1JMCA

Single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
238
structure length
238
Chain Sequence
b'KVVPIASLTPYQSKWTICARVTNKSQIRTWSNSRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKIANKQFTAVKNDYEMTFNNETSVMPCEDDHHLPTVQFDFTGIDDLENKSKDSLVDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*CP*CP*CP*CP*CP*CP*CP*C)-3')
publication title Structure of the single-stranded-DNA-binding domain of replication protein A bound to DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication/dna
total genus 51
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1996-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
A PF16900 REPA_OB_2 Replication protein A OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jmcA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1jmcA02
1X65A 1VQKA 2K5VA 2NZHA 5HGQA 4A3KG 1C7YA 2OTLA 1XJVA 3PO2G 2UXBL 4X6AH 3CCRA 1TXYA 4DUZQ 1XMOQ 1B8AA 1WJJA 3S1QH 5M3MH 4DAYB 1RIPA 2KENA 2R7DA 3CQZH 4YWMA 4O0AA 4JI1L 3ULJA 3W1GA 1VQ4A 1UWVA 3Q8DA 4B3TL 3S1MH 4JG2A 3HOVG 3I2ZA 1Q1BA 3STBC 4DK3C 1YITA 3VDYA 2BA0A 3HKSA 1YJWA 1XPRA 4DV4Q 4B3MQ 3M4OH 2LSSA 3W1BA 4JYAQ 1IBKQ 1D8LA 4NXMQ 5JJIA 2OQ0A 5J3BA 2I5LX 4DR2L 1S72A 1H95A 2UXCL 5EAYA 3U50C 2VS1A 3LGJA 4A76A 1YHQA 1PH4A 4LF6L 4WJ4A 4DPGA 1TWGH 1OXUA 4KHZA 1KHIA 4X64L 5IP9H 3F1ZA 1L1OA 3HOUH 4JCVE 3G6EA 3UDXA 2MQHA 2LXJA 2JA8G 4LFCQ 2R7FA 3H15A 4JI2L 4DR4Q 3HOWG 1E7ZA 4NXNQ 3A5UA 3RZDH 1KAWA 2JA7G 4A3MH 4DR6L 1N32Q 3M4QA 2IX0A 5LMNW 1WI5A 4QQBX 3M3YH 1AE3A 3FHWA 2ALYB 4JI3L 3M9BA 4A3EG 1PH6A 1LYLA 4LUVA 4IFDI 2PI2A 4A3LH 1OXVA 3D0FA 4QJFA 4A93G 4DR3Q 1PHJA 3CCLA 4X66Q 4DR1Q 4JI4L 4K0KQ 3K81C 4IFDJ 1PH3A 5BR8Q 1CSPA 4R4TA 4L5QA 3M4PA 4OONA 4DR7Q 3D31A 1K3RA 4ALPA 1KRSA 4YCVA 4C2MH 1V9PA 4KLKA 5C4XH 2Q2IA 4A3BH 1NMGA 1QZHA 1J5EL 3J81i 2AMCB 5IT9c 4PG3A 1K9MC 2ZTEA 4YCWA 3H0GH 3S24A 4GLVB 5JEAJ 1U0LA 3T1HQ 1TWFH 1CKMA 1SLJA 4DV3Q 2DUDA 4NPSA 4A3JH 3K0XA 2KBNA 1NJIC 3CXCA 1Z47A 2ASBA 1YVCA 4JI7L 4BA1I 1X55A 3BZCA 2GVBA 1Y1WH 1IBML 2KHIA 3UDGA 5IYCH 5LMUQ 2Y0SG 4YHHL 3J81c 2UXDQ 3BZKA 5FJ8G 3HOZH 3AFPA 5GADC 4LUZA 1HR0L 1UE5A 1CKNA 1VQ5A 2EIFA 1FL0A 1SE8A 1X6OA 2K50A 4DR3L 3S17H 4WJ3M 1PH9A 3B6YA 2MO0A 1MJCA 2Q2HA 5M3FH 2JA9A 1Q7YC 1U5KA 4YCUA 4HJ8A 1D7QA 5GQOA 4BBSH 3RZOH 4BY1G 5GAHC 1X3FA 1K73C 2ZJQA 2A8VA 1VCIA 2NVXH 2Q2UA 3KFUA 1I6HH 4JV5Q 4A3IG 2OQKA 2VQEL 1XPUA 3E9IA 1Y14B 1N8RC 2DGYA 2R92G 4BY7H 3PO3H 2XGTA 4P71A 1VQJA 2R93H 4PMWA 2K5HA 2WB1E 3U4VA 5IP7H 2OCEA 5FLXc 3G48A 3J7A5 1JT8A 2AWNA 4DV7L 1KC8C 1MJEA 2NVQH 3IRBA 2R6GA 2B63G 3J80i 3AYHB 3ULPA 4KHPQ 2KHJA 3GTQH 4BBRH 3I4NH 1TWAH 4XIGS 4DKAC 1IYJB 4OWXB 1CKOA 3K80C 2OTJA 2K4KA 1SFOH 3I4MG 2GN5A 3ER0A 2WFWA 1SR3A 2BH2A 4LFBQ 1WCMG 1SMXA 1G6PA 3I4OA 4A3DH 4TQUS 3G4SA 1JJ2A 3OTOQ 1JB7A 4HIKA 1TWHH 3FP9A 3HFZB 4JBJA 3J80c 2N78A 1QVGA 1LTLA 1MIUA 4GKJQ 2HHHQ 1LUZA 3L2PA 1XMQQ 1NY4A 5C3EH 4QGUA 1QVCA 4GN4B 5FLMG 4IJLA 4JOIC 2AHOB 2RCNA 2JA6G 3GTOH 4LF4L 1C0AA 3ULLA 1EUJA 1CSQA 1VQMA 1VQIA 3AEVA 4OX9Q 2E8GA 1Q1EA 5LMNQ 1OXTA 5JJKA 3PSIA 4RG1A 2A1AA 2UUCL 3M7NA 1OXSC 1E3PA 4PZ8A 3F2BA 4DUYQ 3HOXG 4GNXC 4YWKA 2N49A 1HNXQ 3KF8B 4DV0L 3KDFB 3RN5A 3FKIH 3GTLH 1PH7A 2CQOA 1YZ6A 3RN2A 3OW2A 3OTOL 1S40A 3A5ZB 1HNWQ 3GO5A 2Y0SE 3UE0A 1Q46A 1HNZQ 3CMEA 3CCSA 3U58A 4J15A 3ZJYC 4A3FH 1HZAA 3F2DA 1VQPA 1YJ9A 1YNXA 4LFAQ 1OTCA 1ASZA 2NVTH 1A8VA 3CP0A 5C4JH 3GDEA 4P73A 3J81j 4A4IA 4R4IA 4IPDA 5IYDH 1HZCA 4QY7A 3T1YQ 4LF9L 3KF6B 2HIXA 5M3MG 1E24A 4DR5L 2JA5H 4POGA 2VNUD 5JEAG 3SGIA 2E5LQ 4HIDA 4AIMA 1XPOA 3PGZA 2F3IA 3NELA 3PV0A 4PZ7A 3RLOA 1YI2A 4JBMA 4JI5Q 3J7ZC 4A3GG 1YEZA 5K36G 3CF5A 4B3SQ 1JJGA 5IYBH 2VZAA 2ZM6Q 4DUZL 1I50H 1Y1VH 1XMOL 4AYBG 1X9NA 3NBHB 1FJGL 1P16A 1N36L 3HKZG 1VQOA 3GTJH 4GKKQ 4GLAC 2BA1A 3OYYA 4DV5Q 5IP9G 3HOUG 4X62Q 4DV4L 4NB3A 4B3ML 1L2FA 1UEBA 1E22A 4JYAL 1IBKL 4NXML 4JI6Q 5IE8A 3WWVA 2ZJPA 2YU9H 1QUQB 1SN8A 2BH8A 3PF5A 4L5RC 4GOPB 4LW1A 4A3MG 1PH5A 2C35B 4BXXH 1VQBA 3CCUA 4DV2Q 2VQFQ 5GROA 2D62A 4AQYQ 2UUAL 3E9HA 4C3IH 4JC0A 3S2DH 4A3LG 4LFCL 1Q8KA 3A74A 4AH6A 4DR4L 4QL5A 1K83H 4NXNL 1DGSA 2PNHA 4MNOA 4JBKA 4L5TA 1YJNA 1N32L 2IHEA 4DV1Q 1V43A 1FGUA 2K52A 3BU2A 1PV4A 2UUBQ 3CW2C 1Z9FA 1WYDA 1N36Q 2VY3A 4A75A 2IY5B 4C3HH 1I94Q 4B3RQ 1YHAA 1N9WA 2Q2TA 5C4XG 1SROA 4A3BG 4X66L 1B70B 4DR1L 4LF7Q 4K0KL 1X54A 2AWOA 3H0GG 3AQQA 4GN3B 5BR8L 3PUYA 5AJ3Q 2OWOA 3W5OA 1OXXK 4A3JG 1PH1A 2F4VQ 4DR7L 4DNIA 5C44H 1IZ6A 3TS0A 4P75A 1E1OA 3CCQA 2I5HA 5IWAQ 1L1OC 1YHBA 1KQSA 1N34Q 1Y1WG 1N33Q 1BVSA 5IYCG 2B3GA 1O7IA 1VQ7A 3T1HL 4A3CH 3HOZG 3U4ZA 1B7YB 4DV3L 4IO9A 2ES2A 1XNQQ 1VQ9A 3CCJA 2YV5A 4IFDG 1EQQA 3GTGH 2UU9Q 3CCEA 5M3FG 1R9TH 2VUMH 3HOYH 1S3OA 2RHQB 3CCMA 1I3QH 4X65Q 4DV1L 1X56A 3GTKH 4BBSG 5LMUL 3PCOB 2R7ZH 4MZ9A 2QEXA 2UXDL 2QGQA 4JI8Q 2NZOA 3I56A 3MXNB 2HIVA 1IXRA 4DV6Q 4JI0Q 4LF5Q 1CUKA 1W2BA 3EIVA 2IX1A 3ERSX 5M5YH 1XNRQ 4BY7G 3PO3G 4YY3Q 2CFMA 2UUAQ 1LM0A 3STBD 2UXBQ 4HJAA 1E1TA 2R93G 5IP7G 5ELNA 1GD7A 2NVYH 3KJOA 4JV5L 3CD6A 4JI1Q 1HZBA 3KDFA 4B3TQ 4GNXB 1I5FA 1EIYB 2JQOA 3K7UC 1PA6A 1VQDA 4QIWE 2JEAI 2CKZB 3S2HH 4R1JA 4BBRG 3EN2A 3I4NG 4A3GH 4A3KH 2JJQA 4IPCA 1VQNA 4FDBA 3PO2H 1Q86C 3K8AA 5GAEC 2ZJRA 4LUOA 1VS0A 2K14A 2WAQG 4DR2Q 1AH9A 5HY6A 2CCZA 4A3DG 2UXCQ 2JEBI 3KF6A 1PYBA 4IPGA 4LF6Q 2PQAB 3F8TA 3H3VI 3PUZA 3HOVH 4KHPL 2K75A 3RLFA 1A63A 1TWCH 4JBWA 5DLQE 1NMFA 1XTDA 3KJPA 1NTGA 2JE6I 2NN6I 1WOCA 1GVPA 1W3SA 4JI2Q 5JJLA 4LFBL 1Q82C 1UE7A 3DM3A 3UDIA 3M85A 2RHSB 5C3EG 4DR6Q 4OXPA 2L15A 4YY3L 2QA4A 1PH2A 4HJ9A 4GN5A 4HIOA 4JI3Q 2XTIA 2JA8H 1A0IA 4XTCS 2GVAA 4GKJL 4Y7NH 1KIXA 2HHHL 2Z6KA 5ELOA 3HOWH 4BA2I 1XMQL 2VL6A 4JI4Q 3PUWA 2YTVA 1Q12A 2JA7H 1QUQA 1KXLA 1IBLQ 1QZGA 4GOPA 1NBWA 1PH8A 4A3EH 3K7AH 4YWLA 2WB1G 4HJ5A 1K8GA 2K5NA 4A93H 3FKIG 1GKHA 4IPHA 2JK8A 4UP7A 3S1RH 4OX9L 5LMNL 5H1SE 1G51A 1J5EQ 2D0PA 5C0XJ 1RL2A 5GAGC 1ASYA 4A3FG 3H3VH 2PMZE 1BBWA 4DUYL 1EFWA 1KRTA 2V1CC 1HNXL 4H02A 3G71A 5IYDG 1HZ9A 4JI7Q 3PUXA 1BBUA 1V1QA 1M90C 4HJ7A 2JA5G 1T9HA 2ZTCA 4OO1I 1IBMQ 1HNWL 4PZ6A 1HNZL 4HIMA 1VQHA 4YHHQ 1Q81C 4LF8L 4LNQA 2AKWB 4UY8C 4LFAL 4MTNA 1HR0Q 3GTPH 2VW9A 3KYHC 4DK6C 5IYBG 3L0OA 1Y1VG 3T1YL 3CCVA 1VQ6A 1VQEA 4POFA 2E5LL 3RLNA 1FVIA 4RMFA 1IBLL 2I0QA 1SRUA 3CC4A 1L1OB 2YTYA 4JI5L 5FJ8H 2HQLA 4UPAA 1X3GA 3TEHB 2VQEQ 4B3SL 3ICEA 2NN6G 1GO3E 2ZM6L 2PI2E 3S14H 1EYGA 3MEFA 2EXDA 2Z0SA 1C9OA 2A19A 1EWIA 4P74A 1PFSA 3GD7A 3PIPA 3F2CA 4BY1H 4OWWB 4BXXG 4GKKL 1WFQA 1UE1A 2WAQE 2N8NA 4C3JH 1L0WA 4KI0A 4DV5L 4JOIA 4O2DA 3CAMA 4X62L 5C0XI 3CMAA 4DV7Q 4A3IH 1K8AC 3L7ZC 1X3EA 1VQFA 2IT1A 1HR0W 3TREA 4JI6L 1AE2A 1P8LA 3E0EA 4APVA 5M5XH 2R92H 3TRZA 3KOJA 1HH2P 4R4QA 3CPWA 1NE3A 4UP8A 2Z6KC 1JMCA 4R4CA 3TS2A 1VQCA 2WP8J 1YBYA 1YIJA 1FJGQ 4LWCA 4DAMA 2VQFL 4DV2L 4UP9A 4GOPC 4AQYL 1G291 1KL9A 2MNAA 2B63H 2F52A 4GLXA 3EBEA 4GNXA 3CC2A 4IOAA 3UDFA 2ATWA 4OWTB 3KLWA 3CC7A 4EX5A 2LXKA 2N3SA 2YTXA 1KD1C 4L5SA 3I4MH 3A0JA 2UUBL 1UE6A 1WCMH 3NENA 1VQ8A 5C44G 1I94L 4B3RL 3S16H 2ZTDA 2D0OA 2ID0A 1MKHA 2PQAA 4LF7L 3JAMi 4OO1G 2YYZA 1PYSB 2RF4A 2HT1A 4Y52H 4LF4Q 1QVFA 4A3CG 1CKNB 2CWPA 5AJ3L 4AYBE 3TQYA 3UE1A 2E2IH 2F4VL 2CWAA 1PVOA 2B29A 4GS3A 3HKZE 4P72A 1HJPA 3PIOA 3S1NH 3I7FA 4EQ5A 5IWAL 5FLMH 2UUCQ 5E7NA 1N34L 2H5XA 1EOVA 2KCTA 2JA6H 1EQRA 1A62A 1K0RA 1N33L 2VUMG 3HOYG 2KCMA 3I55A 1EIFA 2R7ZG 5IY0A 3JAMc 3PF4A 4DV0Q 1VQLA 4LF8Q 3NEMA 1XNQL 1VQGA 2E2HH 3AFQA 4R4OA 5M5WH 4IJHA 1GM5A 3RR5A 3JC66 4TVAB 2FXQA 2UU9L 3PUVA 1IL2A 2MFIA 1VQAA 2MO1A 4X64Q 4X65L 3HOXH 2IHFA 3DLLA 1M1KC 3CPFA 3GTMH 4JI8L 3RNUA 2EQSA 4LF9Q 4DR5Q 3S15H 1BKBA 5C0XG 4DV6L 4JI0L 4LF5L 4IOCA 2I5MX 4ME3A 1JE5A 1XNRL 2E2JH 3BJUA 1J6QA 1JJCB
