1JM0A

Crystal structure of four-helix bundle model
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jm0A00
3FXEA 2KIKA 1LP1A 1S3JA 1MFTA 2UWJE 1OVVA 5CBNA 2OTKE 1LP1B 4EYYQ 4HJGH 4NPFX 4ZNCA 2LR2A 2WMMA 2JWDA 2B87A 5DJUB 2SPZA 1OVUA 1Q2NA 1JMBA 4JBZA 2K3RA 2M5AA 1BDDA 5EFWB 2QRXA 2KZJA 4K35A 5K5GB 3QWOC 1BDCA 1U7MA 1Y47A 1X0TA 2HR3A 1OVRA 1EC5A 2LXBA 3MZWB 4GOEA 4GOFA 4IOIH 1ZXGA 2KS1B 4ASWA 3PH0A 1FC2C 2ZAEB 4ASVA 5CBOA 1H0TB 2Q1KA 4MN4C 1H0TA 2KI7B 4NPEA 2KUBA 3S1KA 2KZIA 3FXDA 1JM0A 1LT1A 3ZDMA 4ZMDA 1EDIA 4CPGA 4BXLA 2LXCB 4NPDA 2R44A 1EDLA 5DJTB 1EDKA 4WWIA 1DEEG 4HKZH 2P58A 2RKLA 2M0BA 1SS1A 3MHVA 1EDJA 2M5AB 4GODA 4HB1A 4KJMA 1ZW0A 5C39A 1NVOA 2B88A 2B87B 4K3AA 1U7JA 2I8DA 2QVAA 2B89A 3RGUA
chains in the Genus database with same CATH superfamily
3CX5I 3M0AA 5M1BA 3CWBG 1YJ9P 2K88A 3VP8A 4OWFA 3JSVC 2Q5UA 1L4AB 3L37A 1SQBK 2CPSA 1YTZI 1Q7YQ 1NH4A 3BASA 3BRTB 3HD7D 2G8YA 5APWA 2YKPA 3TGUJ 2Z5IA 1LTBC 3EFFK 1IZNB 3WUVA 2QJKB 3I55P 1P84D 3TYYA 1IK7A 3M0DA 3MIWA 5KLIC 2H88C 3S1KA 1YJWP 4WB4A 5CBNA 1AQ5A 5KLVE 3A0HH 5BVZA 1BSNA 4AUWA 1OW8A 2HODA 2OTKE 5AW0B 3MGNA 5APSA 1LTJC 3CCLP 2WT7A 3OAKA 2AXTE 3TNUA 3JC22 3UIAA 3MUDC 3S4RA 2D2CB 3GHGA 3QH9A 3H1ID 2WMMA 1JOCA 3L74E 2ZXXA 1KILC 3CCJP 1GD2E 1OFCX 1L4AD 2MKVA 5KLVD 2E76B 1QL2A 1RQUA 1X9VA 3L70J 4EOTA 3CCMP 1M8OB 4WY4A 1KILD 2V4HA 3B5NA 3W68A 1ZP0C 2A06D 2A45G 4R4LA 5TISH 4IL6E 1AV1A 2JWAA 3GG2A 4PV1D 3H1HE 4YPCA 1LJ2A 1Z56A 5KJ7D 2ZT9B 3CI9A 1IFDA 4M3LA 3BVHA 1JUNA 1JY3P 4I2LC 1ZLLA 5KLVG 1KMIZ 1KORA 1SQVJ 1X0TA 2OQQA 3CX5H 3RBXA 1EZVE 5AW5B 1CZQA 1EC5A 1OXZA 2A06G 3H1IJ 1LTTC 4YXWH 3VMAA 1GTWA 1LT9C 3W67A 1VQ7P 1H88A 2XU6A 3Q1MA 1KQFB 4AQRD 1ZXGA 3A2AA 1FZCA 1AQTA 4H13D 2Q7CA 1T6AA 1XTGB 2E5TA 2V7QH 4GKGA 2WITA 4ASWA 1GW4A 1URQD 3E1RA 1RH5B 4D6TG 2CK3H 2E76D 3V4QA 3JCUH 2JKVA 5AVRB 2W83C 1A02J 2A06E 4KT0J 1NKZB 3H1LD 1BE3G 1M7LA 2NPSC 5AVUB 3H1HG 5CBOA 1AVYA 1GK4A 2Q1KA 1H0TB 1L0LJ 3ABVC 2FYNC 2J5UA 1MV8A 1PIXA 2KUBA 5AW3B 3GW6A 4Y28J 1JO5A 2NPSD 1EQ7A 3L35A 3NMDA 3ZDMA 4RKUJ 1A02F 1X79B 3BATA 2ZVOB 1U57A 1KQLA 3RK3B 1LT9B 4H13B 1N8RQ 2OYHA 1BGYJ 2OYIC 1IFMA 1YBKA 2K37A 1FZCB 4AYCA 1M57D 1BE3E 2E74D 2R32A 2IBZG 4NPDA 3H1LG 4XA4A 5CMZA 5AVZB 1SQPE 3L74G 2R44A 1M90Q 5DJTB 1SQXJ 1FOSF 1LTJA 3A0BH 3G9RA 2BCCD 1HTLC 2BCCE 2E74C 2NZ2A 4PV1C 4U3FE 4R4MA 2WSEH 4C7NA 3PRJA 3I56P 1KYOD 1NJIQ 5CCGD 2W6BA 1RE3A 1N86A 3L74J 1KB9I 5APUA 2GA1A 1VQMP 2YNYA 3CWBJ 1NGMB 2KLUA 2M0BA 4N78D 1VQOP 2NPSB 1L0LD 3AE4C 3LIDA 4RO0A 3H1JJ 3KYQA 1FS0E 2KXPB 3P32A 2BCCG 1T2KD 1S2EA 1S72P 1SQPK 2ZT9C 3CXHD 5APTA 4WY4B 1DIPA 3VMXA 2KNCA 1S5LH 2WSFJ 1EZVG 3PLNA 3ITKA 2FXOA 4PD4D 1EXIA 1R5LA 3HTKA 4IL6H 1GK6A 5TISE 1S4XA 4H13C 2OYIB 1JTHA 2B9BA 2XDJA 3CPWO 1RF0C 2QM8A 1DD4A 2P10A 1SQPG 3GHGB 5AVTB 5GTIH 4Y99C 3KZIH 5KKZB 2Q6QA 2OTLP 4IFFA 3AEDC 1USDA 2GUSA 3HD7B 4U3FG 2GM4A 2IZ1A 3T97B 5KJ7A 1SQXK 2N9BA 3CX5D 1JMMA 2HODB 3L71J 2QJKC 1S3JA 1RF1A 5AW4B 2IPPA 1MFTA 2UWJE 1H8AA 1M1KQ 1BGYG 1WT6A 4UB6H 2M3EA 4WY4D 1BCCD 