1JM0A

Crystal structure of four-helix bundle model
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jm0A00
1MFTA 1EDJA 1EDKA 1H0TB 2B88A 1JMBA 3MHVA 1X0TA 5DJUB 2KUBA 2JWDA 5C39A 4EYYQ 2KIKA 4WWIA 5EFWB 2KS1B 2I8DA 4CPGA 5K5GB 4HJGH 3FXDA 4ASWA 1ZW0A 4K35A 1U7MA 2WMMA 1LP1A 4JBZA 3S1KA 4HB1A 4K3AA 4IOIH 2ZAEB 2OTKE 1EDIA 4MN4C 4NPEA 1ZXGA 1NVOA 3FXEA 4GOFA 1OVUA 4KJMA 2QRXA 4HKZH 1Y47A 2B89A 1H0TA 2M0BA 4ZMDA 4ASVA 2Q1KA 2LR2A 1LP1B 2UWJE 2KZJA 2HR3A 2RKLA 2LXBA 1EDLA 1BDCA 3PH0A 1Q2NA 2KI7B 4NPFX 4ZNCA 5CBOA 2QVAA 3ZDMA 5CBNA 1U7JA 2M5AA 2M5AB 1DEEG 4GOEA 1S3JA 2LXCB 5DJTB 3RGUA 3MZWB 3QWOC 1LT1A 1OVVA 2P58A 1JM0A 4GODA 1EC5A 2B87B 2R44A 4NPDA 2K3RA 1BDDA 2B87A 2KZIA 1OVRA 1SS1A 2SPZA 1FC2C 4BXLA
chains in the Genus database with same CATH superfamily
1AQTA 2WWWA 3R4YA 2P7JA 5CCGD 1LWUA 3L70G 3H1LG 3T97A 1IZNB 2E5YA 3AE4C 2K1AA 3L70D 3MIWA 1M90Q 2CK3H 3GG2A 2B88A 3C1LA 1H0TB 1L0LE 1SQQK 2N1TC 2A45G 2H8PD 1XTGB 3TSIA 3CCMP 3KHUA 4UB8H 2ITAA 3L71E 5AW6B 1X0TA 3CC2P 1NKNA 3A0HE 4O9BA 1H8AA 2E76D 1BCCJ 2KUBA 5APSA 5KAIE 5C39A 5TISE 2OQQA 1S4XA 4EYYQ 5GTIE 1GD2E 4UB8E 1NTKG 4WWIA 2IBZG 1SQBE 3KZIE 3A0HH 1JTHB 1YBKA 5CCGA 2E76C 3H32A 5KKZC 2PGDA 2JP3A 2I8DA 3BCCJ 2QJYC 5KJ7A 3Q5SA 1KILA 3BCCE 4CPGA 1LGHB 2YXQB 5K5GB 1KILC 5APWA 3CCRP 2FFDC 3BCCD 3B5NC 3V2RA 1IFDA 1ZW0A 2KLUA 5GTHE 4LC1A 2E43A 1RE4C 1U7MA 1Y8AA 2FXMA 1NH4A 2L91A 1Q90D 1SQBJ 1NTZE 2M8RA 1OXZA 1PGQA 2JEEA 4HB1A 4EIJA 1M57D 2KB7P 1KILD 4K3AA 4AYCA 3AEDC 3L72J 3BRVB 3KDPB 1G1JA 3M9QA 4PD4E 3EWKA 1X79B 5AW2B 3SWYA 5AVUB 1RE3C 2KP8A 2XNDH 5CCHD 1SQXD 2HLOA 2OTKE 1QLED 2ZT9C 1CI6A 3L36A 3B5NB 5APYA 1FZCA 3H6PA 3V2PA 1JY2O 5GTIH 3ABVC 1L0LJ 5B5EH 1ZXGA 3NXSA 1PPJD 1OW6A 5TISH 1UIXA 3LW5J 3U59A 3CCJP 3M06A 1VQOP 4KJMA 2OYIA 3CMEP 1CW5A 2Q6QA 2V7QH 2A06D 2FYZA 1Z56A 2XKMA 3FGAD 3GLMA 3IN6A 4HKZH 1S1CX 1PP9J 2FYUE 2M0BA 2C9LY 1FZEA 3CX5I 4I6MC 3M91A 1M7LA 2HFED 2WSSH 2H43A 3M0DC 1AVOA 1SQVK 1QEXA 3GF3A 1OMIA 4OWFA 3TK1A 4YXWH 1EQ7A 4U3FJ 1QL1A 5GTHH 1JOCA 3G3ZA 5B66E 1Q82Q 2UWJE 1T2KC 2NRGA 1PL5A 1YYCA 1N7SC 3HTKB 1LTJB 2J58A 1Q7YQ 2N9YB 2JKVA 2WPVB 4JYCA 1KYOH 1BGYG 1S2EA 4Y28J 5CMZA 1Q86Q 3L74E 5APQA 1T3UA 3LIDA 1HTLC 2I1JA 5H2FH 1N73A 4NPFX 1KILB 1L0NK 2B9BA 1JY2N 4OGQB 2Y9YA 5CBOA 1NJIQ 2AXTH 1KYOE 1USDA 3CCUP 2OTJP 3CWBE 3LIEA 2K37A 3ZDMA 2N9BA 5CBNA 5AW4B 5E79E 1VQ6P 1P84I 1U7JA 5KLVD 2M5AA 2M5AB 3H1LJ 1BE3G 2KS1A 2KXPB 4UB6H 2E75C 2G8YA 4GOEA 4I2LC 1S3JA 2LXCB 3R2PA 1FOSE 1EZVD 5CCGC 3RGUA 1SQPK 3G6EP 1BE3J 1BSHA 3JCUE 4XA4A 3CPWO 3Q5PA 2BCCG 1LNQA 1KYOI 3BVHA 3TGUE 1VDFA 1A02F 4C7RA 3B4SA 5B66H 1AJYA 1L2PA 4GDOA 1FZFA 5CCHC 2Z5HA 4GODA 1L0NE 1GU5A 1FBMA 1YQ3C 3HTKA 2WSEJ 2R44A 2WSFJ 3GHGA 4H0LD 3H1JG 2B87A 1MZ9A 2BCCJ 1MFZA 3P8MC 4BWNA 1JB0J 1LT9A 2IPPA 2E5TA 3H1KD 3L71G 4Y99C 3TGUJ 2OYHC 3H1KG 1SS1A 3HD7A 3B71A 1SFCA 4H13B 1FZAA 3SFDC 1SFCC 4ZKUA 4BXLA 1N86A 3RK3C 3MUDC 2HPCB 3RK2C 1EDKA 4JQ0D 2XNXA 3HD7B 4RO0A 3RL0g 3VYIA 1ZR2A 1M1JB 2RN0A 1LT9B 1NTMJ 3HD7D 1GL2D 1PGOA 4WB4A 