 1KQSR 2BANB 3TQ1A 1FDDA 3ENVA 1T05B 3M05A 2C42A 2CFXA 2MQ8A 1X4GA 2RNEA 2RKIB 4HACB 2E9ZA 3DFEA 4JV5F 3WBZA 2W9CB 4EU0A 2YWFA 1CPZA 3ICLA 4OYZA 1NK8A 3MM9B 3CCSS 1CULB 1A9NB 2EK6A 1WG4A 4JV1A 4C4WA 3ILOA 2B8QA 2YWWA 2RF2B 4PYDA 4DV7J 4DX7A 3W2WA 3R27A 3JSRA 3CUNA 1QJHA 2OTLS 8AT1B 1KWMA 2N4CA 3TA2A 3OBIA 1SC6A 4Y2KA 3QSYB 3KLEB 1X4HA 1Y10A 3JSBA 4LSLA 1AA1B 2N7YA 3C66A 2XY5A 2DPIA 3SFUA 2NSCA 2OGUA 3HHLC 4F26A 2R4FA 1RHKB 1RTZA 1H98A 3M30A 4KGMA 1Q79A 1RA7A 1YBAA 2FJDB 2LU2A 2VDIA 3NRBA 4WTOB 3I55S 3D6FB 4K50A 3U1MA 1VLOA 2CAJA 1SL0A 2VODA 1B70B 1KKHA 2MY7A 5KT2A 1OMSA 1RWWB 1TU0B 2NXCA 2JJ4D 4CLYA 4J5OA 4K4WA 4K2XA 4LSNA 5AXKA 3O2IA 1FEEA 4QPXA 3CC4S 1FRMA 4IRKA 4RW8B 1BE4A 4OI6A 1XWLA 2J7KA 4DFKA 1WACA 2PE8A 1F9EB 2V8HA 4UTGA 4Y6IA 5EWEA 1Y3JA 1B7FA 3VQSA 2DH8A 3AB2B 2XO7A 4ZKAA 5JXSA 2YY3A 4BHQA 3AH6A 3SBMA 4YOEA 2XG8A 4ZJOA 3GJRB 5KG4A 1RWOB 2EC2A 3ZC4A 1NK6A 3KUHA 1RU2A 1T94A 1E6YA 2G2ZA 5GMEA 3RBXA 5IWAF 2J0XA 5LMNF 1M5HA 1Q78A 3TRGA 5L9XA 4YUDA 5F0UA 3PR4A 1M5KC 3FK4A 4WFBQ 4K4XA 4QU7A 5AE1A 3M1VB 4PCQA 1OIAA 2EFNA 3G6XA 2DNNA 4DV4F 1FK9A 2DGVA 5IT4A 1FRKA 2XNRA 4DDFA 4DPYA 2F7VA 1GX6A 1KQKA 1Y3KA 2VD3A 4LQ9A 5HMXA 5AJ3J 4ECRA 3NS5A 4ZJQA 4ECQA 2BM1A 3HI9A 2C2ZB 2OHDA 3TUZC 4B3MF 2FQQB 2G1DA 3H2LA 1OQ6A 2CNLB 2F5GA 2FZGB 5JVHQ 2BM0A 1VQ7S 1AW0A 4IFYB 1YRTA 3CJ4A 3NEKA 5GAHU 5JVGQ 5DG7A 1XIQA 5J2PA 4QWDA 2LQ5A 4A8SA 2R8JA 3OPKA 4TQRA 2Y0SD 4OYMA 2VKZG 4N56A 1DAXA 5M2UA 2ZC4A 3A3OB 4C9DA 1KP6A 3DLKB 1QUVA 4QW9A 4DV2F 4F4ZA 3TZYA 1FX4A 4KGXB 2H5EA 3EXYA 2W7AA 4IH6A 1AFIA 2LVWA 1T3NA 3D0GE 5A6WA 1XR5A 2F3JA 2J9EA 