1JLAB

Crystal structure of y181c mutant hiv-1 reverse transcriptase in complex with tnk-651
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
435
structure length
408
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVICQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanisms of drug resistance for mutations at codons 181 and 188 in HIV-1 reverse transcriptase and the improved resilience of second generation non-nucleoside inhibitors.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase
molecule keywords HIV-1 RT A-chain
total genus 111
structure length 408
sequence length 435
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2001-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1jlaB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jlaB03
1C0UA 1RDRA 3KLHA 4M94A 1NHUA 3I5CA 2E9TA 4QPXA 3FRZA 3G6XA 2VA2A 5KFSA 3E01A 4IRCA 1Z4UA 2GC8A 2WB4A 5C42A 1XR5A 1T94A 4ECQA 5DGAA 2IMWP 2IA6A 1IKVA 4I7FA 4QWAA 1S1WB 3JSMA 4KV8A 5EDWA 4EO8A 1S49A 1DLOA 4IFVA 3DOKB 4WE1B 2YKNB 3EPGA 3RB4A 2W9CB 2YNHB 3LP0A 3MEEA 4NRUA 3H59A 3LP0B 2B43A 3DRSA 1C0TA 3ITHA 5J1EB 1HYSB 4RNHA 3V6KA 2AU0A 4NLPA 4MK8A 5KFAA 3ITHB 1QE1A 1HYSA 4J9OA 1IKYA 4DL7A 4JV1A 4WZQA 3KOAA 2YNFA 5L1KA 4ED1A 1HPZB 4U6PA 4K4SA 1DTQA 1NHVA 1VRUB 1RT1B 2VG6B 3C6TA 2CJQA 2ILYA 1T05B 4Q45A 1FKPA 4EBEA 3H5SA 2C2DA 1R0AB 3KHRA 1HMVB 3G6VA 4Q8EA 3KLFB 5F9LA 5KFHA 3BQ1A 4IFYA 2R8JA 3M9OB 3QZ8A 1RT6B 3UPFA 4QWEA 5KFMA 4IQXA 1TKTB 3GIJA 3GIIA 1JKHA 4ZVEA 3JYTA 2I5JB 1ZETA 3QYYA 4KAIA 1S1VB 2YKMA 1DTTB 5D3GB 4MIAA 3DLKB 4M95A 4NLXA 2AQ4A 2FLPA 4O3QA 2BQ3A 1RT7A 2BANB 2GIRA 3T5JA 1JX4A 4ID5B 3C6UA 2RKIA 5HROB 3EZUA 4R5PA 4TLRA 4O3RA 5KFYA 5KFOA 4ZVGA 1RT4B 2D3ZA 2W8LA 3IG1B 4F4XA 2HNYA 1S0OA 3MFIA 3RB3A 4K4UA 4EBDA 4Q8FA 5DLFA 1C1CA 1C1BA 1RT3B 2ZD1A 5J2QB 1K1QA 2O5DA 5F8LA 4H4OB 4NLRA 4ZVHA 2WONA 4PWDA 4KBIA 2UVUA 4ECZA 3UDLA 4PWDB 4ED2A 3PZPA 2DPIA 4XPEA 3TAMB 1NNDA 1RTJB 4O4GA 2R2UA 3QIDA 5EWGA 5C24A 3IG1A 4G1QA 1J5OB 5DG8A 4MKBA 2W9BA 3BSNA 3RBDA 4FBTA 1JLAA 2W9CA 1W25A 2R8GA 1TP7A 3DOKA 1LW2B 4IFVB 1JXLA 3FSIA 2BQRA 2QV6A 1VRTB 2YNGB 3DI6B 3DRSB 3LANA 1T3NA 2J6TA 4KKOA 3RAXA 4NLQA 3CDEA 3Q8PB 3PW0A 4O3PA 4B3OA 4O3OA 4K4YA 2ASLA 4XPCA 2AGOA 4K4WA 3LALA 4LSLB 3D5MA 3MR2A 4J9NA 1RT5A 4KV8B 1IKVB 4I7FB 4QW9A 2B6AA 2HMIB 3HHKA 1RT2B 3IGNA 3NMAA 3LAKA 4IG0A 3Q8SB 4R5PB 4DL5A 4U7CA 4ZPCA 2BQUA 2XGQA 3M8PA 3BGRB 3LP1B 1S6QB 5I42B 4RZRA 1EETA 1KLMB 2B5JA 3NGDA 4EYHB 1SV5A 5C5JA 3DLGB 4PQUB 1IKYB 4IH5A 5KFDA 4Q43A 3OHAA 4RNOA 2ASDA 5J2NB 4Y2AA 2RDIA 3GV8B 4QWBA 2XI2A 4RW6A 3Q8QB 2OPQB 4ZMMA 1TKZA 5KFWA 2HNDB 3T5HA 3KHGA 3G6YA 5KT5A 5KFEA 1RYSA 5HBMA 1TV6B 4R8UB 2OPRB 3CIZA 4Q44A 5KFFA 3N6NA 1TV6A 2OPSB 3PR4A 4ECVA 4O3SA 4YQWA 4QWCA 1RTHB 3H2LA 3SFGA 5L1JA 4TY8B 4NLTA 4TXSA 2WOMB 1S1XB 5KFKA 1BQNB 1EP4B 5F8GA 1CSJA 2V0NA 3MFHA 4K50A 1HQEB 1BQNA 4RNMA 4EBCA 4WZMA 1REVA 5KFRA 3QLHB 1HQEA 1S48A 3MTKA 3OSNA 4H4OA 3QLHA 1S9GB 2VG7B 2R8IA 2CKWA 1QUVA 5J2MB 4NYZA 3I0RB 1KHVA 5KFXA 3RB0A 2C28A 3DMJB 5KT6A 3GV5B 3QZ7A 4YR0A 2ATLA 2HNYB 4ED6A 2YNHA 2HWIA 3FQKA 2IM2A 4WE1A 2HMIA 1S4FA 5KG6A 3UR0A 3OL7A 3PVXA 1BQMB 4WXWA 1QAIA 4NCGB 2E9RX 1S9FA 3T1AA 3CVKA 2VA3A 1U09A 3M8PB 3H40A 3E01B 2B5JB 5C42B 3MR3A 1RTIB 3H98A 4URQU 2DPJA 1IKXB 3FDSA 4HKQA 3DM2A 3SI8A 1JLAB 1JLGA 2C22A 4IRDA 3DM2B 2W9BB 4IKAA 2B6AB 1FKPB 4RW9B 1HMVA 2IAJB 5KFQA 4R0EA 1R0AA 1JLEA 2VG5A 4IG0B 3IS9A 4KKOB 2UVVA 1K1SA 2F8EX 3BQ0A 3M8QB 1S1TA 4K4TA 1LWFA 4RUCA 2UVRA 5KFVA 4WXOA 2YNFB 3KLGA 1RT5B 4ED0A 3LP2A 3G86A 4DG1B 4NLDA 4ZHRB 3NKYA 1MMLA 4RNNA 4JV2A 3KK2B 5F9NA 3GV7B 4KSEB 2IBKA 4RW4A 3TQ1A 4KO0B 1IKWA 4IOBA 2OPQA 4F4YA 4ZP7A 4R8UA 1S9EB 5KG3A 1RAJA 4NLYA 1TL1A 1LWFB 1ZTTA 4NLSA 3HKWA 4ECYA 3QO9A 1D1UA 2FVCA 4RU9A 3LP1A 5I42A 5KT3A 4ECSA 1EP4A 5CYMB 1S1VA 4PQUA 1HNIA 1S1UA 2I5JA 5J2NA 2WONB 2JEJA 1N6QA 3PJXA 2XCPA 4IDKB 3KJVB 3KLVA 3KLEA 3V81B 1XR7A 3C6UB 4IG3B 1T03A 2FVSA 3V6HA 1QAJA 2EC0A 4TY9A 2WRMA 5KFCA 3V6DA 3PW5A 4Q0BB 3ISNC 5F8JA 4ECXA 5KG1A 3CDWA 3EPIA 2R2RA 4FS2A 2AGPA 4WFYA 1JKHB 2IJNA 4O3NA 4LSNB 4J9MA 1TQLA 1DTTA 5D3GA 1RA7A 3V4IA 4IH6A 4NZ0A 3KK3A 4EYIB 3V4IB 4WFZA 3VQSA 4J9QA 3H5XA 5CYQA 3GIKA 5C24B 3CJ3A 3H4BA 4KHRA 5C25A 3PW4A 2V9WA 5DQIA 3QGHA 5J2MA 3V6DB 3BSCA 2IJFA 3RB6A 3DMJA 3LAMA 3MEEB 5KFJA 1SH2A 3C6TB 3MEGB 3QGGA 3ISND 2OH2A 4QW8A 4MH8A 2AX1A 5DLGA 4J9RA 3QIPA 3DDKA 4H4MB 4H54A 4WYWA 2FJWA 2IM3A 2UUTA 3M8QA 5KT7A 3I5AA 5KG0A 1UWBB 3TAMA 2GIQA 4I2QA 3OL9A 1WNEA 1LWCB 3DLEB 5KFTA 4ZHRA 1S6PB 4O4RA 1HNVB 1KHWA 3KLGB 5FDLB 2ASJA 4RW6B 3OL8A 3OSPA 5HBMB 4RW4B 2WHOA 2BANA 4TYBA 1RTDA 1S10A 3H5UA 3MECA 5I3UA 2RDJA 4ZPAA 1ZTWA 5HP1B 3IS9B 3KLIB 2FVQA 1JLEB 2VG5B 1RT4A 4MKAA 1EETB 1KLMA 4OL8A 5F8IA 5KFPA 4NLUA 3KLFA 1S6QA 2W9AA 4URGA 4ED8A 1SV5B 2ZKUA 3I0SA 1S0NA 4K4ZA 5JXSA 1C1BB 4J9SA 4ZP8A 5HLFB 2YKMB 3GIMA 3V81A 1S1UB 4LQ9A 2BRKA 1S9GA 3M9NB 4F4ZA 2D7SA 3OHBA 1T03B 3KHLA 3PJWA 3NBPA 1TL3B 3I5BA 1JLBB 4ECWA 2RKIB 3KMSA 2OPPA 1D0EA 1JLQA 2FJXA 4MIBA 5DG9A 3MR6A 3NL0A 4DL4A 4URSA 4FS1A 3DOLB 4ECRA 2IC3A 4TY8A 1FKOB 4YMEA 