2IFMA 3L72G 4WY4B 3GHGB 1SQXJ 1NTMK 3MHVA 3WU2E 3K5BA 5CCHA 4DZOA 2FYUK 3KZIH 4OGQC 4WY4D 5DJUB 2ZYGA 3PLNA 3S4RA 4ZKPA 3GF7A 3W68A 1YI2P 3G9RA 1YJWP 2IZ0A 3WUUA 5AW5B 1CI6B 1GK6A 3WUTA 2QJPB 1VPCA 2C9NY 3C9IA 1E79H 1RQVA 3IF4A 2Q3IA 1FE6A 4L75A 1HJ0A 3H1HD 1SQPE 4N78E 1PGJA 1JMMA 1HUCA 1WT6A 3H1HG 1PP9D 4TT3H 4C46A 2KS1B 2O1KA 1Q81Q 3A2AA 1NGMB 2WVRA 1URQC 2YIUB 2BCCD 5AVSB 3USSA 1OW8A 3N7NA 3FXDA 1KB9H 3GMAA 2KNCA 1BCCE 2QJYB 3P8CE 4PD4H 1NU1G 1NTZD 4ASWA 3CMAP 4K35A 5APVA 2P67A 4JF7A 1KD1Q 1BCCG 2KYVA 3CXHD 2ZVNB 2Y0DA 2QA4P 1SQQG 1EZVG 2YO2A 3AEFC 3H32B 1M1KQ 3H1IE 1QL2A 2GUVA 1SQQE 2K9YA 1FZGA 2C0WA 2PAJA 1RH5B 2QG4A 3HE5B 1NOHA 1U57A 4AQRD 1H89A 2Y9ZA 1S5LE 2FFDB 1HWTC 4W7YA 1PPJE 2BEZF 4NPEA 1NTKK 2G3AA 1NAYA 1SQVD 2OYIB 3OJAB 5APXA 1JY3O 1SQVE 1NTKJ 1SQBK 2ZFCA 1NHLA 4U3FE 4IFFA 2IYOA 3PHLA 2A06G 1S5LH 4LGDE 2WT7A 1DH3A 1HF9A 2DW3A 1K04A 1LWUC 1M1JC 4H13C 1H0TA 1KQGB 1ZRTE 2P1JA 3VN0A 4ZMDA 5BU8B 3VMAA 1HGVA 1ZRTD 2E42A 4OGQD 1YHQP 1N7SD 1OZHA 4H44C 3RK2B 1URQD 1G1IA 3TF5A 1KZUB 4N78D 4YPCA 1N8RQ 2IZ1A 1KB9E 1KMIZ 1L0NJ 3RK2D 1JNMA 1YTZT 1HJBA 2QJPC 3L71D 5APUA 5KAFH 5H2FE 3L72D 4DJGA 5L8RJ 2YKQA 1FZCC 3OW2O 1G2CB 2WSCJ 1ZMEC 3AE3C 1RF0A 1BDCA 2WTYA 1MUUA 1Q2NA 1ZP0C 2IFNA 3H1JJ 3S9OA 2A45H 1K73Q 1HVVA 2KI7B 5E79H 4H0LB 1KFMA 5KTBA 2A45I 2LKMA 3CWBD 3JSVC 4OVNF 1YITP 1WMKA 2I1KA 2KK7A 2QVAA 1RY3A 5B5EE 2QE7H 2R5BA 1IFNA 2PFXA 1SVFA 2YO3A 3M0AA 1YQ4C 2H88C 4H44D 5AVRB 3VTPC 4AUWA 4WVZA 5BU5A 3JCUH 1QVFO 1IC2A 1RF0C 1ZN5A 4DOJA 3RBXA 3L70J 1BSNA 1DEEG 2ZXEB 2ZYAA 3SSUA 4BRYB 1KQLA 2ZT9B 2HYNA 1DEBA 3TGUG 3L4FA 4WY4A 2YMYA 2MJZA 1NU1E 2FXOA 2QJKB 2R32A 3AE9C 3U1AA 4EOTA 2D2CC 5AW3B 1NTZG 1AA0A 1KFNA 1LT1A 2OYOA 5KAFE 1GL2A 1SQXG 4EDFA 3D6ZA 2YKPA 1JM0A 3CI9A 3HUSC 1KTMA 2JDIH 3H1JE 4I7ZC 3VP9A 1L0LK 3H1JD 2K3RA 1GW4A 1W2EA 1EZVI 3F5HA 3L72E 5KJ7D 2IBZI 3BATA 1FAVA 1LTGC 2R3SA 2VRSA 3W67A 2WT7B 1NO4A 4R4LA 1P84D 2SPZA 2AXTE 3H1KJ 1FC2C 2XV5A 2Q9IA 2NZ2A 1NAFA 3O8ZA 2FBWC 1LTIC 1MFTA 1VF5B 3NFQA 5KLVJ 1T2KD 1IJDB 4I7ZB 3VMYA 1KN7A 1SQPG 1JMBA 1FOSF 1S5LX 1SFCD 1T6AA 4UB6E 1WRGA 2WITA 3A7OA 2E74D 4Z1MH 2W6AA 1OW7A 4GIFA 2IX7C 1PGPA 5CHXA 2WSEH 2Q3EA 4JPZB 2RMZA 4YTPC 3AE8C 1IFJA 5AW1B 3PP5A 1JY3N 4WBAA 1VF5C 3H1LE 5TJHA 5APTA 3U1CA 1AQ5A 2E76B 5KJ7C 1SP4A 5CJ4A 1YIJP 2L5GB 1K9MQ 3BRTB 1AV1A 4DCKA 2JO1A 5EFWB 2Y0EA 3CX5E 2CPSA 2AEFA 2HG5D 2ZT9D 3CWBG 3CWBJ 1J1EC 3CX5D 3H1HJ 4C7NB 3E1IA 2JJLA 2W8ZA 2WQYC 1DD3A 4IL6X 4IL6H 2N1TD 2WSFH 4QMAA 4XFJA 1VQPP 1ZR4A 1E5WA 2Y0CA 3IR9A 1EZVE 3O6QB 5AW7B 3RK3E 1LP1A 2IBZE 2OGUA 3AE2C 1NTME 2AXCA 3S1KA 2H89C 2A06E 1NTMD 2QJKC 2NPSC 2FYNC 1J1EB 2FYUD 1NTMG 4L74A 2O01H 3M0DA 1R8EA 1YJ9P 3CXHI 2FYUG 1URQB 2YIUC 3E7KA 4OH8B 3V5BA 4DT0A 2HPCA 2W6BA 3HE4A 2XU6A 1JCDA 3G71P 1VQLP 4A7PA 1T8ZA 3NTNA 3WU2H 4L73A 3AE7C 3NMDA 1EXJA 1NKZB 1SFCB 2RH0A 3P32A 3FXEA 4PV1B 4N3YB 3VMXA 5AVXB 1IFMA 1W2BO 2QRXA 1KILE 1SQXE 1FDIA 2B89A 2OTLP 5AVQB 1LTBC 1SQQJ 3AEAC 2E74C 5AVYB 2WPSA 2KSEA 3CX5H 5AW9B 1JO5A 3L70E 3E1RA 3CXHH 