1JMCA

Single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
238
structure length
238
Chain Sequence
KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*CP*CP*CP*CP*CP*CP*C)-3')
publication title Structure of the single-stranded-DNA-binding domain of replication protein A bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication/dna
total genus 51
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1996-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF16900 REPA_OB_2 Replication protein A OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jmcA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jmcA02
4L5RC 1TWGH 1NY4A 4GNXC 5BR8Q 4LW1A 1WOCA 4A76A 1M90C 4LF5Q 3JAMc 3H3VH 3K81C 3MXNB 1QVGA 4B3TL 3AFPA 3BJUA 4DV6L 3GDEA 1I94Q 1GD7A 3K0XA 5M5XH 4JYAL 1KAWA 3PGZA 4KHZA 4X64Q 1A8VA 1GO3E 1QZHA 4IPDA 3CC7A 1JJCB 5DLQE 4P72A 2ASBA 2KBNA 4XTCS 3KOJA 3H0GG 2N49A 1KRTA 1EUJA 4DR2Q 3I4NG 2ZTCA 1E24A 4LF4Q 4YCVA 1B7YB 1SMXA 2ID0A 3GTLH 4JV5Q 3B6YA 5AJ3L 1VQLA 4LNQA 1MIUA 1VQHA 2KCMA 2OTLA 2YTXA 3PSIA 1XPOA 2JA7H 1ASZA 3U58A 4A3FH 2GVBA 1G6PA 4JI4L 1JB7A 3M85A 1XPRA 4BBSH 1YJNA 4BY7H 4A3KH 1SR3A 3CPFA 3HOXH 3J7A5 2UXCL 2HIVA 1D8LA 1NMGA 1E7ZA 1FJGL 4R4IA 4DR3Q 4IPHA 4DV3L 2R92G 2YV5A 5K36G 1T9HA 1SROA 3OTOQ 2JA6G 2AMCB 1EWIA 3ULJA 4K0KQ 3J7ZC 4GOPA 4JI6Q 4C3HH 2ALYB 2R93G 4JI5L 1J6QA 3J81j 1X6OA 4POGA 1PH8A 4OO1G 1EFWA 3W1BA 3S2HH 1G51A 4POFA 1HNZQ 2JA5H 5HY6A 2YU9H 4B3RQ 1BVSA 4JBMA 2JJQA 4IPGA 4X65L 1VQOA 3TS0A 1YHAA 1PH9A 4PZ7A 1PHJA 3I55A 2MFIA 1YBYA 4ALPA 4IFDJ 4DR6Q 1CKMA 4NB3A 4O2DA 2EXDA 4JOIA 5GAHC 2VQEL 1XJVA 2PNHA 1PFSA 5IP9H 1FVIA 1NMFA 2VZAA 4DV2Q 1KRSA 3GTOH 1WCMH 2XGTA 2BH2A 1Y1WH 4A3BG 4GKJQ 1HNXL 1H95A 2VQFQ 3E9HA 5C4XH 1YIJA 5BR8L 4C3IH 4A3DG 1U5KA 3F2CA 2PQAA 3RR5A 3WWVA 5IYDH 5C3EH 3FKIH 3J81c 1U0LA 4LF6L 1X55A 3H3VI 4YWKA 4GS3A 4FDBA 1I94L 4MZ9A 3HOZG 4A3CG 3GO5A 4LWCA 1L0WA 2E5LL 1XTDA 4X64L 1C0AA 4LFCL 4A3JH 1XMOQ 4DPGA 3KF6A 4ME3A 5M5WH 4A93H 2OQKA 4LUZA 3UE0A 2CFMA 2ZM6L 1EOVA 3PUWA 4DR2L 1IBKL 1YHBA 3U4VA 1AE3A 1CKNA 2R7ZH 3KFUA 1K73C 4JYAQ 1KQSA 3PIOA 1KC8C 1PH2A 2JK8A 4GOPC 1XNRL 2K52A 3PO3G 2Z0SA 4BXXH 4X6AH 2I5MX 2DGYA 3CMEA 4JI8Q 4JI0Q 1J5EQ 1EYGA 4QY7A 3UDFA 4IPCA 1L2FA 1E3PA 5AJ3Q 3RLFA 4GLVB 2B3GA 2ZTDA 4JI1Q 1S72A 1VQ7A 1L1OA 3AEVA 4OXPA 4X62Q 4A3IG 4DR1Q 3E9IA 4JOIC 1TWAH 2WAQG 3K7UC 1VQJA 2JEAI 3A74A 3IRBA 5FLMH 4R4TA 4L5SA 4JI6L 1BBWA 1FJGQ 1A0IA 3U50C 4GLAC 1HZCA 2A1AA 2E2IH 2CKZB 2IHEA 1HNZL 3RLOA 4R1JA 1N9WA 1K8GA 4RG1A 4AQYQ 4B3RL 2LXJA 4O0AA 3UDXA 4JI5Q 4DK3C 2MQHA 3W5OA 2JE6I 4A75A 4JG2A 3TEHB 1Q7YC 1Q8KA 4AH6A 1YJWA 4DR6L 2UXDL 4YWLA 3OYYA 3UE1A 2YYZA 1OXXK 3AQQA 3RN5A 1VCIA 4X65Q 4NXMQ 4BBSG 4GKJL 4BY7G 3GTQH 1UE1A 3DM3A 4JC0A 5JEAG 3I56A 3CAMA 3HOXG 4QJFA 4AYBG 2VQFL 4A3LH 2WP8J 3CCSA 2VQEQ 2UUCQ 4DV4L 3K80C 2A19A 2WB1G 1GVPA 4GOPB 2AHOB 4WJ4A 2D0PA 2Y0SE 3FP9A 1HNWQ 2B63H 5IWAQ 2ATWA 3CC4A 3CQZH 3S1MH 3CCQA 1XMOL 1SFOH 1L1OC 4LF6Q 2CWPA 3ULLA 5C0XG 4UPAA 1Y1VG 3PUXA 4UP7A 1IXRA 4TQUS 3S1RH 3JAMi 1PH7A 2E5LQ 4JI7Q 3M4QA 3PO2G 3PUZA 4LFCQ 1DGSA 3UDGA 2ZM6Q 5LMNL 4JBJA 1IBKQ 4OO1I 2OCEA 1JJGA 4JI8L 4JI0L 5IP7H 1J5EL 4JBWA 1VQ6A 5IP9G 2WFWA 5LMNW 1MJCA 3T1YL 1XNRQ 1X3FA 2PQAB 3HOYH 1KXLA 5M5YH 2GVAA 4JI1L 1JJ2A 3DLLA 3PV0A 1KL9A 4X62L 4DR1L 5M3MG 4YHHQ 5FLXc 3HOUH 5IYDG 5C3EG 3FKIG 3HKZE 4EX5A 2L15A 4DR4Q 2DUDA 4RMFA 3CW2C 3KF6B 2QEXA 2UXBQ 3PF4A 4OWWB 1UEBA 2JA8H 1E1OA 1KD1C 1VQKA 4A3JG 1CKNB 1N33L 1I50H 3I2ZA 3I4OA 1BKBA 2NN6I 2MNAA 4A93G 5IYCH 5M3FH 2N78A 3S2DH 2R7ZG 3KLWA 4AQYL 4B3SL 2V1CC 3SGIA 4A3EH 2HT1A 1VQIA 1KIXA 2AWOA 1VQDA 2F3IA 4DUZL 4HJAA 2E2JH 1A63A 1D7QA 1VQFA 1FGUA 3L2PA 1I3QH 2LSSA 3L7ZC 4IFDI 4PZ8A 1L1OB 3STBD 4NXML 2VUMH 2KCTA 1Q1BA 2JEBI 4HIOA 1VQNA 2UXDQ 3KF8B 4BA2I 2UUCL 2MO1A 1X9NA 2VW9A 4A3GH 1UE6A 2A8VA 1VQ5A 4YY3Q 5C4JH 2CQOA 2QA4A 4DV1L 2D0OA 3S14H 1V43A 2NZHA 5FLMG 2F4VL 5IWAL 1AH9A 4DV4Q 3BZCA 1AE2A 2MO0A 2PMZE 4UP9A 3F2BA 2NN6G 2OTJA 5ELNA 4X66Q 3PCOB 3G6EA 4WJ3M 4LF9Q 4P75A 4JI7L 2EQSA 2JA9A 1N36Q 3J81i 3HKZG 4GKKL 1MJEA 3M9BA 1PVOA 1EQRA 3TQYA 4IFDG 1HZBA 4LF7Q 2Q2TA 3GTMH 1R9TH 3CCMA 4GLXA 4LUOA 3HOWH 3HOWG 1W3SA 3STBC 1NBWA 5LMNQ 1X3GA 4OX9L 4A3LG 1S3OA 1IZ6A 2I5HA 4LUVA 4MNOA 2AWNA 4YHHL 3I4MH 3CCVA 4PG3A 3KYHC 3T1YQ 4EQ5A 4DR4L 1K9MC 3EBEA 3ULPA 2UXBL 1IL2A 2KHIA 3NBHB 3S1QH 4PMWA 1JT8A 3KDFA 2Q2IA 1TWFH 1RIPA 1SRUA 2YTYA 3FHWA 4XIGS 5H1SE 3TS2A 3E0EA 5IYBH 3BZKA 2R92H 1Y14B 3Q8DA 2PI2E 2R93H 1Q12A 1IBLL 3F8TA 2R6GA 4DKAC 1YVCA 3AYHB 2BH8A 1TWCH 1OXSC 1FL0A 2KHJA 2RCNA 1N33Q 1UWVA 3EN2A 3MEFA 2Q2UA 1NJIC 3S16H 2BA1A 5C0XI 3RNUA 2NVTH 4QIWE 4KI0A 3VDYA 4B3SQ 4IJLA 4R4QA 4UP8A 4YWMA 4GNXA 3W1GA 1Q81C 4B3ML 1VQ4A 1OTCA 4L5QA 4DUZQ 3CC2A 3S24A 1VQCA 1YZ6A 2K75A 2JA7G 4P71A 1PH6A 1OXTA 1C9OA 2XTIA 4A3FG 4Y52H 1LUZA 1Z9FA 5LMUQ 4DR5L 1GM5A 3HOUG 5JJKA 4YY3L 4HIKA 4YCUA 4A3KG 4LF8L 4PZ6A 4H02A 2UU9Q 4P73A 2NVYH 3M4PA 1HH2P 1W2BA 1WI5A 3AFQA 4X66L 1WFQA 4DV1Q 1MKHA 5IYCG 4DV5Q 4LF9L 2F4VQ 2Z6KA 4NXNL 1X54A 4HIDA 1PA6A 1N36L 3KJOA 2IX1A 2Q2HA 1E22A 1O7IA 1M1KC 4LFBQ 4IO9A 5JJIA 2ZJRA 2E8GA 3CCJA 4DUYQ 3ERSX 2IT1A 5JJLA 2RHSB 3GTGH 2VS1A 2JA5G 1TXYA 1B70B 1EIYB 3PF5A 5FJ8H 4LF7L 4HJ7A 3G4SA 4GKKQ 4DR7L 2I0QA 3GTJH 3OW2A 1IBML 3ICEA 4HJ9A 1YITA 1X65A 3CCRA 1YJ9A 4A3GG 1XNQQ 4BBRH 2VL6A 4KHPL 1WCMG 3S17H 1Y1WG 4OWTB 4OX9Q 1HZ9A 4A3IH 3EIVA 3K8AA 3LGJA 1N32L 5C4XG 1JMCA 3M3YH 2D62A 1HNWL 1VQPA 3K7AH 3NEMA 4JI3L 3HOVH 1EIFA 4A3MH 3F1ZA 3CD6A 4OWXB 1QZGA 4IOAA 3A5ZB 1VQEA 1CSPA 3CCEA 4JCVE 2E2HH 1I5FA 1YNXA 2K5HA 3G71A 3I7FA 1IBLQ 3GTKH 4JBKA 3BU2A 4L5TA 4DNIA 2Y0SG 2Z6KC 2FXQA 1CSQA 1YEZA 1P8LA 4LFAQ 1N34L 4BXXG 3T1HL 1OXUA 1OXVA 4QGUA 5C44H 5LMUL 1VS0A 3KDFB 1QUQA 1GKHA 1S40A 4B3MQ 3I4MG 4A4IA 2K5NA 3CXCA 2K50A 3PUYA 1Q82C 3A0JA 2B29A 1VQ9A 2UU9L 2KENA 2QGQA 4GN4B 2HIXA 3NENA 3UDIA 3TREA 4DV0L 4R4OA 4DAYB 5GADC 5IYBG 4DR5Q 1YI2A 1XMQQ 1PH1A 2UUBQ 5IY0A 1N8RC 3PIPA 4LF8Q 1B8AA 4DV5L 1VQBA 4KLKA 4QL5A 1CUKA 2K14A 1PV4A 1IYJB 3CCLA 4LFBL 4JI2L 4Y7NH 4GNXB 1Y1VH 4DUYL 1SN8A 4DV7L 1EQQA 3U4ZA 3PO2H 2JQOA 4UY8C 2VNUD 1LM0A 4NXNQ 1HR0Q 2PI2A 2UUAL 3A5UA 1LYLA 2N3SA 4HJ8A 4BY1H 3I4NH 3H0GH 3RZOH 4OONA 2WAQE 2H5XA 1Q46A 3RZDH 1WJJA 5HGQA 2ZJQA 1V1QA 1XNQL 2NZOA 1QVFA 2F52A 4DR7Q 5GROA 3J80c 2ES2A 2IHFA 4J15A 1IBMQ 3CMAA 5M3MH 1Q1EA 4LF5L 2YTVA 4DAMA 3J80i 2N8NA 3F2DA 1CKOA 4QQBX 4KHPQ 1X56A 1P16A 1PYSB 3ER0A 2BA0A 2LXKA 2IY5B 4BA1I 2B63G 1X3EA 1VQGA 1N32Q 1NE3A 2CWAA 2VY3A 1RL2A 2I5LX 4GN3B 1VQAA 5EAYA 4C3JH 1PH4A 1K83H 4DV6Q 4B3TQ 3PUVA 2K4KA 1XPUA 2ZJPA 2ZTEA 4JI3Q 3RLNA 2JA6H 5ELOA 1ASYA 2HHHL 4AYBE 4LF4L 1NTGA 3HFZB 1Z47A 3CPWA 4IOCA 5FJ8G 4JV5L 4IJHA 2WB1E 4LFAL 2R7FA 4GN5A 4YCWA 1SE8A 3NELA 4MTNA 5E7NA 1YHQA 1E1TA 5IP7G 1SLJA 1QVCA 3H15A 4C2MH 4BBRG 5IT9c 1I6HH 1N34Q 3S1NH 3D31A 3HOYG 1KHIA 4P74A 2NVQH 5JEAJ 3T1HQ 3G48A 4JI4Q 4AIMA 4A3BH 2C35B 1TWHH 4DR3L 1Q86C 1PH5A 3GD7A 3RN2A 1XMQL 2UXCQ 4HIMA 2UUBL 3OTOL 3HOVG 4K0KL 3CF5A 3M7NA 4A3MG 2K5VA 2GN5A 4TVAB 4A3DH 3D0FA 2JA8G 1V9PA 4APVA 2HHHQ 1A62A 2EIFA 5J3BA 4DV0Q 3GTPH 2HQLA 3M4OH 3HOZH 4DV3Q 1K8AC 4A3CH 1G291 5M3FG 4DK6C 2OWOA 4NPSA 3JC66 5C0XJ 1HR0L 5IE8A 3CCUA 1UE5A 3S15H 4R4CA 1BBUA 2OQ0A 3ZJYC 4JI2Q 4A3EG 2RF4A 4DV7Q 4HJ5A 1C7YA 1QUQB 1HR0W 2CCZA 2RHQB 1VQMA 1K0RA 3TRZA 1HZAA 2IX0A 3CP0A 3L0OA 5GQOA 2UUAQ 1PH3A 5C44G 4DV2L 1HJPA 1WYDA 3KJPA 2NVXH 5GAEC 3PO3H 1UE7A 2VUMG 1PYBA 3HKSA 1LTLA 2R7DA 4BY1G 5GAGC 1K3RA 1VQ8A 2AKWB 1JE5A 1HNXQ
chains in the Genus database with same CATH superfamily
1TWGH 2A69D 5ISRA 4GNXC 2WV6D 2B2WC 3JAMc 1HA6A 5T1IA 4JYAL 1KAWA 3PGZA 4OELB 3MFYA 3CC7A 5DLQE 4RGOS 3H0GG 1KRTA 4DR2Q 1E24A 4YCVA 1B7YB 1J9OA 3OWFA 1C48A 1LTID 3GTLH 2LFNA 5AJ3L 2EE1A 4Y7NB 3HOWG 1VQHA 4ZKCB 3R2TA 3M7GA 4KKTA 3AU7A 4JI4L 1XPRA 3I4NB 3EFXD 3OIPA 2PQEA 1SR3A 3CPFA 4A3KH 3J7A5 1SE4A 4IUVA 1G2SA 1FJGL 2F0SA 2EYJA 3KLRA 4R4IA 4IALA 1T9HA 1SROA 4K0KQ 3ULJA 3D4WA 3SK6A 2ALYB 1NR4A 1HXYD 2FMCA 4XYQA 5TSSA 4CJ2C 5HY6A 1I4GA 2JJQA 4IPGA 4FVMA 3PIO3 1K83B 2JA6B 5CV4A 1STEA 4NP5A 2VXWA 2XNAC 1FVIA 1NMFA 4ODGA 3J80E 5KNBA 4DV2Q 3FVQA 3SK8A 2OXPA 1PFNA 2VQFQ 5C4XH 4A3DG 1U5KA 2EY6A 3F2CA 4RHSA 1LT6D 3H3VC 3FKIH 1X55A 1I94L 4FDBA 2KVMA 4X64L 3UI2A 4A3JH 4DAPA 1TWHB 5M5WH 4LUZA 2A6HC 2Z1CA 1EOVA 3PUWA 1AE3A 4OEMB 2R7ZH 3NE5B 5EJWA 1CFMA 4WORA 2R3ZA 3C1EA 1KC8C 2JK8A 2RDGA 2Z0SA 4X6AH 1EU4A 3U9OA 2K32A 1J5EQ 1EYGA 4QY7A 3UDFA 3BVGA 1E3PA 2SDFA 3RLFA 4XQJA 2B3GA 2ZTDA 4OXPA 3I8ZA 4O42A 3E9IA 5F2DA 1B1ZA 3QOJA 5A2QL 4FF1A 2JSOA 2JEAI 1EZ6A 2K1BA 4X3SA 5CBAE 5IGFA 2A1AA 3S17B 1TWGB 1CZGA 2CKZB 2IHEA 4R1JA 1K8GA 3ERQA 1D1IA 2LXJA 4JI5Q 3M3YB 1ILPA 4AH6A 5I6YA 1D5XC 2QF7A 3A8JE 1K8MA 4YWLA 4IFDH 1B9MA 1OXXK 1UE1A 4JC0A 2WP8J 1SXTA 3EROA 4LK1C 5D14A 4B9WA 4R8IA 2VQEQ 4DV4L 1JE4A 3OSOA 4HEDA 3GTLB 3IFDA 2AHOB 1TR5A 2Y0SE 2Z9HA 1U4PA 4K8IA 3CC4A 4C3HG 1FR3A 3S1MH 1UAPA 2ZXOA 1Z6HA 2CWPA 4A3KB 3PUXA 3JAMi 1DGSA 5LMNL 2HD3A 4OO1I 2OCEA 1JJGA 4JI8L 4JI0L 5IP9G 5LMNW 3T1YL 2PQAB 1KXLA 1JJ2A 3R3OA 2JP1A 1KL9A 1BO0A 4C3IG 4DR1L 4YHHQ 1DYQA 3HOUH 3BG3A 4DR4Q 4RMFA 3PF4A 2JA8H 3FDTA 1CM9A 2QDLA 1SYGA 3E3XA 1N33L 4ZQ3A 2EXZA 3ND9A 1BKBA 4A93G 2F0UA 5M3FH 1PTOD 3LWEA 2N78A 5NUCA 1PRTF 4AQYL 3FKIB 4EGVA 1NUCA 5KYLA 2HT1A 2F3IA 2K5DA 1LTTD 1K3BC 2SOBA 4DNTB 4A3JB 1L1OB 5M5WB 2KCTA 1Q1BA 