1JLMA

I-domain from integrin cr3, mn2+ bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
187
structure length
187
Chain Sequence
DSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two conformations of the integrin A-domain (I-domain): a pathway for activation?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
molecule keywords INTEGRIN
total genus 65
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 1996-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 1jlmA00
4G1MB 3K6SB 3ZDYB 4HQOA 1DGQA 3K71B 3HXQA 1AO3A 1IDOA 1N9ZA 1XDDA 2ICAA 2VDOB 1JEQA 1L5GB 1M2VA 2VC2B 3TCXB 5BV8A 1PCXA 1RRKA 4HQFA 3ZE1B 2VDPB 4A0QA 4C29A 2NVOA 1Q0PA 1SHUX 4JDUA 3FCUB 4M76B 4CN9A 4HQKA 4IGIA 1FE8A 4IXDA 1QC5B 3BQNB 2X5NA 2WW8A 2XWBF 3EG9B 4WFQA 5E6RB 3NIGB 3EFOB 1CK4A 1U8CB 3EGDB 4MMXB 5E6RA 1V7PC 2B2XA 3ZE2B 3HI6A 4UM9D 1JEYB 1YVRA 1NA5A 2NUPA 4G1EB 3EH2A 2ADFA 4O02B 5KYUA 4HQLA 3ZDZB 4PN7A 4F1JA 3GXBA 1JV2B 3EGXA 5KYYA 2I6SA 4WK2B 3ZDXB 5KYYB 1JEQB 4NENA 4Z7QB 5LN1A 1RTKA 5ES4B 3FCSB 3EOAI 1JLMA 4BJ3A 4UM8B 4DMUB 3HXOA 2VDQB 4CN8A 2NUTB 3PPYA 2VDKB 1SHTX 5KYXB 3VI4B 3E2MA 2VDRB 3EGDA 4CNBA 3EFOA 4C2BA 3F78A 1XDGA 5KYWA 2VDMB 3TW0A 3ZQKA 1M2OA 4Z7OB 2QTVA 4WK4B 1QCYA 5KYXA 1IJBA 3EGXB 2XWJI 3EOBI 3F74A 4F1KA 1DZIA 1U0OC 3Q3GE 2XGGA 2NUPB 3IBSA 2I6QA 5HDBB 3NIDB 1PD0A 1MHPA 3V4PB 1M1UA 2O7NA 3RAGA 1LFAA 3VI3B 4MMZB 3T3MB 1AUQA 3TVYA 1CQPA 1RD4A 1AOXA 2M32A 2ODQA 3T3PB 4IHKA 5E6UA 2ODPA 3ZE0B 1T6BY 3EG9A 1N3YA 2I91A 1M2VB 5KYNA 1PD1A 1T0PA 1ZONA 5HGJA 1ZOOA 1U0NA 2WINI 4Z7NB 4WK0B 1TYEB 3PPWA 5KYUB 4XW2A 1IDN1 5E6UB 1MF7A 1OAKA 3NIFB 4C2AA 3PPXA 1BHO1 2IUEA 2NUTA 3PPVA 1MQ8B 4FX5A 3N2NA 5KYWB 1XUOA 4HQNA 3K6SA 4NEHB 5E6SB 5HJ2A 3TXAA 1M10A 2VDNB 1YVPA 1SQ0A 3EH1A 1MQ9A 3M6FA 3V4VB 1ATZA 1MQAA 3K72B 1BHQ1 1PT6A 1RS0A 4NENB 4MMYB 1IJKA 5E6SA 3BQMB 1ZOPA 4WJKB 4UM9B 1FNSA 1QC5A 1UEXC 3QA3E 1MJNA 2VDLB 3BN3A 1M1XB 3IJEB 1JEYA
chains in the Genus database with same CATH superfamily
3Q7RA 4B3IA 1VYHA 1WOMA 1BROA 1W5TA 5D3MA 3H97A 2PMKA 4OVKA 2V8BA 1MEOA 3K3PA 4UE6A 1EFRA 5JNUA 1U8FO 1Y1KE 1W9HA 2Q49A 4HYYA 3EXHC 2PO7A 3PU6A 5T4EA 4RS3A 3RHZA 3KFXA 2R6GA 2BGLA 4BJ5A 5C8YB 1PBTA 4LJ6A 1MRSA 4WAUA 4PGGA 1G21B 5E6RB 4S3MA 3DHEA 1ZSVA 3C3CA 3L4BC 1QQTA 2WHQA 1DJQA 4YO8A 3BL8A 2RGXA 1K8YB 2ZKLA 2D5IA 1KPIA 3IE2A 5IBRA 2C3OA 3G8AA 1YTUA 4XQGA 3VA7A 1VE9A 1LK7A 1ZXBA 2ZJOA 1QV7A 1WPQA 4G6ZA 4IQ0A 4MYHA 2G3YA 3ABSB 2C2KA 4A27A 1E64A 3BRCA 2JAQA 3EIQA 1N5IA 3EGXA 1OHHD 3GFOA 5IF9A 5AHOA 5SYAA 3S3TA 4KYTA 2ZUCA 4UDYX 2FH5B 2GXUA 2FF7A 4MINA 3A4VA 2KB0A 3WSTA 4OQYA 2RHJA 5ILGA 1YR7A 1SEPA 4PZ0A 4PNHA 4URUR 2C3UA 4TS9A 2OKCA 4QXAA 1OXXK 1AURA 3L4SO 2HEGA 3A9SA 1Q0HA 1Q7BA 4Y6OA 3SIXA 3FTEA 1XD9A 4G5OA 4KOEC 2AE1A 4EL5A 2HCJB 4L8FA 1FXWA 1NHWA 5DGDA 1A96A 3D0RA 3RUHA 5AM0A 3ZCQA 3VYSB 4D1YA 4UTVA 3OZXA 2C07A 2A0FA 3OC6A 1KFCB 3I6YA 4ZFNA 3Q6IA 1J2EA 1QO0D 4HGYA 1NMEA 1RHQA 3SXPA 5KOHB 1F2TB 2ZE6A 4LJYA 1KFJB 1PVVA 3IA2A 4GE3A 1GT91 4BECA 2A5LA 1JILA 4BQFA 5GZ6A 3E0XA 4FGUA 4LMRA 2YQ4A 2VDUE 5K20A 5JMWA 3PUKA 5DGIA 2P2ZA 4NOJA 4YJ3A 2V9CA 3T3PB 4R2MA 3HE3A 3H1BA 5CVDA 2IIPA 2L82A 5EIBD 1PX0A 2ZWIA 4D92A 3DWGA 3UHOA 4RLFA 5HA5A 1EP1B 4H31A 3G8CA 1YZLA 5BQXA 1TYBE 3ESZA 2AX4A 2W43A 1ZY2A 3DTVB 4DJEC 5KSPA 4OQMA 2WHRA 1F14A 5F5NA 1THTA 4PHHA 2ZTMA 1PK9A 2HIMA 1O6ZA 3LIIA 1KKLA 4D4KA 4MLDA 2QMZA 5K1ZA 1G6Q1 2W2NA 2GD1O 3PYMA 4PO9A 2O8BA 4YIHA 1SOAA 1SZJG 3BICA 4MQLA 4GI7A 2XA1A 5JROA 3ETJA 5BW6B 1LRJA 1JDSA 3GWZA 4BFSA 4MEJA 5JEEA 4K9RA 2Q29A 4DLTA 3UAWA 1KVUA 1FLNA 2CMGA 4BDSA 3AF3A 3S68A 2YYZA 3RTEA 3BH7A 3MQ2A 4P7KA 5FEUA 5DP2A 3V8BA 1Z74A 3B9RA 3HN6A 4MJ7A 2BFDB 1E3SA 4D4HA 1XMPA 1ZH2A 3SJCA 3SU8A 5CDFA 3ZGLA 1LSSA 1PLJA 3LXXA 4RA9A 4BNTA 3P9PA 3IQXA 1AC5A 1OLUA 2NU9B 1ILWA 1TM5E 1VJ5A 4U7TB 1Z2NX 3OF3A 1W5EA 1FYEA 2RBEA 1VFNA 1T1GA 2OCAA 3OI7A 3SBXA 2AMJA 3MGAA 4K6KA 5HBGA 2IH4A 5JBQA 1ADBA 1PSZA 2R1VA 1XK6A 4TMTA 3FG9A 1PUXA 1H9CA 1R10A 4H0CA 2AOXA 2GPWA 4ZT6A 1Q20A 4MLCA 3TAHA 1QFXA 4DXAA 1B76A 5F3DA 1CY6A 4LG1A 4KWEA 1YR2A 2E85A 3HWWA 3O8BA 2M6LA 4ETMA 2V0NA 3VXKA 2NT3A 4MW0A 3UA4A 1F5SA 1GZ3A 5ICFA 2FX5A 5CVCA 1X7WB 8LDHA 3Q4GA 1YASA 3HCOA 1SXGA 5K0FA 2PRSA 3ZYCA 1UFOA 1P6UA 2XVMA 1VHTA 4EEKA 1DQSA 5FOTA 1KE2A 4EM6A 4WX2B 3SMVA 4NARA 1WXIA 3ILXA 2XVYA 3LY9A 1ZVVA 5FAKA 4UHHA 2ZB8A 4PRKA 2XSZA 3AM5A 3C6KA 1V16B 1D6SA 4K9NA 3BK1A 4FBLA 1XTZA 1KQ3A 3EC1A 3OZEA 4PSAA 1JN0A 1SHKA 4TSRA 1Z4KA 1DO0A 3F4KA 3LCVB 2AQIA 4AF7A 5CYGA 3BGWA 2H1IA 5KAMA 3VGPA 2LE0A 4Y9SA 5FTNA 4UBLA 1MORA 5THQA 4O0LA 4QFBA 1ULTA 2IUYA 5D6NA 3TZKA 1J21A 2FU5C 3N75A 3ACDA 5GAJA 3DAFA 5IEBA 4PEVA 1YK1A 1U0GA 3W6PA 3MSCA 1U1EA 3U3JA 1G0OA 2M2IA 1PEDA 4H7KA 5LA6F 4WK4B 2XWJI 1E1RA 1ECPA 1EM6A 1FNBA 2JGFA 4ALLA 1Q95A 1GTRA 1C3VA 2J5XA 4B35A 2GN9A 1D8TA 5H7XA 2Q1XA 2ACWA 5C81A 1FRZA 1MAWA 1NI4A 1VE1A 4YJHA 1DSSG 1Z0UA 3IP8A 4Q48A 5CM9C 4DT1A 1KH1A 3DR5A 2Q1SA 4LRXA 1CFJA 1PFKA 2Q6TA 1LVGA 1H8HA 2BRUA 2BF4A 2DC1A 4UU0A 3UPTA 2IY9A 1ZO8A 1TVMA 3OIGA 2ERXA 3PI7A 1TJ5A 4HEQA 2ODPA 3P9YA 