chains in the Genus database with same CATH superfamily
1UNSA 1Y1VB 2NZHA 1VQKA 5HGQA 2OTLA 2UXBL 4X6AH 2Z9HA 1E2VA 1A3UA 1TXYA 1EY0A 1B8AA 1WJJA 3S1QH 1DM0B 2R7DA 2KENA 4YWMA 4JI1L 4M1UB 3W1GA 1GUGA 1WTQA 1UWVA 1H9JA 5D14A 2K5WA 3FMCA 1AFPA 4DK3C 2BA0A 1YJWA 1CA6A 4B3MQ 2LSSA 4XXEA 1A6XA 4NXMQ 2OQ0A 1H95A 5FO8B 4XQJA 3U50C 1YHQA 1U4MA 1TWGH 1OXUA 2RDGA 1K83B 2D2CC 3HOUH 1T5XD 3GV6A 4JCVE 3G6EA 2JA8G 2LXJA 2XN9C 3N52A 4DAVA 5C3WA 3A5UA 4A3MH 4DR6L 2Q8TA 3IFDA 1BR9A 4HN7A 2V4DA 2B2YC 4LUVA 4A3LH 1OXVA 1EIGA 2SNSA 4C1NK 1PHJA 2B8FA 3TDQA 2OEOA 4HAEA 4JI4L 4K0KQ 2PQEA 1PH3A 5BR8Q 1CSPA 1O7YA 2LS01 1KRSA 4KY5A 4CDFC 5JPNC 3J81i 1ESRA 2C9OA 3AB9A 5IT9c 4ZUJA 1HCZA 2R3ZA 1QG7A 1UEAB 3SR1A 3GTGB 3K0XA 4KD3A 3HOYB 4S3SA 3CXCA 1Z47A 1I3QB 2ASBA 3GTKB 4JI7L 5J1ZA 1X55A 2EE1A 1ML0D 2LFNA 2VB2X 5M9OA 2KHIA 1FR3A 3UDGA 4PMBA 3DWQA 5LMUQ 3J81c 3BZKA 1LTRD 3HOZH 5M5YB 5GADC 1HR0L 1NR4A 1HRJA 1IW7D 1II3A 1X3PA 2D9UA 4DR3L 1CZWA 2EZVA 1MJCA 5M3FH 1U5KA 3VR4A 2JN4A 2ZJQA 4V190 1VCIA 1QILA 3S2HB 1XPUA 3E9IA 1HFGA 4ZAIA 1VQJA 2R93H 4PMWA 2K5HA 3J7A5 3G48A 2AWNA 1MJEA 2NVQH 1TS4A 3J80i 3H91A 4HCSA 3ULPA 4BBRH 1SE4A 4DKAC 4ABNA 4MHEA 4KTAA 4CKEA 3I4MG 2HD3A 3ER0A 1SMXA 1G6PA 4A3DH 4TQUS 5IGFA 3OTOQ 4DAYA 2GA4B 1YNJC 4RKBA 2JA8B 3J80c 4Y7NB 4J8QA 3KBGA 4X3SA 1LTLA 1MIUA 4KY6A 1NY4A 1QVCA 4IJLA 4JOIC 3MFGA 3R2IA 2DJGC 3BVMA 3GTOH 2A68D 1EUJA 1VQMA 1VQIA 1Q1EA 3PSIA 4CDCC 3M7NA 2RDFA 3A54A 3T16A 2LMCB 4Q0FA 2F0EA 1SNQA 3I70A 4HCEA 2EJMA 2CQOA 3OOCA 4J6HA 1YNNC 1HNWQ 3GO5A 2Y0SE 1Q46A 1HNZQ 3KLSX 1WD1A 3SK6A 3F2DA 2EJFC 1PXUA 5C4ZA 1HUMA 1BBXC 1HZCA 3SHLA 5IYDH 4LF9L 5M3MG 2VNUD 3MTSA 1DXMA 5JEAG 1KLGD 2A6HC 2E5LQ 1S5DD 3PGZA 4K6LA 3WOEA 2DNCA 1TR5A 3CF5A 5IYBH 2VZAA 1XMOL 3HG9A 2OXPA 2QDBA 4KV6A 2B2WC 2F0MA 1R4QB 3BG3A 3NBIA 2NN6H 1IBKL 2BH8A 3PF5A 4BXXH 3S17B 3CCUA 3D6WA 2VQFQ 5GROA 5CV8A 3E9HA 4LFCL 1Q8KA 4RGOS 2A6ED 3I4MB 4WFN3 4NXNL 1DGSA 3EFXD 2B39A 1N32L 3LWUA 3KUPA 3FEWX 3BYTB 5NUCA 1FGUA 3LWEA 3BU2A 1PV4A 4XDXA 1EY9A 2F4IA 4B3RQ 4RCNA 1YHAA 1N9WA 4H0LC 2Q8RE 1B70B 1KAAA 4DR1L 5EPJA 1X54A 2E2IB 2AWOA 3C2PA 3H0GG 1ONLA 1OXXK 4A3JG 1PH1A 2F4VQ 1H9KA 4DR7L 5C44H 4P75A 5IWAQ 1G8ZD 1SE2A 1N34Q 1Y1WG 5KEEA 4G7HC 2E2HB 2A74C 2MPMA 1XNQQ 5FOBB 1R9TH 2VUMH 1S3OA 4X65Q 2RSOA 1T5EA 5BN5A 3MXNB 2PO4A 2XWJB 2QEJC 2E2JB 1EIHA 1DYQA 4LF5Q 3P1HA 1W2BA 2IX1A 5CYUA 1STGA 2CFMA 2UUAQ 1LM0A 1QNKA 3STBD 4K8IA 5M3MB 1QB5D 3CQZB 5IP7G 5ELNA 3S1MB 4IUQA 5EPKA 1IYVA 3CKIB 4JV5L 4F87A 1K8OA 3KF8A 3D3RA 4B3TQ 1K28A 5TSSA 1EIYB 5IODA 2CKZB 4KKSA 3HS0C 1RHPA 4A3KH 4DK1A 3NXWA 1B4OA 1GUWA 1Q86C 5GAEC 2K14A 1XWEA 1PMRA 5HY6A 1S5ED 1PYBA 4LF6Q 2PQAB 1XYIA 3HP3A 3PUZA 3HOVH 4KHPL 2K75A 4X3TA 1IHZA 3MVVA 3RZDB 4UHVA 1TQOA 1GVPA 4LFBL 3M3YB 1UE7A 3DM3A 3UDIA 2RHSB 5C3EG 1OO9B 1H9RA 3NBHA 4QF4A 2QA4A 4HJ9A 1GUNA 2CW0C 2XTIA 5CMDA 2HHHL 2Z6KA 3HOWH 5FKAC 1XMQL 2VL6A 2OT2A 1Q12A 2A5HA 1QUQA 1KXLA 4C2MB 1A2TA 2PNRC 1B2TA 5DEHA 4HJ5A 2I46A 3H0GB 2I07B 5H1SE 1J5EQ 4A3JB 2F0LA 2RSNA 4G4KA 4R8IA 1NNXA 2TSSA 4LJZC 4A3FG 1F9PA 1MD2D 2FINB 2K5DA 4XQNA 1Y1WB 4NKLA 3G71A 1HZ9A 3PUXA 3TP5A 1LT3D 4HJ7A 3MZ5A 1UUPA 1UAPA 3SK5A 3ZYYX 3JAME 5ELCA 2A69C 3RZOB 4POFA 1KTKA 2RCFA 4RMFA 3RLNA 2I0QA 1I6HB 1SRUA 3CC4A 4JI5L 2O4XA 4UPAA 3TEHB 2VQEQ 3ICEA 1EWCA 2PI2E 1PZKD 3S14H 2Z0SA 3K57A 4P74A 1KABA 4OWWB 4DU9A 4FO2A 2WAQE 2HDLA 4KI0A 4DV5L 4DV7Q 5C0XI 4X62L 4C3IG 1JB3A 1VQFA 2IT1A 5M5XH 3E0EA 4CGYB 2SEBD 3TRZA 2Z6KC 4IZ8A 3H94A 4LWCA 4DV2L 3UI2A 2EJGC 2F03A 1DOKA 5LL6X 4IUVA 1F2MA 1JOOA 4N8FA 1PTOC 4IOAA 1I6VC 1MSHA 2NTTA 3C1EA 2L5TA 5C3EB 3QO2A 4K2LA 3DUZA 4ZLTF 2JP1A 3S16H 2ZTDA 5JJZA 2O5IC 3DWPA 4JW0A 2KHSA 1CK1A 4LF4Q 1QVFA 1SMYC 1B9NA 4A3CG 1RCVD 5AJ3L 1ICFB 2ENBA 4P72A 1HJPA 2UUCQ 5FLMH 2H5XA 2JA6H 1EQRA 1A62A 3GTLB 2KCMA 3PF4A 4A3FB 1VQGA 2HCIA 5M5WH 1LT4D 5C4JB 5T1GA 3OHXC 1FNWA 2CQAA 2K01A 1SNPA 3DLLA 2IHFA 3GTMH 4C56C 3RUZA 4DR5Q 4I7AA 5C0XG 4DV6L 1HFNA 2G5DA 3GP7A 3QJYA 1JE5A 4ME3A 1GHKA 1XNRL 3BJUA 4A3GG 1K3BC 2K5VA 3TZDA 1C7YA 3I91A 3PO2G 3P75A 3CCRA 3GTJB 3K58A 1FJGQ 1RIPA 2XRSD 1N36Q 1VQ4A 1ZYRC 2ZT9C 3I2ZA 5CGKA 2H1EA 3HKSA 5D3IB 5CC4A 1XPRA 3EQLC 2F0PA 3EJIA 1PYWD 3W1BA 1D8LA 5J3BA 2E2DC 2I5LX 2UXCL 2EYHA 2EYJA 3LGJA 4A76A 4C3IB 4DPGA 3F1ZA 1L1OA 5C4HA 4RFBA 3UDXA 3NPPA 4DR4Q 1Y8OB 1EYDA 2CH4W 4KN7C 1Y8NB 2JA7G 4XYQA 1C4QA 5EJWA 5LMNW 4C3HB 1WI5A 4QQBX 1STEA 1AE3A 3FHWA 2F0SA 4JI3L 3M9BA 5I2YA 2HCCA 2X6GA 4IFDI 2PI2A 3D0FA 3K5LA 4ZKCB 4A93G 4X66Q 1G2SA 4H13C 1ZKOA 3M4PA 3TBIB 4BWGB 3D31A 1BCPC 2KEDA 4OIJA 1V9PA 1WTOA 1LACA 4A3BH 2AMCB 3S24A 3AU7A 4K5XA 1TWFH 1CKMA 5KNBA 4DV3Q 5IGEA 1K8MA 4EQPA 1DD2A 4YIJA 4BA1I 2QKIC 2GVBA 1IBML 5IYCH 4YHHL 2UXDQ 4RHSA 4XYOA 3S9WA 3AFPA 1UE5A 1CKNA 1VQ5A 3J7AV 1FL0A 1SE8A 1X6OA 4WJ3M 5E4WC 5IIFA 1Q7YC 2FMCA 2F0UA 4BBSH 4BY1G 1X3FA 4C3JG 3KFUA 4XT1B 4A3IG 2OQKA 2KJXA 3BS1A 4A3GB 1BO0A 3PO2B 1Y14B 4M8AA 3V2TA 4BY7H 3PO3H 4FYDA 2PZWA 5FLXc 5DAUA 3VR6A 4RWSC 1JT8A 1KC8C 3IRBA 1TWCB 2R6GA 3MHBA 5IOCA 1X32A 3ND9A 3GTQH 1TWAH 2ZXRA 1IYJB 3LX0A 2WKCA 5CV9A 4OWXB 2K4KA 4HSVA 3T56B 1AP0A 2ICIA 1SR3A 2BH2A 3VA5A 3I4OA 1LTGD 1JJ2A 4HIKA 1TWHH 5CV7A 3FP9A 5DM73 2JA7B 2EY6A 4GKJQ 1LUZA 3L2PA 5I6YA 2G9HD 2L55A 1SYDA 4A93B 3K59A 3ULLA 3AEVA 2NTSA 5LMNQ 1OXTA 3OMCA 1HHVA 2F0HA 1AW7A 1U4LA 1E3PA 3F2BA 4DUYQ 3HOXG 4X3KA 1STAA 1HNXQ 1D5XC 3KDFB 1PH7A 2E75C 5CBAE 4U673 3OW2A 2K7VA 3OTOL 3I72A 3ONAB 3UE0A 3U58A 1YJ9A 4J15A 4DXGA 1VQPA 3FPPA 3CP0A 3GDEA 4P73A 3J81j 2IL8A 1BF4A 4R4IA 2HIXA 1Y69U 2JA5H 1CFMA 4POGA 2F0NA 3URYA 4UDUC 4AIMA 4N8X1 3PV0A 1YI2A 1M4VA 3J7ZC 1AZPA 4MTKA 1D1IA 1YEZA 1JICA 4XT3B 3GQBA 2J0TD 4DUZL 3GV3A 1Y1VH 4BY1B 2F0VA 3G6JB 4C3JB 4DGZA 4A3IB 4GKKQ 4GLAC 5IP9G 1CQFA 4DV4L 1L2FA 4JYAL 4FF1A 2B2VC 2QCPX 5IE8A 2BDOA 1Q90A 4GOPB 1U9RA 4IQZA 1ET6A 3A8KE 2D62A 1SYGA 1U4RA 3DHQA 2XSCA 4AH6A 1K83H 4KY7A 2L11A 2EPBA 4MNOA 4DV1Q 2K52A 3TZUA 1HA5A 5IGGA 4A75A 4JPBW 2IY5B 4RAUC 5CR3A 1LV9A 5C4XG 1SROA 3D4DA 3NQTA 4LF7Q 1EY6A 4FXKC 3CRLC 1C8CA 3AQQA 3PUYA 2OWOA 3W5OA 1PZID 3QG1A 1E1OA 3R2TA 3MC0B 4O1NA 3ND8A 1N33Q 1BVSA 4OO1H 3SDZA 1XX8A 3VR2A 3T1HL 1FYCA 1B7YB 3U4ZA 3O13A 3CCJA 3HOXB 5I4DA 5EPLA 3GTGH 1WTRA 2L9HA 2UU9Q 3HOYH 4EQOA 1FNVA 3CCMA 1EOTA 1I3QH 5ELBA 3GTKH 5J22A 3I56A 2NZOA 2HIVA 3SVMA 1FD7D 1IXRA 3EIVA 3K0YA 4IUNA 1AEXA 1ET9A 5M5YH 3VYUA 4YY3Q 3IFTA 2UXBQ 4QUFA 1BDOA 2JSOA 1V1OA 1TVXA 2VXWA 4IALA 4LAAA 4JI1Q 1HZBA 1IW7C 3MA2B 2JQOA 3K7UC 1VQDA 4QIWE 2JEAI 3M4OB 3S2HH 1B53A 3I4NG 2NBFA 2N55A 2F0GA 3K8AA 3I3CA 2ZJRA 1VS0A 1AH9A 2CCZA 2A6HD 3E0JA 2WACA 3KF6A 4IPGA 5ELEA 3JAML 3RLFA 4MN3A 4JBWA 1A63A 3K5NA 1NMFA 2D5DA 1XTDA 1QNUA 3KJPA 1NTGA 1W3SA 4G7ZC 4DR6Q 2L15A 1RTNA 4HIOA 3T51B 5KRUA 2JA8H 2QILA 5JVH3 2AQ3B 2A73B 4XTCS 2GVAA 1MHWC 4Y7NH 4BA2I 2F1MA 4C1NI 3OW7A 1NSNS 4JI4Q 3PUWA 2YTVA 3SXHA 4H44C 1H9SA 2F0IA 5C4XB 4YWLA 5IGBA 3L3OC 2WKDA 1LT5D 3H09A 2KECA 1GKHA 3FKIG 4HR7B 4OX9L 1G51A 1ICWA 5C6AA 1TY0A 2PMZE 2BOSA 4CJ2C 1E0BA 4K8JA 2V1CC 4JI7Q 1V1QA 2N88A 1CI3M 4ID6A 2ZTCA 2L4NA 1QOHA 2EXZA 1Q81C 5EKIA 