3H1LD 2BASA 1NU1K 1QX8A 2Q1KA 1R5LA 2LR2A 5KLVK 2V7QJ 2XZRA 3HE4B 2QEXP 4W80A 2ZYDA 3D71A 1GDTA 4XE5B 1HGZA 4H44B 1NYHA 1VQ8P 1NTKE 1NWQA 1KV4A 3A3YB 4D6TE 2MKVA 4RKUJ 2HR3A 1GTWA 3ITKA 1X9VA 1GK4A 2FYUJ 3QH9A 1VQ7P 3L37A 1EDLA 1RHZB 3WUVA 3PH0A 2N1TB 3I56P 2FFDA 1KB9I 1OX3A 1SQPD 3M9BA 4PD4I 1L4AD 3I5CA 1SQBG 4BRYA 3Q1MA 1KC8Q 1FDMA 1LTSC 2D2CD 1GZLA 2PP6A 2ZVOB 3H1HE 3VMZA 3TGUD 1QVGO 1ZV8A 1KQSO 3B8EB 1FJPA 1T3JA 1FJKA 3OA7A 1K8AQ 2KLVA 3H25A 4PV1D 1PZQA 1OIPA 3TDKA 1PV3A 1ZOYC 3CC4P 2JR8A 1VL2A 1KYOD 1LTJA 2OARA 1DD4A 1HH0A 3FWNA 5DJTB 5AVVB 3B5ND 1L0ND 1Y9BA 4HYTB 1VQ9P 1UIIA 1HBWA 1FU1A 1MKMA 3L71J 1JEKA 1N73C 5BVZA 3H1IG 3MZWB 2K88A 3MGNA 3CLQA 1FZCB 3CCVP 3MD0A 1GMJA 1OVVA 1OWAA 1LWUB 1SLQA 3AE6C 3T97B 3V4QA 5KLVE 3Q2YA 1OFCX 1YJNP 2E74B 2B87B 2O01J 1M1JA 1RF1B 2NPSD 1A02J 1KORA 3HUSB 2YKOA 1CSBA 2W90A 3H1IJ 1R5SA 2KZIA 1AVYA 3EQ2A 3L73G 4M3LA 1OVRA 2QM8A 2AEMA 3MTUE 3MUDA 3L73D 3RK3B 3L73E 4IFMA 3Q3DA 2GA1A 2OYHB 1N7LA 2OYHA 3L73J 4KT0J 1GL2B 4U3FG 1H88A 1D7MA 1LT9C 2FY8A 2PRRA 2R5DA 1S9KE 4RJTA 4IFDK 1EDJA 1S9KD 3A5TA 4HH2A 1M8OB 1W5CE 4W7ZA 5KLIC 1KB9D 4U7JA 3O6QA 3HUSA 3RBZA 3PRJA 1K05A 2J59M 3H1KE 3PJSK 2JWDA 3HE5A 1IFIA 1NTZK 2P10A 2O1JA 5AVTB 3RL0D 1IK7A 3GW6A 1SQXK 3PTZA 1BGYE 4JYBA 4PJ0H 3L75D 3SFEC 2WPQA 3L74G 5AVWB 2KIKA 3RL0B 1URQA 5CJ0A 1NTKD 4D6TG 1JTHA 1L0LG 4GT1A 1LTJC 1BE3E 3IAOA 4D6TD 1SQQD 1M56D 5AVZB 2FKWB 4PJ0E 2ZJSE 2POHA 2KNCB 1JCCA 1X8YA 2QSIA 2R3CA 2W6JH 1LJ2A 2ZXXA 2YNYA 3AE5C 3H1ID 4L76A 4D6TJ 3CCLP 3D6YA 3KYQA 3M9HA 1XTCC 4HJGH 2QIWA 4EI2A 1VQ4P 3V2QA 2WMMA 3Q5RA 4JBZA 1EXIA 1FZBA 5AW8B 1SQVG 1PP9G 2M3EA 1N73B 2BCCE 2N1TA 2JWAA 3HRNA 1PP9E 1TU3F 2C0XA 2E75D 2QM7A 3P8CD 4IOIH 1VQ5P 2ZAEB 1DX7A 2Z5IA 3BCCG 3FWLA 3CD6P 3P7KA 1EDIA 3WMM0 1JY2P 4MN4C 1BCCD 1QGKB 1L4AB 1LTAC 1RF1C 3TNUB 1L0NG 1NVOA 1IFPA 4GKGA 3CXHE 1JY3P 4GOFA 1OVUA 3II6A 1IK9A 2OYIC 3A0BE 3JC22 2FYNB 2K9JB 1Y47A 1LTTC 3OAKA 1CZQA 3CC7P 3N4XA 3KQGA 2CPBA 1L4AA 1GL2C 3KXDA 3L75E 4ASVA 3AEBC 3EFGA 1NTZJ 3A0BH 4U3FD 3L75G 1RE3A 4IL6E 2WSCH 3VP8A 4Y99B 1GU4A 3L35A 1N7SB 2HODA 1LP1B 1X22A 1SQBD 5KLIB 4R4MA 3I55P 2KZJA 3AECC 3FX0A 1PIXA 1ZLLA 1VQNP 2RKLA 2LXBA 3IFMA 4B86A 2IDBA 3F89A 3CCQP 4H0LC 3B5NA 1J1DC 3BASA 2M3BA 2V4HA 3L74J 3CCSP 4C7NA 1VQMP 1S72P 2NPSA 2YXRB 4WY4C 2O01N 1IO4A 1USEA 3L74D 4N6JA 1SQVJ 3RL0C 2GUSA 3MP7B 2WZ7A 4ZNCA 3TYYA 5KKZB 1L0LD 1N2DC 1VQKP 1RE4A 1NU1J 1JUNA 2Q5UA 1KQFB 4KHXA 3D70A 1BGYD 1G2CA 2E75B 1NU1D 2FXPA 2KOGA 2NPSB 4TLFA 1PFIA 1J1DB 3UIAA 5KLVG 1BGYJ 1P84H 2IBZD 3AEGC 3CCEP 3V6IA 1BE3D 4H13D 3SWKA 1N7SA 2IYPA 3AEEC 4I1LA 3RK3D 3V4WA 2GM4A 2WPRA 3KPEA 5KAIH 1DIPA 1PPJG 1FS0E 3G4SP 2YMKA 2W27A 1AFOA 4LLHA 1RQUA 5AW0B 3SWFA 4PV1C 1P84E 3QWOC 3L75J 3LW5H 4RESB 2O3JA 4YXDC 2AEJA 2KSJA 1J2JB 3EFFK 3V2NA 1L4AC 2P58A 2K9JA 3AE1C 2D2CB 2W83C 2P2UA 1EC5A 1SQPJ 4NPDA 1BDDA 1MV8A 3TNUA 1FDOA 2HODB 3CL3D 3VOPA 2Z4EA 3GHGC 2BEQD 1GW3A 5M1BA 1VF5D 2XDJA 4PD4D 3C8VA 1RF1A 1YTZI 2Q7CA 2H7HA 2J5UA 3HD7C