4RHRA 2JEBI 1B4OA 2R7ZB 1V1PB 3KF8B 2G5DA 2UXDQ 2Z8LA 3H91A 1RODA 1X9NA 2VW9A 2A8VA 2ZXRA 2NTSA 1BQQT 3T53B 5EPKA 5IWAL 1AH9A 2MO0A 4UP9A 4OIKA 4PMBA 2NN6G 2OTJA 3VYTA 1EIGA 3GV3A 4JI7L 1Q90A 3HKZG 4GKKL 4GZYC 1VF5C 2F0NA 3KK7A 3V2TA 1KAAA 3BYYB 1PVOA 1HUMA 1EQRA 3P20A 2Q2TA 4GLXA 4LUOA 3HOWH 1H9JA 1B3QA 4KY5A 4G7ZC 3CCVA 5IT9E 4EQ5A 3ULPA 2KHIA 3F2UA 3S1QH 4PMWA 5I4DA 3TS2A 5H1SE 2H1EA 3BZKA 5E4WC 3R93A 2K5WA 4IQZA 4CDEC 1IBLL 5JVH3 4CKBA 4DKAC 1BOSA 2BH8A 3BVZA 4QUCA 1UWVA 1DJRD 2Q2UA 3RNUA 4FF3A 2SNSA 2TMPA 2LS01 1BF4A 3S1MB 2RA4A 4UP8A 4R4QA 2E74C 1XTCD 1Q81C 5CV9A 1VQ4A 4DUZQ 2JA7G 2XTIA 1GM5A 3C2PA 3DM1A 2VB2X 4PZ6A 4LF8L 4F7XA 4P73A 1W2BA 3QB3A 3AFQA 4X66L 2B2UC 4NXNL 1X54A 5IGBA 4HIDA 2EJMA 4KV6A 3HOUB 2FFKB 1CTMA 1M1KC 1HFNA 2KCNA 1E2WA 1K0SA 1VF7A 2KOLA 5FJ8H 3PF5A 3QO2A 1A15A 2KEDA 4HSVA 4DGZA 5M3FB 2XSCA 3D4DA 4HJ9A 1F2YA 3CCRA 1S4ZA 1YJ9A 3CHBD 3S2HB 2LMCB 4OX9Q 3QWNA 2RQXA 1HNWL 3NEMA 3HOVH 4O1NA 1EIFA 2PZUA 4G7OC 3PIP3 1VQEA 1WCMB 3K6OA 2E2HH 1TS5A 2QEJC 1I5FA 1JCKB 3G71A 5C3XA 3GTKH 4JBKA 2OEOA 2Y0SG 2Z6KC 1YEZA 1P8LA 2J7ZA 1PLFA 3T1HL 2F0PA 5JOBA 1OXUA 2HCIA 4QGUA 1ML0D 1S40A 1F77A 3I4MG 1SNPA 1TS3A 4B3MQ 1QCBD 3CXCA 1QOHA 2ZXPA 1Q82C 4H44C 3A0JA 2HHHL 4GN4B 2HIXA 3KBXA 3NENA 4PQXA 5IYBG 1PH1A 2UUBQ 5E3FA 2F0FA 1B8AA 3K5MA 4KKUA 2L0CA 1EQVA 2EYLA 5C4ZA 3J81E 3CCLA 4LFBL 1SN8A 3U4ZA 3BZDB 4C56C 3K57A 5FO7B 5KYIA 3HS0C 1HR0Q 2M9VA 4K5XA 2WAQE 3SDZA 2EZVA 2ZJQA 4HN7A 2NZOA 3I73A 4K6DA 2KUMA 5K5PA 1IBMQ 4S3SA 4DAMA 2N8NA 1ET6A 5EPJA 2NBFA 1PYSB 3EA6A 5BN3A 1DXMA 3N52A 1NE3A 2VY3A 4GN3B 4DU9A 1VQAA 1HUNA 4C3JH 5K36H 3PUVA 2V4DA 2ZJPA 1SE3A 1SAPA 5ELOA 1F2ZA 2JYOA 5CV6A 5EQ0A 1O78A 4ZCKA 1TQOA 4LFAL 1SE8A 5HGTA 2B63B 1I4RA 1SLJA 1QVCA 2QDBA 1F2LA 3HRZC 1X3PA 4BBRG 1N34Q 5FK9C 1SNDA 5DEHA 3G48A 1OO9B 1PH5A 1XMQL 4K0KL 3M7NA 2K5VA 3GV6A 3SXHA 1XXGA 1A62A 4DV0Q 3HOZH 2HQLA 3M4OH 1K8AC 4KK7A 3MWYW 2I46A 4HAEA 3WDNA 3A8IE 1AEXA 1DONA 3HOVB 1RKNA 4E6IA 1C7YA 4NMZA 2CCZA 1HZAA 3CP0A 1PH3A 5FKAC 5C44G 4DV2L 3PO3H 2E2HB 1UE7A 1HTPA 3GTKB 4HTHA 1SNMA 4BY1G 4ILWA 4A3EB 2QCPX 1GXDC 5BR8Q 1WOCA 1M90C 4CDDC 4LF5Q 4EVOA 4DV6L 1GD7A 5M5XH 1PTOH 4RGTA 2BCOA 4KHZA 4XDXA 2D2CC 1WTOA 1A8VA 1GO3E 1JJCB 2A74C 2HCCA 2ASBA 3KOJA 4QIWB 1HA5A 2KA7A 4LF4Q 3A8KE 1LT3D 2RDHA 3TBIB 2KCMA 2YTXA 3PSIA 2JA7H 1ASZA 1AW7A 3U58A 2GVBA 1JB7A 1J8IA 2NB0A 1YJNA 1ENAA 4BY7H 1MGSA 5JEAH 4ZRZA 2UXCL 1SMYC 1D8LA 1NMGA 1E7ZA 2XVSA 4UAIA 3TP7A 3VA5A 4DV3L 2YV5A 2DNEA 1TS2A 3OWEB 3J7ZC 5JPNC 4J8QA 4JI5L 3BDLA 5KIXA 4XQNA 2A6HD 4KY6A 1X6OA 3J81j 1PH8A 2HQEA 5C0XH 1A2TA 4POFA 1B44D 4DXGA 1C4QA 4C3JB 3TS0A 1PH9A 4HCEA 2E76C 1XJVA 2VQEL 5GAHC 2A68C 1DOKA 1EFID 4A3BG 1LT4D 1KRSA 1H95A 2XGTA 2BH2A 3NPPA 3E9HA 1YIJA 2NVTB 1JQYD 1ET9A 3OOCA 1U0LA 2EJGC 4YWKA 3ONAB 4MZ9A 2N88A 3SE0A 1LO5D 5CR3A 3I3CA 3U9SA 1LV9A 3SVMA 1XMOQ 3KF6A 5KGUA 2OQKA 3UE0A 3KFUA 1BR9A 3PIOA 1RF2D 3HOZB 2RKSA 3M4OB 1R4PB 2K52A 3J80L 2F3WA 1TVXA 3DXJC 2F0HA 3J7YW 5JPMC 4JI1Q 1VQ7A 4X62Q 3PO3B 2WAQG 5E4XA 4L8JA 5FLMH 3NQTA 4JI6L 3CRKC 5LHY1 2Z4HA 1NAPA 1HNZL 1EY8A 1N9WA 4B3RL 1ICFB 4DK3C 1TY0A 2JE6I 4A75A 3TEHB 5M5XB 2BDNA 1YJWA 4DR6L 4QCLA 1PTOB 2UXDL 2TSSA 3UE1A 1VCIA 2G9HD 4X65Q 4BBSG 4GKJL 3X3MA 4A3LH 3CAMA 5ELEA 4QJFA 2CVRA 3HOXG 1R4QB 3RUZA 1QE6A 1HCZA 4GOPB 1FGBD 1H9SB 1GVPA 1KABA 2A6ED 3FP9A 2JA7B 2DY7A 1EY7A 4BY7B 1G6ZA 3SK5A 1L1OC 4LF6Q 3NBHA 1V1OA 3ULLA 4AYBB 1QG7A 4L63B 4UPAA 1Y1VG 3DUZA 3S1RH 1XYIA 3PO2G 2E5LQ 2DNCA 3M4QA 3T16A 3PUZA 2WKCA 2WB1B 4LFCQ 3GQBA 2ZM6Q 3OIQA 3TP5A 4KY7A 4F8MA 4JBWA 3T56B 2WFWA 2IW3A 1MJCA 4ABNA 1XNRQ 1RDPD 4KN4C 2GVAA 3QG1A 1HNXQ 1LACA 4RKLA 3DWAA 3LWUA 5FOBB 5M3MG 5FLXc 3K5LA 5IYDG 3HP3A 4RAUC 3HKZE 5D65A 5C3EG 1U4LA 2L15A 5EBDA 2UXBQ 2QEXA 4U68A 1SJHD 5IGCA 1VQKA 3MHBA 5L37A 1CKNB 3NBIA 1I50H 4R9WA 1ENCA 2NN6I 3S9WA 2AQ1B 2K28A 4EQOA 3I90A 3S2DH 2B8GA 2PZTA 3KLWA 1FNUA 3C3LA 1IYUA 3T13A 4R8NA 3BYTB 1KIXA 2AWOA 1VQDA 4DUZL 1D7QA 4HJAA 3AMUA 1CK1A 1A63A 1I3QH 2LSSA 3L7ZC 4NXML 4DNRB 1WD1A 5A35A 3IKJA 2EYMA 3QIAA 2UUCL 1GUTA 4FXKC 2BE5C 3EJIA 4RKBA 2D0OA 4K5VA 1PFMA 1V43A 3BZCA 3F2BA 2C5CA 2EYPA 3KLSX 4ME5A 5ELNA 1D2BA 1PZKD 1O7YA 2B2VA 1VMCA 3G6EA 4LF9Q 1N36Q 2CH4A 1EY5A 2LKVA 4KD3A 3T51B 3NWSA 2F0WA 4LAAA 3VR2A 1HZBA 1KLUD 4LF7Q 3GTMH 3CCMA 1PMRA 5FO8B 3P75A 1W3SA 1IL8A 4K2KA 4OX9L 1X3GA 4LUVA 2K33A 3ND8A 1CT1D 2B2UA 2IPKD 2RCFA 3EBEA 2WINB 3KDFA 2Q2IA 2F03A 1TWFH 4XIGS 3FHWA 5CV5A 3AB9A 3P7JA 5CMDA 4DXFA 1YVCA 3AYHB 1OXSC 1FD7D 1FL0A 2F0OA 3MEFA 5C0XI 3V05A 1DOMA 4Z9CB 4B3SQ 4IUQA 4B3ML 5IT9L 1OTCA 3S1RB 1YZ6A 1DZ1A 1X32A 4A3FG 1PDQA 1HPCA 1S5BD 1Z9FA 4WJWA 5JJKA 4YY3L 4HIKA 1LTAD 3Q0AA 5C6AA 1V8QA 3QJYA 5DM63 2KECA 1PRTD 2UU9Q 1SYCA 3M4PA 2B2YC 1HH2P 1WI5A 1CQVA 1WFQA 5CYUA 1BUVT 5IYCG 4EQNA 4DV5Q 2Z6KA 3JAME 5I6WA 1PA6A 1D6EC 1Y8OB 2D9UA 1CHQD 1IKLA 4DUYQ 2IT1A 2RHSB 4XT1B 3T4AC 2JA5G 1TXYA 2DJFC 1I50B 1PZJD 2QILA 3GTJH 4HMIA 3VYRA 3OW2A 1IBML 3S2DB 1F9RA 1GUSA 2KQ3A 1RJTA 4A3GG 1XNQQ 3D3RA 1ESRA 1Y1WG 1WTRA 1C8CA 1I3QB 2QW7A 3K8AA 5FLXE 3LGJA 5CBEE 1JMCA 2D62A 1FNVA 1VQPA 3K7AH 4IOAA 3CD6A 1QZGA 3K5NA 1FNWA 4JCVE 1EL0A 1TU2B 5C4XB 4ZUIA 2O4XA 4L5TA 3A54A 1ILQA 2FXQA 1CSQA 1N34L 4BXXG 3NWTA 4FXDA 4DK1A 5LMUL 1GKHA 3NQIA 4A4IA 2K50A 3PUYA 2K03A 2A69C 3FRPB 1JWUD 4DV0L 4DR5Q 4R4OA 4DAYB 1STAA 3PIPA 2BOSA 4QL5A 2K14A 4GNXB 1Y1VH 3PO2H 4UY8C 2L11A 1LM0A 1TWFB 3MZ5A 1GUWA 1LYLA 4CBVA 3H0GH 4N8X1 4X3TA 3OMCA 1EWCA 2H5XA 1Q46A 3RZDH 1WJJA 5HGQA 1EY0A 2IX3A 2ES2A 1IW7C 3M4YA 5M3MH 1Q1EA 5I9PA 1IHZA 4LF5L 3J81L 4KHPQ 2EPBA 4BA1I 2XN9C 4HMJA 4DN4M 1VQGA 1PH4A 4JI3Q 3RLNA 2G9DA 1ASYA 4LF4L 4LMQD 2OT2A 3CPWA 1VMPA 4IOCA 2NZ1D 2R7FA 4YCWA 3D6CA 2PW5A 5E7NA 5ELBA 1YHQA 1M4VA 5CC4A 1AN8A 1NR2A 3K5OA 1EWHA 1YNNC 1QILA 2B2VC 4C2MH 1I6HH 1S5DD 3D31A 2NVQH 1ZEQX 2AUJD 1ZYRD 4JI4Q 4AIMA 1BCPB 2C35B 4NKLA 4X3KA 3RN2A 2L55A 4HIMA 3GTJB 4KTAA 4A3DH 4H7BA 4A3MG 2K05A 1V9PA 1O7ZA 3GTPH 4YIJA 2F0KA 2AUKA 3I4LA 5IODA 2GA4B 1G291 5LL6X 4DK6C 1JOQA 1QWYA 3JC66 5IE8A 1UE5A 1MD2D 1HQRD 2OQ0A 4R4CA 3K7AB 4JI2Q 1RCVD 4DV7Q 2L9HA 4HJ5A 1QUQB 1Y69U 2JA8B 3L0OA 1LTBD 1WYDA 3KJPA 4DF7A 1PYBA 2J0TD 4PV1C 1K28A 5T1GA 2L12A 2X6LA 3E0JA 5GAGC 2AKWB 1W6JA 1SMYD 2A5HA 4A76A 1B3AA 1IKMA 1SEBD 3K81C 3MXNB 3OMGA 5I2YA 1QVGA 3AFPA 3BJUA 1WTWA 3GDEA 1I94Q 4B3TL 3D8GA 4X64Q 4FYDA 1JOKA 1QZHA 2RSOA 3BDCA 4XTCS 3I4NG 1EUJA 2ZTCA 4F88A 3DHQA 5D3DA 2ID0A 4JV5Q 3B6YA 1Y1VB 2OTLA 4A3FH 3NK9A 1SYDA 3H0GB 4V190 2MGSA 3RZDB 5E1FA 5ELFA 4B9XA 5IGDA 3HOWB 3TDQA 4DR3Q 4IPHA 5JJZA 2JA6G 3OTOQ 1EWIA 2DN8A 5M3MB 4C3HH 4H0LC 2NWGA 4POGA 1EQTA 1EFWA 4OO1G 2F0MA 3S1QB 2JA5H 2YU9H 4JBMA 2N55A 4XQQA 1S5FD 4X65L 1VQOA 4PZ7A 1PHJA 4IFDJ 1YBYA 4ALPA 2PW7A 2F1MA 4O2DA 2MPMA 5IP9H 2B2TC 2D5DA 1NNXA 4KKSA 1Y1WH 1HNXL 4MHEA 1QNUA 4Q5VA 4C3IH 2PQAA 4C2MB 4LF6L 1I6HB 3H3VI 2JXMB 4GS3A 4A3CG 3GO5A 2F0DA 2NVQB 2E5LL 1XTDA 4LFCL 2K04A 4ME3A 4A93H 2CW0D 2ZM6L 2CFMA 4DR2L 4KHVA 4A3DB 1KQSA 3GTPB 1XNRL 4GOPC 4BXXH 2I5MX 4JI8Q 4JI0Q 4KJOA 5HURA 5IGEA 2RDFA 1S72A 1L1OA 2QKIC 4N9TA 3AEVA 4DR1Q 4FNFA 4JOIC 2PPBC 1TWAH 1V1PA 2LY7A 3KF8A 4DK0A 3A74A 3IRBA 1LT5D 4L5SA 1BBWA 2WKDA 1EEFD 3U50C 2NN6H 4GLAC 1HZCA 1E0BA 1KNAA 5ELDA 1TT2A 1GOZA 3RLOA 4RG1A 4AQYQ 3UDXA 2MQHA 3W5OA 1EYAA 2C9OA 3D6WA 5EBCA 2PCFB 1KDCA 4CHTB 5C5LA 4RCNA 3RN5A 1F9QA 1B50A 1T5EA 1YNJC 3DM3A 3GTQH 5DM73 5FO9B 2VQFL 3CCSA 1KDBA 3PMFA 5BN4A 1VDZA 4WJ4A 2D0PA 4NW2A 3Q24A 3MVVA 3SEBA 2CH4W 5IWAQ 4G7HC 2J4XA 3CCQA 2ZT9C 3G6JB 1SFOH 1TY2A 3W3AA 1PH7A 1IXRA 4TQUS 4JI7Q 1CI3M 2MP1A 3I70A 4ZKBB 1CA5A 1H9KA 4JBJA 1IBKQ 4IURA 4C3HB 1J5EL 2XWJB 1VQ6A 1ICWA 4XT3B 4C1NK 2JA5B 2YU9B 4JPBW 1LTRD 5DNFA 3SHLA 2EYFA 4IUUA 3A7AB 3FKIG 4EX5A 1I6VC 3CW2C 4I65A 1E1OA 1KD1C 4A3JG 2Q8TA 3I2ZA 2NUCA 4J6HA 4C3IB 2R7ZG 1MSHA 4K6LA 4B3SL 4K5WA 1HHVA 2V1CC 2E2JH 1BBXC 4OIJA 1VQFA 4JK1C 4PZ8A 4B08A 1GUNA 4A93B 3V96A 2MO1A 3S14H 2JN4A 1WTQA 1DM0B 3MEHA 2PMZE 3DMUA 3FPPA 3NTKA 3EQLC 4X66Q 3NXWA 5C3WA 1JR0D 3I72A 4P75A 2JA9A 1G8ZD 1PRTB 3CRLC 2F4IA 3M9BA 1TWAB 1STYA 4RA8A 4IFDG 1R9TH 3WOFA 1U4RA 3STBC 1NBWA 1S3OA 1IZ6A 2B2YA 2F0VA 2I5HA 1BCPF 4I7ZC 5LL6S 3HKZB 4YHHL 3A7LA 3I4MH 4IZ8A 4PG3A 2DY8A 2F0JA 1STHA 4DR4L 1JT8A 4CJ1B 2K7VA 1EEID 1F2MA 2FINB 3OPOA 3E0EA 5IYBH 1QNKA 4IUPA 3Q8DA 2PI2E 1Q12A 3F8TA 2F0LA 1TWCH 2KHJA 3EN2A 1NJIC 2PNRC 3S16H 1F9PA 3MTSA 2WIIB 4QIWE 4KI0A 4IJLA 1SFOB 1BDOA 3S24A 1VQCA 1AZPA 3HG9A 4RGNA 1OXTA 1C9OA 4DA2A 4DR5L 3O13A 3HOUG 4YCUA 3DEOA 2X69A 4LJZC 2ICEC 4H02A 1D5MC 1EY4A 4HSPA 5KNCA 4RH6A 1JOOA 2R61A 3C1FA 4DV1Q 1MKHA 4DFAA 2F4VQ 5JAVA 4FO2A 2Q2HA 2ICIA 4LFBQ 4IO9A 2E8GA 3CCJA 5JJLA 3MXPA 2VS1A 1GUOA 2K6AA 3G4SA 1ZKOA 2KHSA 2RVLA 1YITA 3VA7A 2WACA 3SR1A 1W6KA 1GHKA 3NUCA 3KBGA 4QUFA 4BBRH 2E2JB 4KHPL 1WCMG 3S17H 4OWTB 4CGYB 3URYA 2I07B 4FF4A 3M3YH 3JAML 2FMMA 3VR4A 5CV7A 4JI3L 4FXGC 4KJNA 3ZYYX 4OWXB 4DAVA 1CSPA 4ZUJA 1A6XA 3S14B 1YNXA 1G91A 5G3LF 1L0XB 5J39A 2E2DC 4LFAQ 2FHTA 1DD2A 4V0BA 5FLXL 2M00A 5C44H 1SDFA 1VS0A 3GP7A 1IW7D 2K5NA 1B53A 2B29A 1R9TB 2QGQA 1VQ9A 3UDIA 2Y0SB 4BY1H 1XMQQ 4K14A 1ESFA 1VQBA 1WTHA 4KLKA 3I4MB 1RD9D 1RHPA 3WOEA 4JI2L 1MI2A 4DV7L 2FJ2A 3NTIA 2JQOA 5CORA 4IUTA 1EY6A 2PI2A 1BCPC 3RZOH 2EY1A 1YNND 1JWMD 1TWCB 4PMCA 1AP0A 4DR7Q 4G4KA 3S16B 4J15A 2F3VA 3CMAA 2XIWA 3OW7A 3HZXA 3J80i 1CHPD 3BVMA 4QQBX 1X56A 