1JM0A

Crystal structure of four-helix bundle model
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
48
structure length
48
Chain Sequence
DYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FOUR-HELIX BUNDLE MODEL)
publication title Toward the de novo design of a catalytically active helix bundle: a substrate-accessible carboxylate-bridged dinuclear metal center.
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 48
sequence length 48
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1jm0A00
1JMBA 2KZIA 1OVVA 5DJTB 4HB1A 1EDIA 1SS1A 4ZNCA 2P58A 1Q2NA 2RKLA 1FC2C 1EC5A 3FXEA 1LP1A 4K3AA 3S1KA 1OVRA 2LXBA 1JM0A 1OVUA 4ASVA 1S3JA 3MHVA 2K3RA 4NPFX 2B87A 2B89A 2M5AA 4HJGH 4ASWA 4CPGA 2B87B 1LT1A 5EFWB 2M5AB 3MZWB 1NVOA 5CBOA 1EDLA 2M0BA 4GOEA 1Y47A 3FXDA 4JBZA 1EDJA 2WMMA 1DEEG 1H0TB 4IOIH 1LP1B 1U7MA 4ZMDA 4NPEA 2R44A 3QWOC 2QRXA 2Q1KA 2I8DA 1H0TA 2QVAA 4MN4C 3ZDMA 4GODA 3RGUA 5DJUB 1BDCA 2KI7B 2KUBA 2B88A 4WWIA 1BDDA 1MFTA 4KJMA 1EDKA 4NPDA 2JWDA 4HKZH 4BXLA 4K35A 2LR2A 2OTKE 2LXCB 2SPZA 4GOFA 1ZW0A 1U7JA 2KS1B 5K5GB 2KZJA 2UWJE 5C39A 2KIKA 5CBNA 2HR3A 2ZAEB 1ZXGA 4EYYQ 3PH0A 1X0TA
chains in the Genus database with same CATH superfamily
2YO3A 5AW4B 2WSCH 1X79B 3UIAA 1GK4A 1J2JB 1LNQA 1N86A 3MP7B 1Q86Q 4BRYB 2FXPA 1GK6A 2NZ2A 2HODB 1SS1A 1FC2C 3U59A 1FJPA 1GD2E 1LTTC 1OVRA 4RKUJ 1A02F 1YI2P 5CHXA 1NOHA 2M3EA 2WSCJ 4CPGA 3TGUG 4GIFA 3B4SA 1CI6B 1LTGC 4N3YB 1CW5A 4W80A 3C8VA 1L0LD 4H0LB 1L0ND 4PV1C 1KV4A 5B66E 3D6YA 2ZXEB 1GMJA 4D6TD 2QVAA 3L70G 4YXWH 1DD3A 1QL2A 1JOCA 4YTPC 4LLHA 4OGQC 4DT0A 2OYIB 4M3LA 1L0LE 1L0NE 3Q3DA 1OZHA 4I7ZC 4D6TE 2ZJSE 1U7JA 3VMXA 4DZOA 3NTNA 1IFNA 1ZRTD 2E74C 5GTHE 2D2CC 3AEEC 1SQQE 3AE3C 1NU1G 1VPCA 3FX0A 1ZRTE 3CCRP 1JEKA 2WSFJ 2QJPB 2YIUC 1NTMJ 3ITKA 1VQ5P 4H13B 1S4XA 3RL0C 2JO1A 2ZT9C 1QX8A 3AE8C 1ZMEC 2L5GB 1KYOI 2AEJA 3H1IJ 5KAIH 1VQ8P 1L4AD 3E1RA 1FZFA 2BCCG 2BASA 1URQC 4EIJA 1FZEA 3K5BA 1T8ZA 2G3AA 5AW2B 1URQA 3B5NA 3HE5A 1KYOH 4H44C 1SFCD 2XNDH 3MD0A 2E5YA 4C7NA 2J58A 1BSNA 2HODA 2LR2A 3AECC 4U3FJ 3KHUA 5APSA 3L73J 2Q3IA 2FXOA 1MUUA 1YHQP 3B8EB 3HTKB 1PIXA 3H1HG 5AVYB 5AW9B 2QA4P 5AVWB 3H1JD 2WQYC 4H0LC 3W68A 1DH3A 4PD4I 3C1LA 1KQSO 1QGKB 3EFFK 3LW5J 1GW3A 3P7KA 2Y0CA 3M91A 3H1JE 2OYIC 3HD7D 1IFDA 1OX3A 5AVUB 5KJ7C 2IZ1A 2E76B 2ZYAA 1JY3P 4WB4A 1SQPD 4PD4H 3L4FA 5KJ7A 2A06D 3FXDA 2WMMA 2POHA 4HYTB 5KLVK 2J59M 1U7MA 1SQBK 1OW6A 1ZLLA 1AQ5A 1SQPE 1USEA 3WUTA 2K9JB 3F5HA 4MN4C 2A06E 1R5SA 1SQVG 1XTCC 1M57D 3TGUJ 1DIPA 2QJKB 2QJPC 1PFIA 3D71A 2JDIH 2JWDA 5GTHH 3CXHI 4H13C 4N78D 4GT1A 1NTZK 1BE3G 1EZVI 3OJAB 5H2FH 4C46A 5C39A 3BCCG 3M0AA 3CC7P 2HR3A 2W6AA 1H0TB 1L0LJ 1L0NJ 5KAFH 4N78E 1JMBA 4EDFA 1S9KD 4D6TJ 5E79H 4Y28J 3OW2O 1YJ9P 3CXHH 3WUVA 2WSEH 5AW8B 1OMIA 1U57A 3GG2A 3VMYA 4ZNCA 1S9KE 1GTWA 1S5LE 3H6PA 4YPCA 3V2NA 3AEDC 5CCHC 1EQ7A 1AVYA 5BU5A 2XU6A 4NPFX 4RJTA 1FBMA 3HE5B 2XV5A 3V2RA 4YXDC 1BGYD 2N1TB 1J1EB 2FYUK 2M0BA 4GOEA 3V5BA 1PP9J 2W83C 2J5UA 1AA0A 3FWNA 3QWOC 1FDOA 1LWUB 1BGYE 5DJUB 2YO2A 1HBWA 3AEFC 1ZN5A 4PV1D 2KUBA 3TYYA 4JYBA 