3M5DA 5T4FA 3M1LA 1S2GA 1ENZA 2GH1A 2IIQA 2OWDA 4RA6B 3RIGA 2EL9A 2CMHA 2HT6A 2ECQA 2VHYA 3KUXA 4IGKA 3H9UA 4Q03A 1R4MB 5HG0A 1QIJA 4Z2YA 2QMYA 3BE5A 2Y77A 4LX0A 4WRRA 1P4GA 1JDZA 3JASA 1IWOA 4G2TA 1XEWY 2D13A 4QOGA 2DHEA 4RE6A 4AWAA 8GPBA 1K3TA 3CLUD 3QF4A 1ZK4A 4R3UC 2VCYA 4DSNA 3S1SA 1YOBA 2YX1A 3CR7A 1L7BA 5DVZA 3DMRA 3MT0A 4WGFA 4I08A 3NUGA 4YJ3F 2FKNA 2ZOSA 5AW6A 1G8HA 3R3HA 3IVMA 4X0EA 2PD6A 5AK3A 2H54A 3O38A 5TGZA 3K9FC 4EGFA 1B74A 2AS0A 2EWMA 1QBGA 4Q12A 2XUIA 2YRWA 1I0LA 1KMCA 3HNOA 4I46A 4MQ5A 3UOWA 1NN1A 2Z4RA 4ACAA 5AJWA 4DR5B 3W0LB 1E2PA 1HDOA 4EFDA 2CBZA 1L4NA 2CFTA 2HFJA 1CVLA 1BMTA 2JGAA 3ESYA 4IX9A 4RHUA 4CIXA 4JBWA 1W88B 5HM6A 3W3AA 4BU1A 4YLYA 1MFPA 2H1RA 3LH5A 4HDNA 5D84A 3URMA 1U2RA 1YKSA 2EJVA 5G3ZA 1U9JA 2B3TA 1RJ9A 5A7FA 1J1UA 3NFRA 3U7FB 4MS4B 1T8SA 4GPD1 4DWOA 1JYSA 3V1KA 2OE2A 1ADYA 4GX5A 2PRKA 3QVGA 4MRVA 3DMGA 5DNWA 5EUCA 2OFPA 1QGAA 4LKOA 4HVLA 4Q05A 5IUNC 1RWKA 1I1QB 3B1YA 5DBGA 3EUEA 3HR4A 3GEMA 3C45A 2FWAA 1BX3A 3L7DA 4DAEA 4JX9A 3AZPA 2NUBA 4IXDA 3TLKA 1BMDA 4D80A 4EL0A 1JHZA 4I0WB 4E14A 4XGIA 5FWNA 1Z2PX 5C3UA 4W9RA 3UAXA 5E6RA 2WB4A 1KXZA 3FKJA 3L0PA 4XIYA 3WRYA 1QU2A 3HLYA 5M34A 5DBFA 1J07A 3A2MA 4QGAA 2WSIA 4LGYA 1US8B 3KJNA 1AHHA 4JJGA 1WE2A 3WKAA 2WYHA 4CM5A 4DA0A 5B2FA 2XOKA 3MAJA 1W94A 1SUEA 5JDCA 3GLIB 3MAGA 3QBVA 3ZVNA 2RGNC 2Z4SA 4LFAB 2P6OA 4P4NA 3NHSA 3TOXA 2R86A 4GOMD 5AI0A 1KZ7B 3EPKA 1KAMA 4UM8B 1U2ZA 3DPIA 5DO9A 1KOJA 3C5HA 1NLZA 1Y48E 1YS4A 2WQZA 2FKAA 1KZHA 3L2OB 1D5CA 3UMMA 1TLFA 4IDGA 4PC3A 1E5LA 1T3GA 2F3UA 4O4HB 3NIBA 2Z9CA 1K89A 1Q0QA 1U0RA 1YQWA 2FN8A 1RR6A 5FOVA 2GPJA 1CEYA 4PPFA 1G2IA 3PB3A 3KTDA 1I4OA 4KXWA 1G6OA 2QE6A 5CPFA 3AU8A 2AFRA 2R4UA 4A0HA 1P81A 3R0VA 4AP6A 5JBNA 3PA6A 4R5MA 4CR6A 1Y8RB 2CMKA 4D44A 2FGJA 2W22A 3UC5A 1H2BA 1RI1A 4JX8A 1KDYA 4JJ6A 4PSUA 1Z82A 4QEDA 3L6CA 2JI6A 2ODQA 3HCNA 1DAFA 4E31A 3I5UA 3R5XA 3BF7A 1GL6A 2NSHA 2A7XA 3KV1A 3MINA 3AP1A 1YB4A 3HYTA 2NNLD 1J00A 1O08A 2ZITA 2ZJ5A 3Q7QA 3CF6R 2AJ8A 4DJJA 4RTSA 2BEVA 4FILA 1K98A 4M22A 3CW9A 1B73A 2C9YA 4JP3A 3WMXA 1CRZA 1II8B 2F00A 1N2EA 1G7CA 1Q0ZA 3GNLA 4V0ME 3OE1A 4YP9A 5LIRA 1N0WA 4F4FA 1N6OA 1WMDA 2BHNA 5H3HA 4ZI3A 1U5AA 1E6CA 3EF0A 3ZGVA 1Y42X 4EJ2A 1CEQA 5JT1A 3DVQX 4BUZA 5JNLA 2GCOA 3KAKA 1NXVA 4OGFA 4BB6A 2AR9A 3LP5A 1ZRMA 4BNDB 5CAEA 4R31A 1IUNA 4FFLA 4UW9A 2QZJA 3NWJA 5AJYA 4D4LA 3QUAA 3SHWA 4PR3A 1E20A 1SQ0A 1O96A 3B6ZA 3RSHA 5C8VA 2JH3A 5EKUA 1VI2A 3HBNA 1Z5WA 4LCJA 2P6MA 3S2EA 3UQYS 2IH5A 1NFQA 3WRVA 4AZ3A 2YJ6A 3AVQA 3KX2A 1LB1B 5IJ0A 3BK7A 4BMOB 2Q5EA 1E9CA 1FDSA 2XMBA 3DEJA 4P35A 1W52X 2FSVA 1JHQA 1T13A 2OD7A 4Q7EA 4R2HA 4RMHA 5EQFA 3UEOA 1YI8A 1KBOA 2G9VA 3GUUA 5CX1B 5IARA 2QG4A 3SQDA 4KQWA 4BAGA 1M73E 4DABA 1Y7HA 1KHTA 3NT2A 1JG1A 1OB5A 4ID9A 4XWOA 2SBTA 2WAMA 1PZXA 3GQBB 1VHLA 3H5NA 3WMRA 4YRQA 3JQGA 5CP8A 4TMWA 2PUWA 3OLYA 4KG7A 1C9MA 3AVTA 3KKQA 3VZDA 5HP4A 4W9NA 4UNPA 1BAPA 2B4AA 3C16C 5DW3A 3GGPA 2C7VA 2XQVA 2ID4A 3L7BA 5AI4A 2F43A 3N6VA 3VAAA 2DPLA 3I5AA 3HDYA 2IWRA 1NQVA 3WLQA 2OESA 1HT1E 3CIFA 4MYCA 2OV2A 1CV2A 4KYVA 2X5NA 3AVPA 4M0EA 3O4GA 4UVGA 1K5PA 4WOKA 2WSBA 3T7IA 1XRLA 3E3LA 421PA 1KI1A 5IT9A 4JNKA 3JATA 3V5NA 2FUEA 4MDYA 2IU0A 4F38A 2WMYA 4EY8A 4V2UA 5JHGB 1J0BA 1GSOA 2JS7A 1BA2A 1OT5A 2NO7A 2COEA 2QYOA 4F1JA 1WWKA 4O2LA 5D01A 4QJBA 3E27A 2R9VA 3L8ZA 3UFXA 2ISSD 2VUHB 1JEQB 1RXEA 2W6CX 2GK6A 3LK7A 4ZVSA 1RTKA 1LTHR 1KOFA 3SHTA 3GRKA 4FT2A 5LM3A 2B20A 5FXMA 1DG3A 3JYPA 5ADUS 2VG8A 2AF4C 3OZDA 3SF8A 5TT1A 1C7ZA 4FYPA 2WY2D 2FZWA 1FFCA 2GAOA 4WDRA 3UK7A 5KKAA 3FA2A 5DOVA 1H2AS 3SSMA 3KB2A 1HNXB 4QFDA 1RJDA 3D8TA 3CZ4A 1UK7A 4NHEA 4JBXA 2WVGA 1YHNA 1W75A 1AQNA 2HRCA 4U6QA 4G36A 4PLGA 3UJ6A 1X7GA 2GEVA 1CZRA 2NX2A 4IH1A 1ODTC 4ZN6A 5HQTA 4PZLA 3KSDO 4FMDF 4CEJA 3MELA 1P18A 4IJVA 3L3BA 3EY4A 1E77A 2Q5HA 2FN7A 2JI4A 3R3SA 2HMWA 3B70A 1CJKC 2GJ4A 4XM2A 1JHYA 1QCZA 3OEHA 4CTOA 5JS6A 2W2LD 2X0JA 1KETA 4RY8A 3ZHYA 3O73A 4X65B 2K4MA 3WLHA 4XDHA 2Y92A 5IAOA 1FP4B 2QL5A 4Z6KA 4UQLA 2QG6A 3OCZA 4OYHA 1NQUA 4IEIA 3AHEA 4C7MA 5EWJB 2JLUA 3VX3A 3C3DA 1CQIA 4LHEA 3O1IC 1SBQA 2B7BA 2DPGA 2AB0A 4K81B 4LHZA 4MW4A 5K6TA 2EP8A 1OZHA 5CA0A 4FONA 2QJRA 4BKRA 4EA7A 3I05A 1TVKB 5L7YA 1ADFA 3TO5A 3F5DA 1XEFA 1T9ZA 2HY7A 3FMFA 4JUDX 4NPHA 4X1IA 2YRXA 3PFGA 2OBBA 4R0VA 3EUFA 4DIUA 2QM7A 5JWOA 2HA4A 2YDYA 5L6MB 3C3WA 1U2QA 1NBIA 2A57A 3I2YX 2FN4A 4B6JA 3ZXIA 1DQPA 5DYYA 5KOYA 4CJXA 2JGNA 3JZDA 3NHAA 4JB3A 4ZEWA 3NTOA 4X7MA 2G8LA 4A26A 3IJEB 1IB6A 1N8NA 2QUJA 2VF5X 4JA0A 4UE3S 5ESRA 5FYDA 3ZDYB 3CO5A 3K30A 3CJQA 4EYOA 1CF9A 3GWGA 3ZIAD 4PFJA 5ITVA 5JD6A 1H0KA 3V8PA 3B3QA 3QHQA 4RZQA 4AJEA 3AINA 3KELA 5M5BA 1BKYA 2IEGA 3EAGA 3KB1A 3DGFC 1YQEA 4ZK6A 1RYHA 1D4AA 1KMHB 1UBUS 1VSQA 2Z09A 3EBLA 4L8YA 2VTBA 3KU4A 2CNBA 5KVQA 4WXPA 4CMIA 4P6VF 3EB9A 1J7KA 3QRWA 1PWHA 4TXLA 3V7WA 1VE5A 1J8VA 3L7IA 4FLFA 2P35A 1RAAA 1NBWB 4RV5A 2BFWA 5EE5B 2UXDB 1E1QA 1QIMA 1WW2A 1G2OA 4TVBA 2J4FA 2FDCA 2X0FA 1ZBQA 1SKYB 2WZQA 1GPWB 4U2GA 1SXQA 1WUHS 3ZI0A 3HU5A 4L9AA 3JQBC 2ZIWB 3A8TA 2PMEA 4Q00A 1NKSA 4L85A 5JS8A 