3ER0A 4C1NI 2BA0A 2LXKA 2IY5B 2B63G 1N32Q 3MC0B 2CWAA 5EAYA 2I5LX 3TSSA 4DV6Q 4H13C 1WTPA 4J1MA 4AYBE 1NTGA 1QJOA 1M8AA 5FJ8G 4JV5L 4IJHA 2WB1E 4GN5A 4TKOB 3NELA 2HDLA 3X3NA 3CKIB 5IP7G 1A3TA 3H15A 4FF2A 3K0YA 5IT9c 2Z6BA 3S1NH 2A73B 3HOYG 2EVBA 4P74A 1QB5D 2M2LA 5JEAJ 1LTSD 1U4MA 4A3BH 4DR3L 2AQ3B 2UXCQ 2UUBL 3KUPA 3OTOL 3DWPA 3HOVG 5EPLA 4XXEA 1IYVA 4APVA 1KTKA 2EIFA 4BBRB 1XWEA 4DV3Q 1EIHA 3H6MA 4IUNA 1MSGA 1LABA 5KEEA 2OWOA 4NPSA 2Q8IB 4ULLA 5C0XJ 1HR0L 3S15H 1BBUA 4A3EG 1S5ED 2RF4A 3D4RA 3OHXC 1HR0W 4QB4A 1EYCA 3P1HA 2IX0A 5GQOA 1Z7TA 2UUAQ 5BN5A 2NVXH 1HJPA 1KDAA 2VUMG 3HKSA 3MXUA 3IL8A 2CQAA 2R7DA 4CDFC 1HRJA 1I4XA 4L5RC 1EOTA 1NY4A 4LW1A 2O2LD 2SNMA 5C44B 4EQPA 3H3VH 1EZ8A 3K0XA 4BY1B 4IPDA 4P72A 2KBNA 2XRQD 1HFGA 1SYEA 2N49A 5EGTA 2B2TA 3NSWA 2NTTA 1SMXA 1VQLA 4LNQA 1MIUA 1XPOA 1PXUA 2HDMA 1G6PA 2L1BA 1RTNA 3M85A 4BBSH 4QF4A 1XX8A 3RZOB 3HOXH 2A6EC 2XRSD 3L3OC 2HIVA 3NHHA 3GTMB 4G57A 5C5MA 4I7AA 3W2DA 2F0QA 4C3JG 2R92G 5K36G 1HQMC 2AMCB 1GJXA 4GOPA 4JI6Q 1H9SA 2R93G 2X6GA 1J6QA 3W1BA 3S2HH 1HTLD 5J22A 1G51A 1HNZQ 2AQ2B 1H9MA 1BVSA 4B3RQ 1BNZA 5KNDA 1JICA 1YHAA 3I55A 2MFIA 4DR6Q 3HGBA 1CKMA 1MBYA 4NB3A 2EXDA 4JOIA 3G7LA 2PNHA 1PFSA 3TP6A 3MFGA 2VZAA 3GTOH 2K01A 4GKJQ 1WCMH 5D3IB 5BR8L 3RR5A 3WWVA 4ZK9B 5IYDH 5C3EH 2MUYA 3J81c 3HOZG 2SEBD 3S1NB 4LWCA 3IAYA 4OGQC 1L0WA 2NYZD 4JW0A 4MIUA 1DOLA 4M8AA 5A2QE 1C0AA 4A3BB 4DPGA 3CU7A 4RFBA 3LNNA 1STNA 1SNCA 1IBKL 1YHBA 3U4VA 1O7LA 1CKNA 1E2ZA 4JYAQ 1K73C 1T5XD 4M1UB 1PH2A 2ENBA 3PO3G 2DGYA 1PTOF 5ELCA 3CMEA 1YNJD 3S15B 4IPCA 1L2FA 5AJ3Q 2EYOA 4GLVB 3Q6SA 4A3IG 3NP8A 5AFWA 2EY5A 2NVXB 1JC7A 3QOLA 3K7UC 1VQJA 4R4TA 1FJGQ 1A0IA 2O5JC 2E2IH 1AFPA 3H94A 4O0AA 3VYUA 1JB3A 2F0EA 2WAQB 4JG2A 1Q7YC 1Q8KA 3E6ZX 2KEEA 3OYYA 2YYZA 2E75C 3AQQA 4NXMQ 4BY7G 5JEAG 3I56A 2EY2A 4AYBG 2UUCQ 1ENFA 3QR8A 3K80C 4UHVA 1D5ZC 3J7AF 2A19A 2WB1G 2B63H 4L6TB 2ATWA 2H4OA 3KLSA 3CQZH 1Q8IA 4BBSB 1XMOL 3HOXB 5C0XG 4F87A 4UP7A 5M9OA 4WFN3 3UDGA 1KNEA 5IP7H 1B9NA 4FP5D 5C4HA 1X3FA 3HOYH 3PO2B 5M5YH 4JI1L 2A68D 3DLLA 3PV0A 2KJXA 4RCOA 4X62L 4ZYSA 1PRTC 1RTOA 1NSNS 2DUDA 3KF6B 1ONLA 4OWWB 1UEBA 4CKCA 4P2CB 3VR3A 3GTOB 3TN2A 1UUPA 3I4OA 2MNAA 1B2TA 5IYCH 2L4NA 3FPUB 5C3EB 4MTKA 2K5QA 3SGIA 4A3EH 1VQIA 1NCVA 1F9SA 3SK4A 2XWBB 1DCZA 2Q8RE 3DEPA 5EKIA 3TMEA 2P5ZX 1FGUA 3L2PA 1EU3A 3LX0A 4IFDI 3A56A 3STBD 2VUMH 1STGA 1TS4A 2EDGA 4HIOA 1VQNA 1CA6A 4BA2I 3MAQA 2PZWA 4A3GH 1UE6A 1VQ5A 4YY3Q 5C4JH 2CQOA 2QA4A 4DV1L 1G2TA 2F0GA 2NZHA 2PYKA 5FLMG 3ITPA 4CJ0B 2F4VL 4DV4Q 4NDXA 1AE2A 3FMCA 3PCOB 4WJ3M 1SBBB 2EQSA 2MJ8A 1PTOC 4TSSA 3Q22A 3J81i 3HEJA 1MJEA 4RWSC 5EKKA 3VR6A 1EYDA 3I91A 1CZWA 2RBMA 3TQYA 5I9OA 1SJED 2EJFC 4JVZA 2E2IB 4N9PA 4A3LG 3H09A 5LMNQ 5CGKA 3R8BA 4TRDA 3TZUA 4MNOA 2AWNA 2Z4IA 3Q23A 3T1YQ 3KYHC 1JORA 2UXBL 1K9MC 1IL2A 3NBHB 3VR5A 5IIFA 1RIPA 1SRUA 2YTYA 1D1KA 1JWSD 2R92H 1Y14B 2R93H 1CQFA 1STBA 2R6GA 3FEWX 3L9AX 3RMHA 4DAYA 3MXGA 1FYCA 2RCNA 1N33Q 4U673 4OL7A 2BA1A 2NVTH 2B39A 4KMUC 3CQZB 3IFTA 3K59A 3VDYA 4GNXA 4YWMA 3W1GA 3CC2A 2B2WA 1LTGD 3EVQA 4L5QA 2K75A 1SE2A 4P71A 1PH6A 2RSNA 4Y52H 1LUZA 5LMUQ 4K8JA 4WRDA 4A3KG 2PMZB 1SSOA 1PFBA 2NVYH 3HOYB 5M5YB 2F0IA 4LF9L 2L5TA 4A3FB 1N36L 4Q0FA 3MA2B 3KJOA 2IX1A 1O7IA 1E22A 2CHBD 5JJIA 2ZJRA 3ERSX 5I2XA 3GTGH 1B70B 1EIYB 4LF7L 4HJ7A 4GKKQ 4DR7L 2I0QA 2IL8A 2IJ0A 3ICEA 1X65A 4ZAIA 4QMGA 1ZYRC 5EKLA 2VL6A 1HZ9A 4A3IH 3EIVA 1N32L 5C4XG 2BE5D 1AZQA 2VUMB 3NTHA 1L0YB 4MN3A 1Q3LA 4BWGB 4A3MH 2EOTA 3F1ZA 5IGGA 4A3GB 3C46A 3A5ZB 3K58A 1A3UA 5C4JB 3CCEA 1Y1WB 4IN3A 2K5HA 4HCSA 4ZLTF 5KRUA 3I7FA 1IBLQ 1BCPD 3BU2A 4DNIA 1Y8PB 3VYSA 2F0TA 1PZID 1OXVA 3A55A 5J1ZA 3KDFB 4UDUC 1QUQA 4BS9A 3N6RA 1UNSA 1WD0A 2UU9L 2KENA 3TREA 3PQIA 3BDOA 5GADC 1YI2A 1SYBA 5IY0A 1N8RC 4LF8Q 4DV5L 1X3QA 3BS1A 1CUKA 1PV4A 1IYJB 1I4QA 4Y7NH 2O5IC 1TKWB 1WVLA 4DUYL 5COYA 1EQQA 2VNUD 1GHJA 4PNYA 3MXNA 4NXNQ 1TIID 5JVG3 2UUAL 3A5UA 2N3SA 2R92B 4HJ8A 3TZDA 3I4NH 2HUGA 4OONA 2R93B 1I4PA 2OF1A 1V1QA 1XNQL 1QVFA 2F52A 4XYOA 5GROA 3J80c 1KLGD 2IHFA 1LLRD 2YTVA 3TP8A 4CKEA 3F2DA 1CKOA 1WTVA 3DWQA 2BDOA 1P16A 1X3EA 1A2UA 4KN7C 1RL2A 2IWHA 1HNWQ 4B3TQ 1K83H 1ZXTA 1XPUA 4HR7B 2K4KA 3GTQB 2JA6H 2ZTEA 4X3UA 3HFZB 1Z47A 1K8OA 2NVYB 2B8FA 1EY9A 4OO1H 3RD4A 4MTNA 3J7AV 1E1TA 2PO4A 3R2IA 1PYWD 5IOCA 3GTGB 1KHIA 1SNQA 3T1HQ 2VB3X 1TWHH 1Q86C 3GD7A 1Y8NB 4ID6A 1H9RA 3CF5A 2GN5A 1BXTA 3E5SA 3D0FA 4TVAB 5G3LD 2JA8G 1SYFA 4KD4A 2HHHQ 5J3BA 1WTXA 1SNOA 1A3VA 1I4HA 4A3CH 1UEAB 2CW0C 5M3FG 4A3IB 4N8FA 1MHWC 3CCUA 3ZJYC 1E2VA 1U9RA 2DJGC 4A3MB 2RHQB 1VQMA 1K0RA 3TRZA 2MHVA 4RGMA 2KCCA 4OHJA 4CDCC 1GUGA 5GAEC 1O80A 1LTLA 1S5CD 2EYHA 4K2LA 5DAUA 1K3RA 1II3A 1VQ8A 1JE5A 5CV8A
chains in the Genus database with same CATH topology
4L5RC 1TWGH 1NY4A 4GNXC 5BR8Q 4LW1A 1WOCA 4A76A 1M90C 4LF5Q 3JAMc 3H3VH 3K81C 3MXNB 1QVGA 4B3TL 3AFPA 3BJUA 4DV6L 3GDEA 1I94Q 1GD7A 3K0XA 5M5XH 4JYAL 1KAWA 3PGZA 4KHZA 4X64Q 1A8VA 1GO3E 1QZHA 4IPDA 3CC7A 1JJCB 5DLQE 4P72A 2ASBA 2KBNA 4XTCS 3KOJA 3H0GG 2N49A 1KRTA 1EUJA 4DR2Q 3I4NG 2ZTCA 1E24A 4LF4Q 4YCVA 1B7YB 1SMXA 2ID0A 3GTLH 4JV5Q 3B6YA 5AJ3L 1VQLA 4LNQA 1MIUA 1VQHA 2KCMA 2OTLA 2YTXA 3PSIA 1XPOA 2JA7H 1ASZA 3U58A 4A3FH 2GVBA 1G6PA 4JI4L 1JB7A 3M85A 1XPRA 4BBSH 1YJNA 4BY7H 4A3KH 1SR3A 3CPFA 3HOXH 3J7A5 2UXCL 2HIVA 1D8LA 1NMGA 1E7ZA 1FJGL 4R4IA 4DR3Q 4IPHA 4DV3L 2R92G 2YV5A 5K36G 1T9HA 1SROA 3OTOQ 2JA6G 2AMCB 1EWIA 3ULJA 4K0KQ 3J7ZC 4GOPA 4JI6Q 4C3HH 2ALYB 2R93G 4JI5L 1J6QA 3J81j 1X6OA 4POGA 1PH8A 4OO1G 1EFWA 3W1BA 3S2HH 1G51A 4POFA 1HNZQ 2JA5H 5HY6A 2YU9H 4B3RQ 1BVSA 4JBMA 2JJQA 4IPGA 4X65L 1VQOA 3TS0A 1YHAA 1PH9A 4PZ7A 1PHJA 3I55A 2MFIA 1YBYA 4ALPA 4IFDJ 4DR6Q 1CKMA 4NB3A 4O2DA 2EXDA 4JOIA 5GAHC 2VQEL 1XJVA 2PNHA 1PFSA 5IP9H 1FVIA 1NMFA 2VZAA 4DV2Q 1KRSA 3GTOH 1WCMH 2XGTA 2BH2A 1Y1WH 4A3BG 4GKJQ 1HNXL 1H95A 2VQFQ 3E9HA 5C4XH 1YIJA 5BR8L 4C3IH 4A3DG 1U5KA 3F2CA 2PQAA 3RR5A 3WWVA 5IYDH 5C3EH 3FKIH 3J81c 1U0LA 4LF6L 1X55A 3H3VI 4YWKA 4GS3A 4FDBA 1I94L 4MZ9A 3HOZG 4A3CG 3GO5A 4LWCA 1L0WA 2E5LL 1XTDA 4X64L 1C0AA 4LFCL 4A3JH 1XMOQ 4DPGA 3KF6A 4ME3A 5M5WH 4A93H 2OQKA 4LUZA 3UE0A 2CFMA 2ZM6L 1EOVA 3PUWA 4DR2L 1IBKL 1YHBA 3U4VA 1AE3A 1CKNA 2R7ZH 3KFUA 1K73C 4JYAQ 1KQSA 3PIOA 1KC8C 1PH2A 2JK8A 4GOPC 1XNRL 2K52A 3PO3G 2Z0SA 4BXXH 4X6AH 2I5MX 2DGYA 3CMEA 4JI8Q 4JI0Q 1J5EQ 1EYGA 4QY7A 3UDFA 4IPCA 1L2FA 1E3PA 5AJ3Q 3RLFA 4GLVB 2B3GA 2ZTDA 4JI1Q 1S72A 1VQ7A 1L1OA 3AEVA 4OXPA 4X62Q 4A3IG 4DR1Q 3E9IA 4JOIC 1TWAH 2WAQG 3K7UC 1VQJA 2JEAI 3A74A 3IRBA 5FLMH 4R4TA 4L5SA 4JI6L 1BBWA 1FJGQ 1A0IA 3U50C 4GLAC 1HZCA 2A1AA 2E2IH 2CKZB 2IHEA 1HNZL 3RLOA 4R1JA 1N9WA 1K8GA 4RG1A 4AQYQ 4B3RL 2LXJA 4O0AA 3UDXA 4JI5Q 4DK3C 2MQHA 3W5OA 2JE6I 4A75A 4JG2A 3TEHB 1Q7YC 1Q8KA 4AH6A 1YJWA 4DR6L 2UXDL 4YWLA 3OYYA 3UE1A 2YYZA 1OXXK 3AQQA 3RN5A 1VCIA 4X65Q 4NXMQ 4BBSG 4GKJL 4BY7G 3GTQH 1UE1A 3DM3A 4JC0A 5JEAG 3I56A 3CAMA 3HOXG 4QJFA 4AYBG 2VQFL 4A3LH 2WP8J 3CCSA 2VQEQ 2UUCQ 4DV4L 3K80C 2A19A 2WB1G 1GVPA 4GOPB 2AHOB 4WJ4A 2D0PA 2Y0SE 3FP9A 1HNWQ 2B63H 5IWAQ 2ATWA 3CC4A 3CQZH 3S1MH 3CCQA 1XMOL 1SFOH 1L1OC 4LF6Q 2CWPA 3ULLA 5C0XG 4UPAA 1Y1VG 3PUXA 4UP7A 1IXRA 4TQUS 3S1RH 3JAMi 1PH7A 2E5LQ 4JI7Q 3M4QA 3PO2G 3PUZA 4LFCQ 1DGSA 3UDGA 2ZM6Q 5LMNL 4JBJA 1IBKQ 4OO1I 2OCEA 1JJGA 4JI8L 4JI0L 5IP7H 1J5EL 4JBWA 1VQ6A 5IP9G 2WFWA 5LMNW 1MJCA 3T1YL 1XNRQ 1X3FA 2PQAB 3HOYH 1KXLA 5M5YH 2GVAA 4JI1L 1JJ2A 3DLLA 3PV0A 1KL9A 4X62L 4DR1L 5M3MG 4YHHQ 5FLXc 3HOUH 5IYDG 5C3EG 3FKIG 3HKZE 4EX5A 2L15A 4DR4Q 2DUDA 4RMFA 3CW2C 3KF6B 2QEXA 2UXBQ 3PF4A 4OWWB 1UEBA 2JA8H 1E1OA 1KD1C 1VQKA 4A3JG 1CKNB 1N33L 1I50H 3I2ZA 3I4OA 1BKBA 2NN6I 2MNAA 4A93G 5IYCH 5M3FH 2N78A 3S2DH 2R7ZG 3KLWA 4AQYL 4B3SL 2V1CC 3SGIA 4A3EH 2HT1A 1VQIA 1KIXA 2AWOA 1VQDA 2F3IA 4DUZL 4HJAA 2E2JH 1A63A 1D7QA 1VQFA 1FGUA 3L2PA 1I3QH 2LSSA 3L7ZC 4IFDI 4PZ8A 1L1OB 3STBD 4NXML 2VUMH 2KCTA 1Q1BA 2JEBI 4HIOA 1VQNA 2UXDQ 3KF8B 4BA2I 2UUCL 2MO1A 1X9NA 2VW9A 4A3GH 1UE6A 2A8VA 1VQ5A 4YY3Q 5C4JH 2CQOA 2QA4A 4DV1L 2D0OA 3S14H 1V43A 2NZHA 5FLMG 2F4VL 5IWAL 1AH9A 4DV4Q 3BZCA 1AE2A 2MO0A 2PMZE 4UP9A 3F2BA 2NN6G 2OTJA 5ELNA 4X66Q 3PCOB 3G6EA 4WJ3M 4LF9Q 4P75A 4JI7L 2EQSA 2JA9A 1N36Q 3J81i 3HKZG 4GKKL 1MJEA 3M9BA 1PVOA 1EQRA 3TQYA 4IFDG 1HZBA 4LF7Q 2Q2TA 3GTMH 1R9TH 3CCMA 4GLXA 4LUOA 3HOWH 3HOWG 1W3SA 3STBC 1NBWA 5LMNQ 1X3GA 4OX9L 4A3LG 1S3OA 1IZ6A 2I5HA 4LUVA 4MNOA 2AWNA 4YHHL 3I4MH 3CCVA 4PG3A 3KYHC 3T1YQ 4EQ5A 4DR4L 1K9MC 3EBEA 3ULPA 2UXBL 1IL2A 2KHIA 3NBHB 3S1QH 4PMWA 1JT8A 3KDFA 2Q2IA 1TWFH 1RIPA 1SRUA 2YTYA 3FHWA 4XIGS 5H1SE 3TS2A 3E0EA 5IYBH 3BZKA 2R92H 1Y14B 3Q8DA 2PI2E 2R93H 1Q12A 1IBLL 3F8TA 2R6GA 4DKAC 1YVCA 3AYHB 2BH8A 1TWCH 1OXSC 1FL0A 2KHJA 2RCNA 1N33Q 1UWVA 3EN2A 3MEFA 2Q2UA 1NJIC 3S16H 2BA1A 5C0XI 3RNUA 2NVTH 4QIWE 4KI0A 3VDYA 4B3SQ 4IJLA 4R4QA 4UP8A 4YWMA 4GNXA 3W1GA 1Q81C 4B3ML 1VQ4A 1OTCA 4L5QA 4DUZQ 3CC2A 3S24A 1VQCA 1YZ6A 2K75A 2JA7G 4P71A 1PH6A 1OXTA 1C9OA 2XTIA 4A3FG 4Y52H 1LUZA 1Z9FA 5LMUQ 4DR5L 1GM5A 3HOUG 5JJKA 4YY3L 4HIKA 4YCUA 4A3KG 4LF8L 4PZ6A 4H02A 2UU9Q 4P73A 2NVYH 3M4PA 1HH2P 1W2BA 1WI5A 3AFQA 4X66L 1WFQA 4DV1Q 1MKHA 5IYCG 4DV5Q 4LF9L 2F4VQ 2Z6KA 4NXNL 1X54A 4HIDA 1PA6A 1N36L 3KJOA 2IX1A 2Q2HA 1E22A 1O7IA 1M1KC 4LFBQ 4IO9A 5JJIA 2ZJRA 2E8GA 3CCJA 4DUYQ 3ERSX 2IT1A 5JJLA 2RHSB 3GTGH 2VS1A 2JA5G 1TXYA 1B70B 1EIYB 3PF5A 5FJ8H 4LF7L 4HJ7A 3G4SA 4GKKQ 