3T97B 1VQ6P 1JNMA 2WPSA 3PHLA 2E75D 2KS1A 3M9QA 3O6QA 2AEMA 1FE6A 4OGQD 4Z1MH 2C9LY 3L74D 1GL2B 2ZYDA 1JCDA 1RF1B 2XNXA 3H1KG 3A0BH 1KZUB 2E74D 3MGNA 2D2CD 3L74E 1S2EA 4WY4B 2ZXXA 1EDIA 2NPSB 1FS0E 2Q9IA 1M7LA 3Q5SA 2L91A 3GHGB 1H89A 5AVRB 1NTKK 2LXBA 1VQKP 2W27A 2AXTH 4RO0A 1BCCG 2QJKC 2K3RA 3RL0D 1SQQK 1KQLA 2M5AA 3CCUP 1GZLA 4XFJA 3EQ2A 1WT6A 4GDOA 2YXRB 3VN0A 3H1JJ 5KLVG 2H89C 3AE9C 1SQBG 1EXIA 2K37A 1RE4C 1H0TA 3GF3A 3KYQA 2HYNA 4AUWA 1RE4A 4H44D 4HKZH 2GUSA 4KT0J 1IZNB 3I56P 3L73D 1SQPJ 2SPZA 1GU4A 1NTZG 1PL5A 1JTHB 1MFZA 5KAIE 3N4XA 1KYOD 1FAVA 1KQFB 1VQ4P 1KILB 3JSVC 4Y99B 3L73E 2OYHC 3L71D 3PLNA 5DJTB 1MV8A 2N1TC 1QVGO 1J1EC 3G3ZA 2OYHA 1KYOE 3PRJA 1LT9B 1UIIA 2R3CA 2W6BA 3A3YB 1Q2NA 2RKLA 1EC5A 1LWUC 5CCGC 3D70A 1K73Q 1KMIZ 4H0LD 5CCGA 1W5CE 2O01J 2QM8A 1YQ4C 1PGJA 2IFMA 1G2CB 5KJ7D 2FYUG 1PV3A 2QG4A 1GL2C 1Q81Q 4O9BA 2IPPA 1RF1C 1YITP 3TGUD 4R4LA 2Q1KA 2GM4A 1ZR2A 2RMZA 2NPSC 3CCLP 4PD4D 1JO5A 3TGUE 2XKMA 2NPSA 3F89A 4A7PA 1M1KQ 2KK7A 1BGYJ 4DOJA 3L70D 5AW1B 4WVZA 4L76A 1KC8Q 1IJDB 1G1IA 4PD4E 2WT7B 4H13D 1AFOA 2E75C 3PH0A 1Y8AA 2I1KA 2PFXA 3L70E 1J1DC 4HB1A 2G8YA 1JY2O 1WMKA 2FBWC 1X8YA 2HPCB 1SQXK 2QSIA 3AE7C 1JCCA 3JCUH 2P10A 4K3AA 1NU1D 1NGMB 1IK9A 1NTKG 3L74J 1YYCA 3CMEP 2KB7P 4HH2A 5H2FE 3CXHD 2W6JH 3TDKA 1SQQG 1USDA 3CC2P 5CCHD 1EZVD 2B87B 5EFWB 3BATA 5KAFE 2AXCA 1NU1E 1PP9D 1EDLA 1KFNA 5E79E 1HUCA 2PGDA 2OTLP 3M0DC 1ZV8A 3CXHE 3II6A 4IOIH 1EZVE 3L72G 4Y99C 3M0DA 1PP9E 2Y0EA 2Q7CA 4OVNF 3ZDMA 3RGUA 3AEAC 1L2PA 1PPJG 3USSA 3G71P 2BCCD 1LT9C 2KOGA 1LGHB 2KSJA 4PJ0H 3RK2B 4JYCA 4EI2A 1FZAA 3TNUA 4DJGA 3EWKA 1NO4A 2IBZI 2BCCE 1YJWP 1YTZT 1ZXGA 1SP4A 3M9BA 3SWYA 3G6EP 3V4WA 1LTJB 4KHXA 2R5BA 5CJ4A 4BRYA 1HGVA 1NKNA 2JWAA 3BRVB 3VP8A 2E76D 3CI9A 2K1AA 2R3SA 5APTA 1G2CA 1VQNP 2Q3EA 3H1HD 1PGPA 1G1JA 1JY2N 4IFDK 3HRNA 3B71A 3AEBC 1VF5B 1IO4A 3L71J 4ASWA 2N9BA 3H1HE 1CI6A 1JUNA 2P1JA 3A0BE 1KORA 3L75G 1N7SB 4IL6X 3P32A 2PAJA 5CMZA 3Q2YA 1PZQA 1NTMK 2Q6QA 4N6JA 3E1IA 2OYIA 4IFFA 1T3JA 1BDDA 2AXTE 3H1LG 4KJMA 2WTYA 1UIXA 1SVFA 4WBAA 1HJBA 3WU2E 1YIJP 2HPCA 2FYNB 2ZVOB 1RF0C 3L35A 4EOTA 4QMAA 1SQVD 4OH8B 4EYYQ 1RF0A 1X0TA 1LTAC 1IFIA 3TK1A 1VL2A 2KZIA 5AVVB 2YXQB 3FWLA 1BE3D 3CWBG 1SQVE 3TF5A 3GW6A 3BCCD 3VP9A 3V4QA 1SQXG 1W2EA 2N1TD 1HTLC 3MUDC 1P84I 1BE3E 3L70J 1YQ3C 2FFDB 1FZCB 2P67A 3A5TA 3BCCE 1AQTA 1OVUA 1OW8A 3RBZA 4ASVA 3U1AA 1FZBA 5CCGD 5APVA 3HD7B 3RK2C 1LT1A 2JP3A 4BWNA 5APUA 5AVZB 2FKWB 1P84H 2H43A 1Y47A 3CCVP 1EDJA 1HJ0A 1XTGB 5B5EH 2ZFCA 3TSIA 1LTJC 1ZOYC 1GL2D 1NU1J 5CCHA 1VQPP 3G9RA 4AQRD 4TLFA 4UB8H 1FDMA 3CLQA 1BDCA 2FXMA 1LTJA 1CZQA 2YKOA 2HG5D 2WSEJ 1T2KD 4WY4D 5AW3B 2NPSD 1FOSE 4IFMA 2CPSA 3U1CA 3AEGC 3KPEA 2KIKA 2V7QH 1VF5C 1YBKA 3HTKA 3A0HE 5AVQB 3D6ZA 3NFQA 2IYPA 2P7JA 3SFEC 2KP8A 2WPRA 5AW7B 2ZYGA 1ZR4A 1N7SC 2BCCJ 1FDIA 2JKVA 3CD6P 2M3BA 1RY3A 1W2BO 4I6MC 1N7SA 3H1KD 3H32B 1N7LA 3PTZA 3A2AA 2E76C 1ZP0C 1WRGA 1S3JA 3MHVA 2O3JA 3CX5D 2B89A 3I5CA 3H1KE 1L0LK 3S4RA 1L0NK 1OW7A 2FYNC 5CBOA 3KXDA 1HF9A 3AE5C 2WZ7A 1BCCD 2KLUA 3CX5E 1KN7A 1NTMG 3SSUA 2ITAA 2OYOA 