chains in the Genus database with same CATH topology
1MFTA 1EDJA 1EDKA 1H0TB 2B88A 1JMBA 3MHVA 1X0TA 5DJUB 2KUBA 2JWDA 5C39A 4EYYQ 2KIKA 4WWIA 5EFWB 2KS1B 2I8DA 4CPGA 5K5GB 4HJGH 3FXDA 4ASWA 1ZW0A 4K35A 1U7MA 2WMMA 1LP1A 4JBZA 3S1KA 4HB1A 4K3AA 4IOIH 2ZAEB 2OTKE 1EDIA 4MN4C 4NPEA 1ZXGA 1NVOA 3FXEA 4GOFA 1OVUA 4KJMA 2QRXA 4HKZH 1Y47A 2B89A 1H0TA 2M0BA 4ZMDA 4ASVA 2Q1KA 2LR2A 1LP1B 2UWJE 2KZJA 2HR3A 2RKLA 2LXBA 1EDLA 1BDCA 3PH0A 1Q2NA 2KI7B 4NPFX 4ZNCA 5CBOA 2QVAA 3ZDMA 5CBNA 1U7JA 2M5AA 2M5AB 1DEEG 4GOEA 1S3JA 2LXCB 5DJTB 3RGUA 3MZWB 3QWOC 1LT1A 1OVVA 2P58A 1JM0A 4GODA 1EC5A 2B87B 2R44A 4NPDA 2K3RA 1BDDA 2B87A 2KZIA 1OVRA 1SS1A 2SPZA 1FC2C 4BXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MFT A;  1EDJ A;  1EDK A;  1H0T B;  2B88 A;  1JMB A;  3MHV A;  1X0T A;  5DJU B;  2KUB A;  2JWD A;  5C39 A;  4EYY Q;  2KIK A;  4WWI A;  5EFW B;  2KS1 B;  2I8D A;  4CPG A;  5K5G B;  4HJG H;  3FXD A;  4ASW A;  1ZW0 A;  4K35 A;  1U7M A;  2WMM A;  1LP1 A;  4JBZ A;  3S1K A;  4HB1 A;  4K3A A;  4IOI H;  2ZAE B;  2OTK E;  1EDI A;  4MN4 C;  4NPE A;  1ZXG A;  1NVO A;  3FXE A;  4GOF A;  1OVU A;  4KJM A;  2QRX A;  4HKZ H;  1Y47 A;  2B89 A;  1H0T A;  2M0B A;  4ZMD A;  4ASV A;  2Q1K A;  2LR2 A;  1LP1 B;  2UWJ E;  2KZJ A;  2HR3 A;  2RKL A;  2LXB A;  1EDL A;  1BDC A;  3PH0 A;  1Q2N A;  2KI7 B;  4NPF X;  4ZNC A;  5CBO A;  2QVA A;  3ZDM A;  5CBN A;  1U7J A;  2M5A A;  2M5A B;  1DEE G;  4GOE A;  1S3J A;  2LXC B;  5DJT B;  3RGU A;  3MZW B;  3QWO C;  1LT1 A;  1OVV A;  2P58 A;  1JM0 A;  4GOD A;  1EC5 A;  2B87 B;  2R44 A;  4NPD A;  2K3R A;  1BDD A;  2B87 A;  2KZI A;  1OVR A;  1SS1 A;  2SPZ A;  1FC2 C;  4BXL A; 
#chains in the Genus database with same CATH topology
 1AQT A;  2WWW A;  3R4Y A;  2P7J A;  5CCG D;  1LWU A;  3L70 G;  3H1L G;  3T97 A;  1IZN B;  2E5Y A;  3AE4 C;  2K1A A;  3L70 D;  3MIW A;  1M90 Q;  2CK3 H;  3GG2 A;  2B88 A;  3C1L A;  1H0T B;  1L0L E;  1SQQ K;  2N1T C;  2A45 G;  2H8P D;  1XTG B;  3TSI A;  3CCM P;  3KHU A;  4UB8 H;  2ITA A;  3L71 E;  5AW6 B;  1X0T A;  3CC2 P;  1NKN A;  3A0H E;  4O9B A;  1H8A A;  2E76 D;  1BCC J;  2KUB A;  5APS A;  5KAI E;  5C39 A;  5TIS E;  2OQQ A;  1S4X A;  4EYY Q;  5GTI E;  1GD2 E;  4UB8 E;  1NTK G;  4WWI A;  2IBZ G;  1SQB E;  3KZI E;  3A0H H;  1JTH B;  1YBK A;  5CCG A;  2E76 C;  3H32 A;  5KKZ C;  2PGD A;  2JP3 A;  2I8D A;  3BCC J;  2QJY C;  5KJ7 A;  3Q5S A;  1KIL A;  3BCC E;  4CPG A;  1LGH B;  2YXQ B;  5K5G B;  1KIL C;  5APW A;  3CCR P;  2FFD C;  3BCC D;  3B5N C;  3V2R A;  1IFD A;  1ZW0 A;  2KLU A;  5GTH E;  4LC1 A;  2E43 A;  1RE4 C;  1U7M A;  1Y8A A;  2FXM A;  1NH4 A;  2L91 A;  1Q90 D;  1SQB J;  1NTZ E;  2M8R A;  1OXZ A;  1PGQ A;  2JEE A;  4HB1 A;  4EIJ A;  1M57 D;  2KB7 P;  1KIL D;  4K3A A;  4AYC A;  3AED C;  3L72 J;  3BRV B;  3KDP B;  1G1J A;  3M9Q A;  4PD4 E;  3EWK A;  1X79 B;  5AW2 B;  3SWY A;  5AVU B;  1RE3 C;  2KP8 A;  2XND H;  5CCH D;  1SQX D;  2HLO A;  2OTK E;  1QLE D;  2ZT9 C;  1CI6 A;  3L36 A;  3B5N B;  5APY A;  1FZC A;  3H6P A;  3V2P A;  1JY2 O;  