4LF8L 3K6OA 4LFAL 4FF2A 4MTNA 1RJTA 1HR0Q 2IJ0A 4DK6C 1GJXA 3T1YL 1SNCA 3CCVA 3OPOA 1VQ6A 2NVXB 1ZEQX 1FVIA 2J4XA 2YTYA 3J7AF 4B3SL 1MI2A 3AMUA 2CH4A 4JK1C 1B44D 2ZM6L 1EYGA 1EWIA 3GD7A 1KDBA 3VYSA 1X3QA 1UE1A 2N8NA 4G57A 3CAMA 3I4NB 1IYUA 4JI6L 1AE2A 4HMIA 1Q8IA 4APVA 1SFOB 2LY7A 3KOJA 4R4QA 1BOSA 4R4CA 1VQCA 4KMUC 1YIJA 4DAMA 4UP9A 4AQYL 1G291 4O42A 5G3LF 3EBEA 4GNXA 4DXFA 3CC2A 2MJ8A 2LXKA 2YTXA 4JVZA 1KD1C 4L5SA 3I4MH 2DY8A 4WORA 1CHPD 3A0JA 2UUBL 1V1PA 5JPMC 1JR0D 4ILWA 1I94L 1VQ8A 2NUCA 5EGTA 2RF4A 4OL7A 4RGNA 4V0BA 3UE1A 2E2IH 4IUPA 1PVOA 4EVOA 3I7FA 3NTKA 1GHJA 3FRPB 3ITPA 1EOVA 2KCTA 4FXDA 1K0RA 2CW0D 3FKIB 4ZQ3A 2DY7A 2DNEA 5D65A 4XQQA 1EIFA 2R7ZG 3MWYW 5EKKA 1VQLA 3HZXA 1ENCA 2E2HH 2NVTB 3FDTA 3BDOA 1CA5A 4IJHA 3Q6SA 5IT9E 4IURA 2AQ1B 2O5JC 2IWHA 3PIP3 1SYEA 1IL2A 3RMHA 2MGSA 4X64Q 1M1KC 3CPFA 4JI8L 3TMEA 4OIKA 4LF9Q 4TRDA 1BKBA 4JI0L 1QCBD 2E2JH 1J6QA 1B9MA 1I50B 1X65A 3J81E 3SK4A 1XJVA 5KIXA 3OIPA 3PMFA 1XMOQ 1LLRD 5M3MH 4DAYB 3CQZH 3ULJA 4BS9A 5JEAH 3S1MH 3Q8DA 2Z4IA 3STBC 1YITA 3VDYA 4N9PA 2NZ1D 1J8IA 2A69D 5JJIA 1IBKQ 4DR2L 3QOJA 1I4GA 2K33A 1EQTA 2VS1A 4WJ4A 2B2TA 1W6JA 1PH4A 3S2DB 4KHZA 1KHIA 2EYOA 1F2YA 4OELB 4LFCQ 3H15A 4JI2L 3PIO3 4NXNQ 1TY2A 4K5VA 4KD4A 4PQXA 3RZDH 1N32Q 3M4QA 2IX0A 3R93A 3M3YH 2ZXOA 5FO7B 4A3EG 1PH6A 1LYLA 3A8IE 3CCLA 4DR1Q 1BNZA 3K81C 4WRDA 1E2WA 4IFDJ 1LT6D 3J80E 4L5QA 2FJ2A 4OONA 4DR7Q 1K3RA 3KBXA 2Z4HA 1ILPA 4YCVA 2E76C 4C2MH 4KLKA 1GUOA 2PW7A 1STNA 2Q2IA 5I2XA 1CHQD 1NMGA 3A7LA 4PG3A 1S4ZA 1K9MC 3H0GH 4GLVB 2LKVA 3U9SA 1SLJA 3EROA 3P20A 2DUDA 4NPSA 4A3JH 4J1MA 1NJIC 5IGDA 2R7ZB 1Y1WH 3A8JE 1SMYD 2Y0SG 1STHA 5JOBA 1V8QA 5FJ8G 4LUZA 1KDAA 4C3HG 2K50A 3DM1A 3HRZC 2EY1A 4RH6A 4UAIA 2NVYB 1D7QA 4YCUA 5GQOA 3RZOH 2K1BA 5GAHC 3DWAA 2Q2UA 1TS3A 4DFAA 1I6HH 4JV5Q 1WTHA 3M4YA 4LK1C 3NWTA 2DGYA 1CM9A 2R92G 2XGTA 3L9AX 1SDFA 4GZYC 2NB0A 4KK7A 5IP7H 2WB1E 3U4VA 2OCEA 1HA6A 3TSSA 1D1KA 3Q0AA 3TN2A 4CDDC 2NWGA 2B63G 3IL8A 3AYHB 4KHPQ 1DONA 2PW5A 4XIGS 4CHTB 4ZYSA 4IUUA 2OTJA 1CKOA 2GN5A 2L1BA 4DA2A 2WFWA 4LFBQ 1WCMG 1ZYRD 1JB7A 3HFZB 2N78A 3I4LA 5CV4A 2HHHQ 4LMQD 2XVSA 1XMQQ 5C3EH 4QGUA 4A3EB 4GN4B 3K7AB 2R61A 2AHOB 1BQQT 2Z8LA 1QJOA 3S1RB 4Z9CB 1C0AA 1CSQA 3SEBA 1EEFD 2E8GA 5JJKA 3RD4A 2SDFA 4RG1A 1JWUD 1OXSC 4PZ8A 2EY5A 2N49A 3KF8B 5FK9C 4DV0L 3RN5A 3GTLH 3V96A 1RDPD 1YZ6A 3RN2A 1TT2A 3TP6A 3A5ZB 3GTPB 3CMEA 4A3FH 1HZAA 1OTCA 1YNXA 1ASZA 3D4RA 5C4JH 4X3UA 1I4QA 4QY7A 2Y0SB 1E24A 2PCFB 3SGIA 1E2ZA 3C1FA 4CKCA 2F3IA 5CBEE 1SNMA 3RLOA 4PZ7A 3NK9A 4B9XA 2B2UA 4JBMA 4JI5Q 1EZ6A 4CJ1B 2NYZD 1JOQA 2L0CA 3NBHB 5L37A 1VQOA 2Z6BA 3GTJH 3LNNA 3OYYA 1NAPA 4DV5Q 3HOUG 2R92B 4X62Q 4NB3A 4B3ML 2K5QA 1UEBA 3KLSA 1ZXTA 4NXML 4ZK9B 2ZJPA 2YU9H 1QUQB 1IKLA 4L5RC 5KYIA 4LW1A 1JCKB 4A3MG 1PH5A 2C35B 1G91A 1PTOB 1VQBA 2B63B 4DV2Q 1F9RA 4C3IH 4JC0A 3U9OA 4A3LG 3A74A 4QL5A 4DF7A 2PNHA 1YJNA 1WCMB 2IHEA 4L63B 3CW2C 1Z9FA 1WYDA 4H7BA 2VY3A 1WTWA 4C3HH 1ESFA 1LTSD 2Q2TA 1DOLA 4NDXA 1O7ZA 4K0KL 5BR8L 4GN3B 3R3OA 3S1NB 5AJ3Q 2E74C 4DNIA 1IZ6A 2K03A 3W2DA 2FFKB 4PMCA 2I5HA 1LABA 1L1OC 1YHBA 1KQSA 3V05A 1XTCD 1RTOA 3H6MA 2B3GA 1O7IA 1F77A 4A3CH 3HOZG 1EY7A 4IO9A 2B2UC 1EQVA 2RVLA 1GOZA 2YV5A 2XNAC 1EQQA 4IFDG 5KYLA 5M3FG 4DV1L 1X56A 5LMUL 3PCOB 4EQNA 4MZ9A 2QEXA 3R8BA 1PTOF 1WTVA 3NHHA 3S15B 4DV6Q 1CUKA 1CT1D 2Q8IB 1O7LA 1XNRQ 5JAVA 4HJAA 4PV1C 3S1QB 2R93G 1EFID 5BN4A 3KJOA 5C0XH 1DOMA 3QWNA 1PA6A 1FNUA 2B2YA 4R1JA 4BBRG 1SE3A 3EN2A 4A3GH 1GUSA 2JJQA 3TP8A 1VQNA 4FDBA 3PO2H 4U68A 2MHVA 1WVLA 1WTXA 3QR8A 2WAQG 1TWGB 2F0TA 4A3DG 2UXCQ 2JEBI 4RGMA 3HOUB 1PRTC 2BE5C 2EDGA 3F8TA 2G9DA 2OF1A 3BYYB 1TWCH 5DLQE 3K5MA 4FF4A 5E4XA 2JE6I 2NN6I 4A3MB 1WOCA 1B1ZA 5ELDA 1Q82C 1EYCA 1I4XA 4OXPA 4YY3L 1PH2A 4JI3Q 4GN5A 2B8GA 1JC7A 4MIUA 3BDLA 1KIXA 1AZQA 5ELOA 5COYA 2JA7H 3SK8A 1BCPB 5EBDA 1IBLQ 1QZGA 1NBWA 1RODA 1Z7TA 2F0KA 3KK7A 1PH8A 2WB1G 2FMMA 1K8GA 2K5NA 4A93H 2JK8A 4OEMB 5G3LD 1RL2A 5GAGC 1ASYA 3H3VH 3OWFA 1PFBA 1EFWA 4RKLA 5JVG3 4H02A 5IYDG 1M90C 3HOZB 1T9HA 4RGTA 1IBMQ 1HNWL 4IUTA 1HNZL 4HIMA 2EYLA 4KKUA 4YHHQ 5E1FA 1VF7A 1HXYD 5M3FB 5IYBG 2E5LL 1L1OB 2K05A 2HQLA 1SYBA 2NN6G 1GO3E 2R93B 1U4PA 4K14A 2Z1CA 1C9OA 1D5ZC 1I4PA 1RD9D 1BCPF 1F2LA 2NVQB 4BY1H 4BXXG 2KCNA 2H4OA 4C3JH 1L0WA 4JOIA 4A3IH 5IT9L 5A35A 4BBRB 3MXNA 3L7ZC 1Y8PB 1HR0W 3TREA 1YNJD 2CVRA 5KNDA 1HH2P 3NQIA 3CPWA 1NE3A 1I4HA 2WAQB 1PFMA 1JMCA 4A3DB 1YBYA 1CTMA 2VQFL 2TMPA 1A15A 4RHRA 2KUMA 3EA6A 4IFDH 3J81L 1F2ZA 3Q24A 4OWTB 3KLWA 3G7LA 4EX5A 4KN4C 1O80A 4K6DA 3VYTA 2MUYA 3DMUA 3NENA 5C44G 4B3RL 2FHTA 3C3LA 2D0OA 3GTOB 1PLFA 2PQAA 1S5CD 3JAMi 1NUCA 2SOBA 1ENAA 1PRTB 3OWEB 5LHY1 1CKNB 1VMPA 2CWPA 4AYBE 2F4VL 5C3XA 2B29A 4GS3A 3BVGA 3HKZE 2F3WA 1YNND 5IWAL 2F0OA 5E7NA 2M2LA 2WB1B 1N34L 1VMCA 2O2LD 1S5BD 3C46A 2VUMG 5IY0A 3JAMc 3NEMA 1XNQL 1EL0A 3AFQA 1CZGA 2B2WA 5ISRA 1GM5A 3ERQA 2FXQA 2J7ZA 2EYFA 2DJFC 1VQAA 4X65L 4PNYA 3HOXH 2QDLA 3NTHA 4ZKBB 1DJRD 3RNUA 2IX3A 3J80L 4LF5L 3D6CA 5A2QE 3FPUB 2A8VA 4P2CB 3BDCA 4F88A 1JJCB 4FP5D 4DN4M 2UUAL 4A3KG 1K0SA 1DCZA 4CJ0B 3D8GA 3W3AA 4NMZA 4DUZQ 1A3TA 4R8NA 1R4PB 4O0AA 4B3TL 4QMGA 2CHBD 2F0DA 2K32A 4JG2A 3Q22A 3HOVG 1Q1BA 1EZ8A 4DV4Q 3M4OH 1PRTF 4JYAQ 1S72A 1KNAA 5EAYA 4LF6L 5FLXE 1Z6HA 4X64L 1B3QA 2EVBA 5IP9H 1PFNA 4ZRZA 2MQHA 4TSSA 4HEDA 2R7FA 1STBA 2A68C 3HOWG 1E7ZA 5KNCA 1KAWA 3I8ZA 2ALYB 1M8AA 1SYCA 4N9TA 4CKBA 1HQMC 4QUCA 4QJFA 4CBVA 4DR3Q 2EOTA 4QB4A 5C44B 4R4TA 1KLUD 1F9QA 3I73A 2IW3A 5CORA 4ALPA 3PQIA 3K5OA 2KVMA 3VA7A 1ILQA 2WINB 5C4XH 1QZHA 4E6IA 1BXTA 1J5EL 4KJNA 2ZTEA 4YCWA 5JEAJ 3QOLA 4ME5A 1U0LA 2AUJD 3T1HQ 1HTPA 2KBNA 1R9TB 2VUMB 2WV6D 1EU4A 1DZ1A 1YVCA 2F3VA 1SEBD 3BZCA 1PDQA 1JQYD 2ICEC 2IPKD 2WIIB 1L0XB 2EIFA 4DAPA 3S17H 4ODGA 1PH9A 1L0YB 3B6YA 2MO0A 2Q2HA 3IKJA 2JA9A 4HJ8A 2F0WA 1K73C 3SE0A 2NVXH 2VQEL 4FNFA 2KCCA 4A3KB 1N8RC 2A6EC 1MBYA 4P71A 5BN3A 1KNEA 3MAQA 1JOKA 3HOVB 4DV7L 5AFWA 5T1IA 1MSGA 1LTBD 3NE5B 1SJHD 2KHJA 3I4NH 4K2KA 5K5PA 3A55A 3K80C 1NR2A 1SFOH 2RKSA 1GUTA 3G4SA 3OIQA 4Q5VA 1TS5A 2KQ3A 4JBJA 3HOWB 1QVGA 1D5MC 1STYA 4I7ZC 1JWMD 3QB3A 4FVMA 2X6LA 5FLMG 2DN8A 2RCNA 2JA6G 1SAPA 4LF4L 4HSPA 1TIID 1KDCA 4OX9Q 2A1AA 2UUCL 1A2UA 5HURA 5LL6S 4GNXC 3EVQA 4YWKA 4CDEC 3QIAA 3FKIH 2L12A 3DEOA 1S40A 3CCSA 1F9SA 4LF8Q 3ZJYC 2NVTH 4LFAQ 1A8VA 3OMGA 3NTIA 4A4IA 4HTHA 4IPDA 3T1YQ 3KF6B 3WDNA 4DR5L 4HIDA 4ZCKA 1XPOA 2K04A 3NELA 4ZUIA 3S14B 2QW7A 1JJGA 4WJWA 5K36G 4B3SQ 1JWSD 1NCVA 1X9NA 2ZM6Q 1I50H 1SBBB 4AYBG 1FJGL 1P16A 2BDNA 1WD0A 1N36L 2F0QA 3HKZG 4K5WA 1GXDC 2RDHA 2BA1A 3MXGA 5M5XB 4IN3A 4F8MA 1E22A 4OHJA 1PTOD 4F7XA 3NSWA 1JE4A 4JI6Q 3WWVA 3CRKC 1SN8A 1H9SB 3MFYA 4NW2A 1QE6A 4L8JA 1RKNA 4AQYQ 2RQXA 3S2DH 4DNRB 4DR4L 2PZUA 4RCOA 3E6ZX 5CV5A 4JBKA 4L5TA 1EWHA 1CQVA 1V43A 3S16B 3T4AC 2UUBQ 2RBMA 4KJOA 1I94Q 2QF7A 3A7AB 4A3BG 3D4WA 4X66L 4QCLA 1EY5A 1XXGA 3OSOA 2B2TC 2JA6B 3TS0A 2X69A 5E3FA 1S5FD 3CCQA 1HQRD 1PZJD 2JXMB 3F2UA 5IYCG 1SJED 3J7YW 5M5WB 1VQ7A 3X3NA 4DV3L 4TKOB 3MEHA 3Q23A 2ES2A 4KKTA 2SNMA 1SYFA 1VQ9A 3BVZA 1QWYA 3GTMB 5ELFA 1HPCA 2BCOA 3CCEA 2RHQB 3MXPA 4BBSG 1RF2D 2HUGA 2R7ZH 2UXDL 4G7OC 2QGQA 4JI8Q 1LO5D 4JI0Q 1IKMA 4I65A 3ERSX 2PZTA 4BY7G 3PO3G 4RA8A 1E1TA 3HEJA 1GD7A 2NVYH 1G2TA 2M00A 3CD6A 3DEPA 3KDFA 4GNXB 1I5FA 4AYBB 2EY2A 4IPCA 3NP8A 1W6KA 2P5ZX 1V1PB 3HKZB 4LUOA 4DR2Q 4QIWB 1D6EC 1EY4A 1ENFA 5I6WA 1AN8A 2RA4A 1EU3A 