1EXJA 2FY8A 5KAIE 1KN7A 1K04A 1L0NE 4U3FJ 3Q3DA 2WQYC 2Y9ZA 1ZMEC 3M91A 1P84I 2QE7H 1K9MQ 1QVFO 3HUSC 4WY4C 1LP1B 3RK2D 2I1KA 4ZKUA 1VQLP 3TGUE 1BGYE 2Q3IA 1FDOA 3H1LE 2PRRA 2H8PD 3AE5C 3H1KD 1N73B 2A45I 1QGKB 3II6A 2H89C 1VQ9P 1FDIA 5CCGC 3D71A 1NWQA 2OYHC 2JWDA 2DW3A 2VRSA 3I5CA 3VOPA 1PGOA 1SFCD 3A3YB 1MZ9A 2OYIA 2FFDB 2SPZA 2WSFH 3VMYA 3BCCJ 1W5CE 3B5ND 2C0XA 2E74B 1KILE 1IFPA 1NTMJ 4JBZA 2WWWA 2K3RA 2M5AA 1LTAC 1M56D 2R5BA 2C9NY 1HH0A 1IO4A 2FXMA 3EQ2A 5K5GB 3GF3A 1QL1A 1S9KD 1NOHA 5B66H 3H25A 2HPCB 3QWOC 1USEA 2JEEA 1AA0A 1X22A 2KK7A 4OGQD 2WSCH 1Y47A 3AEAC 4EDFA 3D6ZA 1JB0J 1S1CX 3FX0A 1PGPA 1SFCB 2AEJA 1FZBA 3L71D 1T2KC 1DH3A 3L71E 1HJBA 1LTJB 4LC1A 1GL2D 4DZOA 1ZR2A 4GIFA 1S5LX 3B4SA 4L74A 1L0ND 3P7KA 1G1JA 2OTJP 1J1EC 2IZ0A 2KS1B 2ZVNB 3M9QA 3LW5H 1HVVA 3A0BE 2P67A 4OVNF 3EWKA 1K05A 4W80A 5CCHA 2N9YB 3RBZA 3CXHH 4PJ0H 3FWNA 4BRYB 3CLQA 1QEXA 3GF7A 1VQKP 3L71G 4IFMA 1OW6A 1TU3F 2IBZE 2L5GB 3SFEC 4MN4C 2QJPC 3IFMA 1KQGB 5CJ4A 3D70A 3BCCE 4N3YB 1H0TA 5CCHD 1L0NG 2O1KA 4NPEA 2FYNB 2ZJSE 2Y9YA 2OARA 3VYIA 3L75E 5GTIE 1JM0A 3AECC 4ZMDA 3AE3C 1L0LE 4JQ0D 4H0LB 2XV5A 1JCDA 1N2DC 3AEGC 1JY3O 4H44D 1NTZK 1JY2P 2M8RA 4L73A 3TGUG 4A7PA 1PL5A 1VF5C 2KS1A 2HFED 3N7NA 3CWBD 3TK1A 3CCRP 1SQVK 1Q90D 1KILA 5AVWB 3S9OA 1M1JB 1SQBJ 4H44C 1FZEA 2XKMA 1MUUA 3H1HJ 4DT0A 2QA4P 3Q5PA 2AEMA 2PGDA 4WWIA 4XFJA 1FZAA 3NFQA 3AEFC 1FZGA 2IDBA 4HKZH 1N7SA 4WBAA 3P8CD 1L4AC 2HPCA 3TGUD 1E79H 2P58A 3CCVP 1FJPA 2RKLA 1KYOI 1Y8AA 2O01H 1SS1A 4D6TD 2N1TB 2IFNA 3H32B 3BCCG 3SWFA 5KAFH 3U1CA 2Q3EA 1EDJA 1SQVE 2M5AB 1FOSE 1CSBA 4GODA 3N4XA 3NTNA 1YQ4C 2WTYA 4HB1A 1K8AQ 1L0NK 1HGZA 1IFNA 1ZW0A 2FYUK 1YTZT 3CL3D 3H1LJ 1GW3A 3PTZA 5KJ7C 1NTZJ 1YHQP 1R5SA 3CCEP 3CXHI 1NVOA 2FFDA 2B88A 2BEZF 1VL2A 1SVFA 3IAOA 4H44B 3AE2C 4K3AA 2ZXEB 1U7JA 2K9JA 1GU4A 1KB9E 1NTMK 2E5YA 1FZCC 3Q5SA 1M1JC 2IBZI 3H1JD 4LLHA 1EDKA 1SQVG 1LWUA 3BCCD 5H2FH 1GZLA 4WVZA 2KIKA 3HUSA 1LP1A 1PGQA 2IYPA 2FBWC 4UB6E 3EFGA 1VQ5P 2CPBA 2J59M 3H1IE 2FKWB 2A45H 3FGAD 3L73E 5AW1B 1E5WA 1AJYA 2WZ7A 3IF4A 3JCUE 5GTHH 1UIIA 2WVRA 3E7KA 2M3BA 1LTIC 1OVVA 4L75A 1G1IA 2W27A 4Z1MH 1SQVD 1XTCC 5H2FE 2JR8A 5AVXB 3M06A 3RK2B 1L4AA 4EIJA 5APVA 5BU8B 4O9BA 3VN0A 1NTKJ 2IFMA 2JP3A 1NTZD 2O01N 1D7MA 3HUSB 3HD7A 3AE1C 1NTMD 3L73G 1BE3J 5CHXA 2QJYB 1SQQE 1LWUB 1NTME 1GU5A 1RF0A 3SWYA 3U59A 5B5EE 2OYHB 1FU1A 1VPCA 2PP6A 2WPSA 2BEQD 1NO4A 2K9JB 1CI6B 2KP8A 2LR2A 4ZNCA 3CX5E 2FYZA 2YKOA 2AXCA 1JTHB 1QVGO 1URQB 3M9BA 1HBWA 3CMAP 3HTKB 3V4WA 3KHUA 3H1HD 1OX3A 1OVUA 4PD4H 1KFMA 1Q2NA 2QEXP 3Q5RA 2FFDC 2XZRA 3CC7P 1RQVA 2O1JA 2XNXA 2E75D 4YXDC 2L91A 3V2PA 3GMAA 1S9KE 1HWTC 2KLVA 1NTMG 1BDDA 3L73D 3WMM0 5EFWB 3OJAB 2C9LY 4PD4I 5AW8B 5L8RJ 3V2RA 2N1TA 1QLED 2KZJA 1NYHA 1JEKA 2RN0A 1LGHB 1SQXE 1WMKA 1BDCA 1BCCJ 1SLQA 2N1TC 1SQPJ 1OWAA 3BRVB 4QMAA 1YITP 4BRYA 3L75J 1ZV8A 2Q9IA 1OMIA 3A7OA 3LW5J 1YIJP 4C7NB 5CJ0A 2YIUB 4GDOA 4I7ZC 2N1TD 4IFDK 3AE6C 4YTPC 1J1EB 1URQC 2LXBA 3SSUA 1KILB 3L36A 2D2CD 4GOEA 1FZFA 1DD3A 3H1KJ 1SQXD 3HE5A 