2K9JA 3H1HJ 2RN0A 3WU2H 1KILD 2O1KA 3JCUE 3V2QA 1BCCE 1CSBA 4WWIA 1PGOA 3OA7A 5KLVD 3IR9A 1NU1K 3S9OA 1KILE 3IAOA 2WWWA 4GOFA 3H1IG 2W90A 5K5GB 2FFDC 2R32A 5KLVE 2ZAEB 4B86A 5APYA 2YNYA 1NTZD 1EXJA 4XE5B 2D2CB 5AVTB 2FY8A 2E5TA 2JR8A 3E7KA 3MIWA 4UB6H 4PJ0E 1NAYA 2A45G 1AV1A 1SQVJ 2O1JA 1QVFO 5GTIE 3MTUE 4U3FG 4JQ0D 1N2DC 3L73G 4ZKPA 2H88C 2IBZD 2N1TA 1HGZA 3L71E 1BE3J 2ZT9B 3G4SP 2K88A 2IX7C 2H8PD 3BVHA 3BCCJ 2KLVA 2GUVA 3SWFA 2IBZE 1JMMA 1LWUA 1SLQA 4NPEA 1Y9BA 3V6IA 3VOPA 3T97A 1URQB 3B5NB 5TISH 2FYUD 3OAKA 4R4MA 4H44B 4BXLA 4C7NB 3A0HH 1JY3O 3SWKA 2DW3A 2K9YA 2KZJA 1GL2A 2FYUE 2UWJE 3H32A 4L73A 3RK3B 1T2KC 1RF1A 4IL6H 4WY4C 1K05A 1FU1A 4WY4A 5AW0B 1NYHA 1IFMA 2YMYA 3GHGC 3CX5I 2NRGA 3PJSK 3V2PA 3GLMA 3GHGA 5AVSB 3HE4B 2OQQA 2V4HA 1SQPK 2C9NY 3N7NA 1KFMA 1QEXA 1KQGB 1K04A 3CX5H 1PGQA 1L0LG 2P2UA 1L0NG 3WMM0 5KLIB 1GDTA 1GU5A 1SQVK 4D6TG 2WSFH 1LJ2A 1NTKD 3RK2D 4TT3H 4JBZA 1RHZB 1SQQD 3VMAA 3H1KJ 1IFJA 1N73B 2QRXA 1NAFA 1IK7A 3NMDA 1KB9I 3Q5RA 1NTKE 2H7HA 2IZ0A 4I2LC 3R4YA 1P84D 1Q90D 2B9BA 3L72D 1H88A 1KILC 1JTHA 5CJ0A 2JEEA 2Y9ZA 5AW5B 1BCCJ 1KILA 1KB9H 1PPJD 1IC2A 2A45I 1P84E 2Y0DA 1EZVG 4XA4A 3L72E 2RH0A 1PP9G 3Q1MA 1OVVA 5B5EE 1JY3N 1Z56A 1VF5D 1MKMA 1PPJE 2IYOA 1LT9A 4L74A 4UB8E 5GTIH 5BVZA 5KLVJ 1A02J 3JC22 1OWAA 2A45H 2MJZA 1SQBJ 4C7RA 1N7SD 2QJYB 4OWFA 4W7YA 1AJYA 3CCEP 3B5NC 2MKVA 2LKMA 1S5LX 3AE2C 1MZ9A 1S72P 4JF7A 1NTZJ 3CC4P 3GMAA 1VDFA 1AVOA 3RK3C 2W8ZA 3AE6C 1N8RQ 5APWA 2AEFA 1DEBA 1K9MQ 2N9YB 2IDBA 3LW5H 2VRSA 5APXA 3I55P 2E43A 3L75D 4L75A 1VQ7P 2FYZA 1QLED 1M1JB 1MFTA 1EDKA 1L4AB 1M90Q 2C0WA 1Q7YQ 1HH0A 4I1LA 4K35A 4GKGA 3VYIA 3L75E 2KS1B 3O6QB 2WT7A 2Y9YA 3HE4A 5TJHA 5CBNA 1NKZB 2YMKA 3H1LD 3H1JG 1SFCB 1NH4A 3HUSB 2GA1A 3O8ZA 1QL1A 5KLIC 3KQGA 1KD1Q 1X22A 1LTBC 1LTSC 3VMZA 5KKZB 2FYUJ 2XDJA 2KXPB 3H1LE 3VTPC 2KNCB 1HVVA 1R5LA 5B66H 1N73C 3CCQP 3FXEA 3H25A 1SQPG 1RQVA 3CWBD 1D7MA 1N73A 2A06G 3P8CD 2KSEA 2B87A 1SQXD 1OFCX 1TU3F 2M5AB 1NVOA 3RL0g 3IN6A 3CWBE 3P8CE 1VQ9P 1DX7A 1SQXE 2Q5UA 3CPWO 1LP1B 3CCMP 3MUDA 4ZMDA 3CL3D 1X9VA 3P8MC 1T3UA 3CMAP 2Z5IA 2I8DA 1DD4A 4UB6E 2Z4EA 3WUUA 3LIDA 1S1CX 1VQOP 2WVRA 1VQMP 2YKQA 1JY2P 2E42A 2QJYC 3KZIE 1RE3C 1FJKA 3LIEA 1NTKJ 1FZGA 3SFDC 4U7JA 1RE3A 1SQQJ 2KYVA 1Q82Q 2HLOA 3KDPB 1LTIC 3CCSP 3PP5A 3QH9A 4AYCA 2PRRA 1OXZA 5TISE 2WITA 2OYHB 3L72J 2P58A 3L36A 3ABVC 1NHLA 2I1JA 2QIWA 3CCJP 1BGYG 2YKPA 2OGUA 1JM0A 1M1JC 4JPZB 1L4AC 2WPVB 1M56D 3GF7A 1HWTC 4IL6E 2CPBA 1M1JA 1L4AA 1E5WA 4ZKUA 2XZRA 4LC1A 2QE7H 2WPQA 1DEEG 3C9IA 1SFCC 3HUSC 2V7QJ 2R44A 1RH5B 2ZVNB 1M8OB 3NXSA 1SFCA 3HUSA 2WSSH 5KKZC 3L74G 2M8RA 1E79H 1NWQA 3M9HA 2JJLA 1NTMD 2LXCB 1RQUA 4W7ZA 2KNCA 1T6AA 3IFMA 3AE1C 3A7OA 3M06A 2Z5HA 5M1BA 1JB0J 1NTME 2PP6A 4PV1B 1BSHA 3L37A 3L75J 3RBXA 3H1ID 1SQBD 2E75B 1YTZI 4DCKA 1FZCC 4OGQB 2ZT9D 4RESB 2OTJP 1KB9D 5AW6B 1FOSF 2O01N 1J1DB 2FFDA 4I7ZB 1FZCA 2BEZF 3H1IE 3HD7C 1LP1A 1SQBE 3S1KA 2HFED 5KTBA 1IFPA 5L8RJ 2E74B 3H1LJ 3HD7A 1KB9E 1GW4A 4HJGH 5AVXB 1URQD 3B5ND 4LGDE 3MZWB 5APQA 1R8EA 1YJNP 3BASA 2CK3H 1NTZE 3EFGA 4U3FD 2QEXP 2YIUB 3Q5PA 1VQLP 3W67A 3RK3D 3RL0B 3CWBJ 3KZIH 1KTMA 4GODA 4U3FE 3R2PA 2KI7B 2B88A 3AE4C 2O01H 2C0XA 4NPDA 1SQXJ 1S5LH 5BU8B 1OIPA 3L71G 3RK3E 3FGAD 2OTKE 1H8AA 2OARA 2R5DA 1ZW0A 3TNUB 2QM7A 1NJIQ 2IFNA 2IBZG 2BEQD 3IF4A 1K8AQ 3BRTB