3DLHA 1EQMA 2W2OP 3P45B 5HQMA 4KGZB 2HGMA 1Y9OA 4QQBA 5IM0B 1ZTWA 1IR1A 4LF9F 1CC8A 1I94J 2HVHA 2CQ1A 2E1PA 3V4MA 3QIPB 2J0WA 2ZM6J 4FXWA 4DSIA 4ZP9A 1N36J 4KAIA 1TL7A 1NSQA 3TR5A 1ITPA 3CJ8A 3MMBB 1C1BB 4ZLJA 2R8GA 4JI5F 4NXMF 2LP4A 3CCUS 1C0UA 2PDAA 3N0VA 4GVLA 3CMAS 1OYDA 2QC3A 1F0XA 5B0GA 4LMZA 1N52B 1ZBTA 2H3EB 1IR2A 1M5SA 2HQFA 3K59A 4ED8A 3R97A 2E7WA 3BQ1A 3NP5A 4HKQA 1HQEA 2AF6A 2PEHA 1TK8A 3QGIA 2BRKA 2CPEA 1H74A 2P6TA 2CVIA 2OAUA 1MROA 3IM8A 4IR1A 2EPIA 4EO8A 4QIWD 4ZPAA 5ETMA 4DL3A 3A12A 1S4FA 5AT1B 4DPOA 2JVRA 1ZOTA 5RUBA 5AJ3F 2B9WA 3HULA 2QL5B 3W5YA 2VZ9A 1SKWA 1OWXA 4Y65A 4G1QB 1SH0A 5B0EA 1LWCA 3KK2B 1FEHA 2JX2A 2MKYA 3CCES 4MYUA 4USHA 5A76A 4X64J 4HT5A 3EX7B 1KR4A 2UP1A 2B5JA 2MY8A 3M30B 1IKWA 3M8YA 4LBPA 3QO9B 2YVSA 1VRTA 4RBUA 5EX3A 2FLPA 5JUMA 2Y9HA 2XMMA 2UUTA 5DJBA 5F8IA 2WTFA 4DV5J 2CWKA 2R7XA 4DV3F 4NCAA 1GXLA 3MM5A 1QAIA 3O3LA 2HYIB 2IAJA 3I0RB 1BY9A 1MNEA 2JLGA 4DUZF 2NYHA 5T41A 3MR6A 4ED3A 4ILRA 1YITS 5FD1A 4I6AA 2RDJA 4RUHA 1SUQA 1NHUA 2M8HA 2Q6CA 3QMQA 4ANDA 5EGYA 3G8TA 1H3DA 1HI8A 4OZJA 4ER8A 2JC1A 4ECVA 2PIIA 3I5AA 1RT5B 2VA2A 5E33A 1U24A 5F8LA 2XTJP 3U27A 1R8HA 2QTWA 3M1VA 2E9TA 2OPPB 1CC7A 1V5IB 2GNKA 5D4OA 3MAHA 3CJKB 1BQMB 3VGUA 2W7PA 3PY8A 2OPPA 4NX9A 2HZAA 5K8NA 2XBPA 3CGIA 3OQ2A 2MLZA 4OYAA 1VBKA 1TKDA 4USUA 3LP1B 2DNMA 2RB7A 2C2OB 1YBUA 3M7VA 2ATCB 4ES2A 4ZPWR 3BF4A 2DK2A 2DNLA 4MKBA 3VWSA 1FD2A 2AX1A 3BR8A 1C0TA 1FWPA 3W5ZA 5DDQC 3A3PB 5SZTA 5CD4A 3G9CA 2GX8A 1R0AB 5HP1B 3OTBA 2GS8A 3LP0A 4TYAA 3KMSA 4F4YA 2XNQA 4DR2F 4EUVA 4WFYA 4GRSA 2CQ2A 2E29A 1WEZA 2E5GA 4C0HA 2AQ4A 1UVIA 5J2QB 