3R2PA 3HD7C 3IR9A 3L75G 1GDTA 2Z5HA 1L0LG 1FE6A 1FC2C 3KQGA 3A5TA 3H1IG 3B71A 3G71P 2ITAA 2YMYA 1IFIA 2E42A 4BWNA 1FJKA 2O3JA 2WPQA 4I1LA 1EZVD 2K1AA 1G2CB 2FYUJ 2Z4EA 1L0NJ 3L70E 5APXA 4H0LD 3HRNA 3M0DC 1HJ0A 1ZOYC 2KZIA 1SQXG 3OA7A 1VQ6P 5KAIH 3L75D 5APQA 4C7RA 1LT1A 4DCKA 1RE3C 1IJDB 1SQPD 1EDIA 3TDKA 4CPGA 2BASA 4H0LC 1SQQG 3WUTA 2W6AA 1SP4A 2LXCB 2YIUC 3O6QA 4I7ZB 3TF5A 3B8EB 1LNQA 1NTKK 5AW2B 1EDLA 2E75C 1ZRTD 2FYUE 3GHGC 1MKMA 3NXSA 2YO2A 1J1DB 5AVQB 5AW6B 4ZKPA 5B66E 3MTUE 3SWKA 1BCCG 2OGUA 1DEEG 4JYCA 1PPJD 1OZHA 3KXDA 2KB7P 1SQQD 3VMZA 4C46A 1KC8Q 3WUUA 1GMJA 3USSA 2MJZA 1AFOA 1BSHA 2FYUD 2KYVA 3L70G 5AVSB 1HUCA 3F89A 5AW9B 3RK3E 1PZQA 1NTKE 1RHZB 3H1KG 4RJTA 1BE3D 2I1JA 2YXRB 3KPEA 1P84E 5C39A 1RF1C 3H6PA 1DX7A 2JJLA 2D2CC 2Y0DA 1VQ4P 1PPJG 3PHLA 3WU2E 2B87B 4OGQC 3P8MC 2K9YA 1DEBA 3U1AA 1J1DC 1HGVA 2BCCJ 2QVAA 2H7HA 2E76C 3M9HA 1VF5B 3L73J 1JY2O 1L0LK 1PP9J 1KYOE 2B89A 2FYUG 2WSSH 2ZYAA 3L70D 3RGUA 3TNUB 4DJGA 1K73Q 3FXEA 2WT7B 1ZR4A 1SQQK 2IBZD 2H43A 1NU1J 3OW2O 4N78E 4W7YA 1PFIA 3HE4B 3L74D 4JYBA 2PFXA 3C9IA 4N6JA 5E79E 4DOJA 1KQSO 2IX7C 1SQQJ 3KDPB 2O01J 2P7JA 2POHA 3F5HA 4RESB 3RK2C 1LTGC 5BU5A 2RH0A 1IC2A 2E43A 2G3AA 4OH8B 2R5DA 3KZIE 1RF1B 3HE4A 1R8EA 2P1JA 4L76A 3T97A 5GTHE 3Q2YA 1NAFA 1VQ8P 1KTMA 5AVVB 5TJHA 2NRGA 3RK3C 4EYYQ 1SFCC 1Y9BA 4HJGH 5E79H 3RL0g 2GUVA 4NPFX 4OGQB 4U7JA 2WPVB 1N7SD 1LTSC 1OW7A 1VDFA 1S5LE 2LKMA 2QG4A 1OIPA 4Y99B 1NU1E 5KKZC 2WSEJ 3MP7B 4KHXA 2B87A 2R3CA 3MUDA 5DJUB 5KAFE 3V6IA 1AVOA 1BCCE 3IN6A 4PV1B 2KNCB 5KLVK 2W8ZA 1JMBA 2HYNA 2QRXA 3G4SP 2ZT9D 3CCSP 3H32A 2YMKA 4U3FD 3L72J 1N7LA 1NTZE 2KSEA 2NPSA 2WPRA 3B5NC 4K35A 5AW7B 4PD4E 1JNMA 1ZRTE 3SFDC 3CCQP 1KV4A 3G3ZA 1KFNA 1U7MA 1N7SB 2QM7A 3H1KE 1KB9D 1BGYD 1FAVA 2HR3A 3RL0D 1KZUB 1HF9A 3L72G 1W2BO 5B5EH 1Q86Q 1OVRA 1RE4A 2HG5D 2R3SA 3MD0A 3GLMA 2P2UA 1M1JA 5KTBA 2OYOA 1JCCA 1LWUC 1T3UA 3E1IA 3MZWB 1RE4C 4GOFA 3O6QB 1NAYA 2W90A 4GT1A 1UIXA 4IOIH 4UB8H 1PP9E 3PH0A 1LT9A 3PJSK 4JPZB 1IFJA 2WSCJ 3D6YA 2ZAEB 3L72E 2C0WA 4JF7A 2W6JH 3L72D 1GL2A 3AE8C 2XNDH 2AEFA 4I6MC 2AXTH 3CCUP 1VQPP 4ASVA 3K5BA 2QIWA 3RL0B 3AEBC 1MFZA 1PV3A 1G2CA 2V7QJ 1H89A 5AVYB 1J2JB 2KI7B 1YI2P 3RK3D 3C1LA 1VF5D 1GL2B 3FXDA 4UB8E 1X8YA 1FBMA 2ZYDA 1WRGA 2ZFCA 3PP5A 3TSIA 3C8VA 1KB9H 1N7SC 3L4FA 1YYCA 4D6TE 4BXLA 3CD6P 3H1JG 5CCHC 1JY3N 2J58A 3HE5B 2E75B 3FWLA 3CXHE 4PJ0E 4EI2A 2HLOA 1NKNA 4HYTB 2RMZA 3V2QA 1NU1G 3V5BA 1T3JA 1YQ3C 4HH2A 2KSJA 2YKQA 2ZYGA 3VP9A 2Y0CA 4W7ZA 3CC2P 1VQNP 1NTKG 1KYOH 1SFCA 1L2PA 1QX8A 2IYOA 3AEEC 3LIEA 2JDIH 3H1JE 3G6EP 5APYA 1PPJE 1SQBG 2YO3A 3AE9C 3WU2H 1T8ZA 2QJPB 2Y0EA 4D6TJ 1NTZG 1P84H 4LGDE 3RL0C 1NHLA 3MHVA 3V2NA 3VTPC 5KLIB 1YJNP 1NU1D 1PP9D 1Q82Q 1JY2N 1ZN5A 1FDMA 3CMEP 2JO1A 1NTKD 1GL2C 1PGJA 3B5NB 4IL6X 3CWBE 4KJMA 4TLFA 4XE5B 1KD1Q 1Q81Q 2QSIA 2PAJA 1SQBE 3R4YA 2FXPA 1N73C 3CC4P 1URQA 1SQBD 1IK9A 2QJYC 4TT3H 2YXQB 4B86A 2I8DA 2KOGA 1CI6A 3O8ZA 1NU1K 1N73A 1RY3A 1W2EA 3AE7C 3P8CE 5KLVJ 5CCGA 1CW5A 3A0HE 1PP9G 1EZVI