5GTI H;  3ABV C;  1L0L J;  5B5E H;  1ZXG A;  3NXS A;  1PPJ D;  1OW6 A;  5TIS H;  1UIX A;  3LW5 J;  3U59 A;  3CCJ P;  3M06 A;  1VQO P;  4KJM A;  2OYI A;  3CME P;  1CW5 A;  2Q6Q A;  2V7Q H;  2A06 D;  2FYZ A;  1Z56 A;  2XKM A;  3FGA D;  3GLM A;  3IN6 A;  4HKZ H;  1S1C X;  1PP9 J;  2FYU E;  2M0B A;  2C9L Y;  1FZE A;  3CX5 I;  4I6M C;  3M91 A;  1M7L A;  2HFE D;  2WSS H;  2H43 A;  3M0D C;  1AVO A;  1SQV K;  1QEX A;  3GF3 A;  1OMI A;  4OWF A;  3TK1 A;  4YXW H;  1EQ7 A;  4U3F J;  1QL1 A;  5GTH H;  1JOC A;  3G3Z A;  5B66 E;  1Q82 Q;  2UWJ E;  1T2K C;  2NRG A;  1PL5 A;  1YYC A;  1N7S C;  3HTK B;  1LTJ B;  2J58 A;  1Q7Y Q;  2N9Y B;  2JKV A;  2WPV B;  4JYC A;  1KYO H;  1BGY G;  1S2E A;  4Y28 J;  5CMZ A;  1Q86 Q;  3L74 E;  5APQ A;  1T3U A;  3LID A;  1HTL C;  2I1J A;  5H2F H;  1N73 A;  4NPF X;  1KIL B;  1L0N K;  2B9B A;  1JY2 N;  4OGQ B;  2Y9Y A;  5CBO A;  1NJI Q;  2AXT H;  1KYO E;  1USD A;  3CCU P;  2OTJ P;  3CWB E;  3LIE A;  2K37 A;  3ZDM A;  2N9B A;  5CBN A;  5AW4 B;  5E79 E;  1VQ6 P;  1P84 I;  1U7J A;  5KLV D;  2M5A A;  2M5A B;  3H1L J;  1BE3 G;  2KS1 A;  2KXP B;  4UB6 H;  2E75 C;  2G8Y A;  4GOE A;  4I2L C;  1S3J A;  2LXC B;  3R2P A;  1FOS E;  1EZV D;  5CCG C;  3RGU A;  1SQP K;  3G6E P;  1BE3 J;  1BSH A;  3JCU E;  4XA4 A;  3CPW O;  3Q5P A;  2BCC G;  1LNQ A;  1KYO I;  3BVH A;  3TGU E;  1VDF A;  1A02 F;  4C7R A;  3B4S A;  5B66 H;  1AJY A;  1L2P A;  4GDO A;  1FZF A;  5CCH C;  2Z5H A;  4GOD A;  1L0N E;  1GU5 A;  1FBM A;  1YQ3 C;  3HTK A;  2WSE J;  2R44 A;  2WSF J;  3GHG A;  4H0L D;  3H1J G;  2B87 A;  1MZ9 A;  2BCC J;  1MFZ A;  3P8M C;  4BWN A;  1JB0 J;  1LT9 A;  2IPP A;  2E5T A;  3H1K D;  3L71 G;  4Y99 C;  3TGU J;  2OYH C;  3H1K G;  1SS1 A;  3HD7 A;  3B71 A;  1SFC A;  4H13 B;  1FZA A;  3SFD C;  1SFC C;  4ZKU A;  4BXL A;  1N86 A;  3RK3 C;  3MUD C;  2HPC B;  3RK2 C;  1EDK A;  4JQ0 D;  2XNX A;  3HD7 B;  4RO0 A;  3RL0 g;  3VYI A;  1ZR2 A;  1M1J B;  2RN0 A;  1LT9 B;  1NTM J;  3HD7 D;  1GL2 D;  1PGO A;  4WB4 A;  2IFM A;  3L72 G;  4WY4 B;  3GHG B;  1SQX J;  1NTM K;  3MHV A;  3WU2 E;  3K5B A;  5CCH A;  4DZO A;  2FYU K;  3KZI H;  4OGQ C;  4WY4 D;  5DJU B;  2ZYG A;  3PLN A;  3S4R A;  4ZKP A;  3GF7 A;  3W68 A;  1YI2 P;  3G9R A;  1YJW P;  2IZ0 A;  3WUU A;  5AW5 B;  1CI6 B;  1GK6 A;  3WUT A;  2QJP B;  1VPC A;  2C9N Y;  3C9I A;  1E79 H;  1RQV A;  3IF4 A;  2Q3I A;  1FE6 A;  4L75 A;  1HJ0 A;  3H1H D;  1SQP E;  4N78 E;  1PGJ A;  1JMM A;  1HUC A;  1WT6 A;  3H1H G;  1PP9 D;  4TT3 H;  4C46 A;  2KS1 B;  2O1K A;  1Q81 Q;  3A2A A;  1NGM B;  2WVR A;  1URQ C;  2YIU B;  2BCC D;  5AVS B;  3USS A;  1OW8 A;  3N7N A;  3FXD A;  1KB9 H;  3GMA A;  2KNC A;  1BCC E;  2QJY B;  3P8C E;  4PD4 H;  1NU1 G;  1NTZ D;  4ASW A;  3CMA P;  4K35 A;  5APV A;  2P67 A;  4JF7 A;  1KD1 Q;  1BCC G;  2KYV A;  3CXH D;  2ZVN B;  2Y0D A;  2QA4 P;  1SQQ G;  1EZV G;  2YO2 A;  3AEF C;  3H32 B;  1M1K Q;  3H1I E;  1QL2 A;  2GUV A;  1SQQ E;  2K9Y A;  1FZG A;  2C0W A;  2PAJ A;  1RH5 B;  2QG4 A;  3HE5 B;  1NOH A;  