chains in the Genus database with same CATH topology
1JMBA 2KZIA 1OVVA 5DJTB 4HB1A 1EDIA 1SS1A 4ZNCA 2P58A 1Q2NA 2RKLA 1FC2C 1EC5A 3FXEA 1LP1A 4K3AA 3S1KA 1OVRA 2LXBA 1JM0A 1OVUA 4ASVA 1S3JA 3MHVA 2K3RA 4NPFX 2B87A 2B89A 2M5AA 4HJGH 4ASWA 4CPGA 2B87B 1LT1A 5EFWB 2M5AB 3MZWB 1NVOA 5CBOA 1EDLA 2M0BA 4GOEA 1Y47A 3FXDA 4JBZA 1EDJA 2WMMA 1DEEG 1H0TB 4IOIH 1LP1B 1U7MA 4ZMDA 4NPEA 2R44A 3QWOC 2QRXA 2Q1KA 2I8DA 1H0TA 2QVAA 4MN4C 3ZDMA 4GODA 3RGUA 5DJUB 1BDCA 2KI7B 2KUBA 2B88A 4WWIA 1BDDA 1MFTA 4KJMA 1EDKA 4NPDA 2JWDA 4HKZH 4BXLA 4K35A 2LR2A 2OTKE 2LXCB 2SPZA 4GOFA 1ZW0A 1U7JA 2KS1B 5K5GB 2KZJA 2UWJE 5C39A 2KIKA 5CBNA 2HR3A 2ZAEB 1ZXGA 4EYYQ 3PH0A 1X0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMB A;  2KZI A;  1OVV A;  5DJT B;  4HB1 A;  1EDI A;  1SS1 A;  4ZNC A;  2P58 A;  1Q2N A;  2RKL A;  1FC2 C;  1EC5 A;  3FXE A;  1LP1 A;  4K3A A;  3S1K A;  1OVR A;  2LXB A;  1JM0 A;  1OVU A;  4ASV A;  1S3J A;  3MHV A;  2K3R A;  4NPF X;  2B87 A;  2B89 A;  2M5A A;  4HJG H;  4ASW A;  4CPG A;  2B87 B;  1LT1 A;  5EFW B;  2M5A B;  3MZW B;  1NVO A;  5CBO A;  1EDL A;  2M0B A;  4GOE A;  1Y47 A;  3FXD A;  4JBZ A;  1EDJ A;  2WMM A;  1DEE G;  1H0T B;  4IOI H;  1LP1 B;  1U7M A;  4ZMD A;  4NPE A;  2R44 A;  3QWO C;  2QRX A;  2Q1K A;  2I8D A;  1H0T A;  2QVA A;  4MN4 C;  3ZDM A;  4GOD A;  3RGU A;  5DJU B;  1BDC A;  2KI7 B;  2KUB A;  2B88 A;  4WWI A;  1BDD A;  1MFT A;  4KJM A;  1EDK A;  4NPD A;  2JWD A;  4HKZ H;  4BXL A;  4K35 A;  2LR2 A;  2OTK E;  2LXC B;  2SPZ A;  4GOF A;  1ZW0 A;  1U7J A;  2KS1 B;  5K5G B;  2KZJ A;  2UWJ E;  5C39 A;  2KIK A;  5CBN A;  2HR3 A;  2ZAE B;  1ZXG A;  4EYY Q;  3PH0 A;  1X0T A; 
#chains in the Genus database with same CATH topology
 2YO3 A;  5AW4 B;  2WSC H;  1X79 B;  3UIA A;  1GK4 A;  1J2J B;  1LNQ A;  1N86 A;  3MP7 B;  1Q86 Q;  4BRY B;  2FXP A;  1GK6 A;  2NZ2 A;  2HOD B;  1SS1 A;  1FC2 C;  3U59 A;  1FJP A;  1GD2 E;  1LTT C;  1OVR A;  4RKU J;  1A02 F;  1YI2 P;  5CHX A;  1NOH A;  2M3E A;  2WSC J;  4CPG A;  3TGU G;  4GIF A;  3B4S A;  1CI6 B;  1LTG C;  4N3Y B;  1CW5 A;  4W80 A;  3C8V A;  1L0L D;  4H0L B;  1L0N D;  4PV1 C;  1KV4 A;  5B66 E;  3D6Y A;  2ZXE B;  1GMJ A;  4D6T D;  2QVA A;  3L70 G;  4YXW H;  1DD3 A;  1QL2 A;  1JOC A;  4YTP C;  4LLH A;  4OGQ C;  4DT0 A;  2OYI B;  4M3L A;  1L0L E;  1L0N E;  3Q3D A;  1OZH A;  4I7Z C;  4D6T E;  2ZJS E;  1U7J A;  3VMX A;  4DZO A;  3NTN A;  1IFN A;  1ZRT D;  2E74 C;  5GTH E;  2D2C C;  3AEE C;  1SQQ E;  3AE3 C;  1NU1 G;  1VPC A;  3FX0 A;  1ZRT E;  3CCR P;  1JEK A;  2WSF J;  2QJP B;  2YIU C;  1NTM J;  3ITK A;  1VQ5 P;  4H13 B;  1S4X A;  3RL0 C;  2JO1 A;  2ZT9 C;  1QX8 A;  3AE8 C;  1ZME C;  2L5G B;  1KYO I;  2AEJ A;  3H1I J;  5KAI H;  1VQ8 P;  1L4A D;  3E1R A;  1FZF A;  2BCC G;  2BAS A;  1URQ C;  4EIJ A;  1FZE A;  3K5B A;  1T8Z A;  2G3A