chains in the Genus database with same CATH topology
3FXEA 2KIKA 1LP1A 1S3JA 1MFTA 2UWJE 1OVVA 5CBNA 2OTKE 1LP1B 4EYYQ 4HJGH 4NPFX 4ZNCA 2LR2A 2WMMA 2JWDA 2B87A 5DJUB 2SPZA 1OVUA 1Q2NA 1JMBA 4JBZA 2K3RA 2M5AA 1BDDA 5EFWB 2QRXA 2KZJA 4K35A 5K5GB 3QWOC 1BDCA 1U7MA 1Y47A 1X0TA 2HR3A 1OVRA 1EC5A 2LXBA 3MZWB 4GOEA 4GOFA 4IOIH 1ZXGA 2KS1B 4ASWA 3PH0A 1FC2C 2ZAEB 4ASVA 5CBOA 1H0TB 2Q1KA 4MN4C 1H0TA 2KI7B 4NPEA 2KUBA 3S1KA 2KZIA 3FXDA 1JM0A 1LT1A 3ZDMA 4ZMDA 1EDIA 4CPGA 4BXLA 2LXCB 4NPDA 2R44A 1EDLA 5DJTB 1EDKA 4WWIA 1DEEG 4HKZH 2P58A 2RKLA 2M0BA 1SS1A 3MHVA 1EDJA 2M5AB 4GODA 4HB1A 4KJMA 1ZW0A 5C39A 1NVOA 2B88A 2B87B 4K3AA 1U7JA 2I8DA 2QVAA 2B89A 3RGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXE A;  2KIK A;  1LP1 A;  1S3J A;  1MFT A;  2UWJ E;  1OVV A;  5CBN A;  2OTK E;  1LP1 B;  4EYY Q;  4HJG H;  4NPF X;  4ZNC A;  2LR2 A;  2WMM A;  2JWD A;  2B87 A;  5DJU B;  2SPZ A;  1OVU A;  1Q2N A;  1JMB A;  4JBZ A;  2K3R A;  2M5A A;  1BDD A;  5EFW B;  2QRX A;  2KZJ A;  4K35 A;  5K5G B;  3QWO C;  1BDC A;  1U7M A;  1Y47 A;  1X0T A;  2HR3 A;  1OVR A;  1EC5 A;  2LXB A;  3MZW B;  4GOE A;  4GOF A;  4IOI H;  1ZXG A;  2KS1 B;  4ASW A;  3PH0 A;  1FC2 C;  2ZAE B;  4ASV A;  5CBO A;  1H0T B;  2Q1K A;  4MN4 C;  1H0T A;  2KI7 B;  4NPE A;  2KUB A;  3S1K A;  2KZI A;  3FXD A;  1JM0 A;  1LT1 A;  3ZDM A;  4ZMD A;  1EDI A;  4CPG A;  4BXL A;  2LXC B;  4NPD A;  2R44 A;  1EDL A;  5DJT B;  1EDK A;  4WWI A;  1DEE G;  4HKZ H;  2P58 A;  2RKL A;  2M0B A;  1SS1 A;  3MHV A;  1EDJ A;  2M5A B;  4GOD A;  4HB1 A;  4KJM A;  1ZW0 A;  5C39 A;  1NVO A;  2B88 A;  2B87 B;  4K3A A;  1U7J A;  2I8D A;  2QVA A;  2B89 A;  3RGU A; 
#chains in the Genus database with same CATH topology
 3CX5 I;  3M0A A;  5M1B A;  3CWB G;  1YJ9 P;  2K88 A;  3VP8 A;  4OWF A;  3JSV C;  2Q5U A;  1L4A B;  3L37 A;  1SQB K;  2CPS A;  1YTZ I;  1Q7Y Q;  1NH4 A;  3BAS A;  3BRT B;  3HD7 D;  2G8Y A;  5APW A;  2YKP A;  3TGU J;  2Z5I A;  1LTB C;  3EFF K;  1IZN B;  3WUV A;  2QJK B;  3I55 P;  1P84 D;  3TYY A;  1IK7 A;  3M0D A;  3MIW A;  5KLI C;  2H88 C;  3S1K A;  1YJW P;  4WB4 A;  5CBN A;  1AQ5 A;  5KLV E;  3A0H H;  5BVZ A;  1BSN A;  4AUW A;  1OW8 A;  2HOD A;  2OTK E;  5AW0 B;  3MGN A;  5APS A;  1LTJ C;  3CCL P;  2WT7 A;  3OAK A;  2AXT E;  3TNU A;  3JC2 2;  3UIA A;  3MUD C;  3S4R A;  2D2C B;  3GHG A;  3QH9 A;  3H1I D;  2WMM A;  1JOC A;  3L74 E;  2ZXX A;  1KIL C;  3CCJ P;  1GD2 E;  1OFC X;  1L4A D;  2MKV A;  5KLV D;  2E76 B;  1QL2 A;  1RQU A;  1X9V A;  3L70 J;  4EOT A;  3CCM P;  1M8O B;  4WY4 A;  1KIL D;  2V4H A;  3B5N A;  3W68 A;  1ZP0 C;  2A06 D;  2A45 G;  4R4L A;  5TIS H;  4IL6 E;  1AV1 A;  2JWA A;  3GG2 A;  4PV1 D;  3H1H E;  4YPC A;  1LJ2 A;  1Z56 A;  5KJ7 D;  2ZT9 B;  3CI9 A;  1IFD A;  4M3L A;  3BVH A;  1JUN A;  1JY3 P;  4I2L C;  1ZLL A;  5KLV G;  1KMI Z;  1KOR A;  1SQV J;  1X0T A;  2OQQ A;  3CX5 H;  3RBX A;  1EZV E;  5AW5 B;  1CZQ A;  1EC5 A;  1OXZ A;  2A06 G;  3H1I J;  1LTT C;  4YXW H;  3VMA A;  1GTW A;  1LT9 C;  3W67 A;  1VQ7 P;  1H88 A;  2XU6 A;  