4FZVA 4ID5A 4USJC 5FIIA 5HBMA 3GU0A 3CJSA 2PI5A 1N5YB 2MKHA 4B3RJ 3NGUA 3C14B 1WWHA 2X3DA 4FVMA 4ZN3A 2EKYA 1HNWJ 5K20B 2C2DA 3CO0P 3CNQP 4O23A 2N3OA 1S4EA 1U02A 1FJ7A 1XMBA 2RF2A 1WHXA 4NLOA 4C11A 1FX2A 2YWKA 2QG9B 3NGTA 2J8SA 3LW5C 5ETTA 2P9GA 1QDUB 4MYTA 2GHVC 4PG7A 4X84A 4H4KC 4X4SA 2OEKA 3RRGA 2DKOB 3BH7B 2KFNA 2E1AA 4LF2A 3JB9k 1NJXA 1LWXA 3U02A 4EI2A 1M90T 1HR0F 1RWVB 4DR3J 4PQAA 4YR0A 3NWRA 4EGLA 2CJKA 2MQMA 1HWUA 1CJVA 1UJ5A 2RQKA 3H5YA 2BDPA 3K8VA 3GZ7A 4EO6A 2ZD1B 4DZDA 4P75A 4U67Q 2PD1A 4P10A 4AQYJ 2PT0A 1BMQB 1CBKA 1VQNS 2ZE2A 2CNNB 2GGPB 2ZH2A 3DHWC 3HXMA 4IOBA 1U8WA 3Q24A 2CZVC 1S1XA 2AJQA 3H5UA 2QL7B 4Q0BB 4LF4J 3OVSA 1TP7A 2JHEA 5KFZA 2W4PA 5LXYA 4YP3A 1H7XA 2UUWA 1W2IA 2E66A 2OEMA 4KIAA 4BBYA 2CJYB 4ZIVA 2DPJA 4IFVA 2QA1A 1RT1B 2AMCB 3SDEA 1UA1A 5ETRA 2R8KA 5F8NA 4DR4F 2G9OA 4E2FB 2NZCA 4WJBA 1L3SA 4PYAA 4MFBA 2BVZA 4OYBA 3TARA 3AA8A 1J5EF 3TZWA 2G4BA 2FJXA 2D7SA 2YKAA 4PXDA 1U0HA 1KLMB 4K7QA 5E0OA 5GAHI 1HR0J 4LQ3A 2IPOB 4V1Ak 1NNDA 1PYOB 1KLMA 1LOUA 2X1BA 3LH2S 4LIWA 2B6AA 2YH0A 1PGZA 1NAQA 1URNA 1GFWB 1JLBB 1MMLA 2BX6A 2A2CA 3OXFA 1N36F 2VV5A 3AFGA 4NI2B 1Z2LA 2MZQA 3OJUA 1F1BB 1YJVA 3HFZB 3IP0A 1RWKB 4A8MP 4ECYA 1TTHB 4ZVPB 4EEYA 4ZVFA 1XMOF 5A2QU 1U1RA 1BUXA 4CWBA 3JS9A 2KRRA 4OJ1A 2AEJA 3MR7A 5KFQA 2XC9A 4FKYA 2YKQA 2FUG9 4WYWA 2E5LF 3CMES 2GMLA 1ZA2B 2ROPA 3G82B 4TY9A 1K8AT 3CTRA 4Q0BA 4KKOA 2H48B 4EK2A 1NHVA 1VLYA 2DXEA 2Z56B 2COLA 1DQ8A 4DV7F 4C8OA 3D28A 1IQZA 3M2UA 1KC8T 5A8RA 3IBCB 1RT5A 2AHOB 3FBFA 1OQ3A 2FHJD 4IKAA 3CDWA 3UWTA 4ES3A 3AD9C 4B9TA 1EETB 4JYAF 3V81A 3BM7A 3US5A 3OFGA 3GQCA 