1HARA 4NCGA 3CJ4A 4KE5A 5KG2A 2JC1A 3CJ2A 1S1XA 3BR9A 4KFBA 4RW8A 1VRTA 1JLCA 5DQHA 1IM4A 2BE2B 2HWHA 2AGQA 4X2BA 2XGPA 3HVTA 3FFIB 5K14B 3RBEA 4O44A 2IM1A 4G1QB 1J5OA 1RA6A 1GX6A 3OLBA 1RTJA 4O4GB 1S1WA 1LW0A 3I0RA 3NAIA 1HQUA 1DLOB 2IC3B 4KHMA 3MEGA 1HQUB 3QIPB 3BSAA 4RW9A 3KLHB 5KG5A 3Q8RB 4NLOA 5J2QA 1N4LA 3T19A 4WFXA 3MF5A 1S1TB 2FJVA 4GC6A 3DRRB 3FFIA 1N5YB 2JEFA 4RNFA 3NAHA 1GX5A 3OLAA 3GQCA 4O44B 1I6JA 2ZE2A 2W7PA 2R8KA 4ZVFA 4TN2A 4DL6A 3PW2A 4G3IA 1YVFA 3D28A 4PUOB 1JLGB 5L1LA 4DL2A 1SUQB 5HLFA 3DYAB 1IKXA 4DEZA 4TYAA 2JEGA 3GILA 1RT7B 2FLNA 2HNDA 5L1IA 4GC7A 3KLIA 5KFIA 3N6LA 5EWEA 3MEDB 4J9PA 1TL3A 2XC9A 3MECB 5I3UB 3BGRA 3CO9A 3H4DA 2JEIA 3ICLA 4YR2A 2QE5A 3DLGA 1RT6A 3BREA 3JYTB 2FVRA 2WK4A 1LWCA 3DLEA 1TKTA 3DRPB 4MK9A 2V4QA 4J9LA 3CDUA 4ZPBA 2V4RA 2W8KA 1HNIB 5KFLA 3TVKA 4ICLA 2YNIB 5FDLA 4Y2CA 5F8HA 1RT2A 5KG7A 2HAIA 2RF2B 1RT1A 2VG6A 4NRTA 4ZPDA 3OL6A 3H5YA 2HNZB 2I1RA 4K4XA 2VG7A 1OS5A 1TVRB 5HP1A 3PW7A 1TKXB 4ECTA 2XWYA 1LWEB 1TL1B 1C2PA 4NLVA 1LW0B 1XR6A 4NLGA 3PHEA 3HVAA 2D3UA 1N56A 3QO9B 2ZD1B 4EO6A 4RW7A 4ECUA 1LW2A 4DG1A 1C1CB 1JLFA 1JLCB 3BJYA 2YNGA 2XCAA 3KK3B 3HVTB 5K14A 2ILZA 1JLFB 5CYQB 2J6UA 1IKWB 2BE2A 2R2TA 1SH0A 3CJ0A 5EUHA 2R8HA 2ALZA 5J2PB 3JSMB 4YR3A 1S97A 2D41A 1LWEA 4I2PB 4Q0BA 2UUWA 4F50A 2UVWA 3KNAA 3DYAA 2J6SA 4FBUA 4LSNA 1RT3A 2FVPA 4NLWA 5F8MA 1C0UB 2IM0A 4IDKA 3KJVA 4IR9A 4WYLA 4EEYA 2E9ZA 3KLEB 4QWDA 1N5YA 1MU2B 3M9MB 4IRKA 3DRRA 4IG3A 3HVWA 5T14A 5C25B 5L9XA 5J2PA 1MU2A 4ZP9A 3KHHA 3RAQA 4B3OB 1FK9B 2C2EA 4I2PA 1SUQA 4LSLA 1RTIA 1VRUA 5KFNA 4HYKA 1RTDB 2WCXA 3E51A 3PR5B 4KO0A 4Y34A 4MK7A 2BRLA 5KFBA 3DI6A 3MR5A 3MEDA 1S9EA 1C0TB 5J1EA 4ED3A 4IFYB 5KT4A 3IRXB 3KMQA 4I2QB 1S6PA 2W7OA 2ZE2B 1HNVA 1UWBA 2JC0A 5KFZA 4K4VA 1DTQB 4XO0A 4RW7B 4PUOA 3T5LA 5CYMA 1HPZA 4JUZA 4IR1A 1T05A 3BQ2A 2RF2A 4DL3A 2YKNA 3IGVA 1N6QB 2WTFA 4ZP6A 4MFBB 3LP2B 1REVB 5DG7A 1SH3A 2HNZA 4ICLB 4YP3A 2IAJA 4MFBA 4H4MA 3V6JA 2OPPB 3CWJA 5KT2A 1JLBA 3BSOA 3T5KA 1TKXA 1RTHA 2OPRA 1QE1B 2JLEA 3UQSA 3SFUA 2OPSA 3IRXA 4KB7A 3GYNA 2WOMA 2FLLA 2C2RA 3N6MA 5DQGA 4RUAA 3IN5A 5KFUA 4KFBB 4RW8B 3DRPA 3I0SB 2YNIA 1N48A 1RYRA 3KK2A 5JUMA 4ID5A 3DLKA 5HROA 4Y3CA 4ED7A 3KK1B 4LQ3A 2AWZA 4JV0A 4TQSA 1TKZB 3KK1A 2R2SA 1TVRA 4TQRA 4F4WA 2XI3A 1JIHA 3NBPB 5KG4A 1FK9A 2AX0A 3QGIA 5DGBA 3CJ5A 4J9KA 1FKOA 1JLQB 5KFGA 1S0MA 3DOLA 5EWFA 4IH7A 2BR0A 3FQLA 5F8NA 1BQMA
chains in the Genus database with same CATH superfamily
1C0UA 3IAS9 4ZCLA 1WEXA 5B0GA 3M8YA 2H4YB 3BH7B 2HRUA 3MI7X 4CZCA 3PX6A 1HIYA 1U48A 2Y1RI 3MMBB 4IRCA 2YPYA 1Z4UA 4X65F 3MCSA 3ZXWA 4KH1B 3KG1A 4DZ6A 2LEPA 4JI7F 2H54B 4QWAA 3VGVA 3M6WA 5EDWA 1RP5A 2X1BA 3CJQA 5KOWA 1Q5YA 1MWZA 2W9CB 1X5OA 3MEEA 3BGFA 2BJ1A 4NRUA 4DV1J 2KFNA 3TO8A 3H59A 2B7CB 3BZQA 3LP0B 4E0DA 3P96A 2B43A 4M1KA 1OMSA 3KFWX 4M8LA 2Z58B 3V6KA 2E5LF 4F7VA 1U4BA 1RHMB 3BKTA 4P2MA 1EZZB 3UD3P 3JQJA 3M30B 3ITHB 1HYSA 4J9OA 3W5XA 2HVDA 4PXBA 4KIAA 4C8LA 3KOAA 4DPYA 4IOAQ 1X4CA 4HT7A 3BO4A 2F63A 4HH0A 4PG6A 4QYZJ 1DTQA 2LLZA 1RT1B 3C6TA 2A18A 4RLEA 1RXOB 5A0YB 3T3FA 5EGYA 3I6PA 4V19X 2HFNA 1HMVB 3CCWA 3LUYA 4H4KC 4R0JA 1HWKA 3G6VA 4UOHA 1JJHA 1V3SA 5ETKA 1MW7A 4A47A 2R8JA 3M9OB 2YQ0A 4BWMA 3UPFA 3AFGA 5KFMA 2XZDB 3PX4A 5CYJA 2ASYA 3GWCA 4ZVEA 4C8NA 2I5JB 1PAUB 3ENAA 4DR4J 4KAIA 1S1VB 1VLOA 3R9LA 5JVHQ 2AQ4A 4NLXA 2WSEC 1G6BA 3OR2A 3VAKA 5GAEU 4YB1P 3GJTB 5IT9U 1WDTA 1WTBA 5DO2A 2GIRA 3T5JA 2XMVA 4ID5B 5HROB 2CPIA 2VC0A 1E6VA 2O3DA 4TLRA 4O3RA 4ZVPB 1JK9B 3C16B 4TU9A 1O5JA 3RRGA 2YWKA 1X4BA 1Y10A 3MFIA 2DHXA 4YUDA 4Q8FA 4A8WA 1PYOB 2ZM6F 1T8EA 2OEMA 3CCTA 1C1BA 1KP6A 1FNXH 1RT3B 4F25A 2DY9A 5B09A 3GSDA 1OYEA 2O5DA 1UMJA 2KXFA 2B0GA 3GR0A 4G1IA 4H4OB 3Q23A 1UVMA 4KBIA 4RWXA 1PYTA 2RB7A 2VQFF 2NREA 4GRSA 3MOJB 2QA2A 4PWDB 1RSCA 2ZZTA 2C2KB 3TUZC 3H25A 5EWGA 3JSRA 4OHZA 3PV8A 2DXDA 3LGHA 4OYAA 3A8EA 4MKBA 4U67Q 3BDPA 3FSXA 4FBTA 1TFYA 1JLAA 5HVFA 2IBOA 1U6BA 1VIXA 2JH3A 3R5CA 3M32B 4CNZA 3DOKA 4USTA 3K59A 3CCJS 4LRDA 2BQRA 1FRMA 4DFJA 3W2VB 1D9FA 4V19J 2R7SA 1W26A 3DI6B 3AXMA 3LANA 1MROB 1AA1B 1KVKA 3RAXA 3BGLA 4GVBA 3PTWA 2VJUA 2VKZG 4O3PA 4O3OA 3PW0A 3KJNB 1N5QA 2KG1A 3UD4P 1ZYQA 4DSLA 2I38A 4K4WA 3D5MA 4IUFA 1HNWF 3R7BB 4ER8A 4UOFA 2GW8A 1WKJA 2YWEA 3CJSA 4QW9A 1DBDA 3SXLA 1URRA 2HMIB 2B4VA 1GNKA 2OSQA 3I32A 3W2WB 3D9BA 1D9AA 4KGVB 2JRSA 4YHHJ 1WEYA 5KTQA 3NMAA 3D6TB 3OR1B 3K58A 1CS4A 2CJ9A 2Z30B 4WIIA 2BQUA 2XGQA 1YKWA 3M8ZA 4LVNP 3LP1B 4RZRA 1EETA 1KLMB 4EYHB 1YJ7A 2HHWA 2IDLA 5C5JA 1VIOA 1P1LA 1VQNS 2IYGA 3HULA 4ZVRB 3DFEA 2MGZB 5CABA 2X1FA 1KOOA 4OYMA 2XI2A 3Q8QB 3AAWB 4ZMMA 1TKZA 2YWGA 2HNDB 3HX9A 4ATNA 5KFWA 3G6YA 2CQGA 5KFEA 3T5HA 2ZC4A 2VICA 9ATCB 2QL9B 2MZ1A 3DLLQ 2N4CA 5KFFA 2BJ3A 2Q43A 3R7SB 3IXQA 1BUXA 2LU1A 2OPSB 1Y9OA 1YJVA 2A1BA 2AKWB 3W60A 5GAGI 1SKWA 3H2LA 4O3SA 2OHDA 1WHWA 3SFGA 4TY8B 4NLTA 1Y4ZB 4R25A 1HBNA 5AE3A 1HHSA 1CSJA 2C2MB 3WHIA 1YJ9S 5IT9Y 3UNYA 1RABB 1RKIA 3I31A 2QLBB 2IPOB 3GIRA 3MM5A 4UY8T 4MKVA 1HQEA 1IR0A 1R0CB 1GMUA 4DV3F 3CCMS 1JB0C 5LSLA 3K5MA 1QUVA 2LA6A 4I6YA 1NM2A 2QMXA 3QSIA 3DGPB 4RUBA 2BA9A 