4DR7L 2I0QA 3GTJH 3OW2A 1IBML 3ICEA 4HJ9A 1YITA 1X65A 3CCRA 1YJ9A 4A3GG 1XNQQ 4BBRH 2VL6A 4KHPL 1WCMG 3S17H 1Y1WG 4OWTB 4OX9Q 1HZ9A 4A3IH 3EIVA 3K8AA 3LGJA 1N32L 5C4XG 1JMCA 3M3YH 2D62A 1HNWL 1VQPA 3K7AH 3NEMA 4JI3L 3HOVH 1EIFA 4A3MH 3F1ZA 3CD6A 4OWXB 1QZGA 4IOAA 3A5ZB 1VQEA 1CSPA 3CCEA 4JCVE 2E2HH 1I5FA 1YNXA 2K5HA 3G71A 3I7FA 1IBLQ 3GTKH 4JBKA 3BU2A 4L5TA 4DNIA 2Y0SG 2Z6KC 2FXQA 1CSQA 1YEZA 1P8LA 4LFAQ 1N34L 4BXXG 3T1HL 1OXUA 1OXVA 4QGUA 5C44H 5LMUL 1VS0A 3KDFB 1QUQA 1GKHA 1S40A 4B3MQ 3I4MG 4A4IA 2K5NA 3CXCA 2K50A 3PUYA 1Q82C 3A0JA 2B29A 1VQ9A 2UU9L 2KENA 2QGQA 4GN4B 2HIXA 3NENA 3UDIA 3TREA 4DV0L 4R4OA 4DAYB 5GADC 5IYBG 4DR5Q 1YI2A 1XMQQ 1PH1A 2UUBQ 5IY0A 1N8RC 3PIPA 4LF8Q 1B8AA 4DV5L 1VQBA 4KLKA 4QL5A 1CUKA 2K14A 1PV4A 1IYJB 3CCLA 4LFBL 4JI2L 4Y7NH 4GNXB 1Y1VH 4DUYL 1SN8A 4DV7L 1EQQA 3U4ZA 3PO2H 2JQOA 4UY8C 2VNUD 1LM0A 4NXNQ 1HR0Q 2PI2A 2UUAL 3A5UA 1LYLA 2N3SA 4HJ8A 4BY1H 3I4NH 3H0GH 3RZOH 4OONA 2WAQE 2H5XA 1Q46A 3RZDH 1WJJA 5HGQA 2ZJQA 1V1QA 1XNQL 2NZOA 1QVFA 2F52A 4DR7Q 5GROA 3J80c 2ES2A 2IHFA 4J15A 1IBMQ 3CMAA 5M3MH 1Q1EA 4LF5L 2YTVA 4DAMA 3J80i 2N8NA 3F2DA 1CKOA 4QQBX 4KHPQ 1X56A 1P16A 1PYSB 3ER0A 2BA0A 2LXKA 2IY5B 4BA1I 2B63G 1X3EA 1VQGA 1N32Q 1NE3A 2CWAA 2VY3A 1RL2A 2I5LX 4GN3B 1VQAA 5EAYA 4C3JH 1PH4A 1K83H 4DV6Q 4B3TQ 3PUVA 2K4KA 1XPUA 2ZJPA 2ZTEA 4JI3Q 3RLNA 2JA6H 5ELOA 1ASYA 2HHHL 4AYBE 4LF4L 1NTGA 3HFZB 1Z47A 3CPWA 4IOCA 5FJ8G 4JV5L 4IJHA 2WB1E 4LFAL 2R7FA 4GN5A 4YCWA 1SE8A 3NELA 4MTNA 5E7NA 1YHQA 1E1TA 5IP7G 1SLJA 1QVCA 3H15A 4C2MH 4BBRG 5IT9c 1I6HH 1N34Q 3S1NH 3D31A 3HOYG 1KHIA 4P74A 2NVQH 5JEAJ 3T1HQ 3G48A 4JI4Q 4AIMA 4A3BH 2C35B 1TWHH 4DR3L 1Q86C 1PH5A 3GD7A 3RN2A 1XMQL 2UXCQ 4HIMA 2UUBL 3OTOL 3HOVG 4K0KL 3CF5A 3M7NA 4A3MG 2K5VA 2GN5A 4TVAB 4A3DH 3D0FA 2JA8G 1V9PA 4APVA 2HHHQ 1A62A 2EIFA 5J3BA 4DV0Q 3GTPH 2HQLA 3M4OH 3HOZH 4DV3Q 1K8AC 4A3CH 1G291 5M3FG 4DK6C 2OWOA 4NPSA 3JC66 5C0XJ 1HR0L 5IE8A 3CCUA 1UE5A 3S15H 4R4CA 1BBUA 2OQ0A 3ZJYC 4JI2Q 4A3EG 2RF4A 4DV7Q 4HJ5A 1C7YA 1QUQB 1HR0W 2CCZA 2RHQB 1VQMA 1K0RA 3TRZA 1HZAA 2IX0A 3CP0A 3L0OA 5GQOA 2UUAQ 1PH3A 5C44G 4DV2L 1HJPA 1WYDA 3KJPA 2NVXH 5GAEC 3PO3H 1UE7A 2VUMG 1PYBA 3HKSA 1LTLA 2R7DA 4BY1G 5GAGC 1K3RA 1VQ8A 2AKWB 1JE5A 1HNXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L5R C;  1TWG H;  1NY4 A;  4GNX C;  5BR8 Q;  4LW1 A;  1WOC A;  4A76 A;  1M90 C;  4LF5 Q;  3JAM c;  3H3V H;  3K81 C;  3MXN B;  1QVG A;  4B3T L;  3AFP A;  3BJU A;  4DV6 L;  3GDE A;  1I94 Q;  1GD7 A;  3K0X A;  5M5X H;  4JYA L;  1KAW A;  3PGZ A;  4KHZ A;  4X64 Q;  1A8V A;  1GO3 E;  1QZH A;  4IPD A;  3CC7 A;  1JJC B;  5DLQ E;  4P72 A;  2ASB A;  2KBN A;  4XTC S;  3KOJ A;  3H0G G;  2N49 A;  1KRT A;  1EUJ A;  4DR2 Q;  3I4N G;  2ZTC A;  1E24 A;  4LF4 Q;  4YCV A;  1B7Y B;  1SMX A;  2ID0 A;  3GTL H;  4JV5 Q;  3B6Y A;  5AJ3 L;  1VQL A;  4LNQ A;  1MIU A;  1VQH A;  2KCM A;  2OTL A;  2YTX A;  3PSI A;  1XPO A;  2JA7 H;  1ASZ A;  3U58 A;  4A3F H;  2GVB A;  1G6P A;  4JI4 L;  1JB7 A;  3M85 A;  1XPR A;  4BBS H;  1YJN A;  4BY7 H;  4A3K H;  1SR3 A;  3CPF A;  3HOX H;  3J7A 5;  2UXC L;  2HIV A;  1D8L A;  1NMG A;  1E7Z A;  1FJG L;  4R4I A;  4DR3 Q;  4IPH A;  4DV3 L;  2R92 G;  2YV5 A;  5K36 G;  1T9H A;  1SRO A;  3OTO Q;  2JA6 G;  2AMC B;  1EWI A;  3ULJ A;  4K0K Q;  3J7Z C;  4GOP A;  4JI6 Q;  4C3H H;  2ALY B;  2R93 G;  4JI5 L;  1J6Q A;  3J81 j;  1X6O A;  4POG A;  1PH8 A;  4OO1 G;  1EFW A;  3W1B A;  3S2H H;  1G51 A;  4POF A;  1HNZ Q;  2JA5 H;  5HY6 A;  2YU9 H;  4B3R Q;  1BVS A;  4JBM A;  2JJQ A;  4IPG A;  4X65 L;  1VQO A;  3TS0 A;  1YHA A;  1PH9 A;  4PZ7 A;  1PHJ A;  3I55 A;  2MFI A;  1YBY A;  4ALP A;  4IFD J;  4DR6 Q;  1CKM A;  4NB3 A;  4O2D A;  2EXD A;  4JOI A;  5GAH C;  2VQE L;  1XJV A;  2PNH A;  1PFS A;  5IP9 H;  1FVI A;  1NMF A;  2VZA A;  4DV2 Q;  1KRS A;  3GTO H;  1WCM H;  2XGT A;  2BH2 A;  1Y1W H;  4A3B G;  4GKJ Q;  1HNX L;  1H95 A;  2VQF Q;  3E9H A;  5C4X H;  1YIJ A;  5BR8 L;  4C3I H;  4A3D G;  1U5K A;  3F2C A;  2PQA A;  3RR5 A;  3WWV A;  5IYD H;  5C3E H;  3FKI H;  3J81 c;  1U0L A;  4LF6 L;  1X55 A;  3H3V I;  4YWK A;  4GS3 A;  4FDB A;  1I94 L;  4MZ9 A;  3HOZ G;  4A3C G;  3GO5 A;  4LWC A;  1L0W A;  2E5L L;  1XTD A;  4X64 L;  1C0A A;  4LFC L;  4A3J H;  1XMO Q;  4DPG A;  3KF6 A;  4ME3 A;  5M5W H;  4A93 H;  2OQK A;  4LUZ A;  3UE0 A;  2CFM A;  2ZM6 L;  1EOV A;  3PUW A;  4DR2 L;  1IBK L;  1YHB A;  3U4V A;  1AE3 A;  1CKN A;  2R7Z H;  3KFU A;  1K73 C;  4JYA Q;  1KQS A;  3PIO A;  1KC8 C;  1PH2 A;  2JK8 A;  4GOP C;  1XNR L;  2K52 A;  3PO3 G;  2Z0S A;  4BXX H;  4X6A H;  2I5M X;  2DGY A;  3CME A;  4JI8 Q;  4JI0 Q;  1J5E Q;  1EYG A;  4QY7 A;  3UDF A;  4IPC A;  1L2F A;  1E3P A;  5AJ3 Q;  3RLF A;  4GLV B;  2B3G A;  2ZTD A;  4JI1 Q;  1S72 A;  1VQ7 A;  1L1O A;  3AEV A;  4OXP A;  4X62 Q;  4A3I G;  4DR1 Q;  3E9I A;  4JOI C;  1TWA H;  2WAQ G;  3K7U C;  1VQJ A;  2JEA I;  3A74 A;  3IRB A;  5FLM H;  4R4T A;  4L5S A;  4JI6 L;  1BBW A;  1FJG Q;  1A0I A;  3U50 C;  4GLA C;  1HZC A;  2A1A A;  2E2I H;  2CKZ B;  2IHE A;  1HNZ L;  3RLO A;  4R1J A;  1N9W A;  1K8G A;  4RG1 A;  4AQY Q;  4B3R L;  2LXJ A;  4O0A A;  3UDX A;  4JI5 Q;  4DK3 C;  2MQH A;  3W5O A;  2JE6 I;  4A75 A;  4JG2 A;  3TEH B;  1Q7Y C;  1Q8K A;  4AH6 A;  1YJW A;  4DR6 L;  2UXD L;  4YWL A;  3OYY A;  3UE1 A;  2YYZ A;  1OXX K;  3AQQ A;  3RN5 A;  1VCI A;  4X65 Q;  4NXM Q;  4BBS G;  4GKJ L;  4BY7 G;  3GTQ H;  1UE1 A;  3DM3 A;  4JC0 A;  5JEA G;  3I56 A;  3CAM A;  3HOX G;  4QJF A;  4AYB G;  2VQF L;  4A3L H;  2WP8 J;  3CCS A;  2VQE Q;  2UUC Q;  4DV4 L;  3K80 C;  2A19 A;  2WB1 G;  1GVP A;  4GOP B;  2AHO B;  4WJ4 A;  2D0P A;  2Y0S E;  3FP9 A;  1HNW Q;  2B63 H;  5IWA Q;  2ATW A;  3CC4 A;  3CQZ H;  3S1M H;  3CCQ A;  1XMO L;  1SFO H;  1L1O C;  4LF6 Q;  2CWP A;  3ULL A;  5C0X G;  4UPA A;  1Y1V G;  3PUX A;  4UP7 A;  1IXR A;  4TQU S;  3S1R H;  3JAM i;  1PH7 A;  2E5L Q;  4JI7 Q;  3M4Q A;  3PO2 G;  3PUZ A;  4LFC Q;  1DGS A;  3UDG A;  2ZM6 Q;  5LMN L;  4JBJ A;  1IBK Q;  4OO1 I;  2OCE A;  1JJG A;  4JI8 L;  4JI0 L;  5IP7 H;  1J5E L;  4JBW A;  1VQ6 A;  5IP9 G;  2WFW A;  5LMN W;  1MJC A;  3T1Y L;  1XNR Q;  1X3F A;  2PQA B;  3HOY H;  1KXL A;  5M5Y H;  2GVA A;  4JI1 L;  1JJ2 A;  3DLL A;  3PV0 A;  1KL9 A;  4X62 L;  4DR1 L;  5M3M G;  4YHH Q;  5FLX c;  3HOU H;  5IYD G;  5C3E G;  3FKI G;  3HKZ E;  4EX5 A;  2L15 A;  4DR4 Q;  2DUD A;  4RMF A;  3CW2 C;  3KF6 B;  2QEX A;  2UXB Q;  3PF4 A;  4OWW B;  1UEB A;  2JA8 H;  1E1O A;  1KD1 C;  1VQK A;  4A3J G;  1CKN B;  1N33 L;  1I50 H;  3I2Z A;  3I4O A;  1BKB A;  2NN6 I;  2MNA A;  4A93 G;  5IYC H;  5M3F H;  2N78 A;  3S2D H;  2R7Z G;  3KLW A;  4AQY L;  4B3S L;  2V1C C;  3SGI A;  4A3E H;  2HT1 A;  1VQI A;  1KIX A;  2AWO A;  1VQD A;  2F3I A;  4DUZ L;  4HJA A;  2E2J H;  1A63 A;  1D7Q A;  1VQF A;  1FGU A;  3L2P A;  1I3Q H;  2LSS A;  3L7Z C;  4IFD I;  4PZ8 A;  1L1O B;  3STB D;  4NXM L;  2VUM H;  2KCT A;  1Q1B A;  2JEB I;  4HIO A;  1VQN A;  2UXD Q;  3KF8 B;  4BA2 I;  2UUC L;  2MO1 A;  1X9N A;  2VW9 A;  4A3G H;  1UE6 A;  2A8V A;  1VQ5 A;  4YY3 Q;  5C4J H;  2CQO A;  2QA4 A;  4DV1 L;  2D0O A;  3S14 H;  1V43 A;  2NZH A;  5FLM G;  2F4V L;  5IWA L;  1AH9 A;  4DV4 Q;  3BZC A;  1AE2 A;  2MO0 A;  2PMZ E;  4UP9 A;  3F2B A;  2NN6 G;  2OTJ A;  5ELN A;  4X66 Q;  3PCO B;  3G6E A;  4WJ3 M;  4LF9 Q;  4P75 A;  4JI7 L;  2EQS A;  2JA9 A;  1N36 Q;  3J81 i;  3HKZ G;  4GKK L;  1MJE A;  3M9B A;  1PVO A;  1EQR A;  3TQY A;  4IFD G;  1HZB A;  4LF7 Q;  2Q2T A;  3GTM H;  1R9T H;  3CCM A;  4GLX A;  4LUO A;  3HOW H;  3HOW G;  1W3S A;  3STB C;  1NBW A;  5LMN Q;  1X3G A;  4OX9 L;  4A3L G;  1S3O A;  1IZ6 A;  2I5H A;  4LUV A;  4MNO A;  2AWN A;  4YHH L;  3I4M H;  3CCV A;  4PG3 A;  3KYH C;  3T1Y Q;  4EQ5 A;  4DR4 L;  1K9M C;  3EBE A;  3ULP A;  2UXB L;  1IL2 A;  2KHI A;  3NBH B;  3S1Q H;  4PMW A;  1JT8 A;  3KDF A;  2Q2I A;  1TWF H;  1RIP A;  1SRU A;  2YTY A;  3FHW A;  4XIG S;  5H1S E;  3TS2 A;  3E0E A;  5IYB H;  3BZK A;  2R92 H;  1Y14 B;  3Q8D A;  2PI2 E;  2R93 H;  1Q12 A;  1IBL L;  3F8T A;  2R6G A;  4DKA C;  1YVC A;  3AYH B;  2BH8 A;  1TWC H;  1OXS C;  1FL0 A;  2KHJ A;  2RCN A;  1N33 Q;  1UWV A;  3EN2 A;  3MEF A;  2Q2U A;  1NJI C;  3S16 H;  2BA1 A;  5C0X I;  3RNU A;  2NVT H;  4QIW E;  4KI0 A;  3VDY A;  4B3S Q;  4IJL A;  4R4Q A;  4UP8 A;  4YWM A;  4GNX A;  3W1G A;  1Q81 C;  4B3M L;  1VQ4 A;  1OTC A;  4L5Q A;  4DUZ Q;  3CC2 A;  3S24 A;  1VQC A;  1YZ6 A;  2K75 A;  2JA7 G;  4P71 A;  1PH6 A;  1OXT A;  1C9O A;  2XTI A;  4A3F G;  4Y52 H;  1LUZ A;  1Z9F A;  5LMU Q;  4DR5 L;  1GM5 A;  3HOU G;  5JJK A;  4YY3 L;  4HIK A;  4YCU A;  4A3K G;  4LF8 L;  4PZ6 A;  4H02 A;  2UU9 Q;  4P73 A;  2NVY H;  3M4P A;  1HH2 P;  1W2B A;  1WI5 A;  3AFQ A;  4X66 L;  1WFQ A;  4DV1 Q;  1MKH A;  5IYC G;  4DV5 Q;  4LF9 L;  2F4V Q;  2Z6K A;  4NXN L;  1X54 A;  4HID A;  1PA6 A;  1N36 L;  3KJO A;  2IX1 A;  2Q2H A;  1E22 A;  1O7I A;  1M1K C;  4LFB Q;  4IO9 A;  5JJI A;  2ZJR A;  2E8G A;  3CCJ A;  4DUY Q;  3ERS X;  2IT1 A;  5JJL A;  2RHS B;  3GTG H;  2VS1 A;  2JA5 G;  1TXY A;  1B70 B;  1EIY B;  3PF5 A;  5FJ8 H;  4LF7 L;  4HJ7 A;  3G4S A;  4GKK Q;  4DR7 L;  2I0Q A;  3GTJ H;  3OW2 A;  1IBM L;  3ICE A;  4HJ9 A;  1YIT A;  1X65 A;  3CCR A;  1YJ9 A;  4A3G G;  1XNQ Q;  4BBR H;  2VL6 A;  4KHP L;  1WCM G;  3S17 H;  