3Q1M A;  1KQF B;  4AQR D;  1ZXG A;  3A2A A;  1FZC A;  1AQT A;  4H13 D;  2Q7C A;  1T6A A;  1XTG B;  2E5T A;  2V7Q H;  4GKG A;  2WIT A;  4ASW A;  1GW4 A;  1URQ D;  3E1R A;  1RH5 B;  4D6T G;  2CK3 H;  2E76 D;  3V4Q A;  3JCU H;  2JKV A;  5AVR B;  2W83 C;  1A02 J;  2A06 E;  4KT0 J;  1NKZ B;  3H1L D;  1BE3 G;  1M7L A;  2NPS C;  5AVU B;  3H1H G;  5CBO A;  1AVY A;  1GK4 A;  2Q1K A;  1H0T B;  1L0L J;  3ABV C;  2FYN C;  2J5U A;  1MV8 A;  1PIX A;  2KUB A;  5AW3 B;  3GW6 A;  4Y28 J;  1JO5 A;  2NPS D;  1EQ7 A;  3L35 A;  3NMD A;  3ZDM A;  4RKU J;  1A02 F;  1X79 B;  3BAT A;  2ZVO B;  1U57 A;  1KQL A;  3RK3 B;  1LT9 B;  4H13 B;  1N8R Q;  2OYH A;  1BGY J;  2OYI C;  1IFM A;  1YBK A;  2K37 A;  1FZC B;  4AYC A;  1M57 D;  1BE3 E;  2E74 D;  2R32 A;  2IBZ G;  4NPD A;  3H1L G;  4XA4 A;  5CMZ A;  5AVZ B;  1SQP E;  3L74 G;  2R44 A;  1M90 Q;  5DJT B;  1SQX J;  1FOS F;  1LTJ A;  3A0B H;  3G9R A;  2BCC D;  1HTL C;  2BCC E;  2E74 C;  2NZ2 A;  4PV1 C;  4U3F E;  4R4M A;  2WSE H;  4C7N A;  3PRJ A;  3I56 P;  1KYO D;  1NJI Q;  5CCG D;  2W6B A;  1RE3 A;  1N86 A;  3L74 J;  1KB9 I;  5APU A;  2GA1 A;  1VQM P;  2YNY A;  3CWB J;  1NGM B;  2KLU A;  2M0B A;  4N78 D;  1VQO P;  2NPS B;  1L0L D;  3AE4 C;  3LID A;  4RO0 A;  3H1J J;  3KYQ A;  1FS0 E;  2KXP B;  3P32 A;  2BCC G;  1T2K D;  1S2E A;  1S72 P;  1SQP K;  2ZT9 C;  3CXH D;  5APT A;  4WY4 B;  1DIP A;  3VMX A;  2KNC A;  1S5L H;  2WSF J;  1EZV G;  3PLN A;  3ITK A;  2FXO A;  4PD4 D;  1EXI A;  1R5L A;  3HTK A;  4IL6 H;  1GK6 A;  5TIS E;  1S4X A;  4H13 C;  2OYI B;  1JTH A;  2B9B A;  2XDJ A;  3CPW O;  1RF0 C;  2QM8 A;  1DD4 A;  2P10 A;  1SQP G;  3GHG B;  5AVT B;  5GTI H;  4Y99 C;  3KZI H;  5KKZ B;  2Q6Q A;  2OTL P;  4IFF A;  3AED C;  1USD A;  2GUS A;  3HD7 B;  4U3F G;  2GM4 A;  2IZ1 A;  3T97 B;  5KJ7 A;  1SQX K;  2N9B A;  3CX5 D;  1JMM A;  2HOD B;  3L71 J;  2QJK C;  1S3J A;  1RF1 A;  5AW4 B;  2IPP A;  1MFT A;  2UWJ E;  1H8A A;  1M1K Q;  1BGY G;  1WT6 A;  4UB6 H;  2M3E A;  4WY4 D;  1BCC D;  1EXJ A;  2FY8 A;  5KAI E;  1KN7 A;  1K04 A;  1L0N E;  4U3F J;  3Q3D A;  2WQY C;  2Y9Z A;  1ZME C;  3M91 A;  1P84 I;  2QE7 H;  1K9M Q;  1QVF O;  3HUS C;  4WY4 C;  1LP1 B;  3RK2 D;  2I1K A;  4ZKU A;  1VQL P;  3TGU E;  1BGY E;  2Q3I A;  1FDO A;  3H1L E;  2PRR A;  2H8P D;  3AE5 C;  3H1K D;  1N73 B;  2A45 I;  1QGK B;  3II6 A;  2H89 C;  1VQ9 P;  1FDI A;  5CCG C;  3D71 A;  1NWQ A;  2OYH C;  2JWD A;  2DW3 A;  2VRS A;  3I5C A;  3VOP A;  1PGO A;  1SFC D;  3A3Y B;  1MZ9 A;  2OYI A;  2FFD B;  2SPZ A;  2WSF H;  3VMY A;  3BCC J;  1W5C E;  3B5N D;  2C0X A;  2E74 B;  1KIL E;  1IFP A;  1NTM J;  4JBZ A;  2WWW A;  2K3R A;  2M5A A;  1LTA C;  1M56 D;  2R5B A;  2C9N Y;  1HH0 A;  1IO4 A;  2FXM A;  3EQ2 A;  5K5G B;  3GF3 A;  1QL1 A;  1S9K D;  1NOH A;  5B66 H;  3H25 A;  2HPC B;  3QWO C;  1USE A;  2JEE A;  1AA0 A;  1X22 A;  2KK7 A;  4OGQ D;  2WSC H;  1Y47 A;  3AEA C;  4EDF A;  3D6Z A;  1JB0 J;  1S1C X;  3FX0 A;  1PGP A;  1SFC B;  2AEJ A;  1FZB A;  3L71 D;  1T2K C;  1DH3 A;  