1FDAA 4YY3J 1Q7YT 2VA2A 2R7VA 3RJMB 4YR0A 1WOPA 1Y0HA 4AQYJ 1TAQA 2HWIA 4DOZA 4BBYA 2C42A 1RHKB 4ZN1A 5KG6A 1K9MT 1BQMB 4DV6J 1ZAXA 3VV2B 3RTVA 2PD1A 2ALYB 1QD1A 3QFHA 1UEKA 3Q8UA 1UW4A 3LF0A 3CVKA 2VA3A 2N7CA 1H2UX 2RILA 4HDHA 4ZJQA 1KS2A 2AJ0A 2XS5A 4C8MA 3T1YF 2WVFA 3ETMA 2B9EA 2MSTA 3MR3A 2EK1A 4URQU 2AP6A 2ZM6J 3BBBA 2BVZA 2HPUA 4HKQA 3FDSA 3I96A 3S01A 4C0BA 2KYXA 4CLYA 2DO0A 3SCIE 1D8YA 2EW9A 1JLGA 3DGVA 4DL0C 4DN9A 2C22A 2W9BB 1NB7A 1A0OB 1HMVA 1IUJA 1LOUA 2IAJB 3GJSB 3HFKA 3AJ2A 3M8WA 4WKYA 4R0EA 4C3LA 1UA0A 2VG5A 1QVGR 3JXOA 1OSDA 1FVQA 3JS9A 4JI3J 2LA4A 1K1SA 2A6MA 3F73A 1AB8A 1WEZA 1S1TA 1X7VA 3M1VB 4C6AA 5B7WA 4K4TA 4EZ6A 2KRRA 5E3CA 2UP1A 2NZ4A 4ZN3A 1FVSA 3KLGA 1AUDA 1R8PA 4O3NA 3FNNA 4B02A 2DVIA 4ED0A 3CULA 4RNNA 4ECTA 4DG1B 4ZHRB 2Y8WA 5F9NA 3POTB 1HWLA 2K7KA 1Y5LB 4KO0B 3DU6A 3QWUA 3PFEA 4HLBA 4JBCA 5KG3A 2DGUA 3IM9A 5DRKA 4ZIVA 4F3OA 3QGPA 3GJRB 1WTFA 1TU0B 3QO9A 2FVCA 4FVCA 5AJ3J 1Q8LA 5D78A 3BF4A 4OYZA 1GTHA 2DGTA 5I42A 3MAAB 1H2TZ 5CZVA 5KT3A 4ECSA 3WC0A 5CCMA 2UUBF 1F0XA 4ZCMA 1F2GA 4QIEA 4KHPF 2NXJA 3O8WA 3PJXA 4NPOA 3UN3A 4ZKAA 2VBYA 1Y00A 2Y0SD 4QBUA 5HJYA 4B9TA 1PYSB 3C6UB 1FO1A 2O66A 2W01A 1VCTA 1K47A 4P10A 5D15A 4DX5A 2KHDA 2EC0A 2WRMA 3UDEA 5M2RA 2AYGA 3BS9A 5F8JA 2XO7A 2OO4A 1SC6A 1FWPA 4ECXA 3CDWA 3BKFA 2R2RA 3EPIA 1N88A 4FS2A 2CNLB 2IJNA 2W2PP 1HWIA 2VASA 2PSZA 1DTTA 3G8QA 1LXNA 4LBHA 4LF8F 2CPEA 4NZ0A 3W65A 1WG4A 1UFKA 1F9FA 3GONA 4LR8A 5D77A 4EYIB 4J9QA 4PWWA 4LBPA 4Z37A 1NKEA 4FNHA 2RT3A 4PG7A 5B0CA 5CYQA 1S6UA 5M2PA 3GIKA 1HQ2A 4D3GA 1LFPA 2WAQD 3HP6A 3QBCA 2AZ3A 4I4BA 4DQPA 2VHGA 1F5CA 4X4PA 2HVIA 1GQEA 4QIGA 3RB6A 2DYAA 3CD5A 1O0PA 4RBVA 5KFJA 1KONA 2DRBA 3CCUS 1SBRA 2YBVA 3C6TB 1VQLS 2OD4A 1M5SA 1RBLA 1WELA 2LXUA 2RJZA 2VV5A 2OH2A 4MH8A 2GGPB 5JMNA 1YWXA 3N4WA 3DDKA 1AT1B 2RSQA 2FJWA 1A7GE 2HGLA 2NS1B 5KT7A 3I5AA 2CNOB 3UE2A 2P2CB 2KZZA 1Q4RA 3LWMA 1NCLA 4I2QA 2GV1A 2VBZA 4F0KA 4ZLJA 3V2UC 1U26A 3IO1A 4U95A 4ZHRA 1S6PB 3TVYA 3CJKA 2B51A 3QJLA 1KHWA 3OUYB 3PFOA 4C9DA 4ZVTB 2ZH7A 5FDLB 2QT7A 2ASJA 1QY7A 2L3MA 3R27A 4K8RA 4WIQA 4RW4B 3B54A 1RTDA 3H5UA 2RDJA 4ZPAA 2KZMA 1XMOJ 4CDIA 1GTEA 1WHVA 2VG5B 3NCPA 1RT4A 1EETB 1KLMA 2CADA 3DRYA 3NOGA 3QQCD 3TNVA 8RUCA 4C8ZA 3KLFA 3H0PA 5IWAF 3T41A 1XQIA 2QC3A 3C8YA 1SV5B 1WSVA 2MTLA 3MM8A 4KY3A 3T9NA 4PG8A 3I0SA 4NMXA 5LJ5Y 5JXSA 5K8OA 2HGMA 4ALZA 5HSPA 2NXNA 5IFMA 1QLNA 1AROP 3MAHA 2FZKB 5HAOA 3GIMA 1S1UB 4CP5A 2PMWA 2BRKA 1X9MA 4ZDNA 1UVJA 3MMBA 1YG0A 3OHBA 1T03B 3OQ2A 2APOA 3Q24A 5M2UA 3I5BA 1JLBB 3TAPA 2ZBCA 1D0EA 1PO6A 1JLQA 2D3OR 2CPDA 4ED5A 1TUVA 5L46A 2GVDB 4DUZJ 4FS1A 2NQPA 1NSQA 1HARA 4KE5A 5EX3A 2G9OA 2M5YA 3MR7A 3GJQB 5KG2A 4S0MA 3BR9A 4K5RA 1NJYA 3WIVA 2YKOA 1J27A 5AXMA 3S1TA 2HWHA 5E3QA 4B3TF 4N77A 1XJWB 4JI4F 2XGPA 3G8TA 1VJWA 3FFIB 1BE4A 3OT9A 1U1KA 1YRTA 4J7CA 3R6GB 2JVOA 4CO2A 5HQ8A 1UFWA 3TANA 1RA6A 2XMKA 1GFWB 4ZLLA 3OLBA 1RTJA 4HHHA 1S1WA 2B56A 2CQ1A 2CYYA 3RGIA 3AY0A 1HQUA 1DLOB 2IC3B 1ELOA 2F5GA 4AXJA 4XTTA 2ZZMA 3HSJA 2NR0A 3QIPB 1IWAA 1TZ0A 4RW9A 3W5ZA 5L9NA 5KG5A 3OV7A 2FHJD 4NLOA 1X60A 2ZC3A 2FJVA 2MLZA 4DR4F 3FJ2A 4MT1A 4GC6A 2AJQA 4U9RA 5IQQA 4WFAQ 1N5YB 1NH8A 4RNFA 3NAHA 3Q86A 1U1NA 4QIWD 3ENQA 2O1PA 2ZEJA 4G3IA 1ZPVA 3PM9A 4OX8A 1YVFA 3UO0A 3D28A 1HLWA 1NKCA 4ZA1A 2QMUB 5L1LA 4OZLA 2LYVA 1FERA 5HLFA 3DYAB 3QFWA 4WK3A 2V4JB 2DXEA 3PX0A 1VQMS 1IBKF 4TNOA 2HNDA 4DQQA 2H4WB 2RAQA 1QAXA 3ZO7A 3IWLA 5B0EA 3SSSA 5KFIA 5LXRA 5EWEA 2DR9A 2HBYB 3J7ZT 1IXKA 4DPOA 3MECB 5I3UB 3BGRA 2RHSB 5GMDA 1NK5A 1HD1A 4L72B 3K89A 2QE5A 4F2RA 4QYZK 3JYTB 4J37A 5H9FJ 3DLEA 1U0HA 1TKTA 2IVFB 3BM7A 5LOQA 3SFUA 2VJVA 3CJKB 4OYWA 3CDUA 4HACA 4ZPBA 1DQ9A 1HNIB 2W8KA 4JP8A 2XY5A 3TQEA 2FY1A 3EZOA 2VFVA 4K2JA 2GMLA 2Z0GA 2HS4A 1WI6A 4ANDA 2PT0A 5A0YA 2VG6A 3VVUA 3IR5B 4CLLA 4NCBA 1AFJA 4HTJA 4K4XA 2E7XA 2D69A 1OS5A 1EQMA 3JSYA 1F3FA 4AL5A 1WSRA 2J76E 1OY9A 3V5RA 2NSCA 2LECA 2OSRA 3Q22A 3EWGA 1YTYA 2XWYA 1HW9A 3DHWC 4I1TA 1V3ZA 1LW0B 1RWNB 2AV5A 3NS7B 3PHEA 2VQFJ 4IOCQ 1LKZA 2QGFB 2MLXA 2P6SA 2QJ3A 2ZD1B 4EO6A 4RW7A 3TARA 5L38A 3M6UA 3L7UA 1R0BG 2F4FA 2E29A 1V9OA 1U1LA 3R2DJ 3HVTB 2H65B 2ILZA 4WFNQ 5CYQB 2Z56B 1M1HA 1R8CA 2Z2YB 1FFSB 4Y0FA 2J6UA 1H74A 2GQCA 3CEDA 4W92B 2KTQA 3D1OA 4YR3A 3MPWA 2XS2A 2D41A 1LWEA 5C7PA 3IR6B 2EG1A 3W1YC 2HIYA 1TR0A 2RU3A 4FBUA 4K2XA 5E3AA 1ZS6A 2DR6A 1JXEA 2FVPA 3PYGA 4NLWA 3C66A 2ZHAA 1CJVA 1C0UB 1SQGA 1H72C 3KJVA 4I64A 2VZ9A 4WYLA 1X0FA 2X7IA 4X62F 4J9VA 3KLEB 1KKHA 1VS3A 2GQQA 4PXCA 4CH7A 3M9MB 2UUAJ 3JSBA 2DISA 3HVWA 3RAQA 4DF4A 1I94F 3KHHA 3I9ZA 1YIJS 3EM1A 2G13A 2VU5A 3RUBL 1RTIA 1CULB 1QTNB 4LF5J 3NNAA 5KOXA 3HSDA 3HJFA 3NXZA 2BABA 1RTDB 2CZ9A 2FGCA 4JI2J 2V9KA 3LA0A 2DO4A 2CRLA 2W2OP 2Y8YA 3DI6A 2AYMA 3D3BJ 2LQJA 3VAMA 4NEYA 1UPMB 3JQKA 2V2VA 2D1CA 3TOQA 4PPDA 2UV8A 2FGOA 1H7XA 4I2QB 1RWVB 5KFZA 5C2CA 3OTOJ 1IBMF 4OYXA 1DTQB 4PUOA 2O67A 4JI0F 3T5LA 1WACA 4USKA 4IR1A 3MM6B 3MPVA 2J9DE 3IGVA 3TEHB 1REVB 4DSKA 3AOAA 4DV1F 2UXBJ 4MFBA 1B64A 4AQYF 1FDDA 4V1Ak 2EFPA 5KT2A 2LQ5A 3CC2S 2NXUA 5J1PA 4WFBQ 3UQSA 2F40A 2N7YA 3OFGA 3IRXA 2BYCA 3ELHA 3GYNA 