A;  5AW2 B;  1URQ A;  3B5N A;  3HE5 A;  1KYO H;  4H44 C;  1SFC D;  2XND H;  3MD0 A;  2E5Y A;  4C7N A;  2J58 A;  1BSN A;  2HOD A;  2LR2 A;  3AEC C;  4U3F J;  3KHU A;  5APS A;  3L73 J;  2Q3I A;  2FXO A;  1MUU A;  1YHQ P;  3B8E B;  3HTK B;  1PIX A;  3H1H G;  5AVY B;  5AW9 B;  2QA4 P;  5AVW B;  3H1J D;  2WQY C;  4H0L C;  3W68 A;  1DH3 A;  4PD4 I;  3C1L A;  1KQS O;  1QGK B;  3EFF K;  3LW5 J;  1GW3 A;  3P7K A;  2Y0C A;  3M91 A;  3H1J E;  2OYI C;  3HD7 D;  1IFD A;  1OX3 A;  5AVU B;  5KJ7 C;  2IZ1 A;  2E76 B;  2ZYA A;  1JY3 P;  4WB4 A;  1SQP D;  4PD4 H;  3L4F A;  5KJ7 A;  2A06 D;  3FXD A;  2WMM A;  2POH A;  4HYT B;  5KLV K;  2J59 M;  1U7M A;  1SQB K;  1OW6 A;  1ZLL A;  1AQ5 A;  1SQP E;  1USE A;  3WUT A;  2K9J B;  3F5H A;  4MN4 C;  2A06 E;  1R5S A;  1SQV G;  1XTC C;  1M57 D;  3TGU J;  1DIP A;  2QJK B;  2QJP C;  1PFI A;  3D71 A;  2JDI H;  2JWD A;  5GTH H;  3CXH I;  4H13 C;  4N78 D;  4GT1 A;  1NTZ K;  1BE3 G;  1EZV I;  3OJA B;  5H2F H;  4C46 A;  5C39 A;  3BCC G;  3M0A A;  3CC7 P;  2HR3 A;  2W6A A;  1H0T B;  1L0L J;  1L0N J;  5KAF H;  4N78 E;  1JMB A;  4EDF A;  1S9K D;  4D6T J;  5E79 H;  4Y28 J;  3OW2 O;  1YJ9 P;  3CXH H;  3WUV A;  2WSE H;  5AW8 B;  1OMI A;  1U57 A;  3GG2 A;  3VMY A;  4ZNC A;  1S9K E;  1GTW A;  1S5L E;  3H6P A;  4YPC A;  3V2N A;  3AED C;  5CCH C;  1EQ7 A;  1AVY A;  5BU5 A;  2XU6 A;  4NPF X;  4RJT A;  1FBM A;  3HE5 B;  2XV5 A;  3V2R A;  4YXD C;  1BGY D;  2N1T B;  1J1E B;  2FYU K;  2M0B A;  4GOE A;  3V5B A;  1PP9 J;  2W83 C;  2J5U A;  1AA0 A;  3FWN A;  3QWO C;  1FDO A;  1LWU B;  1BGY E;  5DJU B;  2YO2 A;  1HBW A;  3AEF C;  1ZN5 A;  4PV1 D;  2KUB A;  3TYY A;  4JYB A;  3T97 B;  1VQ6 P;  1JNM A;  2WPS A;  3PHL A;  2E75 D;  2KS1 A;  3M9Q A;  3O6Q A;  2AEM A;  1FE6 A;  4OGQ D;  4Z1M H;  2C9L Y;  3L74 D;  1GL2 B;  2ZYD A;  1JCD A;  1RF1 B;  2XNX A;  3H1K G;  3A0B H;  1KZU B;  2E74 D;  3MGN A;  2D2C D;  3L74 E;  1S2E A;  4WY4 B;  2ZXX A;  1EDI A;  2NPS B;  1FS0 E;  2Q9I A;  1M7L A;  3Q5S A;  2L91 A;  3GHG B;  1H89 A;  5AVR B;  1NTK K;  2LXB A;  1VQK P;  2W27 A;  2AXT H;  4RO0 A;  1BCC G;  2QJK C;  2K3R A;  3RL0 D;  1SQQ K;  1KQL A;  2M5A A;  3CCU P;  1GZL A;  4XFJ A;  3EQ2 A;  1WT6 A;  4GDO A;  2YXR B;  3VN0 A;  3H1J J;  5KLV G;  2H89 C;  3AE9 C;  1SQB G;  1EXI A;  2K37 A;  1RE4 C;  1H0T A;  3GF3 A;  3KYQ A;  2HYN A;  4AUW A;  1RE4 A;  4H44 D;  4HKZ H;  2GUS A;  4KT0 J;  1IZN B;  3I56 P;  3L73 D;  1SQP J;  2SPZ A;  1GU4 A;  1NTZ G;  1PL5 A;  1JTH B;  1MFZ A;  5KAI E;  3N4X A;  1KYO D;  1FAV A;  1KQF B;  1VQ4 P;  1KIL B;  3JSV C;  4Y99 B;  3L73 E;  2OYH C;  3L71 D;  3PLN A;  5DJT B;  1MV8 A;  2N1T C;  1QVG O;  1J1E C;  3G3Z A;  2OYH A;  1KYO E;  3PRJ A;  1LT9 B;  1UII A;  2R3C A;  2W6B A;  3A3Y B;  1Q2N A;  2RKL A;  1EC5 A;  1LWU C;  5CCG C;  3D70 A;  1K73 Q;  1KMI Z;  4H0L D;  5CCG A;  1W5C E;  2O01 J;  2QM8 A;  1YQ4 C;  1PGJ A;  2IFM A;  1G2C B;  5KJ7 D;  2FYU G;  1PV3 A;  2QG4 A;  1GL2 C;  1Q81 Q;  4O9B A;  2IPP A;  1RF1 C;  1YIT P;  3TGU D;  4R4L A;  2Q1K A;  2GM4 A;  1ZR2 A;  2RMZ A;  2NPS