1Y1W G;  4OWT B;  4OX9 Q;  1HZ9 A;  4A3I H;  3EIV A;  3K8A A;  3LGJ A;  1N32 L;  5C4X G;  1JMC A;  3M3Y H;  2D62 A;  1HNW L;  1VQP A;  3K7A H;  3NEM A;  4JI3 L;  3HOV H;  1EIF A;  4A3M H;  3F1Z A;  3CD6 A;  4OWX B;  1QZG A;  4IOA A;  3A5Z B;  1VQE A;  1CSP A;  3CCE A;  4JCV E;  2E2H H;  1I5F A;  1YNX A;  2K5H A;  3G71 A;  3I7F A;  1IBL Q;  3GTK H;  4JBK A;  3BU2 A;  4L5T A;  4DNI A;  2Y0S G;  2Z6K C;  2FXQ A;  1CSQ A;  1YEZ A;  1P8L A;  4LFA Q;  1N34 L;  4BXX G;  3T1H L;  1OXU A;  1OXV A;  4QGU A;  5C44 H;  5LMU L;  1VS0 A;  3KDF B;  1QUQ A;  1GKH A;  1S40 A;  4B3M Q;  3I4M G;  4A4I A;  2K5N A;  3CXC A;  2K50 A;  3PUY A;  1Q82 C;  3A0J A;  2B29 A;  1VQ9 A;  2UU9 L;  2KEN A;  2QGQ A;  4GN4 B;  2HIX A;  3NEN A;  3UDI A;  3TRE A;  4DV0 L;  4R4O A;  4DAY B;  5GAD C;  5IYB G;  4DR5 Q;  1YI2 A;  1XMQ Q;  1PH1 A;  2UUB Q;  5IY0 A;  1N8R C;  3PIP A;  4LF8 Q;  1B8A A;  4DV5 L;  1VQB A;  4KLK A;  4QL5 A;  1CUK A;  2K14 A;  1PV4 A;  1IYJ B;  3CCL A;  4LFB L;  4JI2 L;  4Y7N H;  4GNX B;  1Y1V H;  4DUY L;  1SN8 A;  4DV7 L;  1EQQ A;  3U4Z A;  3PO2 H;  2JQO A;  4UY8 C;  2VNU D;  1LM0 A;  4NXN Q;  1HR0 Q;  2PI2 A;  2UUA L;  3A5U A;  1LYL A;  2N3S A;  4HJ8 A;  4BY1 H;  3I4N H;  3H0G H;  3RZO H;  4OON A;  2WAQ E;  2H5X A;  1Q46 A;  3RZD H;  1WJJ A;  5HGQ A;  2ZJQ A;  1V1Q A;  1XNQ L;  2NZO A;  1QVF A;  2F52 A;  4DR7 Q;  5GRO A;  3J80 c;  2ES2 A;  2IHF A;  4J15 A;  1IBM Q;  3CMA A;  5M3M H;  1Q1E A;  4LF5 L;  2YTV A;  4DAM A;  3J80 i;  2N8N A;  3F2D A;  1CKO A;  4QQB X;  4KHP Q;  1X56 A;  1P16 A;  1PYS B;  3ER0 A;  2BA0 A;  2LXK A;  2IY5 B;  4BA1 I;  2B63 G;  1X3E A;  1VQG A;  1N32 Q;  1NE3 A;  2CWA A;  2VY3 A;  1RL2 A;  2I5L X;  4GN3 B;  1VQA A;  5EAY A;  4C3J H;  1PH4 A;  1K83 H;  4DV6 Q;  4B3T Q;  3PUV A;  2K4K A;  1XPU A;  2ZJP A;  2ZTE A;  4JI3 Q;  3RLN A;  2JA6 H;  5ELO A;  1ASY A;  2HHH L;  4AYB E;  4LF4 L;  1NTG A;  3HFZ B;  1Z47 A;  3CPW A;  4IOC A;  5FJ8 G;  4JV5 L;  4IJH A;  2WB1 E;  4LFA L;  2R7F A;  4GN5 A;  4YCW A;  1SE8 A;  3NEL A;  4MTN A;  5E7N A;  1YHQ A;  1E1T A;  5IP7 G;  1SLJ A;  1QVC A;  3H15 A;  4C2M H;  4BBR G;  5IT9 c;  1I6H H;  1N34 Q;  3S1N H;  3D31 A;  3HOY G;  1KHI A;  4P74 A;  2NVQ H;  5JEA J;  3T1H Q;  3G48 A;  4JI4 Q;  4AIM A;  4A3B H;  2C35 B;  1TWH H;  4DR3 L;  1Q86 C;  1PH5 A;  3GD7 A;  3RN2 A;  1XMQ L;  2UXC Q;  4HIM A;  2UUB L;  3OTO L;  3HOV G;  4K0K L;  3CF5 A;  3M7N A;  4A3M G;  2K5V A;  2GN5 A;  4TVA B;  4A3D H;  3D0F A;  2JA8 G;  1V9P A;  4APV A;  2HHH Q;  1A62 A;  2EIF A;  5J3B A;  4DV0 Q;  3GTP H;  2HQL A;  3M4O H;  3HOZ H;  4DV3 Q;  1K8A C;  4A3C H;  1G29 1;  5M3F G;  4DK6 C;  2OWO A;  4NPS A;  3JC6 6;  5C0X J;  1HR0 L;  5IE8 A;  3CCU A;  1UE5 A;  3S15 H;  4R4C A;  1BBU A;  2OQ0 A;  3ZJY C;  4JI2 Q;  4A3E G;  2RF4 A;  4DV7 Q;  4HJ5 A;  1C7Y A;  1QUQ B;  1HR0 W;  2CCZ A;  2RHQ B;  1VQM A;  1K0R A;  3TRZ A;  1HZA A;  2IX0 A;  3CP0 A;  3L0O A;  5GQO A;  2UUA Q;  1PH3 A;  5C44 G;  4DV2 L;  1HJP A;  1WYD A;  3KJP A;  2NVX H;  5GAE C;  3PO3 H;  1UE7 A;  2VUM G;  1PYB A;  3HKS A;  1LTL A;  2R7D A;  4BY1 G;  5GAG C;  1K3R A;  1VQ8 A;  2AKW B;  1JE5 A;  1HNX Q; 
#chains in the Genus database with same CATH topology
 1TWG H;  2A69 D;  5ISR A;  4GNX C;  2WV6 D;  2B2W C;  3JAM c;  1HA6 A;  5T1I A;  4JYA L;  1KAW A;  3PGZ A;  4OEL B;  3MFY A;  3CC7 A;  5DLQ E;  4RGO S;  3H0G G;  1KRT A;  4DR2 Q;  1E24 A;  4YCV A;  1B7Y B;  1J9O A;  3OWF A;  1C48 A;  1LTI D;  3GTL H;  2LFN A;  5AJ3 L;  2EE1 A;  4Y7N B;  3HOW G;  1VQH A;  4ZKC B;  3R2T A;  3M7G A;  4KKT A;  3AU7 A;  4JI4 L;  1XPR A;  3I4N B;  3EFX D;  3OIP A;  2PQE A;  1SR3 A;  3CPF A;  4A3K H;  3J7A 5;  1SE4 A;  4IUV A;  1G2S A;  1FJG L;  2F0S A;  2EYJ A;  3KLR A;  4R4I A;  4IAL A;  1T9H A;  1SRO A;  4K0K Q;  3ULJ A;  3D4W A;  3SK6 A;  2ALY B;  1NR4 A;  1HXY D;  2FMC A;  4XYQ A;  5TSS A;  4CJ2 C;  5HY6 A;  1I4G A;  2JJQ A;  4IPG A;  4FVM A;  3PIO 3;  1K83 B;  2JA6 B;  5CV4 A;  1STE A;  4NP5 A;  2VXW A;  2XNA C;  1FVI A;  1NMF A;  4ODG A;  3J80 E;  5KNB A;  4DV2 Q;  3FVQ A;  3SK8 A;  2OXP A;  1PFN A;  2VQF Q;  5C4X H;  4A3D G;  1U5K A;  2EY6 A;  3F2C A;  4RHS A;  1LT6 D;  3H3V C;  3FKI H;  1X55 A;  1I94 L;  4FDB A;  2KVM A;  4X64 L;  3UI2 A;  4A3J H;  4DAP A;  1TWH B;  5M5W H;  4LUZ A;  2A6H C;  2Z1C A;  1EOV A;  3PUW A;  1AE3 A;  4OEM B;  2R7Z H;  3NE5 B;  5EJW A;  1CFM A;  4WOR A;  2R3Z A;  3C1E A;  1KC8 C;  2JK8 A;  2RDG A;  2Z0S A;  4X6A H;  1EU4 A;  3U9O A;  2K32 A;  1J5E Q;  1EYG A;  4QY7 A;  3UDF A;  3BVG A;  1E3P A;  2SDF A;  3RLF A;  4XQJ A;  2B3G A;  2ZTD A;  4OXP A;  3I8Z A;  4O42 A;  3E9I A;  5F2D A;  1B1Z A;  3QOJ A;  5A2Q L;  4FF1 A;  2JSO A;  2JEA I;  1EZ6 A;  2K1B A;  4X3S A;  5CBA E;  5IGF A;  2A1A A;  3S17 B;  1TWG B;  1CZG A;  2CKZ B;  2IHE A;  4R1J A;  1K8G A;  3ERQ A;  1D1I A;  2LXJ A;  4JI5 Q;  3M3Y B;  1ILP A;  4AH6 A;  5I6Y A;  1D5X C;  2QF7 A;  3A8J E;  1K8M A;  4YWL A;  4IFD H;  1B9M A;  1OXX K;  1UE1 A;  4JC0 A;  2WP8 J;  1SXT A;  3ERO A;  4LK1 C;  5D14 A;  4B9W A;  4R8I A;  2VQE Q;  4DV4 L;  1JE4 A;  3OSO A;  4HED A;  3GTL B;  3IFD A;  2AHO B;  1TR5 A;  2Y0S E;  2Z9H A;  1U4P A;  4K8I A;  3CC4 A;  4C3H G;  1FR3 A;  3S1M H;  1UAP A;  2ZXO A;  1Z6H A;  2CWP A;  4A3K B;  3PUX A;  3JAM i;  1DGS A;  5LMN L;  2HD3 A;  4OO1 I;  2OCE A;  1JJG A;  4JI8 L;  4JI0 L;  5IP9 G;  5LMN W;  3T1Y L;  2PQA B;  1KXL A;  1JJ2 A;  3R3O A;  2JP1 A;  1KL9 A;  1BO0 A;  4C3I G;  4DR1 L;  4YHH Q;  1DYQ A;  3HOU H;  3BG3 A;  4DR4 Q;  4RMF A;  3PF4 A;  2JA8 H;  3FDT A;  1CM9 A;  2QDL A;  1SYG A;  3E3X A;  1N33 L;  4ZQ3 A;  2EXZ A;  3ND9 A;  1BKB A;  4A93 G;  2F0U A;  5M3F H;  1PTO D;  3LWE A;  2N78 A;  5NUC A;  1PRT F;  4AQY L;  3FKI B;  4EGV A;  1NUC A;  5KYL A;  2HT1 A;  2F3I A;  2K5D A;  1LTT D;  1K3B C;  2SOB A;  4DNT B;  4A3J B;  1L1O B;  5M5W B;  2KCT A;  1Q1B A;  4RHR A;  2JEB I;  1B4O A;  2R7Z B;  1V1P B;  3KF8 B;  2G5D A;  2UXD Q;  2Z8L A;  3H91 A;  1ROD A;  1X9N A;  2VW9 A;  2A8V A;  2ZXR A;  2NTS A;  1BQQ T;  3T53 B;  5EPK A;  5IWA L;  1AH9 A;  2MO0 A;  4UP9 A;  4OIK A;  4PMB A;  2NN6 G;  2OTJ A;  3VYT A;  1EIG A;  3GV3 A;  4JI7 L;  1Q90 A;  3HKZ G;  4GKK L;  4GZY C;  1VF5 C;  2F0N A;  3KK7 A;  3V2T A;  1KAA A;  3BYY B;  1PVO A;  1HUM A;  1EQR A;  3P20 A;  2Q2T A;  4GLX A;  4LUO A;  3HOW H;  1H9J A;  1B3Q A;  4KY5 A;  4G7Z C;  3CCV A;  5IT9 E;  4EQ5 A;  3ULP A;  2KHI A;  3F2U A;  3S1Q H;  4PMW A;  5I4D A;  3TS2 A;  5H1S E;  2H1E A;  3BZK A;  5E4W C;  3R93 A;  2K5W A;  4IQZ A;  4CDE C;  1IBL L;  5JVH 3;  4CKB A;  4DKA C;  1BOS A;  2BH8 A;  3BVZ A;  4QUC A;  1UWV A;  1DJR D;  2Q2U A;  3RNU A;  4FF3 A;  2SNS A;  2TMP A;  2LS0 1;  1BF4 A;  3S1M B;  2RA4 A;  4UP8 A;  4R4Q A;  2E74 C;  1XTC D;  1Q81 C;  5CV9 A;  1VQ4 A;  4DUZ Q;  2JA7 G;  2XTI A;  1GM5 A;  3C2P A;  3DM1 A;  2VB2 X;  4PZ6 A;  4LF8 L;  4F7X A;  4P73 A;  1W2B A;  3QB3 A;  3AFQ A;  4X66 L;  2B2U C;  4NXN L;  1X54 A;  5IGB A;  4HID A;  2EJM A;  4KV6 A;  3HOU B;  2FFK B;  1CTM A;  1M1K C;  1HFN A;  2KCN A;  1E2W A;  1K0S A;  1VF7 A;  2KOL A;  5FJ8 H;  3PF5 A;  3QO2 A;  1A15 A;  2KED A;  4HSV A;  4DGZ A;  5M3F B;  2XSC A;  3D4D A;  4HJ9 A;  1F2Y A;  3CCR A;  1S4Z A;  1YJ9 A;  3CHB D;  3S2H B;  2LMC B;  4OX9 Q;  3QWN A;  2RQX A;  1HNW L;  3NEM A;  3HOV H;  4O1N A;  1EIF A;  2PZU A;  4G7O C;  3PIP 3;  1VQE A;  1WCM B;  3K6O A;  2E2H H;  1TS5 A;  2QEJ C;  1I5F A;  1JCK B;  3G71 A;  5C3X A;  3GTK H;  4JBK A;  2OEO A;  2Y0S G;  2Z6K C;  1YEZ A;  1P8L A;  2J7Z A;  1PLF A;  3T1H L;  2F0P A;  5JOB A;  1OXU A;  2HCI A;  4QGU A;  1ML0 D;  1S40 A;  1F77 A;  3I4M G;  1SNP A;  1TS3 A;  4B3M Q;  1QCB D;  3CXC A;  1QOH A;  2ZXP A;  1Q82 C;  4H44 C;  3A0J A;  2HHH L;  4GN4 B;  2HIX A;  3KBX A;  3NEN A;  4PQX A;  5IYB G;  1PH1 A;  2UUB Q;  5E3F A;  2F0F A;  1B8A A;  3K5M A;  4KKU A;  2L0C A;  1EQV A;  2EYL A;  5C4Z A;  3J81 E;  3CCL A;  4LFB L;  1SN8 A;  3U4Z A;  3BZD B;  4C56 C;  3K57 A;  5FO7 B;  5KYI A;  3HS0 C;  1HR0 Q;  2M9V A;  4K5X A;  2WAQ E;  3SDZ A;  2EZV A;  2ZJQ A;  4HN7 A;  2NZO A;  3I73 A;  4K6D A;  2KUM A;  5K5P A;  1IBM Q;  4S3S A;  4DAM A;  2N8N A;  1ET6 A;  5EPJ A;  2NBF A;  1PYS B;  3EA6 A;  5BN3 A;  1DXM A;  3N52 A;  1NE3 A;  2VY3 A;  4GN3 B;  4DU9 A;  1VQA A;  1HUN A;  4C3J H;  5K36 H;  3PUV A;  2V4D A;  2ZJP A;  1SE3 A;  1SAP A;  5ELO A;  1F2Z A;  2JYO A;  5CV6 A;  5EQ0 A;  1O78 A;  4ZCK A;  1TQO A;  4LFA L;  1SE8 A;  5HGT A;  2B63 B;  1I4R A;  1SLJ A;  1QVC A;  2QDB A;  1F2L A;  3HRZ C;  1X3P A;  4BBR G;  1N34 Q;  5FK9 C;  1SND A;  5DEH A;  3G48 A;  1OO9 B;  1PH5 A;  1XMQ L;  4K0K L;  3M7N A;  2K5V A;  3GV6 A;  3SXH A;  1XXG A;  1A62 A;  4DV0 Q;  3HOZ H;  2HQL A;  3M4O H;  1K8A C;  4KK7 A;  3MWY W;  2I46 A;  4HAE A;  3WDN A;  3A8I E;  1AEX A;  1DON A;  3HOV B;  1RKN A;  4E6I A;  1C7Y A;  4NMZ A;  2CCZ A;  1HZA A;  3CP0 A;  1PH3 A;  5FKA C;  5C44 G;  4DV2 L;  3PO3 H;  2E2H B;  1UE7 A;  1HTP A;  3GTK B;  4HTH A;  1SNM A;  4BY1 G;  4ILW A;  4A3E B;  2QCP X;  1GXD C;  5BR8 Q;  1WOC A;  1M90 C;  4CDD C;  4LF5 Q;  4EVO A;  4DV6 L;  1GD7 A;  5M5X H;  1PTO H;  4RGT A;  2BCO A;  4KHZ A;  4XDX A;  2D2C C;  1WTO A;  1A8V A;  1GO3 E;  1JJC B;  2A74 C;  2HCC A;  2ASB