1U57 A;  4AQR D;  1H89 A;  2Y9Z A;  1S5L E;  2FFD B;  1HWT C;  4W7Y A;  1PPJ E;  2BEZ F;  4NPE A;  1NTK K;  2G3A A;  1NAY A;  1SQV D;  2OYI B;  3OJA B;  5APX A;  1JY3 O;  1SQV E;  1NTK J;  1SQB K;  2ZFC A;  1NHL A;  4U3F E;  4IFF A;  2IYO A;  3PHL A;  2A06 G;  1S5L H;  4LGD E;  2WT7 A;  1DH3 A;  1HF9 A;  2DW3 A;  1K04 A;  1LWU C;  1M1J C;  4H13 C;  1H0T A;  1KQG B;  1ZRT E;  2P1J A;  3VN0 A;  4ZMD A;  5BU8 B;  3VMA A;  1HGV A;  1ZRT D;  2E42 A;  4OGQ D;  1YHQ P;  1N7S D;  1OZH A;  4H44 C;  3RK2 B;  1URQ D;  1G1I A;  3TF5 A;  1KZU B;  4N78 D;  4YPC A;  1N8R Q;  2IZ1 A;  1KB9 E;  1KMI Z;  1L0N J;  3RK2 D;  1JNM A;  1YTZ T;  1HJB A;  2QJP C;  3L71 D;  5APU A;  5KAF H;  5H2F E;  3L72 D;  4DJG A;  5L8R J;  2YKQ A;  1FZC C;  3OW2 O;  1G2C B;  2WSC J;  1ZME C;  3AE3 C;  1RF0 A;  1BDC A;  2WTY A;  1MUU A;  1Q2N A;  1ZP0 C;  2IFN A;  3H1J J;  3S9O A;  2A45 H;  1K73 Q;  1HVV A;  2KI7 B;  5E79 H;  4H0L B;  1KFM A;  5KTB A;  2A45 I;  2LKM A;  3CWB D;  3JSV C;  4OVN F;  1YIT P;  1WMK A;  2I1K A;  2KK7 A;  2QVA A;  1RY3 A;  5B5E E;  2QE7 H;  2R5B A;  1IFN A;  2PFX A;  1SVF A;  2YO3 A;  3M0A A;  1YQ4 C;  2H88 C;  4H44 D;  5AVR B;  3VTP C;  4AUW A;  4WVZ A;  5BU5 A;  3JCU H;  1QVF O;  1IC2 A;  1RF0 C;  1ZN5 A;  4DOJ A;  3RBX A;  3L70 J;  1BSN A;  1DEE G;  2ZXE B;  2ZYA A;  3SSU A;  4BRY B;  1KQL A;  2ZT9 B;  2HYN A;  1DEB A;  3TGU G;  3L4F A;  4WY4 A;  2YMY A;  2MJZ A;  1NU1 E;  2FXO A;  2QJK B;  2R32 A;  3AE9 C;  3U1A A;  4EOT A;  2D2C C;  5AW3 B;  1NTZ G;  1AA0 A;  1KFN A;  1LT1 A;  2OYO A;  5KAF E;  1GL2 A;  1SQX G;  4EDF A;  3D6Z A;  2YKP A;  1JM0 A;  3CI9 A;  3HUS C;  1KTM A;  2JDI H;  3H1J E;  4I7Z C;  3VP9 A;  1L0L K;  3H1J D;  2K3R A;  1GW4 A;  1W2E A;  1EZV I;  3F5H A;  3L72 E;  5KJ7 D;  2IBZ I;  3BAT A;  1FAV A;  1LTG C;  2R3S A;  2VRS A;  3W67 A;  2WT7 B;  1NO4 A;  4R4L A;  1P84 D;  2SPZ A;  2AXT E;  3H1K J;  1FC2 C;  2XV5 A;  2Q9I A;  2NZ2 A;  1NAF A;  3O8Z A;  2FBW C;  1LTI C;  1MFT A;  1VF5 B;  3NFQ A;  5KLV J;  1T2K D;  1IJD B;  4I7Z B;  3VMY A;  1KN7 A;  1SQP G;  1JMB A;  1FOS F;  1S5L X;  1SFC D;  1T6A A;  4UB6 E;  1WRG A;  2WIT A;  3A7O A;  2E74 D;  4Z1M H;  2W6A A;  1OW7 A;  4GIF A;  2IX7 C;  1PGP A;  5CHX A;  2WSE H;  2Q3E A;  4JPZ B;  2RMZ A;  4YTP C;  3AE8 C;  1IFJ A;  5AW1 B;  3PP5 A;  1JY3 N;  4WBA A;  1VF5 C;  3H1L E;  5TJH A;  5APT A;  3U1C A;  1AQ5 A;  2E76 B;  5KJ7 C;  1SP4 A;  5CJ4 A;  1YIJ P;  2L5G B;  1K9M Q;  3BRT B;  1AV1 A;  4DCK A;  2JO1 A;  5EFW B;  2Y0E A;  3CX5 E;  2CPS A;  2AEF A;  2HG5 D;  2ZT9 D;  3CWB G;  3CWB J;  1J1E C;  3CX5 D;  3H1H J;  4C7N B;  3E1I A;  2JJL A;  2W8Z A;  2WQY C;  1DD3 A;  4IL6 X;  4IL6 H;  2N1T D;  2WSF H;  4QMA A;  4XFJ A;  1VQP P;  1ZR4 A;  1E5W A;  2Y0C A;  3IR9 A;  1EZV E;  3O6Q B;  5AW7 B;  3RK3 E;  1LP1 A;  2IBZ E;  2OGU A;  3AE2 C;  1NTM E;  2AXC A;  3S1K A;  2H89 C;  2A06 E;  1NTM D;  2QJK C;  2NPS C;  2FYN C;  1J1E B;  2FYU D;  1NTM G;  4L74 A;  2O01 H;  3M0D A;  1R8E A;  1YJ9 P;  3CXH