4BWJA 3SQOP 2NYIA 3GIIA 2QYGA 3M8PA 3HD1A 2DEIA 2GIQA 2QLWA 2YNHB 3KJVB 4JI0F 2GQCA 3IAM9 2V67A 1S97A 4DI6A 1QLNA 5C5JA 2HFVA 4A46A 4RNNA 3TX8A 3ELHA 3MUMP 4M94A 5KFNA 3IBFB 4JI8F 4FXDA 1S0MA 3KWMA 2VASA 3BKTA 4LFAJ 1UFWA 2CQPA 3WIVA 2F1FA 1X31C 3IO1A 4Q45A 2JLEA 2M70A 1VI7A 3IWLA 2JSXA 2KH9A 2J0QD 5D3GA 3NWGA 4ZLNA 2DD8S 2W4CA 1HL6A 3GONA 2EFPA 5KG3A 1FXRA 3FSXA 2FJBB 4JP8A 4ZP7A 3MEKA 2FY8A 4N8OA 2NPFA 2JDJA 4X64F 1Y00A 3UD4P 2NR0A 2NZ4A 1YJNS 3CIMA 4OX6A 3HM9A 5HBMB 5CXTA 3W7BA 1K0TA 3ILIA 4Q44A 3RR8A 1C4CA 1YK9A 2Q66A 3H98A 1NKEA 1R27B 1T9TA 2VH7A 1KD1T 2BJ7A 3PRDA 1HMVB 4F0HA 3HHKA 3MI7X 4D3HA 1L5UA 3PDNA 3MHYA 3LP0B 2KL8A 3ZTOA 3C16A 1RE1B 4DV6J 2AX0A 2ZDPA 1X9SA 3KLIA 1YJTA 2Z2ZA 3THVA 3HSJA 1UWBA 2FYXA 2R2TA 2PMHA 1S1WA 1Z1ZA 3QJJA 2W9CA 1HBUA 4K59A 2LDYA 1YGYA 4DZ6A 3LP1A 4B3TF 5C42B 1Q0NA 1TMJA 2MDAA 3UNYA 5C25B 3R1LA 4OJ3A 3BGLA 2MSSA 2B8PA 2U2FA 2VFRA 2HFZA 2WVCA 3D1QA 1DJ0A 2W9AA 3TAMA 2UXDJ 4M1KA 1I51B 4UUXA 2DISA 4KHMA 5F3ZA 1BQNB 4B9SA 2YKMB 3MAAA 2FD2A 2AYEA 4KY3A 1KDNA 4AXJA 2Z0GA 3MUVP 3UCUP 1U2RA 2XYHB 2WB1D 2CZ9A 4QPTA 2HFSA 4HLBA 1TFYA 2XMTA 2DHHA 4RBTA 3SYZA 3IGNA 4AQYF 2WW8A 3K0JA 3NNCA 2ZOMA 2ZVIA 1G4CA 4PWWA 5DDOC 1FJGJ 2XWXA 4Y2CA 4XDDA 1QAYA 1WF2A 4I68A 1HD1A 1KTVA 2M88A 3PRBA 1YJRA 2CQ4A 3HF5A 1BLUA 5K5MA 3I9ZA 3RAMA 3UI3A 4QWEA 2R9LA 1W7WA 3SMZA 4Z7CA 4PRFA 5HL7Q 4JI4F 1WNEA 2X51A 3UDCA 2V2ZA 1RI7A 4DEZA 3W9IA 2DVIA 4USMA 1QD1A 4KSEB 3HHLD 3UDVA 1YRUA 1U2FA 1AZSB 4FXVA 1M1HA 1A0OB 2VG5A 1TK5A 1JQGA 1RCOB 3QLHB 1R7IA 4WFAQ 3QFWA 4CO2A 5KG2A 3BO3A 2PMWA 4ECUA 2G0JA 2MQOA 1GMUA 3A3NB 4W90B 2W7OA 