3H3VI 1JORA 2XWBB 5IGCA 3P7JA 3NWSA 5I9OA 4JI2Q 2KEEA 4NP5A 5JJLA 3N6RA 3M85A 5FO9B 5I9PA 3IAYA 4DK0A 2F0JA 3E3XA 1D2BA 1BCPD 1H9MA 3VR3A 1A0IA 3I90A 1TS2A 4GKJL 1A3VA 2K28A 3BZDB 5EQ0A 2XRQD 5J39A 1B3AA 4GOPA 3DXJC 2HQEA 1B50A 4A3EH 2YU9B 4A3BB 5K36H 3K7AH 2PYKA 4IPHA 4UP7A 3WOFA 3S1RH 5LMNL 1TWFB 5F2DA 2VB3X 2D0PA 4DNTB 5C0XJ 5KGUA 1BBWA 3H3VC 4DUYL 1KRTA 4FXGC 3VYRA 1HNXL 1VF5C 1BBUA 2JA5G 1C48A 1TU2B 2PPBC 2EYMA 4OO1I 4PZ6A 2PMZB 3HGBA 4LNQA 1VQHA 4UY8C 5DNFA 2AKWB 4L6TB 4B08A 4EGVA 3GTPH 2VW9A 3KYHC 3L0OA 5EKLA 4BBSB 1Y1VG 2KA7A 4B9WA 1VQEA 1SNOA 1IBLL 5FJ8H 5CV6A 1X3GA 3PO3B 4BY7B 1HUNA 1LTTD 3MEFA 2EXDA 4KHVA 2A19A 2ZXPA 3PIPA 1PFSA 3CHBD 3F2CA 2HDMA 3FVQA 4GKKL 1WFQA 1EY8A 4O2DA 1K8AC 3GTQB 3CMAA 1WTPA 1TWAB 1X3EA 1P8LA 2R92H 5HGTA 1I4RA 4UP8A 1J9OA 1O78A 3TS2A 1IL8A 2WP8J 1HTLD 1Q3LA 5D3DA 5A2QL 1SXTA 3NUCA 1TWHB 4GOPC 1LTAD 1KL9A 2MNAA 1EYAA 1PTOH 2B63H 2F52A 4GLXA 1FGBD 3UDFA 2XIWA 3E5SA 2ATWA 3CC7A 2N3SA 5DM63 3KLRA 3A56A 2AQ2B 1LTID 2F0FA 1UE6A 1WCMH 3M7GA 3MXUA 3T13A 1PRTD 3VR5A 2BE5D 1G6ZA 2ID0A 1MKHA 4LF7L 4OO1G 1PYSB 2YYZA 3T53B 2HT1A 4Y52H 2AUKA 1MGSA 1BUVT 2EYPA 3TQYA 2CWAA 2MP1A 3PIOA 3S1NH 1EEID 4EQ5A 5FLXL 1SSOA 1N33L 3HOYG 3I55A 5EBCA 4R9WA 2KOLA 3TP7A 3X3MA 4DV0Q 4FF3A 2M9VA 2JYOA 3CU7A 4R4OA 1SNDA 3RR5A 3JC66 4TVAB 2UU9L 3PUVA 5C5LA 4HMJA 2K6AA 2MFIA 1VDZA 2B2VA 2MO1A 4OGQC 2JA5B 2EQSA 2C5CA 4ULLA 4IOCA 2I5MX 1TKWB 5C5MA 3S15H
chains in the Genus database with same CATH topology
1X65A 1VQKA 2K5VA 2NZHA 5HGQA 4A3KG 1C7YA 2OTLA 1XJVA 3PO2G 2UXBL 4X6AH 3CCRA 1TXYA 4DUZQ 1XMOQ 1B8AA 1WJJA 3S1QH 5M3MH 4DAYB 1RIPA 2KENA 2R7DA 3CQZH 4YWMA 4O0AA 4JI1L 3ULJA 3W1GA 1VQ4A 1UWVA 3Q8DA 4B3TL 3S1MH 4JG2A 3HOVG 3I2ZA 1Q1BA 3STBC 4DK3C 1YITA 3VDYA 2BA0A 3HKSA 1YJWA 1XPRA 4DV4Q 4B3MQ 3M4OH 2LSSA 3W1BA 4JYAQ 1IBKQ 1D8LA 4NXMQ 5JJIA 2OQ0A 5J3BA 2I5LX 4DR2L 1S72A 1H95A 2UXCL 5EAYA 3U50C 2VS1A 3LGJA 4A76A 1YHQA 1PH4A 4LF6L 4WJ4A 4DPGA 1TWGH 1OXUA 4KHZA 1KHIA 4X64L 5IP9H 3F1ZA 1L1OA 3HOUH 4JCVE 3G6EA 3UDXA 2MQHA 2LXJA 2JA8G 4LFCQ 2R7FA 3H15A 4JI2L 4DR4Q 3HOWG 1E7ZA 4NXNQ 3A5UA 3RZDH 1KAWA 2JA7G 4A3MH 4DR6L 1N32Q 3M4QA 2IX0A 5LMNW 1WI5A 4QQBX 3M3YH 1AE3A 3FHWA 2ALYB 4JI3L 3M9BA 4A3EG 1PH6A 1LYLA 4LUVA 4IFDI 2PI2A 4A3LH 1OXVA 3D0FA 4QJFA 4A93G 4DR3Q 1PHJA 3CCLA 4X66Q 4DR1Q 4JI4L 4K0KQ 3K81C 4IFDJ 1PH3A 5BR8Q 1CSPA 4R4TA 4L5QA 3M4PA 4OONA 4DR7Q 3D31A 1K3RA 4ALPA 1KRSA 4YCVA 4C2MH 1V9PA 4KLKA 5C4XH 2Q2IA 4A3BH 1NMGA 1QZHA 1J5EL 3J81i 2AMCB 5IT9c 4PG3A 1K9MC 2ZTEA 4YCWA 3H0GH 3S24A 4GLVB 5JEAJ 1U0LA 3T1HQ 1TWFH 1CKMA 1SLJA 4DV3Q 2DUDA 4NPSA 4A3JH 3K0XA 2KBNA 1NJIC 3CXCA 1Z47A 2ASBA 1YVCA 4JI7L 4BA1I 1X55A 3BZCA 2GVBA 1Y1WH 1IBML 2KHIA 3UDGA 5IYCH 5LMUQ 2Y0SG 4YHHL 3J81c 2UXDQ 3BZKA 5FJ8G 3HOZH 3AFPA 5GADC 4LUZA 1HR0L 1UE5A 1CKNA 1VQ5A 2EIFA 1FL0A 1SE8A 1X6OA 2K50A 4DR3L 3S17H 4WJ3M 1PH9A 3B6YA 2MO0A 1MJCA 2Q2HA 5M3FH 2JA9A 1Q7YC 1U5KA 4YCUA 4HJ8A 1D7QA 5GQOA 4BBSH 3RZOH 4BY1G 5GAHC 1X3FA 1K73C 2ZJQA 2A8VA 1VCIA 2NVXH 2Q2UA 3KFUA 1I6HH 4JV5Q 4A3IG 2OQKA 2VQEL 1XPUA 3E9IA 1Y14B 1N8RC 2DGYA 2R92G 4BY7H 3PO3H 2XGTA 4P71A 1VQJA 2R93H 4PMWA 2K5HA 2WB1E 3U4VA 5IP7H 2OCEA 5FLXc 3G48A 3J7A5 1JT8A 2AWNA 4DV7L 1KC8C 1MJEA 2NVQH 3IRBA 2R6GA 2B63G 3J80i 3AYHB 3ULPA 4KHPQ 2KHJA 3GTQH 4BBRH 3I4NH 1TWAH 4XIGS 4DKAC 1IYJB 4OWXB 1CKOA 3K80C 2OTJA 2K4KA 1SFOH 3I4MG 2GN5A 3ER0A 2WFWA 1SR3A 2BH2A 4LFBQ 1WCMG 1SMXA 1G6PA 3I4OA 4A3DH 4TQUS 3G4SA 1JJ2A 3OTOQ 1JB7A 4HIKA 1TWHH 3FP9A 3HFZB 4JBJA 3J80c 2N78A 1QVGA 1LTLA 1MIUA 4GKJQ 2HHHQ 1LUZA 3L2PA 1XMQQ 1NY4A 5C3EH 4QGUA 1QVCA 4GN4B 5FLMG 4IJLA 4JOIC 2AHOB 2RCNA 2JA6G 3GTOH 4LF4L 1C0AA 3ULLA 1EUJA 1CSQA 1VQMA 1VQIA 3AEVA 4OX9Q 2E8GA 1Q1EA 5LMNQ 1OXTA 5JJKA 3PSIA 4RG1A 2A1AA 2UUCL 3M7NA 1OXSC 1E3PA 4PZ8A 3F2BA 4DUYQ 3HOXG 4GNXC 4YWKA 2N49A 1HNXQ 3KF8B 4DV0L 3KDFB 3RN5A 3FKIH 3GTLH 1PH7A 2CQOA 1YZ6A 3RN2A 3OW2A 3OTOL 1S40A 3A5ZB 1HNWQ 3GO5A 2Y0SE 3UE0A 1Q46A 1HNZQ 3CMEA 3CCSA 3U58A 4J15A 3ZJYC 4A3FH 1HZAA 3F2DA 1VQPA 1YJ9A 1YNXA 4LFAQ 1OTCA 1ASZA 2NVTH 1A8VA 3CP0A 5C4JH 3GDEA 4P73A 3J81j 4A4IA 4R4IA 4IPDA 5IYDH 1HZCA 4QY7A 3T1YQ 4LF9L 3KF6B 2HIXA 5M3MG 1E24A 4DR5L 2JA5H 4POGA 2VNUD 5JEAG 3SGIA 2E5LQ 4HIDA 4AIMA 1XPOA 3PGZA 2F3IA 3NELA 3PV0A 4PZ7A 3RLOA 1YI2A 4JBMA 4JI5Q 3J7ZC 4A3GG 1YEZA 5K36G 3CF5A 4B3SQ 1JJGA 5IYBH 2VZAA 2ZM6Q 4DUZL 1I50H 1Y1VH 1XMOL 4AYBG 1X9NA 3NBHB 1FJGL 1P16A 1N36L 3HKZG 1VQOA 3GTJH 4GKKQ 4GLAC 2BA1A 3OYYA 4DV5Q 5IP9G 3HOUG 4X62Q 4DV4L 4NB3A 4B3ML 1L2FA 1UEBA 1E22A 4JYAL 1IBKL 4NXML 4JI6Q 5IE8A 3WWVA 2ZJPA 2YU9H 1QUQB 1SN8A 2BH8A 3PF5A 4L5RC 4GOPB 4LW1A 4A3MG 1PH5A 2C35B 4BXXH 1VQBA 3CCUA 4DV2Q 2VQFQ 5GROA 2D62A 4AQYQ 2UUAL 3E9HA 4C3IH 4JC0A 3S2DH 4A3LG 4LFCL 1Q8KA 3A74A 4AH6A 4DR4L 4QL5A 1K83H 4NXNL 1DGSA 2PNHA 4MNOA 4JBKA 4L5TA 1YJNA 1N32L 2IHEA 4DV1Q 1V43A 1FGUA 2K52A 3BU2A 1PV4A 2UUBQ 3CW2C 1Z9FA 1WYDA 1N36Q 2VY3A 4A75A 2IY5B 4C3HH 1I94Q 4B3RQ 1YHAA 1N9WA 2Q2TA 5C4XG 1SROA 4A3BG 4X66L 1B70B 4DR1L 4LF7Q 4K0KL 1X54A 2AWOA 3H0GG 3AQQA 4GN3B 5BR8L 3PUYA 5AJ3Q 2OWOA 3W5OA 1OXXK 4A3JG 1PH1A 2F4VQ 4DR7L 4DNIA 5C44H 1IZ6A 3TS0A 4P75A 1E1OA 3CCQA 2I5HA 5IWAQ 1L1OC 1YHBA 1KQSA 1N34Q 1Y1WG 1N33Q 1BVSA 5IYCG 2B3GA 1O7IA 1VQ7A 3T1HL 4A3CH 3HOZG 3U4ZA 1B7YB 4DV3L 4IO9A 2ES2A 1XNQQ 1VQ9A 3CCJA 2YV5A 4IFDG 1EQQA 3GTGH 2UU9Q 3CCEA 5M3FG 1R9TH 2VUMH 3HOYH 1S3OA 2RHQB 3CCMA 1I3QH 4X65Q 4DV1L 1X56A 3GTKH 4BBSG 5LMUL 3PCOB 2R7ZH 4MZ9A 2QEXA 2UXDL 2QGQA 4JI8Q 2NZOA 3I56A 3MXNB 2HIVA 1IXRA 4DV6Q 4JI0Q 4LF5Q 1CUKA 1W2BA 3EIVA 2IX1A 3ERSX 5M5YH 1XNRQ 4BY7G 3PO3G 4YY3Q 2CFMA 2UUAQ 1LM0A 3STBD 2UXBQ 4HJAA 1E1TA 2R93G 5IP7G 5ELNA 1GD7A 2NVYH 3KJOA 4JV5L 3CD6A 4JI1Q 1HZBA 3KDFA 4B3TQ 4GNXB 1I5FA 1EIYB 2JQOA 3K7UC 1PA6A 1VQDA 4QIWE 2JEAI 2CKZB 3S2HH 4R1JA 4BBRG 3EN2A 3I4NG 4A3GH 4A3KH 2JJQA 4IPCA 1VQNA 4FDBA 3PO2H 1Q86C 3K8AA 5GAEC 2ZJRA 4LUOA 1VS0A 2K14A 2WAQG 4DR2Q 1AH9A 5HY6A 2CCZA 4A3DG 2UXCQ 2JEBI 3KF6A 1PYBA 4IPGA 4LF6Q 2PQAB 3F8TA 3H3VI 3PUZA 3HOVH 4KHPL 2K75A 3RLFA 1A63A 1TWCH 4JBWA 5DLQE 1NMFA 1XTDA 3KJPA 1NTGA 2JE6I 2NN6I 1WOCA 1GVPA 1W3SA 4JI2Q 5JJLA 4LFBL 1Q82C 1UE7A 3DM3A 3UDIA 3M85A 2RHSB 5C3EG 4DR6Q 4OXPA 2L15A 4YY3L 2QA4A 1PH2A 4HJ9A 4GN5A 4HIOA 4JI3Q 2XTIA 2JA8H 1A0IA 4XTCS 2GVAA 4GKJL 4Y7NH 1KIXA 2HHHL 2Z6KA 5ELOA 3HOWH 4BA2I 1XMQL 2VL6A 4JI4Q 3PUWA 2YTVA 1Q12A 2JA7H 1QUQA 1KXLA 1IBLQ 1QZGA 4GOPA 1NBWA 1PH8A 4A3EH 3K7AH 4YWLA 2WB1G 4HJ5A 1K8GA 2K5NA 4A93H 3FKIG 1GKHA 4IPHA 2JK8A 4UP7A 3S1RH 4OX9L 5LMNL 5H1SE 1G51A 1J5EQ 2D0PA 5C0XJ 1RL2A 5GAGC 1ASYA 4A3FG 3H3VH 2PMZE 1BBWA 4DUYL 1EFWA 1KRTA 2V1CC 1HNXL 4H02A 3G71A 5IYDG 1HZ9A 4JI7Q 3PUXA 1BBUA 1V1QA 1M90C 4HJ7A 2JA5G 1T9HA 2ZTCA 4OO1I 1IBMQ 1HNWL 4PZ6A 1HNZL 4HIMA 1VQHA 4YHHQ 1Q81C 4LF8L 4LNQA 2AKWB 4UY8C 4LFAL 4MTNA 1HR0Q 3GTPH 2VW9A 3KYHC 4DK6C 5IYBG 3L0OA 1Y1VG 3T1YL 3CCVA 1VQ6A 1VQEA 4POFA 2E5LL 3RLNA 1FVIA 4RMFA 1IBLL 2I0QA 1SRUA 3CC4A 1L1OB 2YTYA 4JI5L 5FJ8H 2HQLA 4UPAA 1X3GA 3TEHB 2VQEQ 4B3SL 3ICEA 2NN6G 1GO3E 2ZM6L 2PI2E 3S14H 1EYGA 3MEFA 2EXDA 2Z0SA 1C9OA 2A19A 1EWIA 4P74A 1PFSA 3GD7A 3PIPA 3F2CA 4BY1H 4OWWB 4BXXG 4GKKL 1WFQA 1UE1A 2WAQE 2N8NA 4C3JH 1L0WA 4KI0A 4DV5L 4JOIA 4O2DA 3CAMA 4X62L 5C0XI 3CMAA 4DV7Q 4A3IH 1K8AC 3L7ZC 1X3EA 1VQFA 2IT1A 1HR0W 3TREA 4JI6L 1AE2A 1P8LA 3E0EA 4APVA 5M5XH 2R92H 3TRZA 3KOJA 1HH2P 4R4QA 3CPWA 1NE3A 4UP8A 2Z6KC 1JMCA 4R4CA 