2VDIA 2WOMA 2G1DA 4I56A 3UWTA 4ZLNA 3SZ2A 2C2RA 2OEJA 4P2SA 4FF4A 1B70B 1IWGA 2NUUG 1GAOA 3DRPA 1FA0A 4JYAF 1RYRA 4ELVA 4K0KJ 5IC4B 4OI4A 1WOSA 4ID5A 5HROA 1PCAA 3FBBA 2ZH2A 4ED7A 1L5UA 2AHOB 2MY8A 2AWZA 3G82B 3ZZPA 2JLFA 2GJIA 2YWFA 3D0HE 4UOCA 1OQ3A 2GIFA 3PKYA 1JIHA 1IBLJ 4HR2A 2DHHA 1FK9A 3CMQA 3QGIA 2Z2LA 4WTYA 5KG4A 5DGBA 1RAOA 5HJXA 1FKOA 5KFGA 4J9KA 1X9WA 2G4BA 2PDAA 1UJ6A 3PW4A 2ZBPA 3KLHA 4M94A 2KDOA 2F7VA 4M63A 5IV3A 2OKQA 3GSIA 1SVDA 3FRZA 3KUHA 3RZAA 1O6XA 1VMBA 1OO0B 2B9WA 5KFSA 4PXDA 3G6XA 3K5NA 4YOEA 2WB4A 2J7KA 2F8MA 5DGAA 2HS0A 1U45A 4JI1J 2ERRA 5B0FA 1S1WB 2FC9A 1M5VC 4DQIA 1NO8A 2AEJA 2V4JA 4NA3A 3EYZA 3TUPA 3DOKB 3OFHA 4WE1B 2E5JA 3EPGA 2ZH6A 2P9CA 3MMCA 4PABA 3AODA 2NYHA 2YY3A 4PWUA 2IY5B 2XEXA 1X4GA 2GFFA 4YEAA 1C0TA 4DN0A 1UP1A 3LW5C 4UTGA 3L95X 4C3MA 3TA2A 1QE1A 3BGOP 4OZ3A 4L73A 3P3DA 2RH3A 2ZOMA 4ZJOA 2J0QD 1OSCA 1NHKL 2CIMA 4N76A 1HPZB 4K4SA 2UZAA 1PJ6A 2AJ2A 4KT0C 1N32F 3D0IE 4DFKA 1S5ZA 2P9GA 1WORA 2ILYA 2FC8A 1T05B 4B9MA 5JVGQ 4EBEA 2XY7A 3KHRA 2Y9HA 3S7RA 3RRHA 2OTJS 3CD7A 4F0MA 4CLSA 4Q8EA 2HHXA 2OFGX 1FXDA 4A4JA 1FI4A 1UJ5A 4LR9A 2EK6A 4M5MA 3IBWA 2A6OA 3JAMU 4IQXA 3HK2A 4DV5F 4C8OA 1TKTB 3GIJA 4C4WA 1LQ9A 2EFNA 2EFQA 4JI5F 1S79A 5D3GB 2LFVA 4K59A 4M95A 2BE9B 2MZSA 2J0SD 2V8VA 3FEZA 2MQMA 3M2UA 1BXNA 4HI1A 2FPHX 4QJVA 1YHQS 2N3LA 1H98A 1FRLA 2Y0BB 1HBMB 4F26A 2QSWA 4ZVGA 1VBZA 1RT4B 2D3ZA 2I9SA 2W8LA 2UV8G 2CZVC 2H1YA 4F4XA 4DSJA 1S0OA 4K4UA 4WF9Q 2XBPA 2CPFA 3RAMA 2YXLA 3MAAA 4U96A 1C1CA 4FYYB 3R97A 5DDPC 4DLGA 4GKKJ 1TMMA 2BW2A 3M2RA 4C97A 4A46A 5CXTA 3O3LA 5J2QB 4N8NA 4USHA 2FB0A 2ZBIA 3NS6A 4ECZA 3QAEA 3UDLA 1XK8A 4KGKA 5A8KB 2DK2A 1VJQA 3DC2A 4ED2A 4L3KA 1XIQA 4OZ5A 1NK0A 3HM9A 1HNZF 2YX4A 4ES1A 1S7HA 5C24A 5CD4H 3MMAB 4YN3B 2C2NA 3IG1A 4X4RA 2LCWA 1EHWA 1LK5A 1RACB 3PRVA 3AOBA 2HRTA 2XNRA 5SZTA 3RBDA 1N5SA 3IRWP 2W9CA 4IQMA 2R8GA 4L74A 1T95A 1Y5NB 2K1RB 2CDQA 2RRNA 4M5DB 4XK8C 2ACYA 4PCQA 1JXLA 1VRTB 2KN4A 4MYTA 2YNGB 3G8SA 2F4VJ 2MKSA 4GMKA 4WBFA 3B4DA 2J6TA 3PXGa 3AD8C 2IVMA 2OLWA 2ACMA 3Q8PB 1WI8A 2ZDOA 5F41A 5HVHA 4K4YA 3THVA 2CJKA 5CHCB 3JB9k 4XPCA 1S72S 3PYEA 3LALA 4LSLB 2OUGA 3MR2A 3TA0A 2PE8A 4WP9A 2LEAA 4FPIA 3BYPA 1PC5A 2W25A 5I4MA 4RR5A 1QSYA 3AD7C 3IGNA 3MEKA 4CO4A 2FZGB 1OY6A 2KVQE 2AEFA 4NI2A 5T7LB 3W2WA 2R7OA 4PZVA 2M52A 3HHLB 3LAKA 4IG0A 1FRJA 4R5PB 1RJJA 2Z8QA 4DX6A 4KRWA 4ZPCA 1ZBTA 4X65J 4EUVA 2BMBA 2GAGC 2D9PA 3DLGB 4Y65A 5C2GA 5KFDA 4CO5A 3Q8YA 4Q43A 3J81j 1FX4A 2ASDA 2I6WA 4AFFA 2J9CA 3FMWA 2D9OA 4QZVB 4RL1A 1OY8A 2QRRA 1FF2A 1RYSA 2RQKA 1OIAA 2K3IA 1F60B 4HDGA 5HBMA 2GMJA 3US5A 3CIZA 1F5AA 2BW7A 4HTIA 2UXBF 1RWUA 2D74B 1CJTA 2CVIA 1U47A 3DCAA 3HDSA 3P8BB 2MYFA 2CG4A 4ECVA 3HI9A 1SC1B 3IFEA 4DU7A 1RTHB 1YRUA 1ZM9A 2NXCA 3A8JA 3IM8A 4QWCA 4CWBA 1RBAA 2ZVIA 2M8HA 4TXSA 2UXCF 5KFKA 2GVDA 2LU2A 3GB0A 5BJRA 1EKSA 3H42A 3ZZOA 2GZOA 4LF4F 4FNIA 2GVZB 4DUYF 1BQNA 4WZMA 1HI1A 5HI7A 5A8KA 1ZAWA 4E8UA 2LVWA 2HHHJ 3OSNA 3PIOQ 3QLHA 3CDBA 5L39A 2WVEA 2ZBQA 4LRFA 3AT1B 4TU8A 1UETA 1UVIA 3I0RB 2YH1A 2C28A 4DV4J 4DFMA 3DMJB 4JB8B 2OP5A 4CYUB 3RB0A 3JTNA 4CLFA 1FJ7A 3UFCX 2PEHA 2ZFHA 3K5PA 3MMCB 2V67A 4UT4A 1S4FA 1FEEA 1JXVA 3X1LB 5DDOC 2IJRA 1NK8A 2HHUA 4NCGB 1RB0A 4OZJA 2AW0A 4KGMA 3CCRS 1NK6A 2BDPA 4KHPJ 4I67A 1KD1T 2UUCJ 3T1AA 3TJ9A 4NXNJ 1U09A 3CD0A 4LSZB 3M8PB 3MOZA 3E01B 2CQCA 4PXEA 4B9NA 1FJGJ 2O01C 2WBMA 5A2QY 3C14B 5HL7Q 5K8MA 3GLJA 3HD1A 3H98A 2J0WA 2OMLA 4AXIA 1IJEB 2X51A 5G0RB 3SI8A 2IHR1 1SB6A 3VALA 3W8GA 5HATA 1AXQA 3B4MA 2VUGA 4Z7CA 4IKAA 4DQRA 2B6AB 4RW9B 4KGXB 4OYPA 4UZCA 5LT5A 2QO3A 4WCEQ 5KFQA 1R0AA 2RMLA 1X5SA 2MPUA 4DR7F 3CCVS 2DD8S 2UVVA 2CQ2A 1B4SA 2JX2A 3S8SA 1KVJA 1VQYA 1LWFA 1PJ7A 5HN0A 4RUCA 2EEYA 5IT4A 2UUAF 3EX7B 4N56A 3NS5A 5F3TA 4DR7J 4IO9Q 1TUWA 2ZZNA 4DPTA 1G7CB 4A8XA 1MMLA 1RHRB 3M4XA 3KK2B 5E3RA 2GS8A 1SXLA 3GV7B 5A8WB 1IKWA 4IOBA 2OPQA 3TZZA 4R8UA 1TL7B 5I3QA 4LF9J 1RAJA 4NLYA 4NOHA 1XNQJ 2BE7D 4I6AA 5GAHI 4ZVUB 4B9LA 3A8KA 4NCAA 1B7YB 3HKWA 5IC6B 1D1UA 2M88A 2ZH9A 4ECYA 4RU9A 4USWA 3PIPQ 1QAYA 4CT9A 3LP1A 3RW7A 1REGX 4GVLA 3N0VA 1M5KC 1CBKA 1SJ1A 1S1VA 3BYRA 4QR1A 3U02A 1S1UA 2I5JA 1MNEA 2C2OB 2RIJA 2XHCA 1XMQJ 2JEJA 2DH8A 2MGZA 1ZM4A 3KJVB 1J5EF 1FD8A 1FDBA 5F0WA 3ZZYA 2R7QA 2Z2ZA 1W7WA 2EC2A 2QA4G 2VFRA 1T03A 2RD5C 1HBMA 3J81U 4P2XA 4DR6F 4TY9A 2QL5B 1WKLA 3GP9A 3HSZA 2DGWA 1YZ6A 3DOMA 3ISNC 3FBEA 1VC6A 3C16A 3QJPA 5KG1A 3P4UB 4AE5A 2AGPA 2R7UA 4WFYA 1JKHB 1H73A 1FWLA 4ITSA 4LSNB 2EPIA 3LH2S 1PAEX 2HEKA 3OXGA 4I6WA 1RK8A 1OJ4A 3V4IA 4IH6A 4WPAA 3WIUA 3MUTP 2CDRB 3JAMY 2OAUA 3H5XA 2JDJA 3KG0A 2BJ8A 5C24B 2F1FA 5C25A 2YX1A 1RHUB 3ULHA 1N54B 3QGHA 3V6DB 5D0HA 4X4NA 2K7JA 1NSKL 3MEEB 1VGYA 3ZZRA 4DZDA 3MEGB 2QFIA 3C2PA 3FEXB 5G4DA 1QSLA 5BYRA 2RUSA 3IA0A 4BCAA 3QIPA 1WC4A 2AMCB 3FZ2A 4H54A 3HHLD 1AFIA 2RVJA 4MAKA 3RRKA 3ZTRA 2IM3A 2UUTA 3M8QA 4GVBB 4QQBA 3TAMA 1BY9A 3CW2C 3OL9A 1WNEA 3DLEB 1U0HB 3TX8A 1Y11A 2ATCB 2A10A 2W1BA 5IXUA 4I68A 2WBRA 2H51B 3DRXA 2E5IA 2PC6A 1VQ4S 3PYDA 4RW6B 1WG5A 1QDUB 4PEOA 3CD6S 2BANA 5A8RB 1N33J 4YB5A 3KLIB 2IVYA 2QX0A 4NZ7A 4DI6A 3I9V9 2J0XA 