2UVRA 2ZEJA 4OHZA 4NRTA 1VRUA 5KFLA 5FDLA 2XZTB 3OFHA 2BACA 2MGZA 5F8JA 1NZ8A 4CLFA 1FNOA 3EE3A 1JLQB 2UXBF 2OD4A 1WJ9A 4A4JA 2DB1A 2HHHF 4KJIA 3M9MB 1VQLS 1B4SA 1X4CA 2GV1A 2ZWPA 4DX5A 2ZJPQ 5H9EJ 1UJ4A 4OZNA 2ZD1A 2BE7D 3P8BB 2QN6B 4DQRA 3N5FA 2GZOA 3QATA 4P7VA 4M5DB 5ADZA 2HAIA 2H65B 4Y2IA 1F6TA 4ZVOB 2AIRB 3CULA 3KK3A 1X0FA 2AEMA 4KFBA 3WC2A 5CYQB 1EETA 1UWBB 2P8IA 4KYZA 3OLAA 4LR8A 2FIUA 1N6QA 1IM4A 2OUGA 1FTCA 4QWCA 1R6VA 3V6DB 4LREA 3AAWB 5KG6A 4AUKA 1JLQA 2ZH7A 1K47A 1RHRB 1J5OA 3T1AA 2RH3A 2V94A 1WI6A 2C2KB 1B99A 5K8OA 1VRUB 1ZPWX 1YWXA 3RBEA 1KSPA 1JJCB 3G82A 1JLAA 3MMJA 4MT1A 3JAMU 2DHXA 2O5DA 5JJBA 4F2RA 2B4UA 5HVFA 4NLTA 1QY7A 2VONA 1LK7A 1YJ7A 5T7LA 4TVAB 1NSAA 2IJNA 5D8HB 4N5SA 1R0CB 4R0JA 2CPYA 4B9MA 1Y0HA 4NI2A 2R7RA 2CQ3A 3KLEA 5T14A 1WSVA 2B56A 4CDIA 5GADU 2ZH3A 1LWEB 2KRBA 4E8UA 3QJLA 3EZUA 2QMXA 2V2QA 4QW8A 2V9KA 2W9BA 2V5HG 1S77D 4ZOSA 2BOPA 2R7VA 3W1YC 4DSFA 4QYZK 2E1CA 2VICA 5G4DA 4MKAA 1FWLA 2QL9B 3DXSX 3N4WA 3K58A 1XMQF 1K0VA 1PSDA 4XPCA 3C6TA 2M3DA 4OYWA 3W66A 3DHXA 3R6GB 2ERRA 4Q8EA 4P71A 4IFVB 3RRKA 5AXLA 1WELA 4BCAA 1VC5A 1O5JA 1SJ1A 1X5TA 1T05A 2XULA 1GX5A 3GJTB 3KG1A 1SI9A 4G1IA 3RU0A 5KFTA 3TQEA 4DR7F 3Q2TC 3KK1B 4OV6A 1B0VA 1DFDA 2HS0A 1L3VA 1KS2A 2DH9A 3D9BA 2MTLA 2DEJA 1Y4ZB 1T02A 4B08A 5BYSA 4B9LA 5C42A 3ZZPA 3D5MA 1F3VA 2ZE2B 4W98A 4WKYA 1U1KA 1B3TA 3OV7A 1U2CA 3C46A 1QTMA 1FNMA 2CWXA 3Q8RB 5LMNJ 3AHPA 3VALA 3VV2B 4KPYA 4I6WA 1X9MA 2K2PA 2AJ1A 1HQUA 3PYGA 3C16B 4URSA 4USKA 4LJMA 5E3QA 5BXIA 3UN2A 3KLFB 2CQDA 4CI0B 4J37A 3I87A 3BYRA 4CLSA 5AE2A 3UDLA 2K3KA 2ROEA 1PC5A 2X1GA 1CJUA 3DI6A 