5DN9A 3QG1A 1ORDA 4FJ0A 1Z29A 1OXBB 4XIIA 1G8YA 2G8NA 1TUBB 1UAYA 5F1OA 3JQ9C 3TIFA 2ATIA 2QE7D 4C4RA 4DE5A 1AMOA 2OG1A 3OFKA 2IOQA 3SXUA 3EFOA 3BMNA 2A94A 2ILVA 1CE8B 3EVDA 4WLEA 2HNBA 2NQ2C 4EI2A 4JXKA 1HTBA 3K4PA 4DC1A 4WLFA 4KKVA 2FWNA 4MV3A 1SCKA 3II6X 3SZLA 4BLRA 1NBHA 4MRAA 2WV9A 3B1FA 3L8FA 1GYPA 3LUJA 1IJBA 3BB3A 4U63A 1TTPB 3F3KA 2C97A 1H85A 2I33A 2OBFA 1E58A 3QKRB 2BRUC 3WMWA 2IYNA 4N41A 3FSRA 4EQZA 4GP7A 4N5DA 3F49S 1F20A 3PFWO 2IUFA 1MN6A 2Q3CA 3UWOA 1U7OA 1SXJB 1TEXA 4F8EA 5KNBD 5CCXA 4RJLA 2PCLA 4B9AA 4GO1A 2UYGA 1Z3IX 2Q7DA 3TVYA 4EBBA 3F7TA 1HQKA 1A50B 2RB5A 1WABA 3JD3A 5E1OA 4IHKA 4L27A 4JR1A 2X8BA 2QAGC 1T0IA 3LXMA 4MZDA 4PLWA 2IEIA 1RZRA 2PJRA 1KMMA 3GROA 3NBQA 5P21A 2ZYUX 4P0QB 4MI6A 1AKYA 1H3FA 3V4LA 3VISA 1UINA 5LUAA 5TVKA 4RTQA 1PR4A 4RPLA 5ADHA 2RGBA 4TMZA 1P5RA 1G6HA 2PVPA 4Z3KA 1ZR2A 4DNOA 5AUNB 3AEZA 1P6QA 2VBIA 3TR5A 4BAUA 1P1CA 4C7OB 1QLWA 3ZDRA 1L4HA 1OA0A 3ZHVA 1J0AA 3FTPA 5K03A 2GGSA 1ONOA 1Y1LA 3C39A 3W8FA 2K6GA 2FOLA 5JPDA 1PP4A 3ZH9B 3PGJA 3HVUA 1G64A 3ANSA 2PU7A 2VYCA 3LWNA 4WCFA 4ATNA 1XO1A 3K1TA 3FFAA 3I64A 2XYHA 1P44A 4DLLA 4AO8A 3IAFA 3R8XA 1SXPA 1C8VB 1RE1A 1CUSA 1GQYA 3AR9A 2YZGA 3BGVA 4P38A 1PQYA 2ID9A 3RD5A 3W9BA 1G20E 1G3UA 3BQMB 3V7YA 4FDAA 1Y6JA 4LQDA 3I04M 3EZYA 1KKUA 1E6KA 1QLHA 1EH5A 2DUJA 2VDLB 1A0OA 1E4EB 1GZ6A 1NMYA 2HSZA 4MB6A 1O6BA 5EXEA 3R76A 4CM9D 2QZPA 3UMYA 1O3YA 2Y1KA 3TDMA 2GA9A 3HJFA 3REFA 3KHKA 3W1EA 4MYRA 1W1UA 3GVXA 4NFYA 4RVFA 1SUBA 3BXXA 1OPRA 3IQFA 4TPKA 4L5CA 1DTSA 3W6ZA 4FYKA 1XTUA 5DP1A 1FNCA 3CLRC 1R6AA 3L01A 4KVAA 3JQAA 2JPDA 4Y6GB 4N0EA 2PJZA 4MKHA 3IVAA 3OZRA 1KZ4A 4RGBA 3V33A 3PXEA 2DY0A 3AEUA 1MUUA 4EPXA 3I01M 1H1LA 2A9OA 3ZHOA 4IG9A 3ABOB 3AHFA 4Q3LA 3LFTA 4RLSA 2E1RA 2Q0HA 3ZH2A 2QX4A 4YRTA 5DM2A 2CXPA 4I19A 2JA1A 2HQRA 3C6QA 1O95D 3FI9A 3Q72A 3TIGA 2V0GA 2DGDA 1BG6A 1DRVA 1GZ7A 1KSHA 3FB4A 3HS3A 2GEKA 4GLJA 4GMDA 1NZDA 1XPJA 2AOVA 2XBUA 2Q45A 4MV1A 4EMBA 1ISHA 1QGUA 2OHJA 1ZICA 3HP7A 2XTAA 1ETHA 5FKJA 4KO2S 2HK8A 2PKCA 4DC0A 4JXJA 1ACLA 1GSAA 3WYCA 4CFYA 4HF7A 1PYDA 3EGDA 4ZV7A 3REOA 3O90A 4EUKA 5TMDA 1O97D 3M7IA 2WAYA 4H4DA 2JATA 4NNPA 1T10A 5TPWB 3VC3A 3FLAA 1SU7A 2ZAOA 1NOJA 2LXNA 5IX8A 1MIOA 3KUCA 2HT1A 1FP1D 4HMOA 4W5TA 1OTHA 1E3IA 3PQ2A 2H4WA 4TN1A 2GPSA 5HCNA 1QE3A 2YXDA 3S2FA 4BCBA 1P91A 2H7YA 2IU4A 2VZ0A 4LJKA 2ISCA 4UEQA 4ID3A 4BFXA 2WQ7A 1R50A 3A28A 3GBSA 1JDJA 2IDZA 3JD4A 3HCPA 4CLEA 2X9VA 1OLSA 3UWKA 4L9RA 5H3CA 5B58T 1SZCA 3MS4A 4DUYB 3KXKA 5JAPA 1IC6A 2I87A 1T2CA 2QB5A 1MH1A 2H65A 3K9QO 1JZSA 1M6VA 2IUSA 4I1RA 2JIQA 2WHPA 2HHAA 4RPIA 4G4SO 1FK8A 4V39A 1TAUA 1G5IA 3FGPA 3KSBC 1TYAE 1IEQA 2V9ZA 3REGA 2A5GA 2CE7A 5ALJA 2H92A 1IFXA 1E2FA 3EDQA 2O06A 3MCTA 1CU1A 4HH0A 4N3BA 5DM60 1E9BA 1L7EA 4F3CA 4UDXX 4WQMA 2ZTLA 3PEYA 1WHSA 2J0UA 1C9NA 5IFLA 5KEIA 3R5JA 2C5GA 1UPTA 3S7TA 1SOUA 1XD8A 4ZO9A 1T0BA 3G0OA 3E70C 3CUSA 4X97A 1MEJA 3WI7A 2WSYB 4L07A 4MRPA 2ZS9A 2UZ1B 3H2GA 3AR4A 2WKSA 1KY4A 2B21A 2I1WA 2V45A 3L5KA 1CQIB 4ZZIA 4CUJA 2BUAA 4E70A 5IASA 2CNWA 2VP5A 3T7CA 1KBQA 4DIKA 3B7GA 3WMEA 1B42A 1RRPA 3BWMA 1GY8A 2EW1A 3NDJA 2QP9X 5I4BA 2GN6A 1EI9A 4KHZA 3ZR4B 4CMGA 5FI1B 3QNUA 2C29D 3EQ7A 2BY4A 1F8GA 5DWVA 3D4OA 5AKXA 4BNLA 3B7WA 4LDRA 2V96A 3DZGA 3RTCA 3ETHA 5K8UA 3K6SB 5ITSA 1JKMA 2QY6A 3QKSA 1RJGA 3MUOA 5JXIA 2QE7A 5EJIA 1UOOA 3WQQA 4U7DA 3LI2A 4RQAA 1GGMA 2HMYB 1Q7EA 2C88A 2IHYA 4HPWA 2IV7A 4EG6A 2J46A 4IQ4A 2WJVA 1Q0SA 1FNNA 3ROTA 1BTOA 1M34E 2OLJA 4P34A 4C5CA 3AF2A 1CRPA 2CJWB 1M0WA 4ZD6A 1OGYA 3NOVA 1Z75A 2WTAA 3AOGA 4X8LA 1JLHA 1CQZA 3AB7A 4TM8A 4EB3A 4EMTA 2RAFA 1DRKA 2FLVA 1YDMA 4WKGA 2QN8A 3N8NA 3PNPA 5AT1A 2J45A 1MZVA 5GGXA 5SYNA 1FDUA 4G97A 4L0DA 4B17A 5BUQA 3M4YA 4FOTA 4LRYA 1NJ2A 4DR3B 3GY0A 1KE1A 2AQHA 4OPMA 3HEMA 2VOEA 4YTEA 3LYLA 4IDDA 4CLRA 2F1HA 2CJXA 2IUTA 3K1JA 4GM1A 5K0NA 1JFTA 4GKJB 4YP0A 3TB4A 5MGBA 5AWFC 3EIOA 1D0IA 2G1AA 2XCOA 3SP1A 3RVMA 4DEXA 2E18A 4FEGA 1LC0A 2J32A 1B00A 2LCQA 3ZD7A 3B89A 2G5GX 2D1TA 2TMGA 1M34B 3AJ8A 4RAOA 3U39A 1XF1A 1CJMA 4D8TA 3U17A 3DEHA 2QTLA 1MOSA 3EZFA 4H3SA 5F64A 4D3FA 1NYRA 1Q3TA 2EZ9A 4NBVA 2A5DA 3KD3A 3BULA 2FW8A 3H99A 4RA9B 5HKOA 1SVMA 1X94A 5DRYA 1XAIA 2OPHA 1PKXA 2QLBA 4OAOA 2CXRA 3R4VA 3FBGA 3RYHA 4FD3A 4ZZ1A 4EKIA 1Y9DA 1RXIA 3QEMB 5E7IA 1CB0A 5KQSA 5FORA 3IEIA 2GN1A 5BQFA 4Y9DA 1CF4A 3BD6A 3Q9NA 3O4FA 3VI3B 1P9LA 3KYDA 1KY5A 2BKXA 5SZJA 5CDYA 1IHPA 1I1NA 5JZSA 2HMUA 4FFSA 5MHTA 3G49A 2W4IA 3QE2A 3U3RA 2C58A 1CR1A 1P2UA 1FYVA 4MTLA 4E5KA 3BHJA 3PGVA 3HJBA 3U9SA 5C1DA 5IH3A 3HJCA 3T8YA 1E61A 3OOEA 3M3DA 2WTXA 3L0BA 2P68A 2EZTA 2I80A 3MAAC 1CY4A 2XXAB 3ZWMA 3AR2A 3K8OE 3QEKA 5DZSA 4HK4A 1A9XA 3T94A 4I8IA 3HADA 3AIKA 5A0TA 4G0PA 3B82A 4P9NA 4QEKA 3KNZA 5LP6A 4P4LA 3ZCPA 4ZRMA 3BA6A 3LUHA 4AY3A 2FW0A 3KKMA 3NC4A 3WWCA 4ZMRA 1Z4IA 2H7VA 4C88A 1H2YA 1DXOA 1BCSB 1RTTA 3DMDA 3EVBA 1YC5A 1ODFA 5JQGF 5D2CA 1FFHA 4I1SA 4IHJB 4B7UA 1KJ8A 1RLOA 4HRXA 1KQFA 4ZK2A 1ECLA 2NXNA 3DZIA 1GL3A 2PH1A 1R6TA 3THWA 4M1TA 4UREA 4BJHB 1T5SA 4RMJA 3OURA 2IYWA 5AXBA 3T9EA 3WV4A 2OXCA 1VM6A 3GMIA 4RXMA 