I;  2FYU G;  1URQ B;  2YIU C;  3E7K A;  4OH8 B;  3V5B A;  4DT0 A;  2HPC A;  2W6B A;  3HE4 A;  2XU6 A;  1JCD A;  3G71 P;  1VQL P;  4A7P A;  1T8Z A;  3NTN A;  3WU2 H;  4L73 A;  3AE7 C;  3NMD A;  1EXJ A;  1NKZ B;  1SFC B;  2RH0 A;  3P32 A;  3FXE A;  4PV1 B;  4N3Y B;  3VMX A;  5AVX B;  1IFM A;  1W2B O;  2QRX A;  1KIL E;  1SQX E;  1FDI A;  2B89 A;  2OTL P;  5AVQ B;  1LTB C;  1SQQ J;  3AEA C;  2E74 C;  5AVY B;  2WPS A;  2KSE A;  3CX5 H;  5AW9 B;  1JO5 A;  3L70 E;  3E1R A;  3CXH H;  3H1L D;  2BAS A;  1NU1 K;  1QX8 A;  2Q1K A;  1R5L A;  2LR2 A;  5KLV K;  2V7Q J;  2XZR A;  3HE4 B;  2QEX P;  4W80 A;  2ZYD A;  3D71 A;  1GDT A;  4XE5 B;  1HGZ A;  4H44 B;  1NYH A;  1VQ8 P;  1NTK E;  1NWQ A;  1KV4 A;  3A3Y B;  4D6T E;  2MKV A;  4RKU J;  2HR3 A;  1GTW A;  3ITK A;  1X9V A;  1GK4 A;  2FYU J;  3QH9 A;  1VQ7 P;  3L37 A;  1EDL A;  1RHZ B;  3WUV A;  3PH0 A;  2N1T B;  3I56 P;  2FFD A;  1KB9 I;  1OX3 A;  1SQP D;  3M9B A;  4PD4 I;  1L4A D;  3I5C A;  1SQB G;  4BRY A;  3Q1M A;  1KC8 Q;  1FDM A;  1LTS C;  2D2C D;  1GZL A;  2PP6 A;  2ZVO B;  3H1H E;  3VMZ A;  3TGU D;  1QVG O;  1ZV8 A;  1KQS O;  3B8E B;  1FJP A;  1T3J A;  1FJK A;  3OA7 A;  1K8A Q;  2KLV A;  3H25 A;  4PV1 D;  1PZQ A;  1OIP A;  3TDK A;  1PV3 A;  1ZOY C;  3CC4 P;  2JR8 A;  1VL2 A;  1KYO D;  1LTJ A;  2OAR A;  1DD4 A;  1HH0 A;  3FWN A;  5DJT B;  5AVV B;  3B5N D;  1L0N D;  1Y9B A;  4HYT B;  1VQ9 P;  1UII A;  1HBW A;  1FU1 A;  1MKM A;  3L71 J;  1JEK A;  1N73 C;  5BVZ A;  3H1I G;  3MZW B;  2K88 A;  3MGN A;  3CLQ A;  1FZC B;  3CCV P;  3MD0 A;  1GMJ A;  1OVV A;  1OWA A;  1LWU B;  1SLQ A;  3AE6 C;  3T97 B;  3V4Q A;  5KLV E;  3Q2Y A;  1OFC X;  1YJN P;  2E74 B;  2B87 B;  2O01 J;  1M1J A;  1RF1 B;  2NPS D;  1A02 J;  1KOR A;  3HUS B;  2YKO A;  1CSB A;  2W90 A;  3H1I J;  1R5S A;  2KZI A;  1AVY A;  3EQ2 A;  3L73 G;  4M3L A;  1OVR A;  2QM8 A;  2AEM A;  3MTU E;  3MUD A;  3L73 D;  3RK3 B;  3L73 E;  4IFM A;  3Q3D A;  2GA1 A;  2OYH B;  1N7L A;  2OYH A;  3L73 J;  4KT0 J;  1GL2 B;  4U3F G;  1H88 A;  1D7M A;  1LT9 C;  2FY8 A;  2PRR A;  2R5D A;  1S9K E;  4RJT A;  4IFD K;  1EDJ A;  1S9K D;  3A5T A;  4HH2 A;  1M8O B;  1W5C E;  4W7Z A;  5KLI C;  1KB9 D;  4U7J A;  3O6Q A;  3HUS A;  3RBZ A;  3PRJ A;  1K05 A;  2J59 M;  3H1K E;  3PJS K;  2JWD A;  3HE5 A;  1IFI A;  1NTZ K;  2P10 A;  2O1J A;  5AVT B;  3RL0 D;  1IK7 A;  3GW6 A;  1SQX K;  3PTZ A;  1BGY E;  4JYB A;  4PJ0 H;  3L75 D;  3SFE C;  2WPQ A;  3L74 G;  5AVW B;  2KIK A;  3RL0 B;  1URQ A;  5CJ0 A;  1NTK D;  4D6T G;  1JTH A;  1L0L G;  4GT1 A;  1LTJ C;  1BE3 E;  3IAO A;  4D6T D;  1SQQ D;  1M56 D;  5AVZ B;  2FKW B;  4PJ0 E;  2ZJS E;  2POH A;  2KNC B;  1JCC A;  1X8Y A;  2QSI A;  2R3C A;  2W6J H;  1LJ2 A;  2ZXX A;  2YNY A;  3AE5 C;  3H1I D;  4L76 A;  4D6T J;  3CCL P;  3D6Y A;  3KYQ A;  3M9H A;  1XTC C;  4HJG H;  2QIW A;  4EI2 A;  1VQ4 P;  3V2Q A;  2WMM A;  3Q5R A;  4JBZ A;  1EXI A;  1FZB A;  5AW8 B;  1SQV G;  1PP9 G;  2M3E A;  1N73 B;  2BCC E;  2N1T A;  2JWA A;  3HRN A;  1PP9 E;  1TU3 