A;  3KOJ A;  4QIW B;  1HA5 A;  2KA7 A;  4LF4 Q;  3A8K E;  1LT3 D;  2RDH A;  3TBI B;  2KCM A;  2YTX A;  3PSI A;  2JA7 H;  1ASZ A;  1AW7 A;  3U58 A;  2GVB A;  1JB7 A;  1J8I A;  2NB0 A;  1YJN A;  1ENA A;  4BY7 H;  1MGS A;  5JEA H;  4ZRZ A;  2UXC L;  1SMY C;  1D8L A;  1NMG A;  1E7Z A;  2XVS A;  4UAI A;  3TP7 A;  3VA5 A;  4DV3 L;  2YV5 A;  2DNE A;  1TS2 A;  3OWE B;  3J7Z C;  5JPN C;  4J8Q A;  4JI5 L;  3BDL A;  5KIX A;  4XQN A;  2A6H D;  4KY6 A;  1X6O A;  3J81 j;  1PH8 A;  2HQE A;  5C0X H;  1A2T A;  4POF A;  1B44 D;  4DXG A;  1C4Q A;  4C3J B;  3TS0 A;  1PH9 A;  4HCE A;  2E76 C;  1XJV A;  2VQE L;  5GAH C;  2A68 C;  1DOK A;  1EFI D;  4A3B G;  1LT4 D;  1KRS A;  1H95 A;  2XGT A;  2BH2 A;  3NPP A;  3E9H A;  1YIJ A;  2NVT B;  1JQY D;  1ET9 A;  3OOC A;  1U0L A;  2EJG C;  4YWK A;  3ONA B;  4MZ9 A;  2N88 A;  3SE0 A;  1LO5 D;  5CR3 A;  3I3C A;  3U9S A;  1LV9 A;  3SVM A;  1XMO Q;  3KF6 A;  5KGU A;  2OQK A;  3UE0 A;  3KFU A;  1BR9 A;  3PIO A;  1RF2 D;  3HOZ B;  2RKS A;  3M4O B;  1R4P B;  2K52 A;  3J80 L;  2F3W A;  1TVX A;  3DXJ C;  2F0H A;  3J7Y W;  5JPM C;  4JI1 Q;  1VQ7 A;  4X62 Q;  3PO3 B;  2WAQ G;  5E4X A;  4L8J A;  5FLM H;  3NQT A;  4JI6 L;  3CRK C;  5LHY 1;  2Z4H A;  1NAP A;  1HNZ L;  1EY8 A;  1N9W A;  4B3R L;  1ICF B;  4DK3 C;  1TY0 A;  2JE6 I;  4A75 A;  3TEH B;  5M5X B;  2BDN A;  1YJW A;  4DR6 L;  4QCL A;  1PTO B;  2UXD L;  2TSS A;  3UE1 A;  1VCI A;  2G9H D;  4X65 Q;  4BBS G;  4GKJ L;  3X3M A;  4A3L H;  3CAM A;  5ELE A;  4QJF A;  2CVR A;  3HOX G;  1R4Q B;  3RUZ A;  1QE6 A;  1HCZ A;  4GOP B;  1FGB D;  1H9S B;  1GVP A;  1KAB A;  2A6E D;  3FP9 A;  2JA7 B;  2DY7 A;  1EY7 A;  4BY7 B;  1G6Z A;  3SK5 A;  1L1O C;  4LF6 Q;  3NBH A;  1V1O A;  3ULL A;  4AYB B;  1QG7 A;  4L63 B;  4UPA A;  1Y1V G;  3DUZ A;  3S1R H;  1XYI A;  3PO2 G;  2E5L Q;  2DNC A;  3M4Q A;  3T16 A;  3PUZ A;  2WKC A;  2WB1 B;  4LFC Q;  3GQB A;  2ZM6 Q;  3OIQ A;  3TP5 A;  4KY7 A;  4F8M A;  4JBW A;  3T56 B;  2WFW A;  2IW3 A;  1MJC A;  4ABN A;  1XNR Q;  1RDP D;  4KN4 C;  2GVA A;  3QG1 A;  1HNX Q;  1LAC A;  4RKL A;  3DWA A;  3LWU A;  5FOB B;  5M3M G;  5FLX c;  3K5L A;  5IYD G;  3HP3 A;  4RAU C;  3HKZ E;  5D65 A;  5C3E G;  1U4L A;  2L15 A;  5EBD A;  2UXB Q;  2QEX A;  4U68 A;  1SJH D;  5IGC A;  1VQK A;  3MHB A;  5L37 A;  1CKN B;  3NBI A;  1I50 H;  4R9W A;  1ENC A;  2NN6 I;  3S9W A;  2AQ1 B;  2K28 A;  4EQO A;  3I90 A;  3S2D H;  2B8G A;  2PZT A;  3KLW A;  1FNU A;  3C3L A;  1IYU A;  3T13 A;  4R8N A;  3BYT B;  1KIX A;  2AWO A;  1VQD A;  4DUZ L;  1D7Q A;  4HJA A;  3AMU A;  1CK1 A;  1A63 A;  1I3Q H;  2LSS A;  3L7Z C;  4NXM L;  4DNR B;  1WD1 A;  5A35 A;  3IKJ A;  2EYM A;  3QIA A;  2UUC L;  1GUT A;  4FXK C;  2BE5 C;  3EJI A;  4RKB A;  2D0O A;  4K5V A;  1PFM A;  1V43 A;  3BZC A;  3F2B A;  2C5C A;  2EYP A;  3KLS X;  4ME5 A;  5ELN A;  1D2B A;  1PZK D;  1O7Y A;  2B2V A;  1VMC A;  3G6E A;  4LF9 Q;  1N36 Q;  2CH4 A;  1EY5 A;  2LKV A;  4KD3 A;  3T51 B;  3NWS A;  2F0W A;  4LAA A;  3VR2 A;  1HZB A;  1KLU D;  4LF7 Q;  3GTM H;  3CCM A;  1PMR A;  5FO8 B;  3P75 A;  1W3S A;  1IL8 A;  4K2K A;  4OX9 L;  1X3G A;  4LUV A;  2K33 A;  3ND8 A;  1CT1 D;  2B2U A;  2IPK D;  2RCF A;  3EBE A;  2WIN B;  3KDF A;  2Q2I A;  2F03 A;  1TWF H;  4XIG S;  3FHW A;  5CV5 A;  3AB9 A;  3P7J A;  5CMD A;  4DXF A;  1YVC A;  3AYH B;  1OXS C;  1FD7 D;  1FL0 A;  2F0O A;  3MEF A;  5C0X I;  3V05 A;  1DOM A;  4Z9C B;  4B3S Q;  4IUQ A;  4B3M L;  5IT9 L;  1OTC A;  3S1R B;  1YZ6 A;  1DZ1 A;  1X32 A;  4A3F G;  1PDQ A;  1HPC A;  1S5B D;  1Z9F A;  4WJW A;  5JJK A;  4YY3 L;  4HIK A;  1LTA D;  3Q0A A;  5C6A A;  1V8Q A;  3QJY A;  5DM6 3;  2KEC A;  1PRT D;  2UU9 Q;  1SYC A;  3M4P A;  2B2Y C;  1HH2 P;  1WI5 A;  1CQV A;  1WFQ A;  5CYU A;  1BUV T;  5IYC G;  4EQN A;  4DV5 Q;  2Z6K A;  3JAM E;  5I6W A;  1PA6 A;  1D6E C;  1Y8O B;  2D9U A;  1CHQ D;  1IKL A;  4DUY Q;  2IT1 A;  2RHS B;  4XT1 B;  3T4A C;  2JA5 G;  1TXY A;  2DJF C;  1I50 B;  1PZJ D;  2QIL A;  3GTJ H;  4HMI A;  3VYR A;  3OW2 A;  1IBM L;  3S2D B;  1F9R A;  1GUS A;  2KQ3 A;  1RJT A;  4A3G G;  1XNQ Q;  3D3R A;  1ESR A;  1Y1W G;  1WTR A;  1C8C A;  1I3Q B;  2QW7 A;  3K8A A;  5FLX E;  3LGJ A;  5CBE E;  1JMC A;  2D62 A;  1FNV A;  1VQP A;  3K7A H;  4IOA A;  3CD6 A;  1QZG A;  3K5N A;  1FNW A;  4JCV E;  1EL0 A;  1TU2 B;  5C4X B;  4ZUI A;  2O4X A;  4L5T A;  3A54 A;  1ILQ A;  2FXQ A;  1CSQ A;  1N34 L;  4BXX G;  3NWT A;  4FXD A;  4DK1 A;  5LMU L;  1GKH A;  3NQI A;  4A4I A;  2K50 A;  3PUY A;  2K03 A;  2A69 C;  3FRP B;  1JWU D;  4DV0 L;  4DR5 Q;  4R4O A;  4DAY B;  1STA A;  3PIP A;  2BOS A;  4QL5 A;  2K14 A;  4GNX B;  1Y1V H;  3PO2 H;  4UY8 C;  2L11 A;  1LM0 A;  1TWF B;  3MZ5 A;  1GUW A;  1LYL A;  4CBV A;  3H0G H;  4N8X 1;  4X3T A;  3OMC A;  1EWC A;  2H5X A;  1Q46 A;  3RZD H;  1WJJ A;  5HGQ A;  1EY0 A;  2IX3 A;  2ES2 A;  1IW7 C;  3M4Y A;  5M3M H;  1Q1E A;  5I9P A;  1IHZ A;  4LF5 L;  3J81 L;  4KHP Q;  2EPB A;  4BA1 I;  2XN9 C;  4HMJ A;  4DN4 M;  1VQG A;  1PH4 A;  4JI3 Q;  3RLN A;  2G9D A;  1ASY A;  4LF4 L;  4LMQ D;  2OT2 A;  3CPW A;  1VMP A;  4IOC A;  2NZ1 D;  2R7F A;  4YCW A;  3D6C A;  2PW5 A;  5E7N A;  5ELB A;  1YHQ A;  1M4V A;  5CC4 A;  1AN8 A;  1NR2 A;  3K5O A;  1EWH A;  1YNN C;  1QIL A;  2B2V C;  4C2M H;  1I6H H;  1S5D D;  3D31 A;  2NVQ H;  1ZEQ X;  2AUJ D;  1ZYR D;  4JI4 Q;  4AIM A;  1BCP B;  2C35 B;  4NKL A;  4X3K A;  3RN2 A;  2L55 A;  4HIM A;  3GTJ B;  4KTA A;  4A3D H;  4H7B A;  4A3M G;  2K05 A;  1V9P A;  1O7Z A;  3GTP H;  4YIJ A;  2F0K A;  2AUK A;  3I4L A;  5IOD A;  2GA4 B;  1G29 1;  5LL6 X;  4DK6 C;  1JOQ A;  1QWY A;  3JC6 6;  5IE8 A;  1UE5 A;  1MD2 D;  1HQR D;  2OQ0 A;  4R4C A;  3K7A B;  4JI2 Q;  1RCV D;  4DV7 Q;  2L9H A;  4HJ5 A;  1QUQ B;  1Y69 U;  2JA8 B;  3L0O A;  1LTB D;  1WYD A;  3KJP A;  4DF7 A;  1PYB A;  2J0T D;  4PV1 C;  1K28 A;  5T1G A;  2L12 A;  2X6L A;  3E0J A;  5GAG C;  2AKW B;  1W6J A;  1SMY D;  2A5H A;  4A76 A;  1B3A A;  1IKM A;  1SEB D;  3K81 C;  3MXN B;  3OMG A;  5I2Y A;  1QVG A;  3AFP A;  3BJU A;  1WTW A;  3GDE A;  1I94 Q;  4B3T L;  3D8G A;  4X64 Q;  4FYD A;  1JOK A;  1QZH A;  2RSO A;  3BDC A;  4XTC S;  3I4N G;  1EUJ A;  2ZTC A;  4F88 A;  3DHQ A;  5D3D A;  2ID0 A;  4JV5 Q;  3B6Y A;  1Y1V B;  2OTL A;  4A3F H;  3NK9 A;  1SYD A;  3H0G B;  4V19 0;  2MGS A;  3RZD B;  5E1F A;  5ELF A;  4B9X A;  5IGD A;  3HOW B;  3TDQ A;  4DR3 Q;  4IPH A;  5JJZ A;  2JA6 G;  3OTO Q;  1EWI A;  2DN8 A;  5M3M B;  4C3H H;  4H0L C;  2NWG A;  4POG A;  1EQT A;  1EFW A;  4OO1 G;  2F0M A;  3S1Q B;  2JA5 H;  2YU9 H;  4JBM A;  2N55 A;  4XQQ A;  1S5F D;  4X65 L;  1VQO A;  4PZ7 A;  1PHJ A;  4IFD J;  1YBY A;  4ALP A;  2PW7 A;  2F1M A;  4O2D A;  2MPM A;  5IP9 H;  2B2T C;  2D5D A;  1NNX A;  4KKS A;  1Y1W H;  1HNX L;  4MHE A;  1QNU A;  4Q5V A;  4C3I H;  2PQA A;  4C2M B;  4LF6 L;  1I6H B;  3H3V I;  2JXM B;  4GS3 A;  4A3C G;  3GO5 A;  2F0D A;  2NVQ B;  2E5L L;  1XTD A;  4LFC L;  2K04 A;  4ME3 A;  4A93 H;  2CW0 D;  2ZM6 L;  2CFM A;  4DR2 L;  4KHV A;  4A3D B;  1KQS A;  3GTP B;  1XNR L;  4GOP C;  4BXX H;  2I5M X;  4JI8 Q;  4JI0 Q;  4KJO A;  5HUR A;  5IGE A;  2RDF A;  1S72 A;  1L1O A;  2QKI C;  4N9T A;  3AEV A;  4DR1 Q;  4FNF A;  4JOI C;  2PPB C;  1TWA H;  1V1P A;  2LY7 A;  3KF8 A;  4DK0 A;  3A74 A;  3IRB A;  1LT5 D;  4L5S A;  1BBW A;  2WKD A;  1EEF D;  3U50 C;  2NN6 H;  4GLA C;  1HZC A;  1E0B A;  1KNA A;  5ELD A;  1TT2 A;  1GOZ A;  3RLO A;  4RG1 A;  4AQY Q;  3UDX A;  2MQH A;  3W5O A;  1EYA A;  2C9O A;  3D6W A;  5EBC A;  2PCF B;  1KDC A;  4CHT B;  5C5L A;  4RCN A;  3RN5 A;  1F9Q A;  1B50 A;  1T5E A;  1YNJ C;  3DM3 A;  3GTQ H;  5DM7 3;  5FO9 B;  2VQF L;  3CCS A;  1KDB A;  3PMF A;  5BN4 A;  1VDZ A;  4WJ4 A;  2D0P A;  4NW2 A;  3Q24 A;  3MVV A;  3SEB A;  2CH4 W;  5IWA Q;  4G7H C;  2J4X A;  3CCQ A;  2ZT9 C;  3G6J B;  1SFO H;  1TY2 A;  3W3A A;  1PH7 A;  1IXR A;  4TQU S;  4JI7 Q;  1CI3 M;  2MP1 A;  3I70 A;  4ZKB B;  1CA5 A;  1H9K A;  4JBJ A;  1IBK Q;  4IUR A;  4C3H B;  1J5E L;  2XWJ B;  1VQ6 A;  1ICW A;  4XT3 B;  4C1N K;  2JA5 B;  2YU9 B;  4JPB W;  1LTR D;  5DNF A;  3SHL A;  2EYF A;  4IUU A;  3A7A B;  3FKI G;  4EX5 A;  1I6V C;  3CW2 C;  4I65 A;  1E1O A;  1KD1 C;  4A3J G;  2Q8T A;  3I2Z A;  2NUC A;  4J6H A;  4C3I B;  2R7Z G;  1MSH A;  4K6L A;  4B3S L;  4K5W A;  1HHV A;  2V1C C;  2E2J H;  1BBX C;  4OIJ A;  1VQF A;  4JK1 C;  4PZ8 A;  4B08 A;  1GUN A;  4A93 B;  3V96 A;  2MO1 A;  3S14 H;  2JN4 A;  1WTQ A;  1DM0 B;  3MEH A;  2PMZ E;  3DMU A;  3FPP A;  3NTK A;  3EQL C;  4X66 Q;  3NXW A;  5C3W A;  1JR0 D;  3I72 A;  4P75 A;  2JA9 A;  1G8Z D;  1PRT B;  3CRL C;  2F4I A;  3M9B A;  1TWA B;  1STY A;  4RA8 A;  4IFD G;  1R9T H;  3WOF A;  1U4R A;  3STB C;  1NBW A;  1S3O A;  1IZ6 A;  2B2Y A;  2F0V A;  2I5H A;  1BCP F;  4I7Z C;  5LL6 S;  3HKZ B;  4YHH L;  3A7L A;  3I4M H;  4IZ8 A;  4PG3 A;  2DY8 A;  2F0J A;  1STH A;  4DR4 L;  1JT8 A;  4CJ1 B;  2K7V A;  1EEI D;  1F2M A;  2FIN B;  3OPO A;  3E0E A;  5IYB H;  1QNK A;  4IUP A;  3Q8D A;  2PI2 E;  1Q12 A;  3F8T A;  2F0L A;  1TWC H;  2KHJ A;  3EN2 A;  1NJI C;  2PNR C;  3S16 H;  1F9P A;  3MTS A;  2WII B;  4QIW E;  4KI0 A;  4IJL A;  1SFO B;  1BDO A;  3S24 A;  1VQC A;  1AZP A;  3HG9 A;  4RGN A;  1OXT A;  1C9O A;  4DA2 A;  4DR5 L;  3O13 A;  3HOU G;  4YCU A;  3DEO A;  2X69 A;  