C;  3CCL P;  4PD4 D;  1JO5 A;  3TGU E;  2XKM A;  2NPS A;  3F89 A;  4A7P A;  1M1K Q;  2KK7 A;  1BGY J;  4DOJ A;  3L70 D;  5AW1 B;  4WVZ A;  4L76 A;  1KC8 Q;  1IJD B;  1G1I A;  4PD4 E;  2WT7 B;  4H13 D;  1AFO A;  2E75 C;  3PH0 A;  1Y8A A;  2I1K A;  2PFX A;  3L70 E;  1J1D C;  4HB1 A;  2G8Y A;  1JY2 O;  1WMK A;  2FBW C;  1X8Y A;  2HPC B;  1SQX K;  2QSI A;  3AE7 C;  1JCC A;  3JCU H;  2P10 A;  4K3A A;  1NU1 D;  1NGM B;  1IK9 A;  1NTK G;  3L74 J;  1YYC A;  3CME P;  2KB7 P;  4HH2 A;  5H2F E;  3CXH D;  2W6J H;  3TDK A;  1SQQ G;  1USD A;  3CC2 P;  5CCH D;  1EZV D;  2B87 B;  5EFW B;  3BAT A;  5KAF E;  2AXC A;  1NU1 E;  1PP9 D;  1EDL A;  1KFN A;  5E79 E;  1HUC A;  2PGD A;  2OTL P;  3M0D C;  1ZV8 A;  3CXH E;  3II6 A;  4IOI H;  1EZV E;  3L72 G;  4Y99 C;  3M0D A;  1PP9 E;  2Y0E A;  2Q7C A;  4OVN F;  3ZDM A;  3RGU A;  3AEA C;  1L2P A;  1PPJ G;  3USS A;  3G71 P;  2BCC D;  1LT9 C;  2KOG A;  1LGH B;  2KSJ A;  4PJ0 H;  3RK2 B;  4JYC A;  4EI2 A;  1FZA A;  3TNU A;  4DJG A;  3EWK A;  1NO4 A;  2IBZ I;  2BCC E;  1YJW P;  1YTZ T;  1ZXG A;  1SP4 A;  3M9B A;  3SWY A;  3G6E P;  3V4W A;  1LTJ B;  4KHX A;  2R5B A;  5CJ4 A;  4BRY A;  1HGV A;  1NKN A;  2JWA A;  3BRV B;  3VP8 A;  2E76 D;  3CI9 A;  2K1A A;  2R3S A;  5APT A;  1G2C A;  1VQN P;  2Q3E A;  3H1H D;  1PGP A;  1G1J A;  1JY2 N;  4IFD K;  3HRN A;  3B71 A;  3AEB C;  1VF5 B;  1IO4 A;  3L71 J;  4ASW A;  2N9B A;  3H1H E;  1CI6 A;  1JUN A;  2P1J A;  3A0B E;  1KOR A;  3L75 G;  1N7S B;  4IL6 X;  3P32 A;  2PAJ A;  5CMZ A;  3Q2Y A;  1PZQ A;  1NTM K;  2Q6Q A;  4N6J A;  3E1I A;  2OYI A;  4IFF A;  1T3J A;  1BDD A;  2AXT E;  3H1L G;  4KJM A;  2WTY A;  1UIX A;  1SVF A;  4WBA A;  1HJB A;  3WU2 E;  1YIJ P;  2HPC A;  2FYN B;  2ZVO B;  1RF0 C;  3L35 A;  4EOT A;  4QMA A;  1SQV D;  4OH8 B;  4EYY Q;  1RF0 A;  1X0T A;  1LTA C;  1IFI A;  3TK1 A;  1VL2 A;  2KZI A;  5AVV B;  2YXQ B;  3FWL A;  1BE3 D;  3CWB G;  1SQV E;  3TF5 A;  3GW6 A;  3BCC D;  3VP9 A;  3V4Q A;  1SQX G;  1W2E A;  2N1T D;  1HTL C;  3MUD C;  1P84 I;  1BE3 E;  3L70 J;  1YQ3 C;  2FFD B;  1FZC B;  2P67 A;  3A5T A;  3BCC E;  1AQT A;  1OVU A;  1OW8 A;  3RBZ A;  4ASV A;  3U1A A;  1FZB A;  5CCG D;  5APV A;  3HD7 B;  3RK2 C;  1LT1 A;  2JP3 A;  4BWN A;  5APU A;  5AVZ B;  2FKW B;  1P84 H;  2H43 A;  1Y47 A;  3CCV P;  1EDJ A;  1HJ0 A;  1XTG B;  5B5E H;  2ZFC A;  3TSI A;  1LTJ C;  1ZOY C;  1GL2 D;  1NU1 J;  5CCH A;  1VQP P;  3G9R A;  4AQR D;  4TLF A;  4UB8 H;  1FDM A;  3CLQ A;  1BDC A;  2FXM A;  1LTJ A;  1CZQ A;  2YKO A;  2HG5 D;  2WSE J;  1T2K D;  4WY4 D;  5AW3 B;  2NPS D;  1FOS E;  4IFM A;  2CPS A;  3U1C A;  3AEG C;  3KPE A;  2KIK A;  2V7Q H;  1VF5 C;  1YBK A;  3HTK A;  3A0H E;  5AVQ B;  3D6Z A;  3NFQ A;  2IYP A;  2P7J A;  3SFE C;  2KP8 A;  2WPR A;  5AW7 B;  2ZYG A;  1ZR4 A;  1N7S C;  2BCC J;  1FDI A;  2JKV A;  3CD6 P;  2M3B A;  1RY3 A;  1W2B O;  4I6M C;  1N7S A;  3H1K D;  3H32 B;  1N7L A;  3PTZ A;  3A2A A;  2E76 C;  1ZP0 C;  1WRG A;  1S3J A;  3MHV A;  2O3J A;  3CX5 D;  2B89 A;  3I5C A;  3H1K E;  1L0L K;  3S4R A;  1L0N K;  1OW7 A;  