3GGJA 4HX9A 1I9GA 1YI1A 1M1NB 4WY5A 1MJNA 4KRYA 2N47A 1NOIA 3GA7A 4MVXA 2FAXA 2FETA 3LLSA 1HT2E 2IHNA 1F8FA 2E5LB 2XXAA 3I62A 1GL9B 3LVRE 4C6SA 5J43A 1DBRA 3E1GA 5WRFA 2FG6C 2BONA 3PEWA 3D6FA 1J2TA 1TKCA 1S8NA 4TTIA 4TGLA 4JLPA 4S0ZA 4HGOA 4B5LA 2GWRA 4N18A 1FJ2A 3UNXA 4AUMA 4GQAA 4JUCA 3ZCUA 3QVSA 3E3OA 1R2QA 4B46A 3F1KA 4QGHA 4W6QA 3ZWCA 3VO8A 3BAFA 4I5EA 8ABPA 3GFBA 4MWDA 3FPSA 2FVYA 3G0GA 3ND7A 3VH1A 1BDMA 1JEOA 1B16A 1OKKA 3CZAA 4JSRA 4OI0A 1T8TA 3ZUGA 1RZRD 3TZHA 5U9CA 4IIJA 1I14A 2YIDA 4O33A 3U62A 5BNIA 1QS0A 3DMYA 3FPFA 4ALIA 4CL8A 1DIBA 1P1IA 2ASEA 2B82A 2I2FA 3HVJA 5AKGA 2FJPA 4JJ7A 2BTEA 4L3WA 4QYIA 2HMAA 1QP0A 1H1LB 1R5OA 1B41A 1C8KA 1HDZA 2PZJA 1Y5IA 3ASVA 3HY3A 4JGIA 4X84A 3PUWA 3P52A 1ZITA 2PLNA 5LZ8A 4DGQA 1PQPA 1WXWA 1QQ7A 1YZKA 5EIXA 4ZODA 2HJWA 1L8XA 1XYVA 5HKBA 4GRAA 2Q7XA 4DA8A 1WR8A 2PMBA 1CXZA 1Z4JA 5AW7A 2DFVA 2CW5A 1SG0A 4YCJA 2UZ3A 4ZO8A 5LBIA 3F78A 3V6MA 4DB4A 3KPJA 1XDGA 1ULHA 2C95A 1PNOA 3S40A 1ONBA 3LPAA 4BO2A 5BVHA 2PSHA 2CNOA 3D4IA 1RZVA 3MMNA 3MQ4A 4E2WA 2XECA 3CUKA 4JDPA 1XQVA 4N7JA 3C43A 4EI7A 3BBLA 3H04A 3WWZA 1UJNA 4FWBA 1ZKDA 4EK9A 3RANA 5BURA 5ER9A 1RWNA 3FVRA 1YHZA 1U1CA 4YX9A 4PY2A 1X7HA 3N86A 1ZJZA 1DKMA 3GZ4A 1GVHA 1RHMA 1THGA 3UATA 2CNWD 4HDSB 3ZGNA 1Z13A 4NDZA 1M1UA 2WFLB 3CW2A 4ZJPA 4M8LA 3W4IA 3FNGA 3QVOA 1RD4A 4OGGA 4QOFA 5EZSA 3LOPA 2MMGA 1I13A 3JWIA 3K0SA 3DDOA 3UCFA 4BKOA 4FDVA 4EQ6A 1ZRHA 5AR1A 3IVCA 1YQGA 3FNEA 5EIBC 1U9IC 1CJBA 3HJGA 1BFUA 4IDPA 3BD8A 3WJAA 4HAXA 1R6XA 4UDNA 1IOZA 1TK2A 1OAKA 3KG2A 4HN9A 1H0RA 2X5JO 4M1KA 1ZFNA 3ZWQA 5REQA 5EP3A 1NY5A 2R1ZA 1KR5A 3WL7A 4KFCA 2ZWAA 3AETB 1U11A 3S6JA 1HY3A 5FJJA 4GMHA 3AH8A 2X22A 5TMBA 3ORYA 5BWNA 3EIUA 4UAJA 2Q3HA 3RIHA 3PEEA 4LF7B 2CEAA 1VJ1A 3A11A 2W6QA 4D45A 1XD2B 1C3OA 5FA8A 4MVJA 3R5TA 2Q5OA 3N0RA 4K6HA 5A6VA 5JHHB 2ACEA 2VHZA 1N5JA 2ATEA 4KQJA 2BEKA 1PJ2A 4B1FA 2BI4A 3A1TA 3EBPA 1L5OA 3INRA 2HA7A 1GARA 2KJQA 4HN2A 1PS8A 1UOEA 2FSVC 2Z1NA 1L2TA 4H35A 1XA3A 1XXHA 3WFJA 4EVRA 4HZUA 1KIAA 4W5QA 4V02A 2BKUA 4EVQA 4CMIB 1ZMRA 3P4UA 1YRAA 4MA0A 3HDTA 4Z7JA 1RXYA 4N5MA 3QSYA 1LPMA 1S2OA 3DCJA 4XSVA 2HF2A 1VBKA 2DHCA 2JRCA 5CVVA 3IDOA 4GC5A 2X41A 2BGWA 4YFYA 2LKDA 5EHQA 1O97C 1N34B 1A7UA 1JIVA 4YBZA 1TQDA 3LM8A 3SEAA 3P0IA 5H59A 4AUNA 2XNJA 4OLJA 4UZEA 1Y6ZA 1W87A 4RGQA 5MDHA 3SBDA 3FOEC 5LQRA 1G63A 2BMFA 3WDMA 4L5AA 4F97A 1HRKA 4GAEA 1AGXA 5A7HA 1PW7A 4ND3A 2ORWA 2XVZA 3TJMA 4Y9UA 1Y81A 1KGSA 4GMKA 1EVIA 2DF8A 3IMEA 3C6YA 1YZYA 1PYGA 3M8KA 1RHJA 1GXSA 2J09A 4JU9A 3UH0A 2GT1A 3ZTWA 4YRMA 2HRRA 1I80A 2OFOA 3LUDA 4XFKA 2KYRA 5CT8A 5JW6A 5E2BA 4QDOA 4Y7DA 5DN6D 1IBSA 4JHLA 2B5VA 3L1HA 3ACBA 2CDRA 3HGMA 4UPVA 2VWQA 4DCSA 4XR9A 3PNMA 5B6IA 2Z04A 1AS0A 3PLNA 1QH1A 4MDEA 1D2AA 1W4CA 1UIMA 4R8RA 1MAVA 3FETA 1UT5A 5DMHA 4GM0A 4Q7QA 1X1AA 5ULLA 5L4LA 2I8AA 3I6QA 1Y7TA 2YWCA 4KWTA 2WWFA 1WCYA 5M29A 3DEZA 4L2IB 1I2BA 2JANA 4QGBA 1D2MA 4WK6A 2QLJA 3OJFA 4F1WA 2Y66A 3PFIA 4ARSA 5EN4A 4ZCMA 2H2WA 5T6MA 1J09A 2C5AA 2QTBA 2VRCD 3PRJA 4H0NA 4RSRA 3I58A 4XB1A 2CJFA 121PA 3TLZA 4XJSA 3IUBA 1T34A 1Y98A 2X1LA 3PFFA 2JI7A 4HBGA 4TV9B 3E9QA 1FS4A 4ZAWA 4MHTA 4EW1A 1V8FA 2PSFA 1THZA 4ZXFA 5FPKA 3SYRA 4S04A 2VDWA 5A5FA 2EX0A 2FR8C 3F6RA 2ZRGA 1W1WA 1CUCA 3EGIA 2H48A 3NYIA 5IFKA 4BO9A 1T91A 2X7HA 3KJEA 4DL9A 3G79A 4GKAA 3ZWNA 5E4JA 2HV9A 3LWDA 4DKJA 1SOMA 2A6PA 4IYJA 1SU4A 1R88A 1OYOA 1IOLA 1GA4A 4XVUA 3KL2A 1CUWA 2OHGA 2ORIA 1UWKA 3OLXA 3WP0A 1APBA 1EE1A 3L40A 4LRSB 2R00C 2PH3A 3ONDA 3JW8A 5LXTB 4IHQA 5ALZA 5GJWC 2PZFA 2B9EA 4YQZA 2NVUA 3L0OA 1JG7A 2X1MA 1Q7GA 1KJYA 4FZJA 2W6JA 2VWGA 4ARIA 2VXOA 3I61A 1U6JA 3RROA 4I4TB 4EI9A 3FUCA 4Z4IA 1I9CA 1L5ZA 4INAA 3MD9A 3RG2A 1TKBA 1GA1A 3UXEA 5FNZA 2Y9MB 2XB9A 3CZPA 1XZHA 4TXNA 2HF7A 3VKUA 5A71A 1FJGB 2EHJA 4KL8S 4A15A 1DBVO 1U7DA 2AX3A 3LT2A 5ESXA 4KQ1A 5G0UA 3QF4B 1OC4A 2HEIA 5BT8A 1JWAB 5DX8A 2A84A 1GKKA 3DPUA 3LT0A 3DV0A 1R4MA 1Q77A 2PV7A 3LDHA 2B0CA 1AU9A 3ZV4A 4YGXB 3WV5A 2JGDB 1ONSA 1NQWA 1GRNA 2WWWA 1EHIA 1FFXB 1NVTA 5G2OA 3R7AA 3TTXA 2CCGA 1EFDN 4CT0A 1KK2A 1PCXA 4PZAA 3TGPA 3GAZA 1XDWA 4HGQA 4CF6A 3WL4A 2QQEA 4GPZA 4B3TB 1R16A 3I9NA 1VJTA 1UXJA 1PSWA 2E4AA 3LSTA 4W6ZA 1D09A 2HW8A 2DRIA 4Q93A 1MOQA 4V0RA 5LLTA 2BGGA 2O2JA 3UPDA 4G5HA 1XZFA 5FBRB 1T35A 2COKA 3AY0A 3DEIA 2WLTA 2FA9A 2IPOA 1BX0A 4M0CA 3INGA 5C35A 5A2QA 4NZMA 4MUJA 3T4UA 2VEOA 3B12A 2FR0A 3LXRA 1TJNA 1VKRA 1FRFS 2QGZA 3Q9SA 4GLLA 1V25A 3H8VA 4JYBA 2G7ZA 3RFUA 2H7CA 2JZCA 4H17A 4KE9A 1KK0A 4M21A 2GVNA 1XEXB 2XQJA 4LX8A 1JLSA 5AKLA 2W6ID 3CCCA 2M1ZA 2AOTB 3N59A 5IVDA 1V7ZA 3WGZA 3EQ2A 3FCSB 4H7JA 1NNLA 2G08A 5K8IA 3VAYA 3BIJA 5DNCA 1WTCA 3G23A 2G80A 3VI4B 3FSGA 3EK2A 4WZ6A 4UMFA 3ZQUA 4LYDA 1IM2A 4TTSA 4BLQA 2Z3VA 3A4YA 2HYIC 2YC4C 1E1CA 2VSOA 4M86A 4JBIA 3VR6D 1QGUB 1TM3E 5EPOA 4DZTA 3OE7A 2V7PA 4J6EA 2W2TA 3HO6A 4YRIA 5KQPA 4M88A 3KVRA 2Y1CA 2GVDC 4HLUC 1E0SA 1I51A 1LLDA 1U8YA 2PPVA 3DONA 3H6HA 2ENWA 3UJHA 5CCEA 3HVHA 3IQDB 3MYYA 3PFKA 2J7KA 3QLEA 3T9AA 1CUZA 4LGCA 4DCUA 2Q4DA 3FOBA 5HSGA 3LO5A 1RRMA 3E8SA 1F0PA 3C5WP 1XK7A 3DV0B 2RIPA 1KOLA 