5F8IA 3NGTA 2BEFA 1R7IA 4X64J 2HKEA 4USMA 2ZKUA 2M9KA 3OW2R 2VBWA 5AJ3F 1VHFA 2W4DA 4LIWA 5HLFB 2HS3A 1M0SA 2A2CA 2YKMB 3SQGB 3DDIA 2N4DA 5LMUJ 3HT0A 4A8MP 1K44A 2HFVA 2LQ8A 5B08A 4USJC 4YFUA 3M9NB 3VQTA 3G4SS 4F4ZA 3FK4A 3PJWA 3D67A 4XDCA 3NBPA 1P6TA 3WX8A 4YDDB 4B3MF 2DNGA 3NG8A 4DV4F 2RKIB 3KMSA 4ECWA 2FJXA 3UVJB 5IT0A 3OTDA 3O5TB 3O1LA 3DOLB 4CO1A 8AT1B 4TY8A 3FCVA 1X4AA 1FKOB 2GVZA 4QPTA 3CJ4A 3MZIA 3AA9A 4B9SA 2BOPA 1S1XA 2KL8A 4RW8A 4M5IA 1VRTA 1JLCA 3PKMA 1VBKA 4P75A 2YKAA 4ZVOB 5EHHA 1U1RA 2AYBA 4CCHA 4ZK7M 4X2BA 2ZH1A 1ZH5A 3HVTA 1JQGA 1N5TA 4A8SA 2XNQA 3EDQB 3P49B 1FKAF 3MMAA 4N7TA 1G3OA 1PG5B 1GX6A 2RS8A 4O4GB 1HWUA 3BO2A 3PHTA 1KR4A 3QT7A 1LW0A 2A3JA 2M7SA 2RRAA 3FBFA 1KDNA 1HQUB 1FEHA 3RYLA 4LF6F 3BSAA 3KLHB 4QIFA 1NK4A 3NMRA 2QA4S 5J2QA 3T19A 1S1TB 2EI5A 4UUXA 1DURA 4MTPA 4LFCF 1XERA 2JEFA 3OTEA 4AD6A 4CI0B 1QSSA 4O44B 3W9IA 2W7PA 2R8KA 5G0RA 3CCSS 3PW2A 3EGNA 1KOHA 2MSSA 2QG9B 3RW6A 4PUOB 1WF2A 3U7JA 3VCDA 5RUBA 1BHNA 3KKFA 1T9WA 1HWJA 3VAFA 2OJ3A 3G96A 1WD6A 5E33A 3KLIA 2KT5A 2DNHA 3TZXA 2BBEA 4OHXA 4ZIWA 3WDOA 1HNWJ 4Y28C 2JEIA 4ES2A 4YR2A 1MSWD 1FJGF 1OPIA 3DLGA 1XBWA 1RT6A 3BREA 3PEJA 4DV2J 2WK4A 3ONQA 1LWCA 1RAFB 4Q2LA 2V50A 4ES3A 4OJ3A 5LMNF 3ET6B 2ZDPA 3HVRA 3H20A 3R6LB 5IWAJ 4F36A 2V4RA 4J9LA 4DV2F 5F8HA 4PRFA 4Y2CA 1N34J 1YRXA 1RT2A 4X4TA 3THPA 4EZ9A 4LF8J 3BGUA 2HAIA 3KTQA 3EVOA 2XTJP 1XMOF 3ZZ0A 4BC7A 5ITHA 3QT5A 5HP1A 1LWXA 4HI2A 2DB1A 1Q1KA 5D4PA 1RLCL 1Z2ZA 2J7UA 2PN6A 2H5JB 4A8OA 1D9DA 2V8DA 2XLIA 2MJUA 1NLKL 4WWSA 3R5GA 3SMZA 5CZXA 4JV5F 4ANCA 1J5EJ 1PIEA 1TK8A 1C1CB 1JLFA 2DKOB 2YNGA 2XCAA 3KK3B 5K14A 3M7VA 3J7A1 4ETXA 3CCES 3MUMP 3UCUP 5HMXA 4QR2A 4YHHF 5EUHA 1DFDA 1UAWA 1ZPWX 2WZ1A 4MMOA 3JSMB 4DX7A 4ZCIA 3W7BA 1S97A 2DNPA 3VWSA 4I2PB 1Q8BA 3NWGA 2PFFB 3FCHA 1OWXA 5D8HB 4OJ1A 1CULA 2XLJA 2UVWA 3U27A 2QTWA 2YWWA 1HI0P 1RT3A 2ADCA 2SXLA 2MDAA 3TZYA 2CWKA 1TAUA 2VD3A 2JFKA 2QMWA 1R8BA 3DXSX 2HBRB 2A2DA 1U6FA 1HW8A 5AE1A 5LXYA 1WUUA 3DRRA 4IG3A 5C25B 1RWWB 2VC1A 1MU2A 5L9XA 3OD2A 5MAOA 4B3OB 1FK9B 1NRKA 2JZ5A 1RLDA 4ZPWR 1VQPS 1WHYA 4LSLA 5BXIA 4JI3F 4DUZF 3R1LA 2HZVA 3MMJA 2BUNA 2ZH5A 3E51A 2Y1IA 2F9DA 4Y34A 4NA1A 5EX0A 2BRLA 2ZJQQ 1HL6A 3GFXA 1TL7A 3HHNB 1G4CA 2HFZA 2IYIA 3M8RA 3IRXB 2W7AA 2W7OA 2DNZA 1B3TA 1HNVA 1UWBA 3QAUA 1IJFB 3GU0A 2FLOA 4K4VA 2HHQA 2DY1A 5CYMA 4L3NA 4JUZA 4OYOA 3UI3A 2GX8A 2RF2A 1SC3B 4DL3A 1UW9A 2VOPA 3LP2B 3MM5B 3SCLE 3W63A 4ICLB 2KVIA 4DCJB 2LXFA 2ADBA 3MPYA 4RJVA 2V2QA 1Q82T 4ZLPA 3CWJA 2HG4A 2EWHA 3A1YG 3NY0A 3N01A 1UEVA 3Q0AA 1S77D 3CUNA 1TKXA 2HFSA 3T6JA 2BKNA 2WSFC 3ILOA 4Y00A 5FLXY 5E7OB 3DXBA 3J7YI 2FLLA 3N6MA 5E41A 5DQGA 4ZS6A 4RUAA 2B7BB 5KFUA 1R8AA 1N48A 3KK2A 2CNKB 1P9QC 3DLKA 2FYXA 4Y3CA 1S12A 2GJFA 1CQMA 2GO8A 3BV8A 4CIOA 4DQSA 4XAKA 5E0OA 3F56A 4EWTA 3ADAC 1KRPA 3KK1A 2RUGA 2HQDA 4TQRA 4F4WA 1MG7A 3SIPB 3HXMA 1YGYA 1F1BB 3B6BA 3CJ5A 3EDRB 6AT1B 1HHQA 1Q7LB 5DJBA 2PMHA 2UU9F 2BR0A 3FQLA 5F8NA 3BPSP 2MKCA 1RDRA 4C3KA 1VYAA 2FIUA 1TELA 3I5CA 3W61A 2OEKA 4CLPA 2E9TA 1NU4A 3EVMA 3VF0B 3VVTA 2Q1LA 2DIVA 5C42A 3GMGA 9RUBA 4OHYA 4OYIA 4C98A 2C3UA 2IMWP 2B4OA 1IKVA 4I7FA 2E7VA 4EO8A 3NWRA 1S49A 3BDEA 5CD4A 4NXMF 1DLOA 2E7WA 4U7UK 2YNHB 3LP0A 1UZHA 4ZVSB 5A8WA 2G2OA 1N32J 3VAJA 3RBXA 2EBEA 4W4MA 3GG1A 3DRSA 5J1EB 3ITHA 1HYSB 1WC1A 4RNHA 3TR5A 4D3HA 3H7HB 4OI1A 2OIHA 5KFAA 4U7UD 3GFYA 2GO9A 1IKYA 2HLUA 3HSGA 4DL7A 2HWTA 1FRKA 2DGQA 5ETPA 3HPOA 3OUYA 4WP8A 5L1KA 2CJAA 4U6PA 3VZIA 1UVLA 3K8WA 3W62A 1NHVA 1VRUB 2VG6B 3FSYA 1U6ZA 4CH1A 2QFJA 1HNXJ 2CJQA 2EFGA 3C46A 3VZHA 2C2DA 2LXIA 4DR2F 1DARA 3WBZA 3IWXA 4JI7J 3KLFB 5F9LA 4OX6A 4LT6A 3MURP 3BQ1A 4IYQA 1PILA 2MQPA 3QZ8A 2PA8D 2YX7A 3ET6A 3FKBA 3SQOP 4E2FB 4QWEA 4CT8A 1YBAA 2CVEA 4AYBD 1JKHA 2E1RA 3D0GE 5BR8F 3P5BP 1P27B 2YKMA 4P2FA 1DTTB 4MIAA 4WU3A 3DLKB 1RWOB 2IDEA 2MHNA 5E3PA 4O3QA 2MKIA 4OX9J 5ETLA 3OJUA 3D1QA 2BANB 3G82A 5A8RA 3ZNJ1 2OI2A 4Q2MA 5A6WA 4X4OA 2RKIA 2MQ8A 3EZUA 1N36F 3UD5A 4O0NA 1CS4B 4FYDA 1BMQB 1GXTA 5KFYA 5KFOA 2ZOFA 2DNQA 3THTA 5FD1A 1HNXF 2HNYA 1NB2A 1NDPA 1VC5A 4DU8A 4JI4J 1ROFA 4G65A 3TA1A 3OTOF 1IBMJ 1BC6A 3M32A 2AJ4A 5IS2A 2XB2D 1LK7A 2ZD1A 3AA8A 1FXRA 2R7WA 5F8LA 2B4PA 3L09A 2HBZB 2UVUA 3E2EA 2WONA 1NDLA 2AIRB 2M70A 4UW2A 1XC9A 4OJGA 4UQTA 4LMZA 2JVRA 4ELTA 2DPIA 1X8DA 5D6GA 3D6MB 4XPEA 3TAMB 1NNDA 1RTJB 1B0PA 1NPKA 4NMLA 3MDFA 3CTRA 5D0RA 3RU0A 1TUGB 1X4FA 5FIIA 4N5SA 2DNKA 3OXLA 4LRBA 2YQ1A 2JJ4D 4QCLA 2Q79A 4ILLA 3FCWA 5E2QA 2QSFA 2DITA 1TP7A 4IFVB 1LW2B 2MKHA 2AEMA 1LV5A 2QV6A 2JFDA 4KC5A 4NX9A 3QPIA 1NPPA 3MCOA 3DLHA 1T3NA 4DV3J 5GAHU 1VK3A 1GMWD 1N0UA 4NLQA 3AQPA 4B3OA 1SKRA 3R3TA 1PBAA 2AGOA 1YJRA 5T41A 1XWLA 5HQMA 1RT5A 4KV8B 1B0VA 1ZM3A 3HHKA 1RT2B 3ENWA 2G0IA 2X3DA 2DHSA 1ACMB 4QR0A 3C3LA 3R8YA 1HBOA 1EKRA 1VISA 1R3NA 1S6OA 2NLWA 2XMMA 4LFBF 1E6VB 3J7YU 4QU6A 3DLJA 3HF5A 1Q16B 2DGXA 4PPZA 1R31A 4U7CA 1R8HA 4CM0A 3J7Z5 2E1AA 2XYHB 4OFZA 4JYAJ 2V69A 3NGDA 1S6QB 3CJRA 1NSPA 1IKYB 2FDNA 2FUG9 4IH5A 4TLQA 2VF3A 1RWMB 3SV3A 2DJWA 5HMYA 1NXIA 2BX6A 3JTOA 4G1PA 1U49A 2QYGA 2OPQB 4NA2A 3N28A 2RQ4A 3M05A 3KHGA 2ZUAA 3TZWA 2H9ZA 4LF9F 3FBCA 1TV6B 4OV6A 5A2QU 1FTCA 2G2YA 4Q44A 3BB5A 1VQKS 3N6NA 4DXLA 1XNRF 1X31C 1FFWB 2DNLA 2MKJA 4ED8A 1UL3A 1RQ0A 3KNGA 3OPKA 4GO5X 4TU7A 5L1JA 3LOUA 1N5VA 2WOMB 1SI9A 4P74A 5LSRA 1EP4B 3MFHA 3EE3A 3G2XA 4K50A 3ISZA 4K5SA 4DR1J 3R5JB 2E1CA 2RQCA 1KN6A 4P9SA 1S48A 2KU7A 2PA3A 1AZSB 2CQIA 5FLXU 4DSIA 4H4OA 2CJYB 4TKTA 1S9GB 2CKWA 3SV4A 4B3RJ 4NYZA 2QIFA 3A3OB 4M5NA 1KHVA 2BKOA 3GYXB 1Q8KA 3EJMA 3PRBA 3C19A 3GV5B 2FHMA 3OVBA 2ATLA 2HNYB 2RHQB 2E1MC 2XMWA 2YNHA 1DHMA 2DHAA 2KXNB 1SQFA 2W4CA 2V8GA 2ZOGA 3PVXA 4WXWA 2E9RX 3GYGA 1VBYA 3BH6B 2HRYA 3GFZA 4Q7AA 5A76A 1S9FA 2AT1B 4Q5VA 3EUNA 2MB0B 3Q2SC 2ZJRQ 3NNCA 3TUJC 1RI7A 5D4OA 3PDNA 4DFPA 2B5JB 4DLEA 3ENVA 1RTIB 2PI4A 1Q0NA 4FN5A 2LEBA 2QLWA 1IKXB 3DM2A 3PY8A 4X84A 4FKYA 1JNRB 4IRDA 1VQ5S 2DR8A 1GT8A 1H7WA 2GJ2A 1FKPB 1VDHA 5K20B 2VPXB 3CCQS 4CLKA 3SDEB 3IS9A 4KKOB 3DNCA 3BPDA 3BQ0A 1DY3A 3KUGA 2UVRA 4F3MA 2KHCA 2V63A 2FD2A 1M1KT 1DJ0A 1RT5B 1NH7A 3LP2A 3G86A 4JV2A 2IRXA 1CEZA 1HNZJ 2IBKA 4RW4A 3TQ1A 3KDNA 4DV7J 1FNOA 4C7QA 4J9UE 3EGWB 5DETA 4F4YA 2QEXS 2KM8B 1S9EB 1SCJB 2XSJA 4PYAA 1Q5VA 3W5YA 2YH0A 1KQSR 1BWVA 1CJTB 5K8NA 1VFJA 1T02A 1HI8A 1TL1A 3MCMA 4NLSA 3W9HA 1NK9A 2ROPA 4BLGA 2DNNA 1A9NB 3CC7S 4JI8J 5CYMB 3W8PA 1HNIA 3HJVA 5J2NA 2COLA 4DPUA 1N6QA 5E5NA 1BD6A 2XCPA 1VBXA 1B7FA 3KLVA 3IP0A 2CQ4A 3KLEA 2HURA 3V81B 1XR7A 2EFOA 2ROGA 4YS2A 1APSA 5D0GA 4IG3B 3FRYA 2GQ2A 1QAJA 4YY3F 2CG8A 4UOGA 4X4QA 3LPYA 2BACA 1N8RT 3PO4A 3PW5A 4Q0BB 4RBTA 3HFZB 2J7WA 3GFHA 2DR7A 3VGSA 1CJKB 7AT1B 4KYZA 4P7TA 2BJDA 4J9MA 3PYFA 2XMAA 1L3UA 4ZITA 1YJTA 3KK3A 1ITPA 3QATA 2UXCJ 4KR0B 1FE0A 4C11A 1ICEB 3H4BA 2EG2A 2B4UA 2NUHA 4KHRA 1JJ4A 2MMYA 2PIIA 3HHDA 4FKXA 4DMZA 1I94J 1TL4A 2CQ3A 2M3DA 4BWJA 2QYCA 2IJFA 4PG5A 1RKJA 3DMJA 3LAMA 3K2YA 4CYUA 1SH2A 3AJ1A 1U2FA 2W2QP 4K7QA 4P72A 1F6TA 1RCOB 1UPPA 2FTRA 4USVA 3QGGA 5CA5A 3K5LA 1IBLF 4B3SJ 2HHVA 3IBCB 5DLGA 1RADB 4J9RA 3O2IA 2H48B 4P6QA 2B8PA 1QUPA 1MMNA 3GCXP 3TJAA 5H9EK 2P9EA 1HD0A 2ZITA 4CTAB 1LWCB 1Y3KA 1KVIA 1U1PA 2DCUB 1U1OA 1JJ2R 3I4HX 4O4RA 4F4AA 2EKNA 1HNVB 2L9DA 4HHJA 4LFBJ 3KLGB 1T9TA 2XMTA 4WK1A 2A0FB 1CC8A 1SIZA 1FRIA 1LFWA 1OYDA 3DKDA 4EI2A 2B8QA 2IFXA 5B0BA 5HBMB 4KH0B 4TYBA 4UQGA 3OL8A 3OSPA 3O44A 1KFSA 2LQ9A 3MECA 5I3UA 3POTA 5AXKA 3BN7A 3UW1A 3WX4A 1ZTWA 2HHPA 5HP1B 3IS9B 1GMWA 4ELUA 2FVQA 2X1AA 3T1YJ 4MIWA 3EGZA 2CJBA 3H90A 3UVJA 5KFPA 1WKKA 1S6QA 3LQVA 4LRAA 4URGA 1RHQB 1S0NA 5B0DA 1U1QA 3MAQA 4ZP8A 1JJCB 3L7OA 3K57A 1WHXA 2WVCA 5A6PA 4FF3A 3V81A 2HQGA 5AT1B 5J1NA 1YZ7A 2MQQA 2IRUA 1FESA 4EGLA 1Q79A 1CVJA 1IBKJ 4MIBA 3E8OA 3RR8A 3NL0A 4PAAA 2WVBA 2HQ3A 4URSA 2LDIA 4DR5J 4ZCKA 4FF1A 3EXCX 2IC3A 3MM8B 4FVMA 4ECRA 1KSPA 2Q66A 2VPYB 1NK7A 4NCGA 4N47A 5HANA 2JC1A 3CMES 3VR1A 1TMJA 2DHGA 4KFBA 2NZCA 1IM4A 1RBOB 2HGNA 2ZVSA 5U47A 3ZTOA 4F0HA 1F2HA 2CPZA 4FYXB 2HFOA 1EIYB 3J7AN 5K14B 1NDKA 4YB7A 3RBEA 1ULRA 2R3VA 2J8AA 2R4FA 3LTOA 3QNWB 3HO1A 3OTCA 4JI0J 5DS7A 1UVNA 1XNQF 1DAXA 1PBUA 5ETNA 3CCLS 4EMDA 3NRBA 4DV7F 2MEWA 4L6V3 4PKDB 4KHMA 3QSYB 1FXLA 2VBXA 4FYWB 1FDNA 4KQZA 1DZ5A 4X4SA 1R89A 3OXFA 5ETRA 4WFXA 2CUYA 1YI2S 1VLYA 2IMOA 1DQAA 4JOUA 3OLAA 1GX5A 2MZQA 2XZWA 2OD6A 4CH0S 4C11B 1K0TA 1I6JA 1KQFB 4C8KA 2DT9A 4ZVFA 4TN2A 4DL6A 1RE1B 2DRAA 4JV5J 1Q53A 4LF2A 2BKPA 2RDDA 2CNNB 3UN2A 2PMZD 1ZZFA 3DDNA 4B9UA 4IH7A 4TYAA 3GILA 1U7LA 3P45B 2FLNA 5L1IA 4C2MA 4GC7A 1KNZA 3MXHP 3N6LA 1RAAB 3MEDB 1TL3A 2V2ZA 2XC9A 1RU2A 3H4DA 2E5GA 3CO9A 3BBFA 2F8HA 3BN4A 1XMQF 4MJKA 1GH8A 3E3XA 4WTOB 2FVRA 4OLOA 4DV0F 2PI5A 2E5LJ 1MN7A 3AH6A 4DS5A 2AGQA 1Z1ZA 2DNRA 4DV0J 3TVKA 4C8YA 4ICLA 2YNIB 3F0NA 1EX8A 1E6YB 4NEZA 2RF2B 4CNYA 1RT1A 1RCXB 1AZSA 4NRTA 2H5IB 2GNKA 5F3ZA 2HNZB 4A48A 4AL6A 2VG7A 3QRPA 5CQGA 5KAKA 1M90T 2E66A 4RX6A 4DWIA 1FX2A 4LBIA 3TX0A 3PW7A 4C48A 2HQFA 2DNMA 1NUEA 1P8GA 2MZTA 1LWEB 1RHJB 1MLAA 2W2MP 2WSCC 3C15B 2NCKL 1K0VA 1XR6A 1JMTA 3OJSA 3W66A 1N56A 2HHHF 3QO9B 2HK3A 4HACB 3HHEA 1B0TA 4DG1A 2K1RA 3HZGA 4ZJLA 4DDFA 4DSEA 3A4TA 3FZBA 3KYLA 3I82A 3K17A 4AUKA 3JQMA 5SUHA 3BJYA 2NPIA 3MTJA 3M2UB 2BE2A 2R2TA 1SH0A 4OI2A 4ED4A 4A8YA 4HL9A 2BM0A 1KTQA 5IV4A 1X9SA 1P9YA 2ALZA 3H2VE 3R5DA 3D4JA 1WJ9A 4P52A 4DSFA 3DOMB 3KJFB 1IM6A 2UUWA 3DLBA 1SIWB 2CPJA 2B3TB 2VIHA 3DYAA 3KNAA 4WP3A 4Y2MA 4LSNA 1FNMA 1ZA1B 3U1NA 2FJDB 2E1PA 4K0KF 1KQKA 1F5BA 1NEEA 2XMUA 5F8MA 4DHVA 4FZVA 4IDKA 1U1MA 2BXJA 4N8OA 4M5HA 2MKKA 2QL7B 4QWDA 2UUCF 3TI0A 4B3TJ 1N5YA 2E9ZA 2KFZA 2GHWA 5J2PA 3Q83A 1LEOA 3AJDA 3UCZP 1U0SA 2C2EA 1HR0J 2R7RA 1AYEA 1NKBA 2DNYA 4LIRA 1YSJA 4FPRA 1RWXB 3M6VA 4CM2A 5HK4A 3ZTQA 1Y3JA 4DUTA 3OVAA 2I2YA 2XS7A 2HW3A 1VRUA 4HYKA 4ENOA 2MLYA 1CG2A 4M5DA 1W2IA 3A13A 1WF1A 1M5HA 1T9UA 2EVZA 4MK7A 4B3MJ 4UUWA 1S9EA 1C0TB 2XSJB 3W2VA 3FEYB 1IN0A 2VL1A 3IC1A 4XIUA 3L4BC 1KLNA 4IFYB 5DZ7A 1NSAA 2XYPB 2DGOA 3M2VB 3KUEA 3NOCA 1SJRA 3K8VA 1JWWA 3R5AA 1T05A 2L9WA 3LPEA 1M5PC 2WTFA 1N6QB 1VRQC 1QVFR 3VAGA 1SH3A 2HNZA 2ZNYA 2DEIA 1RZMA 3LGMA 3ZZUA 1SKSA 4H4MA 3V6JA 1P1TA 2F65A 1GEHA 1JLBA 1YX2A 2CFXA 2RRBA 1U2RA 3C15A 4U8YA 5DM6Q 2NXEA 1RTHA 4GO7X 1QE1B 2JLEA 3V4MA 2JLGA 