3L71 E;  1HJB A;  1LTJ B;  4LC1 A;  1GL2 D;  4DZO A;  1ZR2 A;  4GIF A;  1S5L X;  3B4S A;  4L74 A;  1L0N D;  3P7K A;  1G1J A;  2OTJ P;  1J1E C;  2IZ0 A;  2KS1 B;  2ZVN B;  3M9Q A;  3LW5 H;  1HVV A;  3A0B E;  2P67 A;  4OVN F;  3EWK A;  1K05 A;  4W80 A;  5CCH A;  2N9Y B;  3RBZ A;  3CXH H;  4PJ0 H;  3FWN A;  4BRY B;  3CLQ A;  1QEX A;  3GF7 A;  1VQK P;  3L71 G;  4IFM A;  1OW6 A;  1TU3 F;  2IBZ E;  2L5G B;  3SFE C;  4MN4 C;  2QJP C;  3IFM A;  1KQG B;  5CJ4 A;  3D70 A;  3BCC E;  4N3Y B;  1H0T A;  5CCH D;  1L0N G;  2O1K A;  4NPE A;  2FYN B;  2ZJS E;  2Y9Y A;  2OAR A;  3VYI A;  3L75 E;  5GTI E;  1JM0 A;  3AEC C;  4ZMD A;  3AE3 C;  1L0L E;  4JQ0 D;  4H0L B;  2XV5 A;  1JCD A;  1N2D C;  3AEG C;  1JY3 O;  4H44 D;  1NTZ K;  1JY2 P;  2M8R A;  4L73 A;  3TGU G;  4A7P A;  1PL5 A;  1VF5 C;  2KS1 A;  2HFE D;  3N7N A;  3CWB D;  3TK1 A;  3CCR P;  1SQV K;  1Q90 D;  1KIL A;  5AVW B;  3S9O A;  1M1J B;  1SQB J;  4H44 C;  1FZE A;  2XKM A;  1MUU A;  3H1H J;  4DT0 A;  2QA4 P;  3Q5P A;  2AEM A;  2PGD A;  4WWI A;  4XFJ A;  1FZA A;  3NFQ A;  3AEF C;  1FZG A;  2IDB A;  4HKZ H;  1N7S A;  4WBA A;  3P8C D;  1L4A C;  2HPC A;  3TGU D;  1E79 H;  2P58 A;  3CCV P;  1FJP A;  2RKL A;  1KYO I;  1Y8A A;  2O01 H;  1SS1 A;  4D6T D;  2N1T B;  2IFN A;  3H32 B;  3BCC G;  3SWF A;  5KAF H;  3U1C A;  2Q3E A;  1EDJ A;  1SQV E;  2M5A B;  1FOS E;  1CSB A;  4GOD A;  3N4X A;  3NTN A;  1YQ4 C;  2WTY A;  4HB1 A;  1K8A Q;  1L0N K;  1HGZ A;  1IFN A;  1ZW0 A;  2FYU K;  1YTZ T;  3CL3 D;  3H1L J;  1GW3 A;  3PTZ A;  5KJ7 C;  1NTZ J;  1YHQ P;  1R5S A;  3CCE P;  3CXH I;  1NVO A;  2FFD A;  2B88 A;  2BEZ F;  1VL2 A;  1SVF A;  3IAO A;  4H44 B;  3AE2 C;  4K3A A;  2ZXE B;  1U7J A;  2K9J A;  1GU4 A;  1KB9 E;  1NTM K;  2E5Y A;  1FZC C;  3Q5S A;  1M1J C;  2IBZ I;  3H1J D;  4LLH A;  1EDK A;  1SQV G;  1LWU A;  3BCC D;  5H2F H;  1GZL A;  4WVZ A;  2KIK A;  3HUS A;  1LP1 A;  1PGQ A;  2IYP A;  2FBW C;  4UB6 E;  3EFG A;  1VQ5 P;  2CPB A;  2J59 M;  3H1I E;  2FKW B;  2A45 H;  3FGA D;  3L73 E;  5AW1 B;  1E5W A;  1AJY A;  2WZ7 A;  3IF4 A;  3JCU E;  5GTH H;  1UII A;  2WVR A;  3E7K A;  2M3B A;  1LTI C;  1OVV A;  4L75 A;  1G1I A;  2W27 A;  4Z1M H;  1SQV D;  1XTC C;  5H2F E;  2JR8 A;  5AVX B;  3M06 A;  3RK2 B;  1L4A A;  4EIJ A;  5APV A;  5BU8 B;  4O9B A;  3VN0 A;  1NTK J;  2IFM A;  2JP3 A;  1NTZ D;  2O01 N;  1D7M A;  3HUS B;  3HD7 A;  3AE1 C;  1NTM D;  3L73 G;  1BE3 J;  5CHX A;  2QJY B;  1SQQ E;  1LWU B;  1NTM E;  1GU5 A;  1RF0 A;  3SWY A;  3U59 A;  5B5E E;  2OYH B;  1FU1 A;  1VPC A;  2PP6 A;  2WPS A;  2BEQ D;  1NO4 A;  2K9J B;  1CI6 B;  2KP8 A;  2LR2 A;  4ZNC A;  3CX5 E;  2FYZ A;  2YKO A;  2AXC A;  1JTH B;  1QVG O;  1URQ B;  3M9B A;  1HBW A;  3CMA P;  3HTK B;  3V4W A;  3KHU A;  3H1H D;  1OX3 A;  1OVU A;  4PD4 H;  1KFM A;  1Q2N A;  2QEX P;  3Q5R A;  2FFD C;  2XZR A;  3CC7 P;  1RQV A;  2O1J A;  2XNX A;  2E75 D;  4YXD C;  2L91 A;  3V2P A;  3GMA A;  1S9K E;  1HWT C;  2KLV A;  1NTM G;  1BDD A;  3L73 D;  3WMM 0;  5EFW B;  3OJA B;  2C9L