F;  2C0X A;  2E75 D;  2QM7 A;  3P8C D;  4IOI H;  1VQ5 P;  2ZAE B;  1DX7 A;  2Z5I A;  3BCC G;  3FWL A;  3CD6 P;  3P7K A;  1EDI A;  3WMM 0;  1JY2 P;  4MN4 C;  1BCC D;  1QGK B;  1L4A B;  1LTA C;  1RF1 C;  3TNU B;  1L0N G;  1NVO A;  1IFP A;  4GKG A;  3CXH E;  1JY3 P;  4GOF A;  1OVU A;  3II6 A;  1IK9 A;  2OYI C;  3A0B E;  3JC2 2;  2FYN B;  2K9J B;  1Y47 A;  1LTT C;  3OAK A;  1CZQ A;  3CC7 P;  3N4X A;  3KQG A;  2CPB A;  1L4A A;  1GL2 C;  3KXD A;  3L75 E;  4ASV A;  3AEB C;  3EFG A;  1NTZ J;  3A0B H;  4U3F D;  3L75 G;  1RE3 A;  4IL6 E;  2WSC H;  3VP8 A;  4Y99 B;  1GU4 A;  3L35 A;  1N7S B;  2HOD A;  1LP1 B;  1X22 A;  1SQB D;  5KLI B;  4R4M A;  3I55 P;  2KZJ A;  3AEC C;  3FX0 A;  1PIX A;  1ZLL A;  1VQN P;  2RKL A;  2LXB A;  3IFM A;  4B86 A;  2IDB A;  3F89 A;  3CCQ P;  4H0L C;  3B5N A;  1J1D C;  3BAS A;  2M3B A;  2V4H A;  3L74 J;  3CCS P;  4C7N A;  1VQM P;  1S72 P;  2NPS A;  2YXR B;  4WY4 C;  2O01 N;  1IO4 A;  1USE A;  3L74 D;  4N6J A;  1SQV J;  3RL0 C;  2GUS A;  3MP7 B;  2WZ7 A;  4ZNC A;  3TYY A;  5KKZ B;  1L0L D;  1N2D C;  1VQK P;  1RE4 A;  1NU1 J;  1JUN A;  2Q5U A;  1KQF B;  4KHX A;  3D70 A;  1BGY D;  1G2C A;  2E75 B;  1NU1 D;  2FXP A;  2KOG A;  2NPS B;  4TLF A;  1PFI A;  1J1D B;  3UIA A;  5KLV G;  1BGY J;  1P84 H;  2IBZ D;  3AEG C;  3CCE P;  3V6I A;  1BE3 D;  4H13 D;  3SWK A;  1N7S A;  2IYP A;  3AEE C;  4I1L A;  3RK3 D;  3V4W A;  2GM4 A;  2WPR A;  3KPE A;  5KAI H;  1DIP A;  1PPJ G;  1FS0 E;  3G4S P;  2YMK A;  2W27 A;  1AFO A;  4LLH A;  1RQU A;  5AW0 B;  3SWF A;  4PV1 C;  1P84 E;  3QWO C;  3L75 J;  3LW5 H;  4RES B;  2O3J A;  4YXD C;  2AEJ A;  2KSJ A;  1J2J B;  3EFF K;  3V2N A;  1L4A C;  2P58 A;  2K9J A;  3AE1 C;  2D2C B;  2W83 C;  2P2U A;  1EC5 A;  1SQP J;  4NPD A;  1BDD A;  1MV8 A;  3TNU A;  1FDO A;  2HOD B;  3CL3 D;  3VOP A;  2Z4E A;  3GHG C;  2BEQ D;  1GW3 A;  5M1B A;  1VF5 D;  2XDJ A;  4PD4 D;  3C8V A;  1RF1 A;  1YTZ I;  2Q7C A;  2H7H A;  2J5U A;  3HD7 C; 
#chains in the Genus database with same CATH homology
 1MFT A;  1EDJ A;  1EDK A;  1H0T B;  2B88 A;  1JMB A;  3MHV A;  1X0T A;  5DJU B;  2KUB A;  2JWD A;  5C39 A;  4EYY Q;  2KIK A;  4WWI A;  5EFW B;  2KS1 B;  2I8D A;  4CPG A;  5K5G B;  4HJG H;  3FXD A;  4ASW A;  1ZW0 A;  4K35 A;  1U7M A;  2WMM A;  1LP1 A;  4JBZ A;  3S1K A;  4HB1 A;  4K3A A;  4IOI H;  2ZAE B;  2OTK E;  1EDI A;  4MN4 C;  4NPE A;  1ZXG A;  1NVO A;  3FXE A;  4GOF A;  1OVU A;  4KJM A;  2QRX A;  4HKZ H;  1Y47 A;  2B89 A;  1H0T A;  2M0B A;  4ZMD A;  4ASV A;  2Q1K A;  2LR2 A;  1LP1 B;  2UWJ E;  2KZJ A;  2HR3 A;  2RKL A;  2LXB A;  1EDL A;  1BDC A;  3PH0 A;  1Q2N A;  2KI7 B;  4NPF X;  4ZNC A;  5CBO A;  2QVA A;  3ZDM A;  5CBN A;  1U7J A;  2M5A A;  2M5A B;  1DEE G;  4GOE A;  1S3J A;  2LXC B;  5DJT B;  3RGU A;  3MZW B;  3QWO C;  1LT1 A;  1OVV A;  2P58 A;  1JM0 A;  4GOD A;  1EC5 A;  2B87 B;  2R44 A;  4NPD A;  2K3R A;  1BDD A;  2B87 A;  2KZI A;  1OVR A;  1SS1 A;  2SPZ A;  1FC2 C;  4BXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...