2FYN C;  5CBO A;  3KXD A;  1HF9 A;  3AE5 C;  2WZ7 A;  1BCC D;  2KLU A;  3CX5 E;  1KN7 A;  1NTM G;  3SSU A;  2ITA A;  2OYO A;  2K9J A;  3H1H J;  2RN0 A;  3WU2 H;  1KIL D;  2O1K A;  3JCU E;  3V2Q A;  1BCC E;  1CSB A;  4WWI A;  1PGO A;  3OA7 A;  5KLV D;  3IR9 A;  1NU1 K;  3S9O A;  1KIL E;  3IAO A;  2WWW A;  4GOF A;  3H1I G;  2W90 A;  5K5G B;  2FFD C;  2R32 A;  5KLV E;  2ZAE B;  4B86 A;  5APY A;  2YNY A;  1NTZ D;  1EXJ A;  4XE5 B;  2D2C B;  5AVT B;  2FY8 A;  2E5T A;  2JR8 A;  3E7K A;  3MIW A;  4UB6 H;  4PJ0 E;  1NAY A;  2A45 G;  1AV1 A;  1SQV J;  2O1J A;  1QVF O;  5GTI E;  3MTU E;  4U3F G;  4JQ0 D;  1N2D C;  3L73 G;  4ZKP A;  2H88 C;  2IBZ D;  2N1T A;  1HGZ A;  3L71 E;  1BE3 J;  2ZT9 B;  3G4S P;  2K88 A;  2IX7 C;  2H8P D;  3BVH A;  3BCC J;  2KLV A;  2GUV A;  3SWF A;  2IBZ E;  1JMM A;  1LWU A;  1SLQ A;  4NPE A;  1Y9B A;  3V6I A;  3VOP A;  3T97 A;  1URQ B;  3B5N B;  5TIS H;  2FYU D;  3OAK A;  4R4M A;  4H44 B;  4BXL A;  4C7N B;  3A0H H;  1JY3 O;  3SWK A;  2DW3 A;  2K9Y A;  2KZJ A;  1GL2 A;  2FYU E;  2UWJ E;  3H32 A;  4L73 A;  3RK3 B;  1T2K C;  1RF1 A;  4IL6 H;  4WY4 C;  1K05 A;  1FU1 A;  4WY4 A;  5AW0 B;  1NYH A;  1IFM A;  2YMY A;  3GHG C;  3CX5 I;  2NRG A;  3PJS K;  3V2P A;  3GLM A;  3GHG A;  5AVS B;  3HE4 B;  2OQQ A;  2V4H A;  1SQP K;  2C9N Y;  3N7N A;  1KFM A;  1QEX A;  1KQG B;  1K04 A;  3CX5 H;  1PGQ A;  1L0L G;  2P2U A;  1L0N G;  3WMM 0;  5KLI B;  1GDT A;  1GU5 A;  1SQV K;  4D6T G;  2WSF H;  1LJ2 A;  1NTK D;  3RK2 D;  4TT3 H;  4JBZ A;  1RHZ B;  1SQQ D;  3VMA A;  3H1K J;  1IFJ A;  1N73 B;  2QRX A;  1NAF A;  1IK7 A;  3NMD A;  1KB9 I;  3Q5R A;  1NTK E;  2H7H A;  2IZ0 A;  4I2L C;  3R4Y A;  1P84 D;  1Q90 D;  2B9B A;  3L72 D;  1H88 A;  1KIL C;  1JTH A;  5CJ0 A;  2JEE A;  2Y9Z A;  5AW5 B;  1BCC J;  1KIL A;  1KB9 H;  1PPJ D;  1IC2 A;  2A45 I;  1P84 E;  2Y0D A;  1EZV G;  4XA4 A;  3L72 E;  2RH0 A;  1PP9 G;  3Q1M A;  1OVV A;  5B5E E;  1JY3 N;  1Z56 A;  1VF5 D;  1MKM A;  1PPJ E;  2IYO A;  1LT9 A;  4L74 A;  4UB8 E;  5GTI H;  5BVZ A;  5KLV J;  1A02 J;  3JC2 2;  1OWA A;  2A45 H;  2MJZ A;  1SQB J;  4C7R A;  1N7S D;  2QJY B;  4OWF A;  4W7Y A;  1AJY A;  3CCE P;  3B5N C;  2MKV A;  2LKM A;  1S5L X;  3AE2 C;  1MZ9 A;  1S72 P;  4JF7 A;  1NTZ J;  3CC4 P;  3GMA A;  1VDF A;  1AVO A;  3RK3 C;  2W8Z A;  3AE6 C;  1N8R Q;  5APW A;  2AEF A;  1DEB A;  1K9M Q;  2N9Y B;  2IDB A;  3LW5 H;  2VRS A;  5APX A;  3I55 P;  2E43 A;  3L75 D;  4L75 A;  1VQ7 P;  2FYZ A;  1QLE D;  1M1J B;  1MFT A;  1EDK A;  1L4A B;  1M90 Q;  2C0W A;  1Q7Y Q;  1HH0 A;  4I1L A;  4K35 A;  4GKG A;  3VYI A;  3L75 E;  2KS1 B;  3O6Q B;  2WT7 A;  2Y9Y A;  3HE4 A;  5TJH A;  5CBN A;  1NKZ B;  2YMK A;  3H1L D;  3H1J G;  1SFC B;  1NH4 A;  3HUS B;  2GA1 A;  3O8Z A;  1QL1 A;  5KLI C;  3KQG A;  1KD1 Q;  1X22 A;  1LTB C;  1LTS C;  3VMZ A;  5KKZ B;  2FYU J;  2XDJ A;  2KXP B;  3H1L E;  3VTP C;  2KNC B;  1HVV A;  1R5L A;  5B66 H;  1N73 C;  3CCQ P;  3FXE A;  3H25 A;  1SQP G;  1RQV A;  3CWB D;  1D7M A;  1N73 A;  2A06 G;  3P8C D;  2KSE A;  2B87 A;  1SQX D;  1OFC X;  1TU3 F;  