3TUIC 3K8WA 1JXEA 3GWCA 4DL7A 4LF8J 3RYLA 3V6KA 2FZKB 2LXUA 3A8KA 3SSSA 4QWBA 4AT1B 1PJ6A 3IR6B 2YX4A 3Q8VA 3VAFA 4OL8A 3PW2A 1Q86T 2GQ2A 1IKWB 2A2DA 4UUWA 2GW8A 5A6PA 3DRRA 1FJGF 4IDKA 1L3UA 2YQ1A 2CJXB 1S1TA 4K5RA 5GVQA 3EWGA 1MU2A 5D3GB 1OS5A 3M8SA 2DNKA 4G1QA 1D9FA 1MW7A 3W3SA 3TW0A 1UP1A 3LPYA 1WKJA 2HFUA 4L72B 3NCQA 5E7OB 4LSLB 1UMJA 4IRCA 2UUCF 4DV1F 3IM9A 4KRWA 2OLWA 3KJNB 1JB0C 3KNGA 1RTJB 3P4UB 4OX8A 2V4JA 1F60B 1MMNA 4Y28C 3S1TA 3U1NA 2WVBA 2O1PA 1HKAA 5B0CA 2YNHA 4FPIA 4NLRA 3EUNA 3PXGa 4CYUA 3GG0A 1KFDA 4FDFA 4IOAQ 2GGPA 3NBPB 1HQEB 1TL4A 2OSQA 3FSYA 5ITHA 4DR1F 4CLTA 1RK8A 5LOQA 1AB8A 5HROB 2V6AA 2B0GA 2OP5A 1ROFA 1M1GA 4PABA 2RHQB 4O3OA 5CCMA 2BMBA 1CLFA 1S9GB 1KVJA 2FVQA 4RW4B 3TVZA 2X1AA 5CYMB 2K1RB 3PW0A 2CPIA 5A0YA 1NUEA 5E3RA 3W60A 2Y1JA 1BQXA 1IKYA 1FFWB 3BGRA 1TL7B 3CJKA 2VFVA 3H4BA 3R2DJ 5KOXA 1YTYA 4DR4J 1QSSA 1GT8A 4N77A 4IO9Q 2V4QA 5ETPA 3F41A 5KOWA 2LFVA 2J9CA 1TUWA 4MJKA 1U48A 3POTA 2JH3A 1UPMB 3LTOA 4KGKA 2DY1A 1KVIA 3HLUA 2HBQB 2ZDOA 4ZCIA 2AGPA 4OQJA 2BA9A 5BR8J 3KNAA 1DTQB 2GJ2A 3CDEA 5HK4A 3IN5A 2ZJQQ 2VB6A 2YWGA 1SH3A 3KLHB 4N7TA 3TEHB 4CLLA 2XYGB 3MR2A 3T1HJ 3MOJB 1YG0A 2DH7A 4UT4A 1S9FA 2IAJB 2R2SA 2Q79A 1JK9B 2AJ2A 2M4MA 4ALZA 3WHIA 3VF0B 5D15A 5J2PB 1EQ0A 2E44A 3QWUA 3TX0A 3DLGA 2NPIA 2CPJA 3V6HA 1RJJA
chains in the Genus database with same CATH topology