4LJZ C;  2ICE C;  4H02 A;  1D5M C;  1EY4 A;  4HSP A;  5KNC A;  4RH6 A;  1JOO A;  2R61 A;  3C1F A;  4DV1 Q;  1MKH A;  4DFA A;  2F4V Q;  5JAV A;  4FO2 A;  2Q2H A;  2ICI A;  4LFB Q;  4IO9 A;  2E8G A;  3CCJ A;  5JJL A;  3MXP A;  2VS1 A;  1GUO A;  2K6A A;  3G4S A;  1ZKO A;  2KHS A;  2RVL A;  1YIT A;  3VA7 A;  2WAC A;  3SR1 A;  1W6K A;  1GHK A;  3NUC A;  3KBG A;  4QUF A;  4BBR H;  2E2J B;  4KHP L;  1WCM G;  3S17 H;  4OWT B;  4CGY B;  3URY A;  2I07 B;  4FF4 A;  3M3Y H;  3JAM L;  2FMM A;  3VR4 A;  5CV7 A;  4JI3 L;  4FXG C;  4KJN A;  3ZYY X;  4OWX B;  4DAV A;  1CSP A;  4ZUJ A;  1A6X A;  3S14 B;  1YNX A;  1G91 A;  5G3L F;  1L0X B;  5J39 A;  2E2D C;  4LFA Q;  2FHT A;  1DD2 A;  4V0B A;  5FLX L;  2M00 A;  5C44 H;  1SDF A;  1VS0 A;  3GP7 A;  1IW7 D;  2K5N A;  1B53 A;  2B29 A;  1R9T B;  2QGQ A;  1VQ9 A;  3UDI A;  2Y0S B;  4BY1 H;  1XMQ Q;  4K14 A;  1ESF A;  1VQB A;  1WTH A;  4KLK A;  3I4M B;  1RD9 D;  1RHP A;  3WOE A;  4JI2 L;  1MI2 A;  4DV7 L;  2FJ2 A;  3NTI A;  2JQO A;  5COR A;  4IUT A;  1EY6 A;  2PI2 A;  1BCP C;  3RZO H;  2EY1 A;  1YNN D;  1JWM D;  1TWC B;  4PMC A;  1AP0 A;  4DR7 Q;  4G4K A;  3S16 B;  4J15 A;  2F3V A;  3CMA A;  2XIW A;  3OW7 A;  3HZX A;  3J80 i;  1CHP D;  3BVM A;  4QQB X;  1X56 A;  3ER0 A;  4C1N I;  2BA0 A;  2LXK A;  2IY5 B;  2B63 G;  1N32 Q;  3MC0 B;  2CWA A;  5EAY A;  2I5L X;  3TSS A;  4DV6 Q;  4H13 C;  1WTP A;  4J1M A;  4AYB E;  1NTG A;  1QJO A;  1M8A A;  5FJ8 G;  4JV5 L;  4IJH A;  2WB1 E;  4GN5 A;  4TKO B;  3NEL A;  2HDL A;  3X3N A;  3CKI B;  5IP7 G;  1A3T A;  3H15 A;  4FF2 A;  3K0Y A;  5IT9 c;  2Z6B A;  3S1N H;  2A73 B;  3HOY G;  2EVB A;  4P74 A;  1QB5 D;  2M2L A;  5JEA J;  1LTS D;  1U4M A;  4A3B H;  4DR3 L;  2AQ3 B;  2UXC Q;  2UUB L;  3KUP A;  3OTO L;  3DWP A;  3HOV G;  5EPL A;  4XXE A;  1IYV A;  4APV A;  1KTK A;  2EIF A;  4BBR B;  1XWE A;  4DV3 Q;  1EIH A;  3H6M A;  4IUN A;  1MSG A;  1LAB A;  5KEE A;  2OWO A;  4NPS A;  2Q8I B;  4ULL A;  5C0X J;  1HR0 L;  3S15 H;  1BBU A;  4A3E G;  1S5E D;  2RF4 A;  3D4R A;  3OHX C;  1HR0 W;  4QB4 A;  1EYC A;  3P1H A;  2IX0 A;  5GQO A;  1Z7T A;  2UUA Q;  5BN5 A;  2NVX H;  1HJP A;  1KDA A;  2VUM G;  3HKS A;  3MXU A;  3IL8 A;  2CQA A;  2R7D A;  4CDF C;  1HRJ A;  1I4X A;  4L5R C;  1EOT A;  1NY4 A;  4LW1 A;  2O2L D;  2SNM A;  5C44 B;  4EQP A;  3H3V H;  1EZ8 A;  3K0X A;  4BY1 B;  4IPD A;  4P72 A;  2KBN A;  2XRQ D;  1HFG A;  1SYE A;  2N49 A;  5EGT A;  2B2T A;  3NSW A;  2NTT A;  1SMX A;  1VQL A;  4LNQ A;  1MIU A;  1XPO A;  1PXU A;  2HDM A;  1G6P A;  2L1B A;  1RTN A;  3M85 A;  4BBS H;  4QF4 A;  1XX8 A;  3RZO B;  3HOX H;  2A6E C;  2XRS D;  3L3O C;  2HIV A;  3NHH A;  3GTM B;  4G57 A;  5C5M A;  4I7A A;  3W2D A;  2F0Q A;  4C3J G;  2R92 G;  5K36 G;  1HQM C;  2AMC B;  1GJX A;  4GOP A;  4JI6 Q;  1H9S A;  2R93 G;  2X6G A;  1J6Q A;  3W1B A;  3S2H H;  1HTL D;  5J22 A;  1G51 A;  1HNZ Q;  2AQ2 B;  1H9M A;  1BVS A;  4B3R Q;  1BNZ A;  5KND A;  1JIC A;  1YHA A;  3I55 A;  2MFI A;  4DR6 Q;  3HGB A;  1CKM A;  1MBY A;  4NB3 A;  2EXD A;  4JOI A;  3G7L A;  2PNH A;  1PFS A;  3TP6 A;  3MFG A;  2VZA A;  3GTO H;  2K01 A;  4GKJ Q;  1WCM H;  5D3I B;  5BR8 L;  3RR5 A;  3WWV A;  4ZK9 B;  5IYD H;  5C3E H;  2MUY A;  3J81 c;  3HOZ G;  2SEB D;  3S1N B;  4LWC A;  3IAY A;  4OGQ C;  1L0W A;  2NYZ D;  4JW0 A;  4MIU A;  1DOL A;  4M8A A;  5A2Q E;  1C0A A;  4A3B B;  4DPG A;  3CU7 A;  4RFB A;  3LNN A;  1STN A;  1SNC A;  1IBK L;  1YHB A;  3U4V A;  1O7L A;  1CKN A;  1E2Z A;  4JYA Q;  1K73 C;  1T5X D;  4M1U B;  1PH2 A;  2ENB A;  3PO3 G;  2DGY A;  1PTO F;  5ELC A;  3CME A;  1YNJ D;  3S15 B;  4IPC A;  1L2F A;  5AJ3 Q;  2EYO A;  4GLV B;  3Q6S A;  4A3I G;  3NP8 A;  5AFW A;  2EY5 A;  2NVX B;  1JC7 A;  3QOL A;  3K7U C;  1VQJ A;  4R4T A;  1FJG Q;  1A0I A;  2O5J C;  2E2I H;  1AFP A;  3H94 A;  4O0A A;  3VYU A;  1JB3 A;  2F0E A;  2WAQ B;  4JG2 A;  1Q7Y C;  1Q8K A;  3E6Z X;  2KEE A;  3OYY A;  2YYZ A;  2E75 C;  3AQQ A;  4NXM Q;  4BY7 G;  5JEA G;  3I56 A;  2EY2 A;  4AYB G;  2UUC Q;  1ENF A;  3QR8 A;  3K80 C;  4UHV A;  1D5Z C;  3J7A F;  2A19 A;  2WB1 G;  2B63 H;  4L6T B;  2ATW A;  2H4O A;  3KLS A;  3CQZ H;  1Q8I A;  4BBS B;  1XMO L;  3HOX B;  5C0X G;  4F87 A;  4UP7 A;  5M9O A;  4WFN 3;  3UDG A;  1KNE A;  5IP7 H;  1B9N A;  4FP5 D;  5C4H A;  1X3F A;  3HOY H;  3PO2 B;  5M5Y H;  4JI1 L;  2A68 D;  3DLL A;  3PV0 A;  2KJX A;  4RCO A;  4X62 L;  4ZYS A;  1PRT C;  1RTO A;  1NSN S;  2DUD A;  3KF6 B;  1ONL A;  4OWW B;  1UEB A;  4CKC A;  4P2C B;  3VR3 A;  3GTO B;  3TN2 A;  1UUP A;  3I4O A;  2MNA A;  1B2T A;  5IYC H;  2L4N A;  3FPU B;  5C3E B;  4MTK A;  2K5Q A;  3SGI A;  4A3E H;  1VQI A;  1NCV A;  1F9S A;  3SK4 A;  2XWB B;  1DCZ A;  2Q8R E;  3DEP A;  5EKI A;  3TME A;  2P5Z X;  1FGU A;  3L2P A;  1EU3 A;  3LX0 A;  4IFD I;  3A56 A;  3STB D;  2VUM H;  1STG A;  1TS4 A;  2EDG A;  4HIO A;  1VQN A;  1CA6 A;  4BA2 I;  3MAQ A;  2PZW A;  4A3G H;  1UE6 A;  1VQ5 A;  4YY3 Q;  5C4J H;  2CQO A;  2QA4 A;  4DV1 L;  1G2T A;  2F0G A;  2NZH A;  2PYK A;  5FLM G;  3ITP A;  4CJ0 B;  2F4V L;  4DV4 Q;  4NDX A;  1AE2 A;  3FMC A;  3PCO B;  4WJ3 M;  1SBB B;  2EQS A;  2MJ8 A;  1PTO C;  4TSS A;  3Q22 A;  3J81 i;  3HEJ A;  1MJE A;  4RWS C;  5EKK A;  3VR6 A;  1EYD A;  3I91 A;  1CZW A;  2RBM A;  3TQY A;  5I9O A;  1SJE D;  2EJF C;  4JVZ A;  2E2I B;  4N9P A;  4A3L G;  3H09 A;  5LMN Q;  5CGK A;  3R8B A;  4TRD A;  3TZU A;  4MNO A;  2AWN A;  2Z4I A;  3Q23 A;  3T1Y Q;  3KYH C;  1JOR A;  2UXB L;  1K9M C;  1IL2 A;  3NBH B;  3VR5 A;  5IIF A;  1RIP A;  1SRU A;  2YTY A;  1D1K A;  1JWS D;  2R92 H;  1Y14 B;  2R93 H;  1CQF A;  1STB A;  2R6G A;  3FEW X;  3L9A X;  3RMH A;  4DAY A;  3MXG A;  1FYC A;  2RCN A;  1N33 Q;  4U67 3;  4OL7 A;  2BA1 A;  2NVT H;  2B39 A;  4KMU C;  3CQZ B;  3IFT A;  3K59 A;  3VDY A;  4GNX A;  4YWM A;  3W1G A;  3CC2 A;  2B2W A;  1LTG D;  3EVQ A;  4L5Q A;  2K75 A;  1SE2 A;  4P71 A;  1PH6 A;  2RSN A;  4Y52 H;  1LUZ A;  5LMU Q;  4K8J A;  4WRD A;  4A3K G;  2PMZ B;  1SSO A;  1PFB A;  2NVY H;  3HOY B;  5M5Y B;  2F0I A;  4LF9 L;  2L5T A;  4A3F B;  1N36 L;  4Q0F A;  3MA2 B;  3KJO A;  2IX1 A;  1O7I A;  1E22 A;  2CHB D;  5JJI A;  2ZJR A;  3ERS X;  5I2X A;  3GTG H;  1B70 B;  1EIY B;  4LF7 L;  4HJ7 A;  4GKK Q;  4DR7 L;  2I0Q A;  2IL8 A;  2IJ0 A;  3ICE A;  1X65 A;  4ZAI A;  4QMG A;  1ZYR C;  5EKL A;  2VL6 A;  1HZ9 A;  4A3I H;  3EIV A;  1N32 L;  5C4X G;  2BE5 D;  1AZQ A;  2VUM B;  3NTH A;  1L0Y B;  4MN3 A;  1Q3L A;  4BWG B;  4A3M H;  2EOT A;  3F1Z A;  5IGG A;  4A3G B;  3C46 A;  3A5Z B;  3K58 A;  1A3U A;  5C4J B;  3CCE A;  1Y1W B;  4IN3 A;  2K5H A;  4HCS A;  4ZLT F;  5KRU A;  3I7F A;  1IBL Q;  1BCP D;  3BU2 A;  4DNI A;  1Y8P B;  3VYS A;  2F0T A;  1PZI D;  1OXV A;  3A55 A;  5J1Z A;  3KDF B;  4UDU C;  1QUQ A;  4BS9 A;  3N6R A;  1UNS A;  1WD0 A;  2UU9 L;  2KEN A;  3TRE A;  3PQI A;  3BDO A;  5GAD C;  1YI2 A;  1SYB A;  5IY0 A;  1N8R C;  4LF8 Q;  4DV5 L;  1X3Q A;  3BS1 A;  1CUK A;  1PV4 A;  1IYJ B;  1I4Q A;  4Y7N H;  2O5I C;  1TKW B;  1WVL A;  4DUY L;  5COY A;  1EQQ A;  2VNU D;  1GHJ A;  4PNY A;  3MXN A;  4NXN Q;  1TII D;  5JVG 3;  2UUA L;  3A5U A;  2N3S A;  2R92 B;  4HJ8 A;  3TZD A;  3I4N H;  2HUG A;  4OON A;  2R93 B;  1I4P A;  2OF1 A;  1V1Q A;  1XNQ L;  1QVF A;  2F52 A;  4XYO A;  5GRO A;  3J80 c;  1KLG D;  2IHF A;  1LLR D;  2YTV A;  3TP8 A;  4CKE A;  3F2D A;  1CKO A;  1WTV A;  3DWQ A;  2BDO A;  1P16 A;  1X3E A;  1A2U A;  4KN7 C;  1RL2 A;  2IWH A;  1HNW Q;  4B3T Q;  1K83 H;  1ZXT A;  1XPU A;  4HR7 B;  2K4K A;  3GTQ B;  2JA6 H;  2ZTE A;  4X3U A;  3HFZ B;  1Z47 A;  1K8O A;  2NVY B;  2B8F A;  1EY9 A;  4OO1 H;  3RD4 A;  4MTN A;  3J7A V;  1E1T A;  2PO4 A;  3R2I A;  1PYW D;  5IOC A;  3GTG B;  1KHI A;  1SNQ A;  3T1H Q;  2VB3 X;  1TWH H;  1Q86 C;  3GD7 A;  1Y8N B;  4ID6 A;  1H9R A;  3CF5 A;  2GN5 A;  1BXT A;  3E5S A;  3D0F A;  4TVA B;  5G3L D;  2JA8 G;  1SYF A;  4KD4 A;  2HHH Q;  5J3B A;  1WTX A;  1SNO A;  1A3V A;  1I4H A;  4A3C H;  1UEA B;  2CW0 C;  5M3F G;  4A3I B;  4N8F A;  1MHW C;  3CCU A;  3ZJY C;  1E2V A;  1U9R A;  2DJG C;  4A3M B;  2RHQ B;  1VQM A;  1K0R A;  3TRZ A;  2MHV A;  4RGM A;  2KCC A;  4OHJ A;  4CDC C;  1GUG A;  5GAE C;  1O80 A;  1LTL A;  1S5C D;  2EYH A;  4K2L A;  5DAU A;  1K3R A;  1II3 A;  1VQ8 A;  1JE5 A;  5CV8 A; 
#chains in the Genus database with same CATH homology