Y;  4PD4 I;  5AW8 B;  5L8R J;  3V2R A;  2N1T A;  1QLE D;  2KZJ A;  1NYH A;  1JEK A;  2RN0 A;  1LGH B;  1SQX E;  1WMK A;  1BDC A;  1BCC J;  1SLQ A;  2N1T C;  1SQP J;  1OWA A;  3BRV B;  4QMA A;  1YIT P;  4BRY A;  3L75 J;  1ZV8 A;  2Q9I A;  1OMI A;  3A7O A;  3LW5 J;  1YIJ P;  4C7N B;  5CJ0 A;  2YIU B;  4GDO A;  4I7Z C;  2N1T D;  4IFD K;  3AE6 C;  4YTP C;  1J1E B;  1URQ C;  2LXB A;  3SSU A;  1KIL B;  3L36 A;  2D2C D;  4GOE A;  1FZF A;  1DD3 A;  3H1K J;  1SQX D;  3HE5 A;  3R2P A;  3HD7 C;  3IR9 A;  3L75 G;  1GDT A;  2Z5H A;  1L0L G;  1FE6 A;  1FC2 C;  3KQG A;  3A5T A;  3H1I G;  3B71 A;  3G71 P;  2ITA A;  2YMY A;  1IFI A;  2E42 A;  4BWN A;  1FJK A;  2O3J A;  2WPQ A;  4I1L A;  1EZV D;  2K1A A;  1G2C B;  2FYU J;  2Z4E A;  1L0N J;  3L70 E;  5APX A;  4H0L D;  3HRN A;  3M0D C;  1HJ0 A;  1ZOY C;  2KZI A;  1SQX G;  3OA7 A;  1VQ6 P;  5KAI H;  3L75 D;  5APQ A;  4C7R A;  1LT1 A;  4DCK A;  1RE3 C;  1IJD B;  1SQP D;  1EDI A;  3TDK A;  4CPG A;  2BAS A;  4H0L C;  1SQQ G;  3WUT A;  2W6A A;  1SP4 A;  2LXC B;  2YIU C;  3O6Q A;  4I7Z B;  3TF5 A;  3B8E B;  1LNQ A;  1NTK K;  5AW2 B;  1EDL A;  2E75 C;  1ZRT D;  2FYU E;  3GHG C;  1MKM A;  3NXS A;  2YO2 A;  1J1D B;  5AVQ B;  5AW6 B;  4ZKP A;  5B66 E;  3MTU E;  3SWK A;  1BCC G;  2OGU A;  1DEE G;  4JYC A;  1PPJ D;  1OZH A;  3KXD A;  2KB7 P;  1SQQ D;  3VMZ A;  4C46 A;  1KC8 Q;  3WUU A;  1GMJ A;  3USS A;  2MJZ A;  1AFO A;  1BSH A;  2FYU D;  2KYV A;  3L70 G;  5AVS B;  1HUC A;  3F89 A;  5AW9 B;  3RK3 E;  1PZQ A;  1NTK E;  1RHZ B;  3H1K G;  4RJT A;  1BE3 D;  2I1J A;  2YXR B;  3KPE A;  1P84 E;  5C39 A;  1RF1 C;  3H6P A;  1DX7 A;  2JJL A;  2D2C C;  2Y0D A;  1VQ4 P;  1PPJ G;  3PHL A;  3WU2 E;  2B87 B;  4OGQ C;  3P8M C;  2K9Y A;  1DEB A;  3U1A A;  1J1D C;  1HGV A;  2BCC J;  2QVA A;  2H7H A;  2E76 C;  3M9H A;  1VF5 B;  3L73 J;  1JY2 O;  1L0L K;  1PP9 J;  1KYO E;  2B89 A;  2FYU G;  2WSS H;  2ZYA A;  3L70 D;  3RGU A;  3TNU B;  4DJG A;  1K73 Q;  3FXE A;  2WT7 B;  1ZR4 A;  1SQQ K;  2IBZ D;  2H43 A;  1NU1 J;  3OW2 O;  4N78 E;  4W7Y A;  1PFI A;  3HE4 B;  3L74 D;  4JYB A;  2PFX A;  3C9I A;  4N6J A;  5E79 E;  4DOJ A;  1KQS O;  2IX7 C;  1SQQ J;  3KDP B;  2O01 J;  2P7J A;  2POH A;  3F5H A;  4RES B;  3RK2 C;  1LTG C;  5BU5 A;  2RH0 A;  1IC2 A;  2E43 A;  2G3A A;  4OH8 B;  2R5D A;  3KZI E;  1RF1 B;  3HE4 A;  1R8E A;  2P1J A;  4L76 A;  3T97 A;  5GTH E;  3Q2Y A;  1NAF A;  1VQ8 P;  1KTM A;  5AVV B;  5TJH A;  2NRG A;  3RK3 C;  4EYY Q;  1SFC C;  1Y9B A;  4HJG H;  5E79 H;  3RL0 g;  2GUV A;  4NPF X;  4OGQ B;  4U7J A;  2WPV B;  1N7S D;  1LTS C;  1OW7 A;  1VDF A;  1S5L E;  2LKM A;  2QG4 A;  1OIP A;  4Y99 B;  1NU1 E;  5KKZ C;  2WSE J;  3MP7 B;  4KHX A;  2B87 A;  2R3C A;  3MUD A;  5DJU B;  5KAF E;  3V6I A;  1AVO A;  1BCC E;  3IN6 A;  4PV1 B;  2KNC B;  5KLV K;  2W8Z A;  1JMB A;  2HYN A;  2QRX A;  3G4S P;  2ZT9 D;  3CCS P;  3H32 A;  2YMK A;  4U3F D;  3L72 J;  1N7L A;  1NTZ E;  2KSE A;  2NPS A;  2WPR A;  3B5N C;  4K35 A;  5AW7 B;  4PD4 E;  1JNM A;  1ZRT