5DLYA 1W2WB 4ZQHA 1SOVA 3UJPA 5DXAA 4C7KA 3EXHA 3EVFA 1U9CA 3CA8A 2ZIVB 4JT9A 4BQOA 5BN4A 1K8QA 1TF2A 2IRWA 4FR2A 1ZVQA 4EF5A 2BM1A 3KPVA 3V7NA 5GPBA 2ZUEA 4B83A 1BXGA 2K5UA 1XPRA 2OFFA 1U2PA 3ZLVA 1NYTA 5JJLA 5JFOA 2J07A 1RNLA 1J97A 3P9IA 4Z3DA 2HNAA 2VYNA 3OHMA 3W5JA 1TZJA 1QB8A 4DLBA 3ITDA 2X4IA 1DIOB 3DD5A 1KO7A 5BN3A 4S05A 1NURA 4EY3A 2OL4A 1T1SA 3A1VA 4EZBA 3LVQE 3BG5A 4UTXA 1A76A 1DJMA 1DC3A 2NN3C 3JPYA 3TI9A 3DSRA 4F7WA 2X6QA 1IZ8A 4EB6B 4QRIA 4TROA 4RVCA 2ZJ6A 3T1OA 2E5WA 3C4JA 1DKOA 2GO1A 5IDVA 1NMQA 2R6FA 3EHEA 3OX3A 2Q9CA 3SICE 4BQNA 4JI7B 1Q3HA 4WZBA 2CB9A 3GF4A 4FMCF 4GVPA 3I92A 2H07A 2ADOA 4BNWA 1QC5A 1T9KA 2BC9A 2FG7C 2QOEA 1N2IA 2J30A 4Q3BA 3UXMA 1YR6A 4B3SB 1DXHA 1FFAA 4MV8A 3N0XA 3HU1A 4O4LA 3SHVA 2O14A 4L57A 4KBFA 4XGQA 4F3NA 5HIMA 5CBPB 4B3MB 3PWSA 4DUZB 4NI5A 1P3Y1 2Q28A 2J41A 3D54D 1OZFA 1R0BA 1XVAA 1I0ZA 1WLSA 1XFAA 3FCUB 3HFSA 5LZ5A 3PKJA 1Q7RA 2GK4A 5EKXA 4H77A 4BNZA 3KV3O 3OAAD 1J5EB 5KHAA 2IP2A 1VGVA 3EZ7A 3C3PA 1LQTA 3T5MA 5TMEA 4LHSA 3T4XA 2XV1A 1NNI1 3CPJB 3VSEA 5C8YA 3IC5A 3I1FA 3OQOA 3QJ5A 5AKEA 4D43A 1B6TA 1BKSB 5JVDF 1RKBA 4EHDA 5CIYA 5ED4A 1ULZA 2JD0A 4UPDA 2HDHA 1Z8DA 3HKEB 3MN1A 4I50A 5ALRA 9LDBA 2QUIA 3KSZO 2ZSAA 1K0FA 3DWEX 3OUZA 3BGDA 2CKDA 3MD0A 3Q8XB 1A9OA 3EA4A 4XUEA 3ZE7A 2R0QC 1EVJA 3CLSC 3G6KA 4UXJA 2O2XA 4BZXA 2VHCA 3R3WA 4P08A 4Q9IA 1JIXA 4LNUB 4XRRA 2EFJA 2C7GA 3P32A 4ILKA 3A1DA 1AS3A 4FEYA 5D3KA 3EPLA 4S0XA 3MXOA 1E0KA 3ML1A 2GETA 2DULA 4EJSC 3B3GA 4DOMA 1O2DA 2I3GA 1N2CA 4J2OA 3OY2A 4KQMA 1CR0A 3M4JA 3EXEA 5IM4F 1M0SA 1NQOA 2VZ9A 3H6GA 4YRBA 1LZLA 3NMUF 1FQKA 3WYEA 1M1YA 3DYBA 3AEKA 3KAQA 1J8FA 5FCDA 4BUJA 1N5OX 5H68A 2WIBA 1RQNA 4EKYA 4QPCA 4DWVA 4D6PA 1G9SA 3GHYA 1BXRA 1QE5A 2ZWMA 1J0EA 4HH4A 1O7JA 4HX5A 4IF4A 3T3DA 5J4KA 2NP6A 1LBQA 1RYYA 4LY6A 4OM8A 4K2AA 5ANRB 3D7MA 3HUEA 1JI0A 2F8MA 1PV1A 3H9CA 1B4DA 3AP2A 1XZEA 4TWIA 1PYOA 1LF5A 4FNMA 4NE2A 1D4FA 3E48A 3GZNB 3I9V1 1M2GA 4DJ5X 5EJGA 3B38A 2FEMA 3JQ8B 3WYDA 1U3DA 1R6VA 3OA0A 2EARA 5BWOA 2Q4OA 4XOIA 2OYSA 4R2IA 3W2TA 4ZT4A 3AG5A 3CONA 1TU0A 3T1YB 3KJFA 4J07A 3OU6A 4D8XA 1X8XA 1YOVA 2GPNA 3MCAA 1B2RA 2LCIA 1F9EA 1S4QA 4G1VA 4ND4A 4ZVKA 4B7CA 1WMBA 4YAJA 4J4HA 1G66A 4JFRA 2I4MA 4AUEA 3SC6A 1HDYA 1TU4A 1WZIA 4M0LA 1NW9B 1NATA 1TC1A 2ECFA 3C48A 4R9UC 4L8GA 4CEHB 4PS1A 3EZXA 3KVOA 4QNNA 2ZANA 1NOKA 3ZIUA 4RIIA 3MHTA 1WDWB 4OATA 1C0LA 1A2KC 1UKZA 4Z9AA 1O4WA 3PCXA 5FR1A 5J59A 2XW6A 1Z4PX 4F06A 2VRWA 1MTOA 4OP1A 2JIZD 1I4WA 1M1YB 1UBSB 1UMCA 2FUCA 2PMCA 5TE9A 5FBWB 4YT2A 3IQGX 1D07A 2AOUA 4BQEA 2OLKA 5FFNA 1CUHA 3WVNA 4R1OA 2NLOA 3FTDA 1SIUA 1DO8A 5C8XA 1PL8A 4OQEA 1AQ6A 3T3OA 3RT9A 4FFOA 4E6PA 5IVKA 3G85A 1X7XB 3RLIA 3N2LA 3MUEA 5DNUA 1IBLB 2CXXA 1ZM3A 2X77A 2C2GA 4EVIA 1HA3A 2C4KA 2JJQA 2VQDA 2BGNA 5SZKB 2QX7A 3UUGA 5BSHA 5IKEA 4WERA 2ZRCA 1EWQA 2PUBA 4EX7A 5BRJA 2IBSA 4V3CA 1HTWA 1F2VA 2LRHA 2A5YB 4ZCPA 3RBZA 4X66B 3VTAA 2WUEA 1OGIA 3T5AA 2GKSA 4TMKA 3UMSA 4BN4A 5ELXA 4KWIA 1OVGA 5BNZA 3F3SA 1MIOB 1G6KA 1QFJA 5KYTA 3OCWA 1KJ9A 2VH1A 4BVLA 2YVAA 3WLSA 2NXEA 2G9RA 1JFLA 1E1CB 1NIJA 3OT4A 2FCAA 4F85A 5FX2A 1FP4A 1USIA 2GD0A 3IMGA 3L1UA 4ZOLA 3SIWA 5BSEA 1SKMA 1BDHA 3C8ZA 2PSSA 1F7UA 2ZYDA 3WRWA 4OH7A 3L1JA 2NW6A 3DTYA 2AW5A 4P1ZA 1RPZA 5DGHA 16PKA 1LBSA 4MEBA 4EGJA 4B9EA 4IXNA 3QUSA 4MVJF 4IQFA 3AFNA 2VJQA 1MIHA 3O94A 1GFZA 4G24A 4LZLA 3TXYA 3B1JA 4WFKA 1T3ZA 1AQJA 3AX6A 4GXRA 4EEXA 1T2EA 1PGJA 1IUKA 1SKYE 1TFRA 2GEFA 3EXHB 1NW5A 2OAEA 2PQMA 2X5OA 3WSVA 5FAXA 3TRJA 1FFEA 3IELA 5AKYA 2WZBA 4H4EA 3WS7A 1DARA 3WBBA 3G5TA 5COAA 2Q3FA 1WVIA 2Z83A 1Y3FE 4PQYA 5LQJA 4TSKA 4Y6SA 3GFTA 4MCHA 2NIPA 3GQBA 2VHEA 3AZOA 1E3TA 2OO3A 3ANLA 5IAKA 2VDVE 2INGX 3GMSA 4H6VA 3RYIB 2ZB4A 1BOFA 1FFXA 4OQLA 5IC6A 3SE0A 3WBFA 3MJ4A 5AVZA 1J2RA 1HE4A 4WV3A 2I7DA 3VPCA 3ZGYA 4CR7A 5K45A 2E55A 5FBQB 2WF6A 1XVUA 2X9GA 2B94A 4OHRA 1IL0A 1TZ2A 1M34A 4JIMA 2FF5A 3TFOA 1QQ5A 3OLVA 3U7QB 4BLWA 2XCIA 1QP7A 3JAMA 1U0BB 4FFMA 3RUDA 2AXNA 2EKBA 5T3YA 4TL6A 3ED5A 2C04A 3KOOA 2JHGA 1U2DA 3Q5DA 4EHFA 1GFIA 4KKXB 4HATA 2WFMA 3R3VA 5JASA 5HZHA 1P9OA 4I55B 2XUGA 2RHLA 3HLKA 3O8NA 2DB3A 2ZSIA 3OJXA 4WCFB 5JXGA 2UZAA 3BN3A 1U04A 5KQLA 1ODJA 1YS2X 3FTCA 4MW1A 4RULA 2ZRQA 3K1YA 4NSNA 4YHBA 3S70A 3JQ8A 3A10A 1CQXA 2D1QA 2VO1A 2V7GA 4ZEXA 5THKA 1QXSA 3NT5A 3UJ7A 3ZGXA 5J5CA 3HCCA 3P8ZA 4F8YA 4BKMA 4F9GA 2QLLA 3HHPA 4JYCA 4XJVA 2X4LA 3IT3A 4LVNA 2WFAA 1XLTA 3H3FA 1KWKA 2XLCA 3BXZA 1EQUA 1QMGA 3FZQA 4C0XA 1MA3A 3RVBA 4W5HA 4BKPA 4FE3A 1W25A 3R6LA 1LPOA 2XZLA 3KYCB 2NUAA 3F3YA 2BR5A 1XYYA 3GLFA 2PGIA 4GSYA 3J81k 3GDWA 3R6DA 3G8YA 4FS3A 4P0TA 1JR4A 1WDMA 3V4RA 4BFLA 2CLEB 2B6NA 4O02B 2IELA 4PC7A 3L8CA 5KSWB 4O4JF 3TL3A 1VMKA 3RAPR 2VA9A 4QT4A 3PT5A 1WB6A 2XBLA 3LPMA 4YJ2F 2CFIA 4X8MA 4PRYA 4QATA 1NM5C 1ORTA 2B34A 1MCZA 1UKCA 2HV8A 3JWJA 2ATXA 4ZC8A 4JV5B 4YRFA 2C4UA 3BZWA 5DI9A 5I4CA 4MR7A 2AYZA 3PQ5A 2JBAB 1UDCA 2ABWA 2FB9A 2QGFA 3GT0A 1NUQA 2VJLA 4C2BA 3FOWA 5C8YF 2XCSB 4A2PA 5C5EA 2EYUA 3DYIA 3WA7A 4K2HA 2P0AA 3ZIAA 1L5QA 5FLYA 3ANYB 3INYA 3BB4A 4MWSA 2VNHA 4YFVA 4EJSA 5I47A 