1R0AA 2PFFB 1S6QA 3ZZUA 4LT6A 1RKJA 5KFKA 2B9YA 1UAWA 4Q5VA 4X65F 2UUAF 2JEJA 2F4VF 3MXHP 2CJQA 3LAMA 1GH8A 3T19A 1UEVA 4B3RF 1RT4B 4CO0A 2LU1A 2CYYA 4NLYA 4WIIA 2VFTA 3BGFA 4BC9A 4R25A 5B0BA 4H4MA 1R6YA 3P6YC 2B4OA 4GO7X 1RT7A 4Q2MA 1VQKS 2K1RA 1QE1A 2CQIA 3KHHA 1JJ2R 1H2VZ 4IYQA 2JZ5A 5I42A 2ZOGA 2HNZB 2B3TB 2VG7A 2HPUA 2HS4A 2KVIA 2OMLA 2PC6A 4PG4A 1WHWA 5L38A 3PO4A 3HT3A 3TNVA 4NZ6A 2UZAA 2QZ8A 4ZHRB 3MMCB 1ZM3A 2ZKUA 1BD6A 3LF0A 3S01A 4DR5F 1HMVA 3B4MA 2V4JB 1S72S 1T3OA 5F41A 3CD7A 3CD0A 3MMAA 1DRZA 3E8OA 3MTJA 2WBMA 3BDEA 4ETXA 5I4MA 4U7CA 2MQPA 2B5JB 2UXCF 2R2RA 3OUYB 1P1TA 4I2QB 1U09A 5CH7B 4YDDB 5DDPC 3RAQA 4IDKB 6FDRA 2GQQA 4QIEA 3NMRA 2R7UA 3R5AA 4X66F 2AJ0A 1TR0A 5DQHA 3IFEA 2CQBA 3FFIA 4C97A 2UXDF 4ZVEA 1VGYA 4CIOA 1D0EA 2XGPA 5KFJA 2HHQA 4RU2A 2YNFA 3IBWA 4PPZA 1TVRA 3R3TA 2IYGA 1CVJA 4AL5A 3DMJA 1NZAA 5KFXA 3NAIA 3TO8A 2DGSA 2M9KA 5HI7A 3PEHA 3LQVA 3J7YU 5KG1A 1LXJA 3TA1A 1FRHA 3MF5A 3KLVA 3IWNC 1FXLA 2CVEA 4K4SA 2LA6A 2HNDB 4ATNA 3HVRA 3N79A 1U6BA 2HQ3A 4CNYA 5KFPA 4EBDA 3ZZZA 1XEZA 3V4IB 3ENQA 3KK1A 1NK5A 3ISNC 3SEOA 3DMJB 3QIPA 2IYIA 3GB0A 2UVWA 1IXKA 1ZPVA 3V6JA 4DLGA 2UV8A 4DS4A 2LEBA 2HRUA 2VFUA 4DQQA 3AA9A 1H38A 2O67A 2V4RA 1R31A 5B09A 4YB6A 4J9SA 3M9NB 1LQ9A 3OR1A 2B6AB 2GO9A 3TAPA 1D9AA 3O6QA 4DR3F 2BJDA 2OD6A 4A8OA 2I1RA 3CCWA 2L48A 3CSKA 3QO9A 3G6ES 3DLKA 1OPIA 4KTQA 4O44A 3PM9A 5J2MB 5HLFA 4I4BA 3MR3A 3OTOF 4DL0C 3L3CA 2J7WA 4GKJF 2QLXA 3IRXB 1YJ9S 4Y34A 5HMZA 2FLOA 3MPWA 1KFSA 2ACYA 2B4VA 2AU0A 5DGBA 4ZPTR 4JI1F 2IA0A 4A8YA 3IG1A 4NL5A 2C3OA 5E41A 1S1XB 1IBLF 1V3ZA 1WHVA 4HT7A 4IH5A 5EN1A 3CCQS 1VFJA 3NS6A 1ULRA 3JSMA 1X4AA 2LKZA 2YWHA 1URRA 3M4XA 3SCLE 3ZZTA 3GV8B 4A48A 3KK3B 4YDXA 3U7JA 2RQCA 1UW4A 1O8BA 3K5OA 4WF9Q 1WF1A 3CEDA 1NH8A 4DQIA 2ZC3A 2QYCA 2DRBA 3N6LA 2ZUGA 1FKAF 2FLLA 4FBUA 2DGXA 1K1QA 4ERDA 1H7WA 3I6PA