3TS2A 1VQCA 2WP8J 1YBYA 1YIJA 1FJGQ 4LWCA 4DAMA 2VQFL 4DV2L 4UP9A 4GOPC 4AQYL 1G291 1KL9A 2MNAA 2B63H 2F52A 4GLXA 3EBEA 4GNXA 3CC2A 4IOAA 3UDFA 2ATWA 4OWTB 3KLWA 3CC7A 4EX5A 2LXKA 2N3SA 2YTXA 1KD1C 4L5SA 3I4MH 3A0JA 2UUBL 1UE6A 1WCMH 3NENA 1VQ8A 5C44G 1I94L 4B3RL 3S16H 2ZTDA 2D0OA 2ID0A 1MKHA 2PQAA 4LF7L 3JAMi 4OO1G 2YYZA 1PYSB 2RF4A 2HT1A 4Y52H 4LF4Q 1QVFA 4A3CG 1CKNB 2CWPA 5AJ3L 4AYBE 3TQYA 3UE1A 2E2IH 2F4VL 2CWAA 1PVOA 2B29A 4GS3A 3HKZE 4P72A 1HJPA 3PIOA 3S1NH 3I7FA 4EQ5A 5IWAL 5FLMH 2UUCQ 5E7NA 1N34L 2H5XA 1EOVA 2KCTA 2JA6H 1EQRA 1A62A 1K0RA 1N33L 2VUMG 3HOYG 2KCMA 3I55A 1EIFA 2R7ZG 5IY0A 3JAMc 3PF4A 4DV0Q 1VQLA 4LF8Q 3NEMA 1XNQL 1VQGA 2E2HH 3AFQA 4R4OA 5M5WH 4IJHA 1GM5A 3RR5A 3JC66 4TVAB 2FXQA 2UU9L 3PUVA 1IL2A 2MFIA 1VQAA 2MO1A 4X64Q 4X65L 3HOXH 2IHFA 3DLLA 1M1KC 3CPFA 3GTMH 4JI8L 3RNUA 2EQSA 4LF9Q 4DR5Q 3S15H 1BKBA 5C0XG 4DV6L 4JI0L 4LF5L 4IOCA 2I5MX 4ME3A 1JE5A 1XNRL 2E2JH 3BJUA 1J6QA 1JJCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X65 A;  1VQK A;  2K5V A;  2NZH A;  5HGQ A;  4A3K G;  1C7Y A;  2OTL A;  1XJV A;  3PO2 G;  2UXB L;  4X6A H;  3CCR A;  1TXY A;  4DUZ Q;  1XMO Q;  1B8A A;  1WJJ A;  3S1Q H;  5M3M H;  4DAY B;  1RIP A;  2KEN A;  2R7D A;  3CQZ H;  4YWM A;  4O0A A;  4JI1 L;  3ULJ A;  3W1G A;  1VQ4 A;  1UWV A;  3Q8D A;  4B3T L;  3S1M H;  4JG2 A;  3HOV G;  3I2Z A;  1Q1B A;  3STB C;  4DK3 C;  1YIT A;  3VDY A;  2BA0 A;  3HKS A;  1YJW A;  1XPR A;  4DV4 Q;  4B3M Q;  3M4O H;  2LSS A;  3W1B A;  4JYA Q;  1IBK Q;  1D8L A;  4NXM Q;  5JJI A;  2OQ0 A;  5J3B A;  2I5L X;  4DR2 L;  1S72 A;  1H95 A;  2UXC L;  5EAY A;  3U50 C;  2VS1 A;  3LGJ A;  4A76 A;  1YHQ A;  1PH4 A;  4LF6 L;  4WJ4 A;  4DPG A;  1TWG H;  1OXU A;  4KHZ A;  1KHI A;  4X64 L;  5IP9 H;  3F1Z A;  1L1O A;  3HOU H;  4JCV E;  3G6E A;  3UDX A;  2MQH A;  2LXJ A;  2JA8 G;  4LFC Q;  2R7F A;  3H15 A;  4JI2 L;  4DR4 Q;  3HOW G;  1E7Z A;  4NXN Q;  3A5U A;  3RZD H;  1KAW A;  2JA7 G;  4A3M H;  4DR6 L;  1N32 Q;  3M4Q A;  2IX0 A;  5LMN W;  1WI5 A;  4QQB X;  3M3Y H;  1AE3 A;  3FHW A;  2ALY B;  4JI3 L;  3M9B A;  4A3E G;  1PH6 A;  1LYL A;  4LUV A;  4IFD I;  2PI2 A;  4A3L H;  1OXV A;  3D0F A;  4QJF A;  4A93 G;  4DR3 Q;  1PHJ A;  3CCL A;  4X66 Q;  4DR1 Q;  4JI4 L;  4K0K Q;  3K81 C;  4IFD J;  1PH3 A;  5BR8 Q;  1CSP A;  4R4T A;  4L5Q A;  3M4P A;  4OON A;  4DR7 Q;  3D31 A;  1K3R A;  4ALP A;  1KRS A;  4YCV A;  4C2M H;  1V9P A;  4KLK A;  5C4X H;  2Q2I A;  4A3B H;  1NMG A;  1QZH A;  1J5E L;  3J81 i;  2AMC B;  5IT9 c;  4PG3 A;  1K9M C;  2ZTE A;  4YCW A;  3H0G H;  3S24 A;  4GLV B;  5JEA J;  1U0L A;  3T1H Q;  1TWF H;  1CKM A;  1SLJ A;  4DV3 Q;  2DUD A;  4NPS A;  4A3J H;  3K0X A;  2KBN A;  1NJI C;  3CXC A;  1Z47 A;  2ASB A;  1YVC A;  4JI7 L;  4BA1 I;  1X55 A;  3BZC A;  2GVB A;  1Y1W H;  1IBM L;  2KHI A;  3UDG A;  5IYC H;  5LMU Q;  2Y0S G;  4YHH L;  3J81 c;  2UXD Q;  3BZK A;  5FJ8 G;  3HOZ H;  3AFP A;  5GAD C;  4LUZ A;  1HR0 L;  1UE5 A;  1CKN A;  1VQ5 A;  2EIF A;  1FL0 A;  1SE8 A;  1X6O A;  2K50 A;  4DR3 L;  3S17 H;  4WJ3 M;  1PH9 A;  3B6Y A;  2MO0 A;  1MJC A;  2Q2H A;  5M3F H;  2JA9 A;  1Q7Y C;  1U5K A;  4YCU A;  4HJ8 A;  1D7Q A;  5GQO A;  4BBS H;  3RZO H;  4BY1 G;  5GAH C;  1X3F A;  1K73 C;  2ZJQ A;  2A8V A;  1VCI A;  2NVX H;  2Q2U A;  3KFU A;  1I6H H;  4JV5 Q;  4A3I G;  2OQK A;  2VQE L;  1XPU A;  3E9I A;  1Y14 B;  1N8R C;  2DGY A;  2R92 G;  4BY7 H;  3PO3 H;  2XGT A;  4P71 A;  1VQJ A;  2R93 H;  4PMW A;  2K5H A;  2WB1 E;  3U4V A;  5IP7 H;  2OCE A;  5FLX c;  3G48 A;  3J7A 5;  1JT8 A;  2AWN A;  4DV7 L;  1KC8 C;  1MJE A;  2NVQ H;  3IRB A;  2R6G A;  2B63 G;  3J80 i;  3AYH B;  3ULP A;  4KHP Q;  2KHJ A;  3GTQ H;  4BBR H;  3I4N H;  1TWA H;  4XIG S;  4DKA C;  1IYJ B;  4OWX B;  1CKO A;  3K80 C;  2OTJ A;  2K4K A;  1SFO H;  3I4M G;  2GN5 A;  3ER0 A;  2WFW A;  1SR3 A;  2BH2 A;  4LFB Q;  1WCM G;  1SMX A;  1G6P A;  3I4O A;  4A3D H;  4TQU S;  3G4S A;  1JJ2 A;  3OTO Q;  1JB7 A;  4HIK A;  1TWH H;  3FP9 A;  3HFZ B;  4JBJ A;  3J80 c;  2N78 A;  1QVG A;  1LTL A;  1MIU A;  4GKJ Q;  2HHH Q;  1LUZ A;  3L2P A;  1XMQ Q;  1NY4 A;  5C3E H;  4QGU A;  1QVC A;  4GN4 B;  5FLM G;  4IJL A;  4JOI C;  2AHO B;  2RCN A;  2JA6 G;  3GTO H;  4LF4 L;  1C0A A;  3ULL A;  1EUJ A;  1CSQ A;  1VQM A;  1VQI A;  3AEV A;  4OX9 Q;  2E8G A;  1Q1E A;  5LMN Q;  1OXT A;  5JJK A;  3PSI A;  4RG1 A;  2A1A A;  2UUC L;  3M7N A;  1OXS C;  1E3P A;  4PZ8 A;  3F2B A;  4DUY Q;  3HOX G;  4GNX C;  4YWK A;  2N49 A;  1HNX Q;  3KF8 B;  4DV0 L;  3KDF B;  3RN5 A;  3FKI H;  3GTL H;  1PH7 A;  2CQO A;  1YZ6 A;  3RN2 A;  3OW2 A;  3OTO L;  1S40 A;  3A5Z B;  1HNW Q;  3GO5 A;  2Y0S E;  3UE0 A;  1Q46 A;  1HNZ Q;  3CME A;  3CCS A;  3U58 A;  4J15 A;  3ZJY C;  4A3F H;  1HZA A;  3F2D A;  1VQP A;  1YJ9 A;  1YNX A;  4LFA Q;  1OTC A;  1ASZ A;  2NVT H;  1A8V A;  3CP0 A;  5C4J H;  3GDE A;  4P73 A;  3J81 j;  4A4I A;  4R4I A;  4IPD A;  5IYD H;  1HZC A;  4QY7 A;  3T1Y Q;  4LF9 L;  3KF6 B;  2HIX A;  5M3M G;  1E24 A;  4DR5 L;  2JA5 H;  4POG A;  2VNU D;  5JEA G;  3SGI A;  2E5L Q;  4HID A;  4AIM A;  1XPO A;  3PGZ A;  2F3I A;  3NEL A;  3PV0 A;  4PZ7 A;  3RLO A;  1YI2 A;  4JBM A;  4JI5 Q;  3J7Z C;  4A3G G;  1YEZ A;  5K36 G;  3CF5 A;  4B3S Q;  1JJG A;  5IYB H;  2VZA A;  2ZM6 Q;  4DUZ L;  1I50 H;  1Y1V H;  1XMO L;  4AYB G;  1X9N A;  3NBH B;  1FJG L;  1P16 A;  1N36 L;  3HKZ G;  1VQO A;  3GTJ H;  4GKK Q;  4GLA C;  2BA1 A;  3OYY A;  4DV5 Q;  5IP9 G;  3HOU G;  4X62 Q;  4DV4 L;  4NB3 A;  4B3M L;  1L2F A;  1UEB A;  1E22 A;  4JYA L;  1IBK L;  4NXM L;  4JI6 Q;  5IE8 A;  3WWV A;  2ZJP A;  2YU9 H;  1QUQ B;  1SN8 A;  2BH8 A;  3PF5 A;  4L5R C;  4GOP B;  4LW1 A;  4A3M G;  1PH5 A;  2C35 B;  4BXX H;  1VQB A;  3CCU A;  4DV2 Q;  2VQF Q;  5GRO A;  2D62 A;  4AQY Q;  2UUA L;  3E9H A;  4C3I H;  4JC0 A;  3S2D H;  4A3L G;  4LFC L;  1Q8K A;  3A74 A;  4AH6 A;  4DR4 L;  4QL5 A;  1K83 H;  4NXN L;  1DGS A;  2PNH A;  4MNO A;  4JBK A;  4L5T A;  1YJN A;  1N32 L;  2IHE A;  4DV1 Q;  1V43 A;  1FGU A;  2K52 A;  3BU2 A;  1PV4 A;  2UUB Q;  3CW2 C;  1Z9F A;  1WYD A;  1N36 Q;  2VY3 A;  4A75 A;  2IY5 B;  4C3H H;  1I94 Q;  4B3R Q;  1YHA A;  1N9W A;  2Q2T A;  5C4X G;  1SRO A;  4A3B G;  4X66 L;  1B70 B;  4DR1 L;  4LF7 Q;  4K0K L;  1X54 A;  2AWO A;  3H0G G;  3AQQ A;  4GN3 B;  5BR8 L;  3PUY A;  5AJ3 Q;  2OWO A;  3W5O A;  1OXX K;  4A3J G;  1PH1 A;  2F4V Q;  4DR7 L;  4DNI A;  5C44 H;  1IZ6 A;  3TS0 A;  4P75 A;  1E1O A;  3CCQ A;  2I5H A;  5IWA Q;  1L1O C;  1YHB A;  1KQS A;  1N34 Q;  1Y1W G;  1N33 Q;  1BVS A;  5IYC G;  2B3G A;  1O7I A;  1VQ7 A;  3T1H L;  4A3C H;  3HOZ G;  3U4Z A;  1B7Y B;  4DV3 L;  4IO9 A;  2ES2 A;  1XNQ Q;  1VQ9 A;  3CCJ A;  2YV5 A;  4IFD G;  1EQQ A;  3GTG H;  2UU9 Q;  3CCE A;  5M3F G;  1R9T H;  2VUM H;  3HOY H;  1S3O A;  2RHQ B;  3CCM A;  1I3Q H;  4X65 Q;  4DV1 L;  1X56 A;  3GTK H;  4BBS G;  5LMU L;  3PCO B;  2R7Z H;  4MZ9 A;  2QEX A;  2UXD L;  2QGQ A;  4JI8 Q;  2NZO A;  3I56 A;  3MXN B;  2HIV A;  1IXR A;  4DV6 Q;  4JI0 Q;  4LF5 Q;  1CUK A;  1W2B A;  3EIV A;  2IX1 A;  3ERS X;  5M5Y H;  1XNR Q;  4BY7 G;  3PO3 G;  4YY3 Q;  2CFM A;  2UUA Q;  1LM0 A;  3STB D;  2UXB Q;  4HJA A;  1E1T A;  2R93 G;  5IP7 G;  5ELN A;  1GD7 A;  2NVY H;  3KJO A;  4JV5 L;  3CD6 A;  4JI1 Q;  1HZB A;  3KDF A;  4B3T Q;  4GNX B;  1I5F A;  1EIY B;  2JQO A;  3K7U C;  1PA6 A;  