2M5A B;  1NVO A;  3RL0 g;  3IN6 A;  3CWB E;  3P8C E;  1VQ9 P;  1DX7 A;  1SQX E;  2Q5U A;  3CPW O;  1LP1 B;  3CCM P;  3MUD A;  4ZMD A;  3CL3 D;  1X9V A;  3P8M C;  1T3U A;  3CMA P;  2Z5I A;  2I8D A;  1DD4 A;  4UB6 E;  2Z4E A;  3WUU A;  3LID A;  1S1C X;  1VQO P;  2WVR A;  1VQM P;  2YKQ A;  1JY2 P;  2E42 A;  2QJY C;  3KZI E;  1RE3 C;  1FJK A;  3LIE A;  1NTK J;  1FZG A;  3SFD C;  4U7J A;  1RE3 A;  1SQQ J;  2KYV A;  1Q82 Q;  2HLO A;  3KDP B;  1LTI C;  3CCS P;  3PP5 A;  3QH9 A;  4AYC A;  2PRR A;  1OXZ A;  5TIS E;  2WIT A;  2OYH B;  3L72 J;  2P58 A;  3L36 A;  3ABV C;  1NHL A;  2I1J A;  2QIW A;  3CCJ P;  1BGY G;  2YKP A;  2OGU A;  1JM0 A;  1M1J C;  4JPZ B;  1L4A C;  2WPV B;  1M56 D;  3GF7 A;  1HWT C;  4IL6 E;  2CPB A;  1M1J A;  1L4A A;  1E5W A;  4ZKU A;  2XZR A;  4LC1 A;  2QE7 H;  2WPQ A;  1DEE G;  3C9I A;  1SFC C;  3HUS C;  2V7Q J;  2R44 A;  1RH5 B;  2ZVN B;  1M8O B;  3NXS A;  1SFC A;  3HUS A;  2WSS H;  5KKZ C;  3L74 G;  2M8R A;  1E79 H;  1NWQ A;  3M9H A;  2JJL A;  1NTM D;  2LXC B;  1RQU A;  4W7Z A;  2KNC A;  1T6A A;  3IFM A;  3AE1 C;  3A7O A;  3M06 A;  2Z5H A;  5M1B A;  1JB0 J;  1NTM E;  2PP6 A;  4PV1 B;  1BSH A;  3L37 A;  3L75 J;  3RBX A;  3H1I D;  1SQB D;  2E75 B;  1YTZ I;  4DCK A;  1FZC C;  4OGQ B;  2ZT9 D;  4RES B;  2OTJ P;  1KB9 D;  5AW6 B;  1FOS F;  2O01 N;  1J1D B;  2FFD A;  4I7Z B;  1FZC A;  2BEZ F;  3H1I E;  3HD7 C;  1LP1 A;  1SQB E;  3S1K A;  2HFE D;  5KTB A;  1IFP A;  5L8R J;  2E74 B;  3H1L J;  3HD7 A;  1KB9 E;  1GW4 A;  4HJG H;  5AVX B;  1URQ D;  3B5N D;  4LGD E;  3MZW B;  5APQ A;  1R8E A;  1YJN P;  3BAS A;  2CK3 H;  1NTZ E;  3EFG A;  4U3F D;  2QEX P;  2YIU B;  3Q5P A;  1VQL P;  3W67 A;  3RK3 D;  3RL0 B;  3CWB J;  3KZI H;  1KTM A;  4GOD A;  4U3F E;  3R2P A;  2KI7 B;  2B88 A;  3AE4 C;  2O01 H;  2C0X A;  4NPD A;  1SQX J;  1S5L H;  5BU8 B;  1OIP A;  3L71 G;  3RK3 E;  3FGA D;  2OTK E;  1H8A A;  2OAR A;  2R5D A;  1ZW0 A;  3TNU B;  2QM7 A;  1NJI Q;  2IFN A;  2IBZ G;  2BEQ D;  3IF4 A;  1K8A Q;  3BRT B; 
#chains in the Genus database with same CATH homology
 1JMB A;  2KZI A;  1OVV A;  5DJT B;  4HB1 A;  1EDI A;  1SS1 A;  4ZNC A;  2P58 A;  1Q2N A;  2RKL A;  1FC2 C;  1EC5 A;  3FXE A;  1LP1 A;  4K3A A;  3S1K A;  1OVR A;  2LXB A;  1JM0 A;  1OVU A;  4ASV A;  1S3J A;  3MHV A;  2K3R A;  4NPF X;  2B87 A;  2B89 A;  2M5A A;  4HJG H;  4ASW A;  4CPG A;  2B87 B;  1LT1 A;  5EFW B;  2M5A B;  3MZW B;  1NVO A;  5CBO A;  1EDL A;  2M0B A;  4GOE A;  1Y47 A;  3FXD A;  4JBZ A;  1EDJ A;  2WMM A;  1DEE G;  1H0T B;  4IOI H;  1LP1 B;  1U7M A;  4ZMD A;  4NPE A;  2R44 A;  3QWO C;  2QRX A;  2Q1K A;  2I8D A;  1H0T A;  2QVA A;  4MN4 C;  3ZDM A;  4GOD A;  3RGU A;  5DJU B;  1BDC A;  2KI7 B;  2KUB A;  2B88 A;  4WWI A;  1BDD A;  1MFT A;  4KJM A;  1EDK A;  4NPD A;  2JWD A;  4HKZ H;  4BXL A;  4K35 A;  2LR2 A;  2OTK E;  2LXC B;  2SPZ A;  4GOF A;  1ZW0 A;  1U7J A;  2KS1 B;  5K5G B;  2KZJ A;  2UWJ E;  5C39 A;  2KIK A;  5CBN A;  2HR3 A;  2ZAE B;  1ZXG A;  4EYY Q;  3PH0 A;  1X0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...