1XDSA 5T64A 1P45A 1JAHA 4D3SA 2QI9C 3E5NA 2XB2A 5J9FA 1TCBA 1USWA 1L9XA 3G2IA 2P9HA 1J8YF 2LV8A 1GGFA 1SHZA 3FW1A 2QXYA 3KQUA 4CKZA 2V7XA 2O0JA 1HI9A 4HB3A 2HK9A 3E5MA 5M04A 4TYQA 2M32A 4I1OA 1YZQA 1YQDA 3SX2A 2CYCA 5G4LA 1WX1A 4Z1OA 1CY0A 4UFNA 4OA5A 3BIFA 1N3YA 4WE3A 3I6ZA 3O1JC 1T0PA 3L4BA 3EZNA 3QU2A 3WLNA 1GFWA 1D2HA 5EIEA 1VYTA 1HOXA 2DTXA 2GJKA 4K87A 1JZQA 4P7BA 5IM5A 5EJ9A 1I24A 4DIFA 5BOVA 2NZ2A 1U2GC 5K2OA 1VKJA 4IJMA 3VMFA 5I9IA 4BOYA 1WMAA 5JLAA 4LJRA 1R7RA 4RH0A 1ECBA 3TNLA 5K51A 2A3NA 4QAQA 5HRUA 4GR9A 1PU2A 2MYPA 1Y8ZA 1XT6A 1M2NA 5BMVF 1IPEA 1SCIA 3VYWA 5ALHA 5LLDA 3OX1A 4IGAA 2C9DA 1ODIA 1I5RA 1WNTA 3TSOA 1LCIA 5JJIA 2EF1A 3DUFA 1IM8A 5ENZA 3VAZA 3R9XB 3G59A 4E5UA 1S2MA 2Q46A 3R1IA 1U0JA 2VHJA 1FYFA 1UEXC 3AEYA 3IMFA 1XXHE 3R6TA 3WNBA 5LZ4A 1M6WA 1M72A 1OFVA 4MYUA 1EVEA 4AC9A 2C3PA 4P92A 3RTAA 2FEPA 4MWOA 4OFXA 3WICA 2VT6A 3MB8A 4YRSA 5C52B 4DLAA 4M9QA 2NVBA 1F0KA 3QNMA 2JBHA 1SIWA 4P3OA 4L72A 4QQ8A 5EL0A 4D9BA 5I9TA 4BKQA 4IGEA 3U5ZB 5LA6B 4ED9A 2W5UA 4ZDIA 4LF6B 2VC2B 3PHBE 1K9VF 3P4XA 3H1FA 2VTDA 3PR1A 1IVNA 3OUUA 4OHFA 4RWEA 3BDVA 3ZCRA 1C1DB 3OQPA 4WXMA 1YNSA 2H51A 3CE9A 4NBSA 4ZV9A 4EB6A 3ICQB 2WUDA 2XITA 4RVSA 3U31A 1UMDB 4TLCA 5LJLA 1FE8A 2V6MA 2EEPA 3F5MA 4UEOA 1SO8A 1LLQA 4IIFA 4WNYA 3RSSA 2GBPA 1F4VA 4GFDA 2COUA 5FV7A 5FPHA 3R7WA 1SXIA 3RVDA 5I9LA 4YAEA 2GCNA 5BNFA 4BVBA 4EHNA 1ECCA 4RBNA 4UM9D 3QLTA 4WNIA 2YC2C 5BSVA 2WM8A 4NEGA 4BZWA 1JS1X 4KXMA 2CJWA 5CUQA 1B2LA 2CD7A 3COZA 1IUPA 3W78A 4DSTA 1NXWA 2FUG1 3DJFA 3ZDXB 5SZIA 1L5MA 1KI2A 1IZZA 1XZBA 2BV3A 4O25A 4AIRA 1S1CA 3IRVA 3VPHA 4B3FX 2DWCA 1HSOA 4L22A 1AY0A 1XD2A 2ZR0A 4I4LA 1A27A 4FLMA 2CYAA 2IHKA 2YJ5A 3TVTA 3GLKA 3TDNA 5LFAA 4E13A 2FFBA 2VPPA 5C5DA 1RXWA 3DMTC 4MUHA 5EJ2A 2YBEA 2R96A 1W44A 2HH9A 3ROMA 5C7LO 2F6RA 5J5VA 1CYEA 1VRWA 2CJPA 3DE0X 3ZDEA 2OHHA 2QTVA 4FHGA 2NPIA 1PO7A 4AN0A 5CT6A 4I1PA 2WU8A 3BMCA 3GO4A 1ZD9A 4V0NA 3Q3GE 3NWEA 5TF4A 5B7NA 1RWPA 5CDGA 1NC3A 4RLQA 1G41A 7GPBA 4R05A 2WB2A 4P36A 3NDRA 3G2PA 4ND8A 1CDEA 4B4DA 3C24A 5JSUA 1D3AA 4NPAA 3WO1A 4NE9A 4EVSA 4L4UA 4R7GA 3JTEA 4BWYA 1ND5A 1ZBDA 3O3NB 2P5YA 2QEQA 3RYHB 4BB0A 3DF9A 3WK4A 1LX7A 1QK5A 4U00A 1AQYA 2VJKA 3MJRA 1Z0DA 2HGZA 4OA8A 5GONF 3SZRA 1Q17A 3EWIA 3GEEA 5E6UB 1G4UR 4Y2SA 5A0FA 1ABFA 1UANA 3GFFA 1OWNA 1GUZA 2OV3A 1OLOA 1JI3A 1J56A 1L8OA 3LHSA 1GU0A 4A91A 3I4CA 4TQGA 4EEZA 1EVYA 3B2NA 4RF5A 3S8MA 4QHTA 4BNKA 5HR5A 4JUIA 2QRZA 3IBTA 3TXAA 3QPAA 3RRNA 2GZRA 1XHFA 4KPEC 1QH0A 4KLNA 3PE6A 5GGYA 1X19A 2DCMA 5FFFA 3V4VB 4FGSA 2ZQYA 1UPCA 3DFMA 4WUTA 4TWBA 1Z5GA 3OF5A 4N82A 4I4TF 1F60A 3GDHA 4CU2A 1VJCA 1QWSA 1ZW1A 3DVSX 3NHUA 4ENSA 2ONCA 4RFSA 1N36B 5CB8A 3QX7A 3STVA 1WZ2A 3U7QA 4TS3A 1DBWA 2A9FA 4PZYA 3V34A 3D43A 1X70A 3TW8A 1QZXA 1KU6A 2PVSA 3GA0A 3KYIB 3SFVA 5IAAA 3FTFA 1HEUA 3FDZA 5HF6A 5KREA 1JX6A 2C4VA 3COSA 2O54A 4CF5A 1EFCA 2C1XA 3E2IA 4NTZA 3WAKA 4O4JB 4PONA 5FWXA 6AT1A 1TJ3A 3NHRA 3O4JA 3UWDA 4MV5A 1NXTA 1Q16A 3DA8A 3A9UA 3EGVA 3GIDA 2LIPA 1P5ZB 1NJGA 4UU1A 4DRXA 2E7ZA 5GJVC 1V1MB 2AZMA 5D86A 1LLCA 1RKVA 4WACA 5JU6A 2X8JB 4PBRA 2OB1A 4W99A 1F4LA 1L4FA 1T8RA 3N2GA 5H81A 5SV2A 2AEEA 4F12A 1NWHA 3BRQA 5HM8A 2FVXA 4KU4A 3ELBA 3TTUA 5T8KA 3NDPA 5DM1A 4A23A 3RC7A 4RWZA 1T5DX 2OO5C 4Q7JB 1A1VA 3I8SA 5I3CA 3U0VA 4PZZA 2G71A 1P4HA 3BD9A 3IUQA 1O5TA 2HRBA 1DIHA 1QO7A 5KOHA 2AQKA 3IUPA 3PJGA 4GRDA 4OB7A 3O8RA 2J0SA 3R0QA 3VDMA 1TCCA 2P2SA 5DI3A 4QHYA 1QNFA 1ESEA 5AFSA 4BMDA 3L0CA 3DG9A 4YR7A 1XRQA 4HR7A 2MHCA 2Q0QA 1R4AA 3ZGZA 1OZ0A 2B37A 2H9AA 3IUSA 2GDZA 3CYFA 5AHXA 2PZGA 1VC2A 3UANA 2YYYA 2OV1A 3RVRA 4FGKA 1AMUA 4J3JA 4LFBB 3OPNA 2RDMA 1N33B 5KX5F 4U5XA 2JJ8A 3IPCA 1W7AA 5IN5A 3RFXA 1U63A 4ETIA 2QQGA 1X7ZA 5CT5A 3DAPA 1GAQA 2FWIA 1IG0A 2XBMA 2MT9A 1J24A 4KRGA 3TAXA 4BB9A 3QMVA 4FMBB 2HUPA 4Q1BA 4RD3A 3OH8A 4LMBA 3EAQA 4RDIA 1RQ7A 3ONWA 1Y6GA 4WMLA 3A3YA 3OQVA 2W2VA 3SSOA 4HRAA 1AOXA 5IMBA 1U5CA 2OB2A 3ZK8A 4CKBA 4E32A 1T1IA 3OFND 1QRSA 1R8JA 4LQCA 5E38A 1GV1A 1T2NA 5L40A 3N2GB 2AZXA 1ZOOA 2B36A 3QVLA 4YP6A 3KHTA 3LIPA 1TW2A 1E7QA 1JDBC 3OE4A 4GECA 4XCVA 4XARA 2P9EA 3UGQA 2O3RA 5THXA 1YF3A 5DTEA 1MF7A 1F0NA 1IY1A 2P91A 3GRRA 5GOZA 4P54A 3PHCA 3IAHA 3DLAA 1Z6PA 1BD4A 4Y2XA 4FC6A 1B26A 5KTTA 1TIKA 3ROQA 3OEYA 4CHGA 2EJCA 1CZOA 4TUYA 4MV4A 2RGYA 2GQ0A 1Y89A 2ZJ8A 5K8TA 3JRWA 3DTTA 2H4HA 4HTAA 1RHUA 3OTOB 3QGMA 4O8CA 4AKHA 3KETA 4M1EA 5A7GA 3L49A 4JR2A 5C8DA 1EINA 3NRJA 1F2DA 1OX4A 1SC9A 3CPEA 3EXFB 2CD9A 2QN9A 3DDSA 3OJLA 5JD3A 3UB4A 3UG6A 5GVSA 3SJAA 4KAJA 3F2VA 1WW8A 2EDCA 5JY1A 2JFXA 2ZXUA 1R0WA 1ZNXA 3KQWA 2C9OA 1UFVA 2O5VA 2P9JA 3JQRA 3ZNOA 2GYWA 3NORA 3I1YA 3EDOA 3K9NA 3TQTA 1RZ3A 4HRYA 3IQIX 1WB9A 4I6JA 4YASA 1PT8A 1ZN9A 2WLSA 1MV5A 4QU8A 4RFVA 4XEHA 4QYIB 3ORFA 3QEMA 3R3XA 4A0SA 2G9QA 1O1YA 1CTQA 1L7QA 1KJJA 1Z08A 2O7VA 3EMBA 4JBHA 2J7PA 1U9ZA 1UMCB 2R6AA 2VBCA 4URXR 2HD4A 4PO1A 4DLPA 1RJFA 3GJRA 3SK0A 1AKMA 1M7GA 4UMVA 4PYJA 5I7WA 2QRNA 4MCAA 3NGMA 2Y0EA 3WIOA 2R6DA 1NF9A 3DLPX 1C9KA 2XNHA 3D8BA 1WBBA 4HQLA 5EE0A 1QGOA 4BATA 5JSQA 5IAEA 1PEYA 1DRUA 3G0IA 3H1EA 