1VQD A;  4QIW E;  2JEA I;  2CKZ B;  3S2H H;  4R1J A;  4BBR G;  3EN2 A;  3I4N G;  4A3G H;  4A3K H;  2JJQ A;  4IPC A;  1VQN A;  4FDB A;  3PO2 H;  1Q86 C;  3K8A A;  5GAE C;  2ZJR A;  4LUO A;  1VS0 A;  2K14 A;  2WAQ G;  4DR2 Q;  1AH9 A;  5HY6 A;  2CCZ A;  4A3D G;  2UXC Q;  2JEB I;  3KF6 A;  1PYB A;  4IPG A;  4LF6 Q;  2PQA B;  3F8T A;  3H3V I;  3PUZ A;  3HOV H;  4KHP L;  2K75 A;  3RLF A;  1A63 A;  1TWC H;  4JBW A;  5DLQ E;  1NMF A;  1XTD A;  3KJP A;  1NTG A;  2JE6 I;  2NN6 I;  1WOC A;  1GVP A;  1W3S A;  4JI2 Q;  5JJL A;  4LFB L;  1Q82 C;  1UE7 A;  3DM3 A;  3UDI A;  3M85 A;  2RHS B;  5C3E G;  4DR6 Q;  4OXP A;  2L15 A;  4YY3 L;  2QA4 A;  1PH2 A;  4HJ9 A;  4GN5 A;  4HIO A;  4JI3 Q;  2XTI A;  2JA8 H;  1A0I A;  4XTC S;  2GVA A;  4GKJ L;  4Y7N H;  1KIX A;  2HHH L;  2Z6K A;  5ELO A;  3HOW H;  4BA2 I;  1XMQ L;  2VL6 A;  4JI4 Q;  3PUW A;  2YTV A;  1Q12 A;  2JA7 H;  1QUQ A;  1KXL A;  1IBL Q;  1QZG A;  4GOP A;  1NBW A;  1PH8 A;  4A3E H;  3K7A H;  4YWL A;  2WB1 G;  4HJ5 A;  1K8G A;  2K5N A;  4A93 H;  3FKI G;  1GKH A;  4IPH A;  2JK8 A;  4UP7 A;  3S1R H;  4OX9 L;  5LMN L;  5H1S E;  1G51 A;  1J5E Q;  2D0P A;  5C0X J;  1RL2 A;  5GAG C;  1ASY A;  4A3F G;  3H3V H;  2PMZ E;  1BBW A;  4DUY L;  1EFW A;  1KRT A;  2V1C C;  1HNX L;  4H02 A;  3G71 A;  5IYD G;  1HZ9 A;  4JI7 Q;  3PUX A;  1BBU A;  1V1Q A;  1M90 C;  4HJ7 A;  2JA5 G;  1T9H A;  2ZTC A;  4OO1 I;  1IBM Q;  1HNW L;  4PZ6 A;  1HNZ L;  4HIM A;  1VQH A;  4YHH Q;  1Q81 C;  4LF8 L;  4LNQ A;  2AKW B;  4UY8 C;  4LFA L;  4MTN A;  1HR0 Q;  3GTP H;  2VW9 A;  3KYH C;  4DK6 C;  5IYB G;  3L0O A;  1Y1V G;  3T1Y L;  3CCV A;  1VQ6 A;  1VQE A;  4POF A;  2E5L L;  3RLN A;  1FVI A;  4RMF A;  1IBL L;  2I0Q A;  1SRU A;  3CC4 A;  1L1O B;  2YTY A;  4JI5 L;  5FJ8 H;  2HQL A;  4UPA A;  1X3G A;  3TEH B;  2VQE Q;  4B3S L;  3ICE A;  2NN6 G;  1GO3 E;  2ZM6 L;  2PI2 E;  3S14 H;  1EYG A;  3MEF A;  2EXD A;  2Z0S A;  1C9O A;  2A19 A;  1EWI A;  4P74 A;  1PFS A;  3GD7 A;  3PIP A;  3F2C A;  4BY1 H;  4OWW B;  4BXX G;  4GKK L;  1WFQ A;  1UE1 A;  2WAQ E;  2N8N A;  4C3J H;  1L0W A;  4KI0 A;  4DV5 L;  4JOI A;  4O2D A;  3CAM A;  4X62 L;  5C0X I;  3CMA A;  4DV7 Q;  4A3I H;  1K8A C;  3L7Z C;  1X3E A;  1VQF A;  2IT1 A;  1HR0 W;  3TRE A;  4JI6 L;  1AE2 A;  1P8L A;  3E0E A;  4APV A;  5M5X H;  2R92 H;  3TRZ A;  3KOJ A;  1HH2 P;  4R4Q A;  3CPW A;  1NE3 A;  4UP8 A;  2Z6K C;  1JMC A;  4R4C A;  3TS2 A;  1VQC A;  2WP8 J;  1YBY A;  1YIJ A;  1FJG Q;  4LWC A;  4DAM A;  2VQF L;  4DV2 L;  4UP9 A;  4GOP C;  4AQY L;  1G29 1;  1KL9 A;  2MNA A;  2B63 H;  2F52 A;  4GLX A;  3EBE A;  4GNX A;  3CC2 A;  4IOA A;  3UDF A;  2ATW A;  4OWT B;  3KLW A;  3CC7 A;  4EX5 A;  2LXK A;  2N3S A;  2YTX A;  1KD1 C;  4L5S A;  3I4M H;  3A0J A;  2UUB L;  1UE6 A;  1WCM H;  3NEN A;  1VQ8 A;  5C44 G;  1I94 L;  4B3R L;  3S16 H;  2ZTD A;  2D0O A;  2ID0 A;  1MKH A;  2PQA A;  4LF7 L;  3JAM i;  4OO1 G;  2YYZ A;  1PYS B;  2RF4 A;  2HT1 A;  4Y52 H;  4LF4 Q;  1QVF A;  4A3C G;  1CKN B;  2CWP A;  5AJ3 L;  4AYB E;  3TQY A;  3UE1 A;  2E2I H;  2F4V L;  2CWA A;  1PVO A;  2B29 A;  4GS3 A;  3HKZ E;  4P72 A;  1HJP A;  3PIO A;  3S1N H;  3I7F A;  4EQ5 A;  5IWA L;  5FLM H;  2UUC Q;  5E7N A;  1N34 L;  2H5X A;  1EOV A;  2KCT A;  2JA6 H;  1EQR A;  1A62 A;  1K0R A;  1N33 L;  2VUM G;  3HOY G;  2KCM A;  3I55 A;  1EIF A;  2R7Z G;  5IY0 A;  3JAM c;  3PF4 A;  4DV0 Q;  1VQL A;  4LF8 Q;  3NEM A;  1XNQ L;  1VQG A;  2E2H H;  3AFQ A;  4R4O A;  5M5W H;  4IJH A;  1GM5 A;  3RR5 A;  3JC6 6;  4TVA B;  2FXQ A;  2UU9 L;  3PUV A;  1IL2 A;  2MFI A;  1VQA A;  2MO1 A;  4X64 Q;  4X65 L;  3HOX H;  2IHF A;  3DLL A;  1M1K C;  3CPF A;  3GTM H;  4JI8 L;  3RNU A;  2EQS A;  4LF9 Q;  4DR5 Q;  3S15 H;  1BKB A;  5C0X G;  4DV6 L;  4JI0 L;  4LF5 L;  4IOC A;  2I5M X;  4ME3 A;  1JE5 A;  1XNR L;  2E2J H;  3BJU A;  1J6Q A;  1JJC B; 
#chains in the Genus database with same CATH topology
 1UNS A;  1Y1V B;  2NZH A;  1VQK A;  5HGQ A;  2OTL A;  2UXB L;  4X6A H;  2Z9H A;  1E2V A;  1A3U A;  1TXY A;  1EY0 A;  1B8A A;  1WJJ A;  3S1Q H;  1DM0 B;  2R7D A;  2KEN A;  4YWM A;  4JI1 L;  4M1U B;  3W1G A;  1GUG A;  1WTQ A;  1UWV A;  1H9J A;  5D14 A;  2K5W A;  3FMC A;  1AFP A;  4DK3 C;  2BA0 A;  1YJW A;  1CA6 A;  4B3M Q;  2LSS A;  4XXE A;  1A6X A;  4NXM Q;  2OQ0 A;  1H95 A;  5FO8 B;  4XQJ A;  3U50 C;  1YHQ A;  1U4M A;  1TWG H;  1OXU A;  2RDG A;  1K83 B;  2D2C C;  3HOU H;  1T5X D;  3GV6 A;  4JCV E;  3G6E A;  2JA8 G;  2LXJ A;  2XN9 C;  3N52 A;  4DAV A;  5C3W A;  3A5U A;  4A3M H;  4DR6 L;  2Q8T A;  3IFD A;  1BR9 A;  4HN7 A;  2V4D A;  2B2Y C;  4LUV A;  4A3L H;  1OXV A;  1EIG A;  2SNS A;  4C1N K;  1PHJ A;  2B8F A;  3TDQ A;  2OEO A;  4HAE A;  4JI4 L;  4K0K Q;  2PQE A;  1PH3 A;  5BR8 Q;  1CSP A;  1O7Y A;  2LS0 1;  1KRS A;  4KY5 A;  4CDF C;  5JPN C;  3J81 i;  1ESR A;  2C9O A;  3AB9 A;  5IT9 c;  4ZUJ A;  1HCZ A;  2R3Z A;  1QG7 A;  1UEA B;  3SR1 A;  3GTG B;  3K0X A;  4KD3 A;  3HOY B;  4S3S A;  3CXC A;  1Z47 A;  1I3Q B;  2ASB A;  3GTK B;  4JI7 L;  5J1Z A;  1X55 A;  2EE1 A;  1ML0 D;  2LFN A;  2VB2 X;  5M9O A;  2KHI A;  1FR3 A;  3UDG A;  4PMB A;  3DWQ A;  5LMU Q;  3J81 c;  3BZK A;  1LTR D;  3HOZ H;  5M5Y B;  5GAD C;  1HR0 L;  1NR4 A;  1HRJ A;  1IW7 D;  1II3 A;  1X3P A;  2D9U A;  4DR3 L;  1CZW A;  2EZV A;  1MJC A;  5M3F H;  1U5K A;  3VR4 A;  2JN4 A;  2ZJQ A;  4V19 0;  1VCI A;  1QIL A;  3S2H B;  1XPU A;  3E9I A;  1HFG A;  4ZAI A;  1VQJ A;  2R93 H;  4PMW A;  2K5H A;  3J7A 5;  3G48 A;  2AWN A;  1MJE A;  2NVQ H;  1TS4 A;  3J80 i;  3H91 A;  4HCS A;  3ULP A;  4BBR H;  1SE4 A;  4DKA C;  4ABN A;  4MHE A;  4KTA A;  4CKE A;  3I4M G;  2HD3 A;  3ER0 A;  1SMX A;  1G6P A;  4A3D H;  4TQU S;  5IGF A;  3OTO Q;  4DAY A;  2GA4 B;  1YNJ C;  4RKB A;  2JA8 B;  3J80 c;  4Y7N B;  4J8Q A;  3KBG A;  4X3S A;  1LTL A;  1MIU A;  4KY6 A;  1NY4 A;  1QVC A;  4IJL A;  4JOI C;  3MFG A;  3R2I A;  2DJG C;  3BVM A;  3GTO H;  2A68 D;  1EUJ A;  1VQM A;  1VQI A;  1Q1E A;  3PSI A;  4CDC C;  3M7N A;  2RDF A;  3A54 A;  3T16 A;  2LMC B;  4Q0F A;  2F0E A;  1SNQ A;  3I70 A;  4HCE A;  2EJM A;  2CQO A;  3OOC A;  4J6H A;  1YNN C;  1HNW Q;  3GO5 A;  2Y0S E;  1Q46 A;  1HNZ Q;  3KLS X;  1WD1 A;  3SK6 A;  3F2D A;  2EJF C;  1PXU A;  5C4Z A;  1HUM A;  1BBX C;  1HZC A;  3SHL A;  5IYD H;  4LF9 L;  5M3M G;  2VNU D;  3MTS A;  1DXM A;  5JEA G;  1KLG D;  2A6H C;  2E5L Q;  1S5D D;  3PGZ A;  4K6L A;  3WOE A;  2DNC A;  1TR5 A;  3CF5 A;  5IYB H;  2VZA A;  1XMO L;  3HG9 A;  2OXP A;  2QDB A;  4KV6 A;  2B2W C;  2F0M A;  1R4Q B;  3BG3 A;  3NBI A;  2NN6 H;  1IBK L;  2BH8 A;  3PF5 A;  4BXX H;  3S17 B;  3CCU A;  3D6W A;  2VQF Q;  5GRO A;  5CV8 A;  3E9H A;  4LFC L;  1Q8K A;  4RGO S;  2A6E D;  3I4M B;  4WFN 3;  4NXN L;  1DGS A;  3EFX D;  2B39 A;  1N32 L;  3LWU A;  3KUP A;  3FEW X;  3BYT B;  5NUC A;  1FGU A;  3LWE A;  3BU2 A;  1PV4 A;  4XDX A;  1EY9 A;  2F4I A;  4B3R Q;  4RCN A;  1YHA A;  1N9W A;  4H0L C;  2Q8R E;  1B70 B;  1KAA A;  4DR1 L;  5EPJ A;  1X54 A;  2E2I B;  2AWO A;  3C2P A;  3H0G G;  1ONL A;  1OXX K;  4A3J G;  1PH1 A;  2F4V Q;  1H9K A;  4DR7 L;  5C44 H;  4P75 A;  5IWA Q;  1G8Z D;  1SE2 A;  1N34 Q;  1Y1W G;  5KEE A;  4G7H C;  2E2H B;  2A74 C;  2MPM A;  1XNQ Q;  5FOB B;  1R9T H;  2VUM H;  1S3O A;  4X65 Q;  2RSO A;  1T5E A;  5BN5 A;  3MXN B;  2PO4 A;  2XWJ B;  2QEJ C;  2E2J B;  1EIH A;  1DYQ A;  4LF5 Q;  3P1H A;  1W2B A;  2IX1 A;  5CYU A;  1STG A;  2CFM A;  2UUA Q;  1LM0 A;  1QNK A;  3STB D;  4K8I A;  5M3M B;  1QB5 D;  3CQZ B;  5IP7 G;  5ELN A;  3S1M B;  4IUQ A;  5EPK A;  1IYV A;  3CKI B;  4JV5 L;  4F87 A;  1K8O A;  3KF8 A;  3D3R A;  4B3T Q;  1K28 A;  5TSS A;  1EIY B;  5IOD A;  2CKZ B;  4KKS A;  3HS0 C;  1RHP A;  4A3K H;  4DK1 A;  3NXW A;  1B4O A;  1GUW A;  1Q86 C;  5GAE C;  2K14 A;  1XWE A;  1PMR A;  5HY6 A;  1S5E D;  1PYB A;  4LF6 Q;  2PQA B;  1XYI A;  3HP3 A;  3PUZ A;  3HOV H;  4KHP L;  2K75 A;  4X3T A;  1IHZ A;  3MVV A;  3RZD B;  4UHV A;  1TQO A;  1GVP A;  4LFB L;  3M3Y B;  1UE7 A;  3DM3 A;  3UDI A;  2RHS B;  5C3E G;  1OO9 B;  1H9R A;  3NBH A;  4QF4 A;  2QA4 A;  4HJ9 A;  1GUN A;  2CW0 C;  2XTI A;  5CMD A;  2HHH L;  2Z6K A;  3HOW H;  5FKA C;  1XMQ L;  2VL6 A;  2OT2 A;  1Q12 A;  2A5H A;  1QUQ A;  1KXL A;  4C2M B;  1A2T A;  2PNR C;  1B2T A;  5DEH A;  4HJ5 A;  2I46 A;  3H0G B;  2I07 B;  5H1S E;  1J5E Q;  4A3J B;  2F0L A;  2RSN A;  4G4K A;  4R8I A;  1NNX A;  2TSS A;  4LJZ C;  4A3F G;  1F9P A;  1MD2 D;  2FIN B;  2K5D A;  4XQN A;  1Y1W B;  4NKL A;  3G71 A;  1HZ9 A;  3PUX A;  3TP5 A;  1LT3 D;  4HJ7 A;  3MZ5 A;  1UUP A;  1UAP A;  3SK5 A;  3ZYY X;  3JAM E;  5ELC A;  2A69 C;  3RZO B;  4POF A;  1KTK A;  2RCF A;  4RMF A;  3RLN A;  2I0Q A;  1I6H B;  1SRU A;  3CC4 A;  4JI5 L;  2O4X A;  4UPA A;  3TEH B;  2VQE Q;  3ICE A;  1EWC A;  2PI2 E;  1PZK D;  3S14 H;  2Z0S A;  3K57 A;  4P74 A;  1KAB A;  4OWW B;  4DU9 A;  4FO2 A;  2WAQ E;  2HDL A;  4KI0 A;  4DV5 L;  4DV7 Q;  5C0X I;  4X62 L;  4C3I G;  1JB3 A;  1VQF A;  2IT1 A;  5M5X H;  3E0E A;  4CGY B;  2SEB D;  3TRZ A;  2Z6K C;  4IZ8 A;  3H94 A;  4LWC A;  4DV2 L;  3UI2 A;  2EJG C;  2F03 A;  1DOK A;  5LL6 X;  4IUV A;  1F2M A;  1JOO A;  4N8F A;  1PTO C;  4IOA A;  1I6V C;  1MSH A;  2NTT A;  3C1E A;  2L5T A;  5C3E B;  3QO2 A;  4K2L A;  3DUZ A;  4ZLT F;  2JP1 A;  3S16 H;  2ZTD A;  5JJZ A;  2O5I C;  3DWP A;  4JW0 A;  2KHS A;  1CK1 A;  4LF4 Q;  1QVF A;  1SMY C;  1B9N A;  4A3C G;  1RCV D;  5AJ3 L;  1ICF B;  2ENB A;  4P72 A;  1HJP A;  2UUC Q;  5FLM H;  2H5X A;  2JA6 H;  1EQR A;  1A62 A;  3GTL B;  2KCM A;  3PF4 A;  4A3F B;  1VQG A;  2HCI A;  5M5W H;  1LT4 D;  5C4J B;  5T1G A;  3OHX C;  1FNW A;  2CQA A;  2K01 A;  1SNP A;  3DLL A;  2IHF A;  3GTM H;  4C56 C;  3RUZ A;  4DR5 Q;  4I7A A;  5C0X G;  4DV6 L;  1HFN A;  2G5D A;  3GP7 A;  3QJY A;  1JE5 A;  4ME3 A;  1GHK A;  1XNR L;  3BJU A;  4A3G G;  1K3B C;  2K5V A;  3TZD A;  1C7Y A;  3I91 A;  3PO2 G;  3P75 A;  3CCR A;  3GTJ B;  3K58 A;  1FJG Q;  1RIP A;  2XRS D;  1N36 Q;  1VQ4 A;  1ZYR C;  2ZT9 C;  3I2Z A;  5CGK A;  2H1E A;  3HKS A;  5D3I B;  5CC4 A;  1XPR A;  3EQL C;  2F0P A;  3EJI A;  1PYW D;  3W1B A;  1D8L A;  5J3B A;  2E2D C;  2I5L X;  2UXC L;  2EYH A;  2EYJ A;  3LGJ A;  4A76 A;  4C3I B;  4DPG A;  3F1Z A;  1L1O A;  5C4H A;  4RFB A;  3UDX A;  3NPP A;  4DR4 Q;  1Y8O B;  1EYD A;  2CH4 W;  4KN7 C;  1Y8N B;  2JA7 G;  4XYQ A;  1C4Q A;  5EJW A;  5LMN W;  4C3H B;  1WI5 A;  4QQB X;  1STE A;  1AE3 A;  3FHW A;  2F0S A;  4JI3 L;  3M9B A;  5I2Y A;  2HCC A;  2X6G A;  4IFD I;  2PI2 A;  3D0F A;  3K5L A;  4ZKC B;  4A93 G;  4X66 Q;  1G2S A;  4H13 C;  1ZKO A;  3M4P A;  3TBI B;  4BWG B;  3D31 A;  1BCP C;  2KED A;  4OIJ A;  1V9P A;  1WTO A;  1LAC A;  4A3B H;  2AMC B;  3S24 A;  3AU7 A;  4K5X A;  1TWF H;  1CKM A;  5KNB A;  4DV3 Q;  5IGE A;  1K8M A;  4EQP A;  1DD2 A;  4YIJ A;  4BA1 I;  2QKI C;  2GVB A;  1IBM L;  5IYC H;  4YHH L;  2UXD Q;  4RHS A;  4XYO A;  3S9W A;  3AFP A;  1UE5 A;  1CKN A;  1VQ5 A;  3J7A V;  1FL0 A;  1SE8 A;  1X6O A;  4WJ3 M;  5E4W C;  5IIF A;  1Q7Y C;  2FMC A;  2F0U A;  4BBS H;  4BY1 G;  1X3F A;  4C3J G;  3KFU A;  4XT1 B;  4A3I G;  2OQK A;  2KJX A;  3BS1 A;  4A3G B;  1BO0 A;  3PO2 B;  1Y14 B;  4M8A A;  3V2T A;  4BY7 H;  3PO3 H;  4FYD A;  2PZW A;  5FLX c;  5DAU A;  3VR6 A;  4RWS C;  1JT8 A;  1KC8 C;  3IRB A;  1TWC B;  2R6G A;  3MHB A;  5IOC A;  1X32 A;  3ND9 A;  3GTQ H;  1TWA H;  2ZXR A;  1IYJ B;  3LX0 A;  2WKC A;  5CV9 A;  4OWX B;  2K4K A;  4HSV A;  3T56 B;  1AP0 A;  2ICI A;  1SR3 A;  2BH2 A;  3VA5 A;  3I4O A;  1LTG D;  1JJ2 A;  4HIK A;  1TWH H;  5CV7 A;  3FP9 A;  5DM7 3;  2JA7 B;  2EY6 A;  4GKJ Q;  1LUZ A;  3L2P A;  5I6Y A;  2G9H D;  2L55 A;  1SYD A;  4A93 B;  3K59 A;  3ULL A;  3AEV A;  2NTS A;  5LMN Q;  1OXT A;  3OMC A;  1HHV A;  2F0H A;  1AW7 A;  1U4L A;  1E3P A;  3F2B A;  4DUY Q;  3HOX G;  4X3K A;  1STA A;  1HNX Q;  1D5X C;  3KDF B;  1PH7 A;  2E75 C;  5CBA E;  4U67 3;  3OW2 A;  2K7V A;  3OTO L;  3I72 A;  3ONA B;  3UE0 A;  3U58 A;  1YJ9 A;  4J15 A;  4DXG A;  1VQP A;  3FPP A;  3CP0 A;  3GDE A;  4P73 A;  3J81 j;  2IL8 A;  1BF4 A;  4R4I A;  2HIX A;  1Y69 U;  2JA5 H;  1CFM A;  4POG A;  2F0N A;  3URY A;  4UDU C;  4AIM A;  4N8X 1;  3PV0 A;  1YI2 A;  1M4V A;  3J7Z C;  1AZP A;  4MTK A;  1D1I A;  1YEZ A;  1JIC A;  4XT3 B;  3GQB A;  2J0T D;  4DUZ L;  3GV3 A;  1Y1V H;  4BY1 B;  2F0V A;  3G6J B;  4C3J B;  4DGZ A;  4A3I B;  4GKK Q;  4GLA C;  5IP9 G;  1CQF A;  4DV4 L;  1L2F A;  4JYA L;  4FF1 A;  2B2V C;  2QCP X;  5IE8 A;  2BDO A;  1Q90 A;  4GOP B;  1U9R A;  4IQZ A;  1ET6 A;  3A8K E;  2D62 A;  1SYG A;  1U4R A;  3DHQ A;  2XSC A;  4AH6 A;  1K83 H;  4KY7 A;  2L11 A;  2EPB A;  4MNO A;  4DV1 Q;  2K52 A;  3TZU A;  1HA5 A;  5IGG A;  4A75 A;  4JPB W;  2IY5 B;  4RAU C;  5CR3 A;  1LV9 A;  5C4X G;  1SRO A;  3D4D A;  3NQT A;  4LF7 Q;  1EY6 A;  4FXK C;  3CRL C;  1C8C A;  3AQQ A;  3PUY A;  2OWO A;  3W5O A;  1PZI D;  3QG1 A;  1E1O A;  3R2T A;  3MC0 B;  4O1N A;  3ND8 A;  1N33 Q;  1BVS A;  4OO1 H;  3SDZ A;  1XX8 A;  3VR2 A;  3T1H L;  1FYC A;  1B7Y B;  3U4Z A;  3O13 A;  3CCJ A;  3HOX B;  5I4D A;  5EPL A;  3GTG H;  1WTR A;  2L9H A;  2UU9 Q;  3HOY H;  4EQO A;  1FNV A;  3CCM A;  1EOT A;  1I3Q H;  5ELB A;  3GTK H;  5J22 A;  3I56 A;  2NZO A;  2HIV A;  3SVM A;  1FD7 D;  1IXR A;  3EIV A;  3K0Y A;  4IUN A;  1AEX A;  1ET9 A;  5M5Y H;  3VYU A;  4YY3 Q;  3IFT A;  2UXB Q;  4QUF A;  1BDO A;  2JSO A;  1V1O A;  1TVX A;  2VXW A;  4IAL A;  4LAA A;  4JI1 Q;  1HZB A;  1IW7 C;  3MA2 B;  2JQO A;  3K7U C;  1VQD A;  4QIW E;  2JEA I;  3M4O B;  3S2H H;  1B53 A;  3I4N G;  2NBF A;  2N55 A;  2F0G A;  3K8A A;  3I3C A;  2ZJR A;  1VS0 A;  1AH9 A;  2CCZ A;  2A6H D;  3E0J A;  2WAC A;  3KF6 A;  4IPG A;  5ELE A;  3JAM L;  3RLF A;  4MN3 A;  4JBW A;  1A63 A;  3K5N A;  1NMF A;  2D5D A;  1XTD A;  1QNU A;  3KJP A;  1NTG A;  1W3S A;  4G7Z C;  4DR6 Q;  2L15 A;  1RTN A;  4HIO A;  3T51 B;  5KRU A;  2JA8 H;  2QIL A;  5JVH 3;  2AQ3 B;  2A73 B;  4XTC S;  2GVA A;  1MHW C;  4Y7N H;  4BA2 I;  2F1M A;  4C1N I;  3OW7 A;  1NSN S;  4JI4 Q;  3PUW A;  2YTV A;  3SXH A;  4H44 C;  1H9S A;  2F0I A;  5C4X B;  4YWL A;  5IGB A;  3L3O C;  2WKD A;  1LT5 D;  3H09 A;  2KEC A;  1GKH A;  3FKI G;  4HR7 B;  4OX9 L;  1G51 A;  1ICW A;  5C6A A;  1TY0 A;  2PMZ E;  2BOS A;  4CJ2 C;  1E0B A;  4K8J A;  2V1C C;  4JI7 Q;  1V1Q A;  2N88 A;  1CI3 M;  4ID6 A;  2ZTC A;  2L4N A;  1QOH A;  2EXZ A;  1Q81 C;  5EKI A;  4LF8 L;  3K6O A;  4LFA L;  4FF2 A;  4MTN A;  1RJT A;  1HR0 Q;  2IJ0 A;  4DK6 C;  1GJX A;  3T1Y L;  1SNC A;  3CCV A;  3OPO A;  1VQ6 A;  2NVX B;  1ZEQ X;  1FVI A;  2J4X A;  2YTY A;  3J7A F;  4B3S L;  1MI2 A;  3AMU A;  2CH4 A;  4JK1 C;  1B44 D;  2ZM6 L;  1EYG