2R9LA 4KB7A 2M8DB 2LQBA 1DRZA 4HEA9 4B3RF 2L9NA 1KEKA 4X62J 5HVGA 3ILLA 4RW8B 5JJBA 3LGNA 1IR2A 2HFUA 4JI6F 3W64A 1D09B 3I0SB 2YNIA 1Q78A 2FHKA 4DR1F 6FDRA 1NPRA 4OZNA 3RR7A 2YQ3A 1SL0A 2HZCA 4U8VA 3ZZZA 3MHYA 1RAIB 4JV0A 4TQSA 2QZ8A 2CQ0A 1F9EB 1TKZB 1FJEB 4X4UA 4O23A 4LR7A 3PO5A 1KFDA 1X0PA 2E44A 3NBPB 2AX0A 1R27B 2XYGB 5CH7B 5K8PA 4G6VB 4P73A 1JLQB 3OFEA 1WC5A 3CE8A 1S0MA 3DOLA 4OIXA 1X4EA 5EWFA 3VGTA 2K2PA 1U24A 4OMFG 4PG4A 1YJUA 1YJWS 2ABYA 4OX9F 1NHUA 4OHVA 4X66F 4H4KA 5H9EJ 4JI6J 5BR8J 4MKYA 4QPXA 1Q81T 3E01A 1CJVB 4BHQA 1X4DA 2GC8A 2HLTA 2JNJA 2Y1JA 1XR5A 4GKJJ 1T94A 4ECQA 1V5IB 2PO4A 1K73T 3ILIA 5BYQA 1S0VA 4QYRA 2IA6A 1GXLA 2WW4A 3JSMA 4KV8A 2R7XA 3F41A 4NXMJ 4NE9C 4IFVA 4PQAA 2YKNB 3MM9B 3RB4A 1H0HB 2ZH8A 4X4VA 4DR6J 1I51B 1GXUA 1X5PA 2M2BA 3Q89A 4UF4A 4RWWA 2AU0A 5LMNJ 1IQTA 4NLPA 1ZA2B 3QRQA 4MK8A 3MUVP 2HVHA 1LXJA 2LMIA 3D68A 1VK8A 5H9FK 2BZ2A 4JV1A 4WZQA 1RAGB 1Z2LA 2U1AA 2BM1A 2YNFA 3SSQA 3CMAS 2P6TA 4ED1A 4OZ1A 4GKKF 5AXNA 3MM6A 2CPYA 4I69A 1FKPA 4Q45A 3GR1A 4FF2A 1C4CA 3CJ8A 3H5SA 4NI2B 5AXLA 5T7LA 2N3OA 1R0AB 4OI0A 1TL5A 1BWEA 4UY85 5GADI 5KFHA 1VR6A 2GA7A 1SL1A 2MJNA 4IFYA 3KG4A 1HR0F 5THWA 1ZM2A 1RT6B 3OFFA 2EBGA 4Z2XA 3GIIA 4PYDA 3SBMA 3JYTA 1LNQA 3MPUB 4DX8H 1ZETA 3QYYA 1NJZA 2FLPA 4XDDA 1WWHA 3MCNA 2BQ3A 3QT8A 5I3PA 1QJHA 3CIMA 3T6BA 2HSEB 1RT7A 4B08A 5IM0A 3CF5Q 2Q3PA 1T7PA 2EXUA 2KM8C 1JX4A 3C6UA 4CO3A 4B9VA 4YDXA 1U2CA 1V5VA 2AZ1A 4R5PA 4C0OC 4M5LA 2HHTA 3A3PB 3IG1B 4NWBA 3KDOA 3RB3A 1V3RA 4EBDA 4Y2IA 2WW8A 1D3WA 2V68A 2YKPA 1IBCB 2KJVA 2KO1A 2V8PA 3PNIA 4FXVA 5DLFA 3L3CA 4F2SA 4CLZA 1MWYA 1Y7PA 2QLXA 3I56S 1CLFA 1K1QA 1WC3A 4OQJA 4NLRA 4ZVHA 4DBQA 4PWDA 3D7SB 3N5BA 5K9FA 1RGVA 3GG0A 1NMEB 4DPWA 3PZPA 5L8RC 1WOOA 4O4GA 2R2UA 3TEGA 3QIDA 2HK2A 3ZTSA 4F67A 4O0IA 5GADU 1L3VA 4G1QA 1J5OB 5DG8A 1W2BR 3T1HJ 2GMHA 1S99A 4NYOA 2W9BA 1XN9A 2XWXA 1FRXA 3AB4B 3BSNA 1TK0A 1W25A 1Y5IB 2KG0A 2ZNZA 4Y6IA 4JI1F 1VQ6S 3FSIA 1MN9A 1VI7A 4RKUC 5GMEA 3DRSB 1WG1A 2MZRA 4KKOA 4NASA 3GZ7A 2F9JA 3CDEA 4LF1A 2HYIB 2MY7A 2JWNA 1J2VA 3TJ8A 2Y1LB 5BYSA 4DUYJ 1ZZNA 2ASLA 1EQ0A 4J9NA 1UFLA 2ZH3A 4QIVA 1IKVB 4I7FB 2B6AA 4CRJA 3FC9A 3TYTA 3FMBA 1U8WA 3SQGA 1XNRJ 3D3CJ 5IZHA 2BJEA 5DG7A 3PJ9A 4ETZA 3B78A 1KBRA 2J9DA 1U25A 3LO3A 3Q8SB 4DL5A 1TKDA 2DTJA 3O6QA 1T11A 3M8PA 3BGRB 5I42B 5LSOA 2KI2A 2B5JA 1WC0A 1SV5A 1N0VC 4JI5J 4PQUB 1VQ8S 1SC4B 3H2UB 3OHAA 2Y3YA 4P71A 4RNOA 1SL2A 1SJ4P 1NBEB 5J2NB 3R7NB 2AJFE 2FY8A 2RDIA 3CGIA 4Y2AA 4QWBA 3GV8B 4RW6A 2KB2A 4DR3J 4M5KA 3ZTPA 1HBUB 2L08A 5KT5A 4OHWA 1PGZA 2R7TA 4R8UB 2OPRB 2JHEA 1UVKA 1SJ3P 2CZ4A 2GCFA 2VPZB 3BEGB 5D4NA 1TV6A 1EJ7L 1SKUB 3DHXA 5K5MA 3PR4A 1B99A 1UTAA 2ZBRA 4YQWA 2JOQA 1N52B 5GAGU 1S1XB 1BQNB 3HFVA 5F8GA 2F3JA 2V0NA 2XMJA 4RBUA 4FDFA 1HQEB 5FJ4A 4RNMA 4EBCA 4OX7A 5HMWA 1REVA 5HO4A 5KFRA 3QLHB 3MTKA 4OV1A 3OVSA 2MQLA 1SPBP 3GPAA 2OMOA 5HMZA 4DR5F 2R8IA 2VG7B 3D66A 5J2MB 2ZHOA 3HD2A 5KFXA 4OLPA 5KT6A 3QZ7A 2CQBA 3F44A 4ED6A 2R42A 2IM2A 3FQKA 3NCQA 4WE1A 3PCOB 2HMIA 2IIHA 3OL7A 3UR0A 3KJQB 1QAIA 1EB0A 4GKJF 1UKUA 3D54A 2BOAA 2KRBA 2C3PA 2RU9A 3IMQJ 5ETTA 4JI8F 4F3QA 1XTZA 3ILJA 3FUYA 8ATCB 1BLUA 1KQGB 2H3EB 1RISA 1F3VA 2V6AA 4X66J 5H1SV 3H40A 3SYZA 3R5BA 3QMQA 5C42B 3NGSA 3G6ES 3TP2A 4B17A 1TFWA 2DPJA 3K5OA 4ERDA 1U8SA 2YKQA 3NP5A 1JLAB 1RTZA 3QJJA 3DM2B 1RAHB 4JI2F 2MHEA 3A12A 2G0CA 4FXDA 3EGVA 1HBOB 1T9YA 3CC4S 3I4PA 3EXYA 2G1HA 1DQ8A 3N79A 1FJCA 1JLEA 4IG0B 3CO0P 1CJUB 1X5TA 2ZWPA 3R1HA 3NLCA 2ZHBA 1N36J 2UXDF 2RE1A 3OTBA 2F8EX 5B0AA 1SJQA 3M8QB 3HZEA 4ILRA 3B8HA 4OYBA 3VHQA 4J5OA 3X3UA 4EK2A 2C2ZB 4W90B 1FT8A 3M8SA 4HHUA 1L3KA 5KFVA 4WXOA 2YNFB 1EAYC 5F0UA 2L41A 1FE4A 1SJFA 2EKYA 1QTMA 3GE9A 4NLDA 1S76D 3NKYA 3EMTA 3QWPA 2VDHA 4NL5A 1R6VA 3D2WA 4KSEB 2CXEA 1KC8T 2DH7A 4ZP7A 4F02A 1UWAA 2WB1D 4RPFA 1VQOS 4RO0A 5MLCV 3TVZA 2W2NP 1LWFB 1ZTTA 1A6LA 1NZ8A 4HVZA 4NXNF 1T9VA 3OR2B 2CPHA 4DJBA 1EP4A 4PQUA 3M2RB 2POKA 4TVAB 2WONB 2CWXA 2HQCA 2LDYA 1E6YA 4IDKB 3FVYA 3PEHA 2Z2MA 3MD1A 1X4HA 2K8GA 3N5FA 5GAEI 2VPWB 2XSFA 4F04B 2AYEA 4BC9A 5EN1A 2FVSA 3K7RA 3V6HA 2HIQA 4ZPVR 5KFCA 3V6DA 1CC7A 2X3GA 1N33F 1NDCA 4Z7YA 1UCNA 2V94A 3UR3C 2MQNA 4DCPB 2IA0A 1NJWA 3RG6A 1L3TA 1AUSL 1UEUA 4I0WA 5LMUF 2KYZA 2PFDA 4HT5A 2KKHA 1TQLA 5D3GA 2U2FA 1RA7A 2DH9A 1FHTA 4LF4J 1R43A 1YQHA 2C3OA 3V4IB 4WFZA 5D4LA 2HBQB 3VQSA 1V6HA 3G87A 1GMVA 3EVWA 3M30A 4ZPTR 3TWZA 3CJ3A 1XMBA 1IVZA 1S57A 2V9WA 5DQIA 5J2MA 1GK8A 3BSCA 2L48A 2V8HA 3MM7B 1YITS 1YJNS 3J80U 2RQMA 7FDRA 2NPFA 3HMJG 4LF7F 2CPXA 2NSBA 2CA9A 2PGCA 2H5EA 3J80Y 1AW0A 2GGPA 5LL6d 3SCJE 3ISND 1FWKA 1H6KX 4CLWA 2KH9A 4USIA 4QW8A 2AX1A 4DF8A 2V34A 4WYWA 4H4MB 5AE2A 1G2EA 4QU7A 1FCAA 1I3OB 1XEZA 3SDEA 3D6FB 1RAEB 1OQ6A 3KWMA 2DRDA 3UNGC 3P6YC 3LWLA 2CQDA 5KG0A 1UWBB 4LJMA 2GIQA 2HVEA 3WQPA 1O8BA 4OI6A 4LFCJ 4AL7A 5KFTA 2QN6B 2Z4PA 3P5TL 3M2VA 3VAIA 3W3SA 3SEOA 2DIUA 3ZFVA 1HBUA 1RUSA 1UZDA 3AD9C 2GAHC 3AHPA 4LF6J 2WHOA 3CPWR 2M4MA 1TK5A 2VQEF 1S10A 3NGRA 2CJXB 5LJ3Y 5DM7Q 3UDCA 2XZTB 2FJAB 2V5HG 1JLEB 2DCLA 3CSKA 2V2KA 3GCWP 4MKAA 3SSRA 4OL8A 2FHOB 3MGJA 1N34F 1VHIA 4NLUA 3GTYX 