2W0SA 3VNUA 3G2OA 5JAUA 1PR5A 3K0FB 3W7VA 2A92A 5D51S 2QA5A 3ZJUA 2RE8A 5CW1A 2C3MA 2IHJA 1DKQA 3AF4A 2O2IA 2R7AA 3LTNC 1TFUA 3PIDA 3PPYA 4HWTA 4LC1A 3W8NA 5LOVF 3RK4A 2EQAA 1R0CA 3HYLA 4IUCS 1OYVA 3L8DA 1LPSA 2ZRDA 4PLFA 3IURA 4RTOA 1NTRA 5F9HA 2VBGA 1E9VA 4ARBA 4CV0A 1OX4B 4EQ6B 3I4FA 1NVKA 4MAAA 3RARA 1ZI6A 5J4HA 3VM6A 1FFWA 1K6IA 3TM5A 2J5BA 1UT6A 2WYVA 1UPXA 4WEOA 3KUKA 2AZ4A 3PXBA 3PZBA 1EX1A 2C1ZA 1PHRA 3PP8A 1HFEL 1Z37A 4CXMA 5H02A 1QHEA 1TF7A 1XFDA 5GV7A 3K0HA 2W8BB 4D6XA 5LMCA 3K53A 1C1HA 2ARKA 1K88A 2EG5A 2XCQA 1V6SA 2RJ3A 1QH8B 1BOOA 3X1ZA 4JLWA 4KXQA 2UXCB 2ZRAA 1E3LA 2Z8XA 3QQPA 3AK4A 3I0NA 4EOGA 4F5YA 4BNVA 1A9QA 3TIVA 1RYEA 2ZRMA 4ZI5A 4DCOA 4FI3F 2ZPAA 3I32A 4J49A 4J1QA 2QZZA 4NV3A 3L06A 4MWEA 1FMJA 1BE6A 3FTQA 3UV7A 2ZCJA 4MZXA 4K6OA 4YUVA 1EFHA 5IUJC 4RK5A 4G0NA 3CB4A 2R6CA 4BPBA 1J1ZA 1ZCZA 3MWYW 4I2VA 4LGVA 4TT3D 3AEQB 1J9EA 3QPCA 4CGZA 1E0AA 5K8CA 1FS5A 5F5LA 4D8YA 1CY8A 3CINA 4JI8B 3C41J 1RHKA 4AJPA 3T9DA 1W88A 2VQ3A 5DDIP 1NRWA 4QM6A 2OECA 721PA 3AR8A 2O8EB 3AUKA 3EC7A 2QD5A 3X3HA 3CF2A 1DFGA 3JARB 2VCEA 4G25A 1DQZA 4B76A 3ZV7A 1PEAA 2VH2A 1BW9B 1QRDA 3VR5A 5AI5A 4ARZB 2N1MA 2ZRKA 3MINB 1S8AA 4GRIA 5E9AA 3TZBA 5BUSA 5BW4A 4C7BA 3RC1A 5EP2A 5FNVF 3IXQA 2CLCX 4KPUA 2AKEA 1QK4A 2I9PA 1ZGGA 4LJ5A 2PGJA 3GLUA 1X86B 5EC8A 4AD8A 1H69A 2P9GA 1C2TA 2IOFK 3OT5A 4M9RA 4WBSA 3Q8MA 5FP0A 3ND8A 3L6BA 4Y0AA 3ZHUA 4M3NA 4A2CA 4LI0A 5IU6A 2RMKA 4M8IA 4QULA 4KW7A 4MUBA 3U4IA 2YW2A 3GGOA 3G82C 4RHTA 3V1UA 3ADDA 2QAIA 1G8GA 2H16A 2PAAA 2QPOA 3FCXA 3F7NA 3FIJA 4MVJM 1BCSA 3E1SA 4LHYA 3FYUA 3OFJA 4WD3A 5BXQC 1QH1B 2P2LA 3AQ4A 1QOQB 3DC2A 5AVJA 2X13A 3ECCA 2DWUA 4M99A 2V8OA 2CFCA 1K2WA 4YK7A 1OOEA 3IALA 4MKIA 4EYGA 2H29A 4OU5A 1NR7A 1VSVA 1ZJ6A 4XTRA 5AD1A 2QI9F 4DANA 5B55A 3H84A 5FLEX 4KAAA 1JXQA 4COOA 3ZUPA 3OMXA 3DCNA 5FO0A 1HT3A 4YCAA 5IVIA 3ANNA 1JQJC 1KJWA 1PG5A 5EJ8A 2X0IA 4IS3A 1K4YA 4IJ5A 4XPIA 1ZM9A 2OUKA 1XZLA 4FWTA 4OAQA 3GJTA 1JPNA 1QCCA 4EJSB 1M75A 1T9CA 1FP7A 3ASZA 3IAS6 4QPPA 4BVAA 2BKVA 2I99A 3FVTA 3NP7A 2YVLA 1JHAA 1P1KA 2J3DA 4ZCQA 3R8CA 2QRHA 4ECEA 2O8VA 4N7MA 3HO1A 4R1NA 2J08A 4YRKA 1V3TA 4HP8A 4ZU1X 1WUTA 1W4BA 2PAFA 4OHCA 2ZS7A 3U3OA 3PUHA 1Q7CA 4L4RA 3E1KA 4OREX 1UPAA 5DLPA 5PGMA 4K1LA 3V7FA 2UUBB 1JEAA 4ZZ2A 2ERCA 3HTXA 1V16A 1B0UA 2OBMA 2AJBA 3AUSA 1JR2A 3P9KA 1CSEE 1EXNA 5KDOA 2QJTA 3LJKA 2BCEA 4IWYA 1K7XB 3T35A 3EXAA 1N77A 3GLHA 1XRNA 1SWWA 5C1PA 1XR3A 3TQOA 3B8HA 2HMSA 2OM6A 5AM1A 1YGPA 4K9OA 1JU4A 2QRVB 1X92A 5BOSA 1K7EB 3GGGA 4R81A 4CQLA 5L3QA 4DQXA 4Q9HA 2WINI 4W1RA 3F9CA 1C8LA 1GSIA 1L5LA 5H0IA 3GAMA 1O9HA 1Y5MA 3ZCTA 3O95A 4PLVA 1AHNA 1E6LA 1GQFA 2JKYA 4PYOA 3PKIA 1L9KA 1XDZA 2C57A 3C0KA 3G1UA 4PZCA 3CX3A 4KE6A 1C9DB 3IOYA 1U1FA 3OMWA 1MDFA 5ALPA 1IAQA 1TCAA 3HKCB 4L6IA 3BHMA 4P3YA 2X8LA 4KREA 1XQ9A 4ESHA 3CLHA 1X80B 2Q99A 5BW5A 3OECA 3NGXA 4U2FA 4L4XA 1WIWA 5H16A 4YV2A 3SN6A 4G0MA 1L5YA 1ZSNA 3LQ4A 4J4BA 1CJVC 4J1NA 2QX9A 1JLRA 2YIMA 4QELA 4CQJA 5EPUA 2X1HA 4OG2A 1UPBA 3PFNA 4AICA 3KE9A 5BWCA 3G88A 3L46A 4MQBA 5TB5A 4ZYXA 2VKTA 1KVQA 1QKJA 4GG1A 3HYRA 4IEFB 5KX5B 2GAIA 4YV1A 1MRNA 3OPVA 3UA3A 4OF4A 4GSKA 2XTZA 4E11A 3P0EA 4G8BA 1ULSA 1RM3A 2VSQA 3ZI4A 4BRZA 5M3BA 1I7QB 1KIMA 2IEAA 3FNRA 2WVJA 3KQMA 3IOCA 3QXSA 4EF6A 2OHOA 2VRBA 3M6LA 5TARA 2PLWA 5A5EA 1SU6A 2KS6A 3SNHA 4AWXA 1O94C 4MW2A 1C1DA 1E2BA 2H5EA 2XUJA 2D3WA 3T5TA 4QVKA 2G5TA 1EGAA 3UAYA 2IX3A 5IUKC 4FE7A 2YFHA 2P9FA 3N2YA 4NKRA 1A5ZA 5DSXA 3ZWBA 1XWWA 1J8DA 1QFZA 3I76A 4HTFA 4J3FA 2X0DA 2VDWB 3H75A 1XPOA 5TC4A 2VKQA 3STXA 3KDSE 2JIOA 2QX8A 3F2IA 2N1BA 1SZDA 3L92A 6GPBA 3G5LA 4AKGA 2ZJZA 1AS2A 2J67A 1UMDA 1MVNA 4OSOA 3TIXB 4CTMA 3IUYA 4QSMA 4F21A 1M74A 1Z39A 2OENG 5DV9A 3ITNA 4MKZA 1T2DA 5IYZF 4BVEA 2NG1A 3I5XA 3L05A 2BGKA 1Y5NA 1HL7A 3TTSA 2HO5A 1QG6A 2PL1A 2GASA 1RRFA 2B98A 2ZSDA 5HMMA 3TUJC 3K05A 4EDHA 1L5KA 5C32A 2O1EA 3DCIA 3TOVA 4AT1A 2B1QA 4DPKA 4BRUA 3Q98A 1BYIA 3N2KA 2W6MA 4QYXA 5EHZA 4K8RB 3LUAA 3ZW8A 2IOYA 3E7WA 4XAQA 3BREA 4YV7A 3PDWA 3UGTA 4IUDS 5LNK6 2WK1A 3OWOA 4IL5A 2HCBA 3C5EA 4Y1RB 5AKHA 5EXDA 2JFOA 4GL4A 2GFHA 3P26A 4GE0A 5KQMA 1E3DA 3ILSA 3K2BA 2Z5FA 1DKUA 2I6QA 2OLEA 2XKJE 3U4DA 1TD9A 1YK0A 1XRMA 4IVPA 4QZVA 1JH8A 5A04A 4MUXA 3JQQA 2QMEA 1GDHA 4JQSA 3VNAA 3K4QA 3K9WA 5AQ1A 3EGWA 3QQ5A 3RTDA 1GM5A 3F9IA 3K5WA 3KKZA 4J1TC 1DT3A 1EPUA 1YBHA 1JJ7A 1YZ3A 3FNIA 5E6UA 3QVJA 3KCQA 1TVCA 4QA9A 2H4ZA 1HPLA 3C7KA 1IXZA 3CLVA 1YJXA 1B3BA 1W4LA 3I37X 1SPXA 4BWGA 3F6PA 4O4LF 1SG6A 4L2IA 4YAWA 3AIOA 4LSMA 2WJHA 5ECWA 1IE3A 4GQBA 4V24A 3NT4A 1K6JA 1KJZA 1QKIA 2IDKA 5E2AA 1NRXA 4NNJA 5HFJA 1ZOIA 5T4BA 4D5GA 1V48A 4DMHA 5JAIA 2WTUA 3KB6A 4UBOA 1QHHA 4HVAA 1NKTA 1XDUA 2D00A 4HOYA 2AG6A 1Q1BA 2O48X 2R5NA 3MJCA 3DOHA 3GRFA 1KMHA 1XZIA 2Y0BA 2WAXA 1CULC 1ZGZA 1MENA 1BSVA 3IBYA 2ZWVA 3DDCA 5TJ9A 3AYZB 4HAWA 4CT4B 5L95A 2G1KA 2CVQA 3IPYA 1ABBA 1AGNA 1TL7C 3QYFA 4N5NA 1PWYE 3AW8A 4JY7A 4BN0A 4GMFA 1UEIA 2XWSA 4ZEMA 2R5WA 3HSKA 1U99A 1HUQA 2PX3A 3DZKA 3HWSA 3PCRB 3QI2A 4JUAA 4PAGA 5KSZA 2X23A 1FDTA 2AV6A 4LMPA 4X6XA 1BYUA 3F8TA 4M60A 1ZC4A 