E;  3SFD C;  3CCQ P;  1KV4 A;  3G3Z A;  1KFN A;  1U7M A;  1N7S B;  2QM7 A;  3H1K E;  1KB9 D;  1BGY D;  1FAV A;  2HR3 A;  3RL0 D;  1KZU B;  1HF9 A;  3L72 G;  1W2B O;  5B5E H;  1Q86 Q;  1OVR A;  1RE4 A;  2HG5 D;  2R3S A;  3MD0 A;  3GLM A;  2P2U A;  1M1J A;  5KTB A;  2OYO A;  1JCC A;  1LWU C;  1T3U A;  3E1I A;  3MZW B;  1RE4 C;  4GOF A;  3O6Q B;  1NAY A;  2W90 A;  4GT1 A;  1UIX A;  4IOI H;  4UB8 H;  1PP9 E;  3PH0 A;  1LT9 A;  3PJS K;  4JPZ B;  1IFJ A;  2WSC J;  3D6Y A;  2ZAE B;  3L72 E;  2C0W A;  4JF7 A;  2W6J H;  3L72 D;  1GL2 A;  3AE8 C;  2XND H;  2AEF A;  4I6M C;  2AXT H;  3CCU P;  1VQP P;  4ASV A;  3K5B A;  2QIW A;  3RL0 B;  3AEB C;  1MFZ A;  1PV3 A;  1G2C A;  2V7Q J;  1H89 A;  5AVY B;  1J2J B;  2KI7 B;  1YI2 P;  3RK3 D;  3C1L A;  1VF5 D;  1GL2 B;  3FXD A;  4UB8 E;  1X8Y A;  1FBM A;  2ZYD A;  1WRG A;  2ZFC A;  3PP5 A;  3TSI A;  3C8V A;  1KB9 H;  1N7S C;  3L4F A;  1YYC A;  4D6T E;  4BXL A;  3CD6 P;  3H1J G;  5CCH C;  1JY3 N;  2J58 A;  3HE5 B;  2E75 B;  3FWL A;  3CXH E;  4PJ0 E;  4EI2 A;  2HLO A;  1NKN A;  4HYT B;  2RMZ A;  3V2Q A;  1NU1 G;  3V5B A;  1T3J A;  1YQ3 C;  4HH2 A;  2KSJ A;  2YKQ A;  2ZYG A;  3VP9 A;  2Y0C A;  4W7Z A;  3CC2 P;  1VQN P;  1NTK G;  1KYO H;  1SFC A;  1L2P A;  1QX8 A;  2IYO A;  3AEE C;  3LIE A;  2JDI H;  3H1J E;  3G6E P;  5APY A;  1PPJ E;  1SQB G;  2YO3 A;  3AE9 C;  3WU2 H;  1T8Z A;  2QJP B;  2Y0E A;  4D6T J;  1NTZ G;  1P84 H;  4LGD E;  3RL0 C;  1NHL A;  3MHV A;  3V2N A;  3VTP C;  5KLI B;  1YJN P;  1NU1 D;  1PP9 D;  1Q82 Q;  1JY2 N;  1ZN5 A;  1FDM A;  3CME P;  2JO1 A;  1NTK D;  1GL2 C;  1PGJ A;  3B5N B;  4IL6 X;  3CWB E;  4KJM A;  4TLF A;  4XE5 B;  1KD1 Q;  1Q81 Q;  2QSI A;  2PAJ A;  1SQB E;  3R4Y A;  2FXP A;  1N73 C;  3CC4 P;  1URQ A;  1SQB D;  1IK9 A;  2QJY C;  4TT3 H;  2YXQ B;  4B86 A;  2I8D A;  2KOG A;  1CI6 A;  3O8Z A;  1NU1 K;  1N73 A;  1RY3 A;  1W2E A;  3AE7 C;  3P8C E;  5KLV J;  5CCG A;  1CW5 A;  3A0H E;  1PP9 G;  1EZV I; 
#chains in the Genus database with same CATH homology
 3FXE A;  2KIK A;  1LP1 A;  1S3J A;  1MFT A;  2UWJ E;  1OVV A;  5CBN A;  2OTK E;  1LP1 B;  4EYY Q;  4HJG H;  4NPF X;  4ZNC A;  2LR2 A;  2WMM A;  2JWD A;  2B87 A;  5DJU B;  2SPZ A;  1OVU A;  1Q2N A;  1JMB A;  4JBZ A;  2K3R A;  2M5A A;  1BDD A;  5EFW B;  2QRX A;  2KZJ A;  4K35 A;  5K5G B;  3QWO C;  1BDC A;  1U7M A;  1Y47 A;  1X0T A;  2HR3 A;  1OVR A;  1EC5 A;  2LXB A;  3MZW B;  4GOE A;  4GOF A;  4IOI H;  1ZXG A;  2KS1 B;  4ASW A;  3PH0 A;  1FC2 C;  2ZAE B;  4ASV A;  5CBO A;  1H0T B;  2Q1K A;  4MN4 C;  1H0T A;  2KI7 B;  4NPE A;  2KUB A;  3S1K A;  2KZI A;  3FXD A;  1JM0 A;  1LT1 A;  3ZDM A;  4ZMD A;  1EDI A;  4CPG A;  4BXL A;  2LXC B;  4NPD A;  2R44 A;  1EDL A;  5DJT B;  1EDK A;  4WWI A;  1DEE G;  4HKZ H;  2P58 A;  2RKL A;  2M0B A;  1SS1 A;  3MHV A;  1EDJ A;  2M5A B;  4GOD A;  4HB1 A;  4KJM A;  1ZW0 A;  5C39 A;  1NVO A;  2B88 A;  2B87 B;  4K3A A;  1U7J A;  2I8D A;  2QVA A;  2B89 A;  3RGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...