 4L5R C;  1TWG H;  1NY4 A;  4GNX C;  5BR8 Q;  4LW1 A;  1WOC A;  4A76 A;  1M90 C;  4LF5 Q;  3JAM c;  3H3V H;  3K81 C;  3MXN B;  1QVG A;  4B3T L;  3AFP A;  3BJU A;  4DV6 L;  3GDE A;  1I94 Q;  1GD7 A;  3K0X A;  5M5X H;  4JYA L;  1KAW A;  3PGZ A;  4KHZ A;  4X64 Q;  1A8V A;  1GO3 E;  1QZH A;  4IPD A;  3CC7 A;  1JJC B;  5DLQ E;  4P72 A;  2ASB A;  2KBN A;  4XTC S;  3KOJ A;  3H0G G;  2N49 A;  1KRT A;  1EUJ A;  4DR2 Q;  3I4N G;  2ZTC A;  1E24 A;  4LF4 Q;  4YCV A;  1B7Y B;  1SMX A;  2ID0 A;  3GTL H;  4JV5 Q;  3B6Y A;  5AJ3 L;  1VQL A;  4LNQ A;  1MIU A;  1VQH A;  2KCM A;  2OTL A;  2YTX A;  3PSI A;  1XPO A;  2JA7 H;  1ASZ A;  3U58 A;  4A3F H;  2GVB A;  1G6P A;  4JI4 L;  1JB7 A;  3M85 A;  1XPR A;  4BBS H;  1YJN A;  4BY7 H;  4A3K H;  1SR3 A;  3CPF A;  3HOX H;  3J7A 5;  2UXC L;  2HIV A;  1D8L A;  1NMG A;  1E7Z A;  1FJG L;  4R4I A;  4DR3 Q;  4IPH A;  4DV3 L;  2R92 G;  2YV5 A;  5K36 G;  1T9H A;  1SRO A;  3OTO Q;  2JA6 G;  2AMC B;  1EWI A;  3ULJ A;  4K0K Q;  3J7Z C;  4GOP A;  4JI6 Q;  4C3H H;  2ALY B;  2R93 G;  4JI5 L;  1J6Q A;  3J81 j;  1X6O A;  4POG A;  1PH8 A;  4OO1 G;  1EFW A;  3W1B A;  3S2H H;  1G51 A;  4POF A;  1HNZ Q;  2JA5 H;  5HY6 A;  2YU9 H;  4B3R Q;  1BVS A;  4JBM A;  2JJQ A;  4IPG A;  4X65 L;  1VQO A;  3TS0 A;  1YHA A;  1PH9 A;  4PZ7 A;  1PHJ A;  3I55 A;  2MFI A;  1YBY A;  4ALP A;  4IFD J;  4DR6 Q;  1CKM A;  4NB3 A;  4O2D A;  2EXD A;  4JOI A;  5GAH C;  2VQE L;  1XJV A;  2PNH A;  1PFS A;  5IP9 H;  1FVI A;  1NMF A;  2VZA A;  4DV2 Q;  1KRS A;  3GTO H;  1WCM H;  2XGT A;  2BH2 A;  1Y1W H;  4A3B G;  4GKJ Q;  1HNX L;  1H95 A;  2VQF Q;  3E9H A;  5C4X H;  1YIJ A;  5BR8 L;  4C3I H;  4A3D G;  1U5K A;  3F2C A;  2PQA A;  3RR5 A;  3WWV A;  5IYD H;  5C3E H;  3FKI H;  3J81 c;  1U0L A;  4LF6 L;  1X55 A;  3H3V I;  4YWK A;  4GS3 A;  4FDB A;  1I94 L;  4MZ9 A;  3HOZ G;  4A3C G;  3GO5 A;  4LWC A;  1L0W A;  2E5L L;  1XTD A;  4X64 L;  1C0A A;  4LFC L;  4A3J H;  1XMO Q;  4DPG A;  3KF6 A;  4ME3 A;  5M5W H;  4A93 H;  2OQK A;  4LUZ A;  3UE0 A;  2CFM A;  2ZM6 L;  1EOV A;  3PUW A;  4DR2 L;  1IBK L;  1YHB A;  3U4V A;  1AE3 A;  1CKN A;  2R7Z H;  3KFU A;  1K73 C;  4JYA Q;  1KQS A;  3PIO A;  1KC8 C;  1PH2 A;  2JK8 A;  4GOP C;  1XNR L;  2K52 A;  3PO3 G;  2Z0S A;  4BXX H;  4X6A H;  2I5M X;  2DGY A;  3CME A;  4JI8 Q;  4JI0 Q;  1J5E Q;  1EYG A;  4QY7 A;  3UDF A;  4IPC A;  1L2F A;  1E3P A;  5AJ3 Q;  3RLF A;  4GLV B;  2B3G A;  2ZTD A;  4JI1 Q;  1S72 A;  1VQ7 A;  1L1O A;  3AEV A;  4OXP A;  4X62 Q;  4A3I G;  4DR1 Q;  3E9I A;  4JOI C;  1TWA H;  2WAQ G;  3K7U C;  1VQJ A;  2JEA I;  3A74 A;  3IRB A;  5FLM H;  4R4T A;  4L5S A;  4JI6 L;  1BBW A;  1FJG Q;  1A0I A;  3U50 C;  4GLA C;  1HZC A;  2A1A A;  2E2I H;  2CKZ B;  2IHE A;  1HNZ L;  3RLO A;  4R1J A;  1N9W A;  1K8G A;  4RG1 A;  4AQY Q;  4B3R L;  2LXJ A;  4O0A A;  3UDX A;  4JI5 Q;  4DK3 C;  2MQH A;  3W5O A;  2JE6 I;  4A75 A;  4JG2 A;  3TEH B;  1Q7Y C;  1Q8K A;  4AH6 A;  1YJW A;  4DR6 L;  2UXD L;  4YWL A;  3OYY A;  3UE1 A;  2YYZ A;  1OXX K;  3AQQ A;  3RN5 A;  1VCI A;  4X65 Q;  4NXM Q;  4BBS G;  4GKJ L;  4BY7 G;  3GTQ H;  1UE1 A;  3DM3 A;  4JC0 A;  5JEA G;  3I56 A;  3CAM A;  3HOX G;  4QJF A;  4AYB G;  2VQF L;  4A3L H;  2WP8 J;  3CCS A;  2VQE Q;  2UUC Q;  4DV4 L;  3K80 C;  2A19 A;  2WB1 G;  1GVP A;  4GOP B;  2AHO B;  4WJ4 A;  2D0P A;  2Y0S E;  3FP9 A;  1HNW Q;  2B63 H;  5IWA Q;  2ATW A;  3CC4 A;  3CQZ H;  3S1M H;  3CCQ A;  1XMO L;  1SFO H;  1L1O C;  4LF6 Q;  2CWP A;  3ULL A;  5C0X G;  4UPA A;  1Y1V G;  3PUX A;  4UP7 A;  1IXR A;  4TQU S;  3S1R H;  3JAM i;  1PH7 A;  2E5L Q;  4JI7 Q;  3M4Q A;  3PO2 G;  3PUZ A;  4LFC Q;  1DGS A;  3UDG A;  2ZM6 Q;  5LMN L;  4JBJ A;  1IBK Q;  4OO1 I;  2OCE A;  1JJG A;  4JI8 L;  4JI0 L;  5IP7 H;  1J5E L;  4JBW A;  1VQ6 A;  5IP9 G;  2WFW A;  5LMN W;  1MJC A;  3T1Y L;  1XNR Q;  1X3F A;  2PQA B;  3HOY H;  1KXL A;  5M5Y H;  2GVA A;  4JI1 L;  1JJ2 A;  3DLL A;  3PV0 A;  1KL9 A;  4X62 L;  4DR1 L;  5M3M G;  4YHH Q;  5FLX c;  3HOU H;  5IYD G;  5C3E G;  3FKI G;  3HKZ E;  4EX5 A;  2L15 A;  4DR4 Q;  2DUD A;  4RMF A;  3CW2 C;  3KF6 B;  2QEX A;  2UXB Q;  3PF4 A;  4OWW B;  1UEB A;  2JA8 H;  1E1O A;  1KD1 C;  1VQK A;  4A3J G;  1CKN B;  1N33 L;  1I50 H;  3I2Z A;  3I4O A;  1BKB A;  2NN6 I;  2MNA A;  4A93 G;  5IYC H;  5M3F H;  2N78 A;  3S2D H;  2R7Z G;  3KLW A;  4AQY L;  4B3S L;  2V1C C;  3SGI A;  4A3E H;  2HT1 A;  1VQI A;  1KIX A;  2AWO A;  1VQD A;  2F3I A;  4DUZ L;  4HJA A;  2E2J H;  1A63 A;  1D7Q A;  1VQF A;  1FGU A;  3L2P A;  1I3Q H;  2LSS A;  3L7Z C;  4IFD I;  4PZ8 A;  1L1O B;  3STB D;  4NXM L;  2VUM H;  2KCT A;  1Q1B A;  2JEB I;  4HIO A;  1VQN A;  2UXD Q;  3KF8 B;  4BA2 I;  2UUC L;  2MO1 A;  1X9N A;  2VW9 A;  4A3G H;  1UE6 A;  2A8V A;  1VQ5 A;  4YY3 Q;  5C4J H;  2CQO A;  2QA4 A;  4DV1 L;  2D0O A;  3S14 H;  1V43 A;  2NZH A;  5FLM G;  2F4V L;  5IWA L;  1AH9 A;  4DV4 Q;  3BZC A;  1AE2 A;  2MO0 A;  2PMZ E;  4UP9 A;  3F2B A;  2NN6 G;  2OTJ A;  5ELN A;  4X66 Q;  3PCO B;  3G6E A;  4WJ3 M;  4LF9 Q;  4P75 A;  4JI7 L;  2EQS A;  2JA9 A;  1N36 Q;  3J81 i;  3HKZ G;  4GKK L;  1MJE A;  3M9B A;  1PVO A;  1EQR A;  3TQY A;  4IFD G;  1HZB A;  4LF7 Q;  2Q2T A;  3GTM H;  1R9T H;  3CCM A;  4GLX A;  4LUO A;  3HOW H;  3HOW G;  1W3S A;  3STB C;  1NBW A;  5LMN Q;  1X3G A;  4OX9 L;  4A3L G;  1S3O A;  1IZ6 A;  2I5H A;  4LUV A;  4MNO A;  2AWN A;  4YHH L;  3I4M H;  3CCV A;  4PG3 A;  3KYH C;  3T1Y Q;  4EQ5 A;  4DR4 L;  1K9M C;  3EBE A;  3ULP A;  2UXB L;  1IL2 A;  2KHI A;  3NBH B;  3S1Q H;  4PMW A;  1JT8 A;  3KDF A;  2Q2I A;  1TWF H;  1RIP A;  1SRU A;  2YTY A;  3FHW A;  4XIG S;  5H1S E;  3TS2 A;  3E0E A;  5IYB H;  3BZK A;  2R92 H;  1Y14 B;  3Q8D A;  2PI2 E;  2R93 H;  1Q12 A;  1IBL L;  3F8T A;  2R6G A;  4DKA C;  1YVC A;  3AYH B;  2BH8 A;  1TWC H;  1OXS C;  1FL0 A;  2KHJ A;  2RCN A;  1N33 Q;  1UWV A;  3EN2 A;  3MEF A;  2Q2U A;  1NJI C;  3S16 H;  2BA1 A;  5C0X I;  3RNU A;  2NVT H;  4QIW E;  4KI0 A;  3VDY A;  4B3S Q;  4IJL A;  4R4Q A;  4UP8 A;  4YWM A;  4GNX A;  3W1G A;  1Q81 C;  4B3M L;  1VQ4 A;  1OTC A;  4L5Q A;  4DUZ Q;  3CC2 A;  3S24 A;  1VQC A;  1YZ6 A;  2K75 A;  2JA7 G;  4P71 A;  1PH6 A;  1OXT A;  1C9O A;  2XTI A;  4A3F G;  4Y52 H;  1LUZ A;  1Z9F A;  5LMU Q;  4DR5 L;  1GM5 A;  3HOU G;  5JJK A;  4YY3 L;  4HIK A;  4YCU A;  4A3K G;  4LF8 L;  4PZ6 A;  4H02 A;  2UU9 Q;  4P73 A;  2NVY H;  3M4P A;  1HH2 P;  1W2B A;  1WI5 A;  3AFQ A;  4X66 L;  1WFQ A;  4DV1 Q;  1MKH A;  5IYC G;  4DV5 Q;  4LF9 L;  2F4V Q;  2Z6K A;  4NXN L;  1X54 A;  4HID A;  1PA6 A;  1N36 L;  3KJO A;  2IX1 A;  2Q2H A;  1E22 A;  1O7I A;  1M1K C;  4LFB Q;  4IO9 A;  5JJI A;  2ZJR A;  2E8G A;  3CCJ A;  4DUY Q;  3ERS X;  2IT1 A;  5JJL A;  2RHS B;  3GTG H;  2VS1 A;  2JA5 G;  1TXY A;  1B70 B;  1EIY B;  3PF5 A;  5FJ8 H;  4LF7 L;  4HJ7 A;  3G4S A;  4GKK Q;  4DR7 L;  2I0Q A;  3GTJ H;  3OW2 A;  1IBM L;  3ICE A;  4HJ9 A;  1YIT A;  1X65 A;  3CCR A;  1YJ9 A;  4A3G G;  1XNQ Q;  4BBR H;  2VL6 A;  4KHP L;  1WCM G;  3S17 H;  1Y1W G;  4OWT B;  4OX9 Q;  1HZ9 A;  4A3I H;  3EIV A;  3K8A A;  3LGJ A;  1N32 L;  5C4X G;  1JMC A;  3M3Y H;  2D62 A;  1HNW L;  1VQP A;  3K7A H;  3NEM A;  4JI3 L;  3HOV H;  1EIF A;  4A3M H;  3F1Z A;  3CD6 A;  4OWX B;  1QZG A;  4IOA A;  3A5Z B;  1VQE A;  1CSP A;  3CCE A;  4JCV E;  2E2H H;  1I5F A;  1YNX A;  2K5H A;  3G71 A;  3I7F A;  1IBL Q;  3GTK H;  4JBK A;  3BU2 A;  4L5T A;  4DNI A;  2Y0S G;  2Z6K C;  2FXQ A;  1CSQ A;  1YEZ A;  1P8L A;  4LFA Q;  1N34 L;  4BXX G;  3T1H L;  1OXU A;  1OXV A;  4QGU A;  5C44 H;  5LMU L;  1VS0 A;  3KDF B;  1QUQ A;  1GKH A;  1S40 A;  4B3M Q;  3I4M G;  4A4I A;  2K5N A;  3CXC A;  2K50 A;  3PUY A;  1Q82 C;  3A0J A;  2B29 A;  1VQ9 A;  2UU9 L;  2KEN A;  2QGQ A;  4GN4 B;  2HIX A;  3NEN A;  3UDI A;  3TRE A;  4DV0 L;  4R4O A;  4DAY B;  5GAD C;  5IYB G;  4DR5 Q;  1YI2 A;  1XMQ Q;  1PH1 A;  2UUB Q;  5IY0 A;  1N8R C;  3PIP A;  4LF8 Q;  1B8A A;  4DV5 L;  1VQB A;  4KLK A;  4QL5 A;  1CUK A;  2K14 A;  1PV4 A;  1IYJ B;  3CCL A;  4LFB L;  4JI2 L;  4Y7N H;  4GNX B;  1Y1V H;  4DUY L;  1SN8 A;  4DV7 L;  1EQQ A;  3U4Z A;  3PO2 H;  2JQO A;  4UY8 C;  2VNU D;  1LM0 A;  4NXN Q;  1HR0 Q;  2PI2 A;  2UUA L;  3A5U A;  1LYL A;  2N3S A;  4HJ8 A;  4BY1 H;  3I4N H;  3H0G H;  3RZO H;  4OON A;  2WAQ E;  2H5X A;  1Q46 A;  3RZD H;  1WJJ A;  5HGQ A;  2ZJQ A;  1V1Q A;  1XNQ L;  2NZO A;  1QVF A;  2F52 A;  4DR7 Q;  5GRO A;  3J80 c;  2ES2 A;  2IHF A;  4J15 A;  1IBM Q;  3CMA A;  5M3M H;  1Q1E A;  4LF5 L;  2YTV A;  4DAM A;  3J80 i;  2N8N A;  3F2D A;  1CKO A;  4QQB X;  4KHP Q;  1X56 A;  1P16 A;  1PYS B;  3ER0 A;  2BA0 A;  2LXK A;  2IY5 B;  4BA1 I;  2B63 G;  1X3E A;  1VQG A;  1N32 Q;  1NE3 A;  2CWA A;  2VY3 A;  1RL2 A;  2I5L X;  4GN3 B;  1VQA A;  5EAY A;  4C3J H;  1PH4 A;  1K83 H;  4DV6 Q;  4B3T Q;  3PUV A;  2K4K A;  1XPU A;  2ZJP A;  2ZTE A;  4JI3 Q;  3RLN A;  2JA6 H;  5ELO A;  1ASY A;  2HHH L;  4AYB E;  4LF4 L;  1NTG A;  3HFZ B;  1Z47 A;  3CPW A;  4IOC A;  5FJ8 G;  4JV5 L;  4IJH A;  2WB1 E;  4LFA L;  2R7F A;  4GN5 A;  4YCW A;  1SE8 A;  3NEL A;  4MTN A;  5E7N A;  1YHQ A;  1E1T A;  5IP7 G;  1SLJ A;  1QVC A;  3H15 A;  4C2M H;  4BBR G;  5IT9 c;  1I6H H;  1N34 Q;  3S1N H;  3D31 A;  3HOY G;  1KHI A;  4P74 A;  2NVQ H;  5JEA J;  3T1H Q;  3G48 A;  4JI4 Q;  4AIM A;  4A3B H;  2C35 B;  1TWH H;  4DR3 L;  1Q86 C;  1PH5 A;  3GD7 A;  3RN2 A;  1XMQ L;  2UXC Q;  4HIM A;  2UUB L;  3OTO L;  3HOV G;  4K0K L;  3CF5 A;  3M7N A;  4A3M G;  2K5V A;  2GN5 A;  4TVA B;  4A3D H;  3D0F A;  2JA8 G;  1V9P A;  4APV A;  2HHH Q;  1A62 A;  2EIF A;  5J3B A;  4DV0 Q;  3GTP H;  2HQL A;  3M4O H;  3HOZ H;  4DV3 Q;  1K8A C;  4A3C H;  1G29 1;  5M3F G;  4DK6 C;  2OWO A;  4NPS A;  3JC6 6;  5C0X J;  1HR0 L;  5IE8 A;  3CCU A;  1UE5 A;  3S15 H;  4R4C A;  1BBU A;  2OQ0 A;  3ZJY C;  4JI2 Q;  4A3E G;  2RF4 A;  4DV7 Q;  4HJ5 A;  1C7Y A;  1QUQ B;  1HR0 W;  2CCZ A;  2RHQ B;  1VQM A;  1K0R A;  3TRZ A;  1HZA A;  2IX0 A;  3CP0 A;  3L0O A;  5GQO A;  2UUA Q;  1PH3 A;  5C44 G;  4DV2 L;  1HJP A;  1WYD A;  3KJP A;  2NVX H;  5GAE C;  3PO3 H;  1UE7 A;  2VUM G;  1PYB A;  3HKS A;  1LTL A;  2R7D A;  4BY1 G;  5GAG C;  1K3R A;  1VQ8 A;  2AKW B;  1JE5 A;  1HNX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...