4TMFA 5D5HA 2BHTA 3QYPA 3GLGE 3PC7A 4FDUA 4D97A 1PZHA 3P27A 4MLZA 2MSLA 3G5AA 2OV4A 2HMTA 2XMZA 1LLFA 4NRDA 1NBMD 3HCDA 4ENRA 1WBDA 1P0MA 3U3KA 2I4RA 5BVGB 2R65A 2Z3ZA 2P62A 1OMOA 2JC3A 2VPIA 2X0RA 3FGOA 3RSFA 5BR8B 4W82A 3BT7A 5P8WA 1N3IA 3OEHD 4UUPA 2NPOA 4DAOA 2WQ6A 3UTCA 1H93A 1XRPA 4K6GA 4UZSA 4JROA 1JA9A 1TT5A 2QM3A 4N8SA 4QODA 1ECFA 3A3OA 4Z9XA 3DZJA 4XUDA 2X0EA 3TTWA 1A97A 4F4JA 3RH0A 3WIUA 4E1AA 5CTJA 1KNXA 4M1YA 4FU0A 4MO2A 1C3LA 1ZC3A 4I8XA 5LYJB 2QTAA 4F3TA 1E2EA 2DTEA 4E5VA 4EFLA 1DCTA 4EA9A 1SAYA 1KYZA 3OPYB 3QVWA 4MAFA 3BMNB 3BIXA 5LQNA 3IBCA 2QNIA 4ZP1A 5BNTA 3I9MA 4UUAA 4V3BA 1PI3A 2O5CA 3GN2A 1OC2A 4HCJA 1FXSA 1TTQB 3N39C 1A7JA 5KSOA 3KZOA 5AH0A 1PQUA 2XWPA 1C4OA 1A9PA 1WEHA 1RYBA 3IXMA 3HNRA 4TM7A 5L9AA 2I34A 2ZUFA 4E5NA 5KJEA 3LUPA 4Y2GA 1T6YA 2F1RA 3IR5A 3PC8A 1YACA 1ZUWA 5D3MB 3OPQA 1ZWKA 3G9ZA 4RABA 4OUDA 4EI8A 2NZUG 3A4TA 4M98A 4TRMA 3CLKA 3UMVA 4KFTA 3CZRA 4AUKA 2CB0A 3I2KA 4D9KA 1K08A 4ZAVA 3MTDA 2P1DA 1SRRA 3JQBA 3WDLA 5L4NA 5DLQC 5JFTA 1E0DA 1QFMA 1DIGA 3DYVA 3PNOA 4LJ7A 2IL1A 3LZ6A 3SC3A 4B33A 5JYBA 3IE1A 3FPBA 2HGSA 1P75A 3ODGA 4WDQA 3CZ9A 1Q74A 5AVKA 2ZIAA 4LJLA 4QDZA 4BGDA 1WMSA 1WZCA 2R66A 4P84A 5EIAA 1QIFA 4ZTUB 3I72A 3OEEA 4EIWA 4OHYA 4UEKA 2XNSA 1NLYA 2HU5A 3UHAA 2MU1A 3QVXA 1DFHA 2AXQA 2GNPA 4M1SA 4DMCA 1OLUB 4ZHQF 3UK6A 2IEZA 4GX1A 1FUUA 2HU8A 1ITZA 5EMMA 3NNNA 3CH5A 1LDYA 4LZNA 2BKLA 2QMOA 1V26A 2JGJA 1Z2AA 1J6UA 1D6JA 5HJ2A 5U1PA 4E08A 3DUFB 1JTVA 1Y4SA 2D7CA 2DFNA 1E3QA 3K31A 4HGRA 4ER5A 3KXLA 3AVUA 2DWPA 5HIIA 3HCBA 5JLJA 1FTQA 3UFBA 2X0KA 2A0UA 3KVVA 4KQCA 3RFCA 5I9NA 2I03A 5GADl 3T1QA 3WK9A 3FCEA 4OD0A 3TLXA 1UZNA 3PXXA 2BI8A 4NFSA 2O1SA 3F4LA 4CTKA 2WZDA 3NBMA 4ENUA 2D7DA 4BNHA 1G2QA 1N2JA 2QVXX 1N2OA 3AU9A 4CMJA 1M2FA 2JVJA 3T3GA 1RBZA 3KLBA 4R8MA 3PYXA 2OCYC 3OQ6A 4D56A 4EX6A 1E96A 3K15A 1EK0A 2HWYA 2WWXA 1LKZA 2C92A 2EFGA 3HABA 5B1IA 5B4VA 2RHBA 5CLJA 4FZ5A 3JYHA 1DADA 1X8LA 1XA4A 2SKDA 5BV8A 2I9KA 3G9QA 3L6RA 1PLKA 2JDIA 1GNLA 1LBIA 3ANXA 3KLPX 4WASA 1H0SA 1NVAA 2D5LA 3N9IA 4AMBA 3W06A 1IJEA 4BVGA 5A9SA 5CD9A 1UC9A 5K4HA 2AYXA 2WMOB 3HY6A 3LBHA 4WKOA 5DTIA 4ZU3A 4DYHA 3ZHQA 1SFRA 2A4MA 4PZUA 2B8TA 3V1YA 1NE7A 1YDHA 3U4QB 2DJIA 2AEFA 4KFSA 3Q41A 2PWPA 4TVSA 4WXEA 5C7OO 2HPZA 1BQEA 1Y8CA 2EKDA 1U90A 2WIKA 2XPCA 2CLMB 4Q16A 1II8A 4UHBA 1W29A 2O5RA 5HK9A 1MDBA 4BAZA 2OQRA 1E1LA 2REOA 3VNQA 1KQGA 2JFYA 3DDZX 4G2NA 1ZI8A 2WM9B 5F98A 2KE5A 3G17A 4KVGA 3BD7A 1ZUNA 4PLYA 4NFLA 1HDRA 2ZI7A 2O2CA 3W7BA 2UVDA 1K68A 3RRXA 3GLFE 1EVQA 3EXG1 4GX0A 3ZWXA 2BEWB 4FHZA 4O4IA 2AMYA 1YOVB 1F8YA 2BJWA 1GIAA 5EVJA 5EZYF 5AVRA 3K20A 3GJ4A 3PWZA 4M46A 4BP9A 5HVNA 1ND6A 1DX4A 4JD5A 4HYEA 3DM5A 3HL0A 4MI9A 3AI3A 1E98A 2UVPA 2ZJ3A 1ISFA 3AP3A 4NMLA 4AURA 4L95C 3RGGA 4ESEA 1A9SA 2ODAA 1TE2A 3OOHA 2GUWA 2AFHA 2J1LA 1MO5A 1F7VA 5TS2A 3KQKA 2C7QA 1M0TA 2DPYA 3LW7A 5F7XA 4Y0NA 4CKCA 3M6IA 3NBYC 3CEAA 3QWBA 3X0DA 4F5EA 1NGSA 4LXTA 4RIFA 1AUQA 3FAKA 2HWWA 1PUIA 1OD6A 4E5SA 4LC9A 2JIZA 2Q7OE 4J7CA 1UXIA 4DDVA 1B43A 2F1JA 4FSHA 4C0QC 1TQHA 4K9QA 2ZZMA 4JEUA 4BNJA 1Q1ZA 3PXGA 4Y6PA 2AZTA 3IS3A 4WK0B 4A8HA 3R9KA 2HRDA 1ENYA 3A6LA 5ERXA 4RJTA 1ZHFA 2CFOA 3L93A 2IZ0A 4KXXA 1HDCA 5EFOA 1WSBA 4II2A 4Q6BA 1N32B 1PFGA 2N46A 1PJAA 4R2JA 4CFZA 2E4YA 4QUEA 3IEVA 2Q6OA 4FFPA 5EINA 1M2EA 4O1MA 5LC1A 4CL0A 1CR6A 2XIJA 2Z8YA 2PQ0A 4NENB 1DHTA 4E5DA 1T9AA 3IQHX 5A4IS 5F7OA 4CETA 1G8PA 5HXAA 2XZOA 2UXBB 1MO6A 2ZBGA 1QUFA 3HA2A 4V0SA 3FWPA 1BMFA 5ALYA 1NLUA 3WRXC 1TPYA 5IXJA 1GNRA 3L0DA 2C99A 4ZVNA 3LZDA 3ETGA 3IKTA 5FPYA 3GDGA 3R3UA 4L6AA 4UOQA 1LRKA 3GVIA 1HFJA 1CQJB 2Y1LA 1YL7A 3N28A 4CLXA 3KL4A 3KHSA 1ZA2A 5DSTA 2D4AA 1F8UA 1OAOA 4FYYA 1KMIY 3PPIA 3LLUA 3E0QA 1I1HA 1K7FB 2WPDD 3HA7A 4U3JA 3E2PA 3OJWA 3RHFA 2Z2YA 3EQ9A 5AW5A 2WSLA 2OK7A 4PAWA 2VS1A 2I3DA 3GRYA 3ZBUA 4IZOA 2B2CA 3Q3JB 5EWLB 1KK3A 1R64A 2V7QD 4LPSA 5EUMA 3LRPA 1LPPA 1YUBA 3VU9B 3RDPA 1UT8A 2ZI4A 1FA9A 2JEZA 3JQ6A 3GLGB 3G1TA 1X0VA 2A78A 2H3EA 2IU6A 3FJYA 5CVTA 5ADVA 5GZ1A 1LK0A 3VKGA 1G5PA 2ETXA 1YULA 3LRTA 5KYYB 3I6MA 3SHOA 3L0SA 3LQRA 4V1CB 3QWHA 5HKAA 1RMTA 1PTKA 1JBEA 1ZGHA 4K46A 2OFWA 1TVEA 3NAZA 4QBIA 5SY9A 1JIQA 4EKDA 4AJ2A 3KQQA 2VDRB 4ZT5A 4IIDA 4X63A 3WYNA 3ZN2A 2BVNA 3PDCA 3PNLA 1N78A 1MFZA 2R00A 2R3SA 4FGZA 2QNBA 3R77A 4QTZA 2QTGA 3OBIA 2Z2IA 3AUTA 2XGMA 2YXBA 4LYYA 2FWMX 5ALNA 1Y9EA 2GESA 1K3UB 1NI5A 4YI3A 5ALDA 4ZARA 3IOMA 4FW9A 4DUPA 4F84A 4MPTA 3O0TA 3ORHA 2HCRA 1X1BA 4UATA 3OPMA 3R9WA 1CZNA 3KE8A 3AFMA 2WWYA 3ZXYA 5EMLA 3V4PB 1R18A 4QJ4A 1LLUA 1RDFA 3EQZA 3CRNA 3SQLA 1WULS 4BB5A 4EW6A 4KH1A 3DBHA 1VLJA 1A5TA 1J9GA 1JLLB 1JDBB 1XLVA 1DEKA 2PLFA 4W8HA 2XXBA 3GVHA 3ZNPA 1DDGA 1QZZA 1VL2A 3FR7A 3FYTA 4JBNA 4AZVA 1YAJA 1A5AB 3H5AA 3PF9A 1SR8A 2AC2A 5E7MA 4UJ3A 1IMOA 8ATCA 3NP9A 1V71A 2G88A 2C9BA 2GPYA 2XNDD 5AESA 3PUYA 3O3OB 5A5DA 4QLOA 4D5EA 4X93A 1MO2A 2EQBA 2IS2A 3HV0A 4TTJA 3LQKA 1T3TA 5JVDB 1UK8A 1J8MF 3NOOA 3STUA 2BP7B 3BSFA 2XF2A 3IP6A 3CVXA 3H3XA 4BO3A 1L4BA 1KEWA 3D2BA 3HJAA 5E0KB 3ZTYA 1G8SA 1SVLA 1STOA 2ZXEA 3GUYA 4EPWA 2A1IA 2B83A 3A3PA