2VONA 2W9AA 3HKZD 3NGKA 3QRRA 1PJ5A 3G71S 4WU2A 1PC4A 3DU5A 4K4ZA 1C1BB 4J9SA 2F4VF 2XQCA 3ZC4A 2XULA 2OGUA 4LQ9A 1S9GA 7FD1A 1NAQA 2D7SA 4LREA 3KHLA 3CT9A 2VQEJ 3IWNC 1TL3B 1IR1A 4FP9A 4L75A 5ETMA 5LM7E 2VODA 1PSDA 2OPPA 2DEJA 2HVZA 2ZUGA 2I0XA 5DG9A 3DN9A 2HAFA 5D0EA 4ZVQB 4CO0A 3MR6A 4OZ2A 2WVDA 3TUIC 4DCOB 1HBNB 4DL4A 4UZBA 3R2CJ 3T9ZA 3HT3A 1S7IA 2JSXA 2BV3A 4YMEA 1QM9A 2C1EB 2VFUA 3PG9A 2FZCB 3CJ2A 5DQHA 2G0JA 4EU0A 2BE2B 2NYIA 1CQNA 5ADZA 3I87A 3PRDA 2AD9A 4X64F 1R6YA 3DGPA 2HZAA 2Q6CA 1WF0A 3NGUA 4O44A 2IM1A 4G1QB 1J5OA 1EARA 1NZAA 4OI3A 4RUHA 1YLXA 3NAIA 3I0RA 4FXWA 1UJ4A 2W4PA 3H8YA 3MEGA 2AF6A 5GVQA 3Q8RB 3AB2B 4ILMA 1N4LA 2YTCA 3CJTA 3UDVA 1VC0A 3MF5A 3OR1A 1YDLA 2Z57B 3MD3A 3DRRB 3FGVA 3FFIA 3IR7B 3UN5A 3M6XA 3GQCA 3VTIA 2MKYA 4C0HA 2P8IA 2ZE2A 2YPZA 2D3O1 2QLJB 1VQSA 1Q86T 3L9ZA 3W9JA 1YBUA 3MM7A 1JLGB 5IOLA 2XO6A 4OZ0A 3NNHA 3HCXA 4DL2A 1SUQB 3IBFB 4QOTA 3TRGA 1IKXA 2KT3A 4W98A 5ETVA 4DEZA 2JEGA 3MWBA 4WKRA 1RT7B 2J8SA 2FQQB 1H38A 4CLUA 2FJBB 3A8IA 2MXYA 1M5OC 3A3NB 4J9PA 1MROA 4DS4A 6FD1A 1ZOTA 2DGSA 3HHLA 2KFYA 2FJEB 3ICLA 2OTLS 2DNOA 4LFAF 1S59A 3DRPB 4MK9A 3U1LA 2RS2A 2V4QA 1KTVA 3AXKA 5CCLA 4LFAJ 5KFLA 1C4AA 5KG7A 5FDLA 1O51A 5DDQC 3N9UC 2KJWA 4DV6F 1FTRA 3ETOA 3PACA 5DZ6A 5DDRC 2QA1A 4ZPDA 3OL6A 3H5YA 1T3OA 2BJ9A 2JL9A 2I1RA 3T1HF 4RU2A 1TVRB 1NJXA 2DR5A 1TKXB 3G9CA 1TL1B 1HKAA 1C2PA 4NLVA 4Y2KA 2RNEA 4NLGA 3B82A 4KJIA 3HVAA 2D3UA 3TW0A 3KXDA 1Q95G 4LUBA 1ZAVA 2DBBA 2LKZA 4M5JA 3S6EA 4ECUA 1WDDA 5IQ6A 1LW2A 2HQIA 1IQZA 1MMDA 3HLUA 4OJHA 4A8KA 1JLCB 3MPDA 3D1HA 1VQ7S 4N41A 1HHTP 2Q6BA 3EZ5A 1JLFB 2N82B 2UU9J 4E98A 1IKWB 1Q8IA 4KTQA 3AQOA 3CJ0A 1D8ZA 1T0TV 2KXHA 2C3YA 2AJ1A 3VGUA 2IRYA 5J2PB 3AOCA 1MWQA 2R8HA 3K0JA 1HFEL 4CLTA 4Q0BA 1RWKB 4A8FA 2PEBA 1H2VZ 2QLFB 3OBIA 1RWPB 4HH1A 2VFTA 2ZWOA 4J91A 3EICA 4F50A 4BS2A 2J6SA 4A8QA 4P7VA 1I5OB 5GMKa 4DR3F 4B3SF 1CJKA 2DGVA 3UCGA 1S4EA 2IM0A 1TTHB 2VFSA 1F9HA 1HA1A 4EEYA 3WC2A 4IR9A 4DPXA 4KPCA 4DV5J 3ZNUA 3L7PA 1MU2B 2W24A 4IRKA 2GHVC 1NJIT 3QT6A 4PR6A 4FYVB 4ANEA 5T14A 4F4KA 1YBTA 4ZP9A 2XY6A 3BKUA 2XHWA 1H3DA 2OELA 4I2PA 1SUQA 2ZKTA 5ETOA 1K8AT 3C14A 1UA1A 1BGXT 1M1GA 5KFNA 2C3MA 1JNZB 3Q2TC 2WCXA 2FHJA 3J81Y 4NZ6A 2ZH4A 2ROEA 3PR5B 4AT1B 3BBCA 4KO0A 2G2ZA 4WJBA 1URNA 5KFBA 2VOOA 4IO1A 3MR5A 3MEDA 2K06A 4ED3A 5J1EA 5ETQA 3WZ0A 2BJ7A 3VAHA 1FFGB 4KPYA 2VH7A 2B9YA 2I8EA 3CCZA 1BQXA 5KT4A 1I1GA 2KT2A 4KGZB 3SCKE 4EFAC 2XG8A 3Q8VA 1S6PA 4L76A 2ZE2B 3BO3A 2UUBJ 2JC0A 3KMQA 3CB4A 4XO0A 4RW7B 4CTAA 2J5AA 1HPZA 2MZJA 1VOMA 4J90A 3BQ2A 2YKNA 2YWHA 1PKUA 3MM9A 4ZOSA 4MFBB 4ZP6A 4CQ1A 3I55S 3TAQA 3BR8A 4YP3A 2IAJA 1SQEA 2E5HA 4LF5F 2MQOA 3CDAA 2OPPB 1U02A 1CJUA 2X1GA 4LRCA 1VQ9S 2P5VA 3BSOA 3T5KA 4USUA 1WC6A 3M1VA 2OPRA 2HHSA 3HHLC 2OPSA 2J9EA 3JTPA 2LP4A 2OFHX 4ID8A 4LVOP 5ETSA 2XM3A 1L3SA 3IN5A 4YB6A 5HQLA 4KFBB 3U1MA 3CXCR 2CAJA 1RU1A 1FD2A 4LF7J 2K3KA 1T9XA 5CAAA 5JUMA 4LQ3A 1KWMA 1G1XA 3KK1B 2VB6A 4NYPA 2DXFA 2M0GB 3NEKA 1OPZA 4MYUA 5IM0B 4DR2J 2UXDJ 3ZZTA 2GHPA 2R2SA 1TVRA 3RBZA 4BDPA 2XI3A 3CNQP 2CQPA 4M5GA 2EFVA 4F8RA 2B9XA 1CPZA 2ZJPQ 1YK9A 3IAM9 2YVSA 2CQHA 3D6HB 2XLKA 3NCRA 1FRHA 2VKRA 1BQMA
chains in the Genus database with same CATH topology
1C0UA 3IAS9 4ZCLA 1WEXA 5B0GA 3MI7X 2HRUA 4CZCA 3PX6A 1U48A 2Y1RI 3MMBB 4IRCA 1Z4UA 4X65F 3MCSA 3KG1A 2LEPA 4JI7F 4QWAA 3M6WA 5EDWA 1RP5A 2X1BA 5KOWA 1MWZA 2W9CB 1X5OA 3MEEA 3BGFA 4NRUA 2KFNA 3TO8A 3H59A 2B7CB 3BZQA 3LP0B 4E0DA 3P96A 2B43A 4M1KA 4M8LA 3KFWX 3V6KA 2E5LF 1U4BA 3UD3P 3M30B 3ITHB 1HYSA 4J9OA 4PXBA 4KIAA 4C8LA 3KOAA 4IOAQ 1X4CA 4HT7A 3BO4A 4PG6A 4HH0A 4QYZJ 1DTQA 2LLZA 1RT1B 3C6TA 2A18A 4RLEA 5A0YB 3T3FA 5EGYA 3I6PA 2HFNA 1HMVB 3CCWA 3LUYA 4H4KC 4R0JA 1HWKA 3G6VA 1JJHA 1V3SA 4A47A 1MW7A 2R8JA 3M9OB 4BWMA 3UPFA 5KFMA 3PX4A 5CYJA 2ASYA 3GWCA 4ZVEA 4C8NA 2I5JB 4KAIA 1S1VB 5JVHQ 2AQ4A 4NLXA 2WSEC 1G6BA 3OR2A 3VAKA 5GAEU 4YB1P 1WTBA 5DO2A 2GIRA 3T5JA 2XMVA 4ID5B 5HROB 2CPIA 2VC0A 1E6VA 2O3DA 4TLRA 4O3RA 1JK9B 4TU9A 1O5JA 3RRGA 2YWKA 1X4BA 3MFIA 2DHXA 4YUDA 4Q8FA 4A8WA 2ZM6F 1T8EA 3CCTA 1C1BA 1FNXH 1RT3B 4F25A 5B09A 3GSDA 2O5DA 1UMJA 2KXFA 2B0GA 3GR0A 4G1IA 4H4OB 3Q23A 1UVMA 4KBIA 4RWXA 2RB7A 2VQFF 2NREA 2QA2A 4PWDB 3TUZC 3H25A 5EWGA 3JSRA 4OHZA 3PV8A 3A8EA 4MKBA 4U67Q 3BDPA 3FSXA 4FBTA 1TFYA 1JLAA 2IBOA 1U6BA 1VIXA 2JH3A 3R5CA 3M32B 4CNZA 3DOKA 3K59A 3CCJS 2R7SA 4V19J 2BQRA 1FRMA 4DFJA 3W2VB 3DI6B 3LANA 1MROB 3RAXA 3BGLA 3PW0A 2VKZG 4O3PA 4O3OA 4DSLA 1S77D 1N5QA 2KG1A 3UD4P 1ZYQA 2I38A 4K4WA 3D5MA 4IUFA 1HNWF 2GW8A 2YWEA 4QW9A 1DBDA 3SXLA 1URRA 2HMIB 2B4VA 1GNKA 2OSQA 3I32A 3W2WB 1D9AA 2JRSA 1WEYA 5KTQA 3NMAA 3OR1B 3K58A 2CJ9A 4WIIA 2BQUA 2XGQA 4LVNP 3LP1B 4RZRA 1EETA 1KLMB 4EYHB 5C5JA 1VIOA 1P1LA 1VQNS 2IYGA 3DFEA 2MGZB 1KOOA 2XI2A 3Q8QB 3AAWB 4ZMMA 1TKZA 2YWGA 2HNDB 3HX9A 4ATNA 5KFWA 3G6YA 2CQGA 5KFEA 3T5HA 2ZC4A 3DLLQ 2MZ1A 2N4CA 5KFFA 2Q43A 3IXQA 2LU1A 2OPSB 1Y9OA 1YJVA 2A1BA 5GAGI 1SKWA 4O3SA 3H2LA 1WHWA 3SFGA 4TY8B 4NLTA 1Y4ZB 4R25A 1HBNA 5AE3A 1HHSA 1CSJA 5IT9Y 1YJ9S 1RKIA 3I31A 3MM5A 4UY8T 1HQEA 1IR0A 4DV3F 3CCMS 1JB0C 5LSLA 3K5MA