A;  1EWI A;  3GD7 A;  1KDB A;  3VYS A;  1X3Q A;  1UE1 A;  2N8N A;  4G57 A;  3CAM A;  3I4N B;  1IYU A;  4JI6 L;  1AE2 A;  4HMI A;  1Q8I A;  4APV A;  1SFO B;  2LY7 A;  3KOJ A;  4R4Q A;  1BOS A;  4R4C A;  1VQC A;  4KMU C;  1YIJ A;  4DAM A;  4UP9 A;  4AQY L;  1G29 1;  4O42 A;  5G3L F;  3EBE A;  4GNX A;  4DXF A;  3CC2 A;  2MJ8 A;  2LXK A;  2YTX A;  4JVZ A;  1KD1 C;  4L5S A;  3I4M H;  2DY8 A;  4WOR A;  1CHP D;  3A0J A;  2UUB L;  1V1P A;  5JPM C;  1JR0 D;  4ILW A;  1I94 L;  1VQ8 A;  2NUC A;  5EGT A;  2RF4 A;  4OL7 A;  4RGN A;  4V0B A;  3UE1 A;  2E2I H;  4IUP A;  1PVO A;  4EVO A;  3I7F A;  3NTK A;  1GHJ A;  3FRP B;  3ITP A;  1EOV A;  2KCT A;  4FXD A;  1K0R A;  2CW0 D;  3FKI B;  4ZQ3 A;  2DY7 A;  2DNE A;  5D65 A;  4XQQ A;  1EIF A;  2R7Z G;  3MWY W;  5EKK A;  1VQL A;  3HZX A;  1ENC A;  2E2H H;  2NVT B;  3FDT A;  3BDO A;  1CA5 A;  4IJH A;  3Q6S A;  5IT9 E;  4IUR A;  2AQ1 B;  2O5J C;  2IWH A;  3PIP 3;  1SYE A;  1IL2 A;  3RMH A;  2MGS A;  4X64 Q;  1M1K C;  3CPF A;  4JI8 L;  3TME A;  4OIK A;  4LF9 Q;  4TRD A;  1BKB A;  4JI0 L;  1QCB D;  2E2J H;  1J6Q A;  1B9M A;  1I50 B;  1X65 A;  3J81 E;  3SK4 A;  1XJV A;  5KIX A;  3OIP A;  3PMF A;  1XMO Q;  1LLR D;  5M3M H;  4DAY B;  3CQZ H;  3ULJ A;  4BS9 A;  5JEA H;  3S1M H;  3Q8D A;  2Z4I A;  3STB C;  1YIT A;  3VDY A;  4N9P A;  2NZ1 D;  1J8I A;  2A69 D;  5JJI A;  1IBK Q;  4DR2 L;  3QOJ A;  1I4G A;  2K33 A;  1EQT A;  2VS1 A;  4WJ4 A;  2B2T A;  1W6J A;  1PH4 A;  3S2D B;  4KHZ A;  1KHI A;  2EYO A;  1F2Y A;  4OEL B;  4LFC Q;  3H15 A;  4JI2 L;  3PIO 3;  4NXN Q;  1TY2 A;  4K5V A;  4KD4 A;  4PQX A;  3RZD H;  1N32 Q;  3M4Q A;  2IX0 A;  3R93 A;  3M3Y H;  2ZXO A;  5FO7 B;  4A3E G;  1PH6 A;  1LYL A;  3A8I E;  3CCL A;  4DR1 Q;  1BNZ A;  3K81 C;  4WRD A;  1E2W A;  4IFD J;  1LT6 D;  3J80 E;  4L5Q A;  2FJ2 A;  4OON A;  4DR7 Q;  1K3R A;  3KBX A;  2Z4H A;  1ILP A;  4YCV A;  2E76 C;  4C2M H;  4KLK A;  1GUO A;  2PW7 A;  1STN A;  2Q2I A;  5I2X A;  1CHQ D;  1NMG A;  3A7L A;  4PG3 A;  1S4Z A;  1K9M C;  3H0G H;  4GLV B;  2LKV A;  3U9S A;  1SLJ A;  3ERO A;  3P20 A;  2DUD A;  4NPS A;  4A3J H;  4J1M A;  1NJI C;  5IGD A;  2R7Z B;  1Y1W H;  3A8J E;  1SMY D;  2Y0S G;  1STH A;  5JOB A;  1V8Q A;  5FJ8 G;  4LUZ A;  1KDA A;  4C3H G;  2K50 A;  3DM1 A;  3HRZ C;  2EY1 A;  4RH6 A;  4UAI A;  2NVY B;  1D7Q A;  4YCU A;  5GQO A;  3RZO H;  2K1B A;  5GAH C;  3DWA A;  2Q2U A;  1TS3 A;  4DFA A;  1I6H H;  4JV5 Q;  1WTH A;  3M4Y A;  4LK1 C;  3NWT A;  2DGY A;  1CM9 A;  2R92 G;  2XGT A;  3L9A X;  1SDF A;  4GZY C;  2NB0 A;  4KK7 A;  5IP7 H;  2WB1 E;  3U4V A;  2OCE A;  1HA6 A;  3TSS A;  1D1K A;  3Q0A A;  3TN2 A;  4CDD C;  2NWG A;  2B63 G;  3IL8 A;  3AYH B;  4KHP Q;  1DON A;  2PW5 A;  4XIG S;  4CHT B;  4ZYS A;  4IUU A;  2OTJ A;  1CKO A;  2GN5 A;  2L1B A;  4DA2 A;  2WFW A;  4LFB Q;  1WCM G;  1ZYR D;  1JB7 A;  3HFZ B;  2N78 A;  3I4L A;  5CV4 A;  2HHH Q;  4LMQ D;  2XVS A;  1XMQ Q;  5C3E H;  4QGU A;  4A3E B;  4GN4 B;  3K7A B;  2R61 A;  2AHO B;  1BQQ T;  2Z8L A;  1QJO A;  3S1R B;  4Z9C B;  1C0A A;  1CSQ A;  3SEB A;  1EEF D;  2E8G A;  5JJK A;  3RD4 A;  2SDF A;  4RG1 A;  1JWU D;  1OXS C;  4PZ8 A;  2EY5 A;  2N49 A;  3KF8 B;  5FK9 C;  4DV0 L;  3RN5 A;  3GTL H;  3V96 A;  1RDP D;  1YZ6 A;  3RN2 A;  1TT2 A;  3TP6 A;  3A5Z B;  3GTP B;  3CME A;  4A3F H;  1HZA A;  1OTC A;  1YNX A;  1ASZ A;  3D4R A;  5C4J H;  4X3U A;  1I4Q A;  4QY7 A;  2Y0S B;  1E24 A;  2PCF B;  3SGI A;  1E2Z A;  3C1F A;  4CKC A;  2F3I A;  5CBE E;  1SNM A;  3RLO A;  4PZ7 A;  3NK9 A;  4B9X A;  2B2U A;  4JBM A;  4JI5 Q;  1EZ6 A;  4CJ1 B;  2NYZ D;  1JOQ A;  2L0C A;  3NBH B;  5L37 A;  1VQO A;  2Z6B A;  3GTJ H;  3LNN A;  3OYY A;  1NAP A;  4DV5 Q;  3HOU G;  2R92 B;  4X62 Q;  4NB3 A;  4B3M L;  2K5Q A;  1UEB A;  3KLS A;  1ZXT A;  4NXM L;  4ZK9 B;  2ZJP A;  2YU9 H;  1QUQ B;  1IKL A;  4L5R C;  5KYI A;  4LW1 A;  1JCK B;  4A3M G;  1PH5 A;  2C35 B;  1G91 A;  1PTO B;  1VQB A;  2B63 B;  4DV2 Q;  1F9R A;  4C3I H;  4JC0 A;  3U9O A;  4A3L G;  3A74 A;  4QL5 A;  4DF7 A;  2PNH A;  1YJN A;  1WCM B;  2IHE A;  4L63 B;  3CW2 C;  1Z9F A;  1WYD A;  4H7B A;  2VY3 A;  1WTW A;  4C3H H;  1ESF A;  1LTS D;  2Q2T A;  1DOL A;  4NDX A;  1O7Z A;  4K0K L;  5BR8 L;  4GN3 B;  3R3O A;  3S1N B;  5AJ3 Q;  2E74 C;  4DNI A;  1IZ6 A;  2K03 A;  3W2D A;  2FFK B;  4PMC A;  2I5H A;  1LAB A;  1L1O C;  1YHB A;  1KQS A;  3V05 A;  1XTC D;  1RTO A;  3H6M A;  2B3G A;  1O7I A;  1F77 A;  4A3C H;  3HOZ G;  1EY7 A;  4IO9 A;  2B2U C;  1EQV A;  2RVL A;  1GOZ A;  2YV5 A;  2XNA C;  1EQQ A;  4IFD G;  5KYL A;  5M3F G;  4DV1 L;  1X56 A;  5LMU L;  3PCO B;  4EQN A;  4MZ9 A;  2QEX A;  3R8B A;  1PTO F;  1WTV A;  3NHH A;  3S15 B;  4DV6 Q;  1CUK A;  1CT1 D;  2Q8I B;  1O7L A;  1XNR Q;  5JAV A;  4HJA A;  4PV1 C;  3S1Q B;  2R93 G;  1EFI D;  5BN4 A;  3KJO A;  5C0X H;  1DOM A;  3QWN A;  1PA6 A;  1FNU A;  2B2Y A;  4R1J A;  4BBR G;  1SE3 A;  3EN2 A;  4A3G H;  1GUS A;  2JJQ A;  3TP8 A;  1VQN A;  4FDB A;  3PO2 H;  4U68 A;  2MHV A;  1WVL A;  1WTX A;  3QR8 A;  2WAQ G;  1TWG B;  2F0T A;  4A3D G;  2UXC Q;  2JEB I;  4RGM A;  3HOU B;  1PRT C;  2BE5 C;  2EDG A;  3F8T A;  2G9D A;  2OF1 A;  3BYY B;  1TWC H;  5DLQ E;  3K5M A;  4FF4 A;  5E4X A;  2JE6 I;  2NN6 I;  4A3M B;  1WOC A;  1B1Z A;  5ELD A;  1Q82 C;  1EYC A;  1I4X A;  4OXP A;  4YY3 L;  1PH2 A;  4JI3 Q;  4GN5 A;  2B8G A;  1JC7 A;  4MIU A;  3BDL A;  1KIX A;  1AZQ A;  5ELO A;  5COY A;  2JA7 H;  3SK8 A;  1BCP B;  5EBD A;  1IBL Q;  1QZG A;  1NBW A;  1ROD A;  1Z7T A;  2F0K A;  3KK7 A;  1PH8 A;  2WB1 G;  2FMM A;  1K8G A;  2K5N A;  4A93 H;  2JK8 A;  4OEM B;  5G3L D;  1RL2 A;  5GAG C;  1ASY A;  3H3V H;  3OWF A;  1PFB A;  1EFW A;  4RKL A;  5JVG 3;  4H02 A;  5IYD G;  1M90 C;  3HOZ B;  1T9H A;  4RGT A;  1IBM Q;  1HNW L;  4IUT A;  1HNZ L;  4HIM A;  2EYL A;  4KKU A;  4YHH Q;  5E1F A;  1VF7 A;  1HXY D;  5M3F B;  5IYB G;  2E5L L;  1L1O B;  2K05 A;  2HQL A;  1SYB A;  2NN6 G;  1GO3 E;  2R93 B;  1U4P A;  4K14 A;  2Z1C A;  1C9O A;  1D5Z C;  1I4P A;  1RD9 D;  1BCP F;  1F2L A;  2NVQ B;  4BY1 H;  4BXX G;  2KCN A;  2H4O A;  4C3J H;  1L0W A;  4JOI A;  4A3I H;  5IT9 L;  5A35 A;  4BBR B;  3MXN A;  3L7Z C;  1Y8P B;  1HR0 W;  3TRE A;  1YNJ D;  2CVR A;  5KND A;  1HH2 P;  3NQI A;  3CPW A;  1NE3 A;  1I4H A;  2WAQ B;  1PFM A;  1JMC A;  4A3D B;  1YBY A;  1CTM A;  2VQF L;  2TMP A;  1A15 A;  4RHR A;  2KUM A;  3EA6 A;  4IFD H;  3J81 L;  1F2Z A;  3Q24 A;  4OWT B;  3KLW A;  3G7L A;  4EX5 A;  4KN4 C;  1O80 A;  4K6D A;  3VYT A;  2MUY A;  3DMU A;  3NEN A;  5C44 G;  4B3R L;  2FHT A;  3C3L A;  2D0O A;  3GTO B;  1PLF A;  2PQA A;  1S5C D;  3JAM i;  1NUC A;  2SOB A;  1ENA A;  1PRT B;  3OWE B;  5LHY 1;  1CKN B;  1VMP A;  2CWP A;  4AYB E;  2F4V L;  5C3X A;  2B29 A;  4GS3 A;  3BVG A;  3HKZ E;  2F3W A;  1YNN D;  5IWA L;  2F0O A;  5E7N A;  2M2L A;  2WB1 B;  1N34 L;  1VMC A;  2O2L D;  1S5B D;  3C46 A;  2VUM G;  5IY0 A;  3JAM c;  3NEM A;  1XNQ L;  1EL0 A;  3AFQ A;  1CZG A;  2B2W A;  5ISR A;  1GM5 A;  3ERQ A;  2FXQ A;  2J7Z A;  2EYF A;  2DJF C;  1VQA A;  4X65 L;  4PNY A;  3HOX H;  2QDL A;  3NTH A;  4ZKB B;  1DJR D;  3RNU A;  2IX3 A;  3J80 L;  4LF5 L;  3D6C A;  5A2Q E;  3FPU B;  2A8V A;  4P2C B;  3BDC A;  4F88 A;  1JJC B;  4FP5 D;  4DN4 M;  2UUA L;  4A3K G;  1K0S A;  1DCZ A;  4CJ0 B;  3D8G A;  3W3A A;  4NMZ A;  4DUZ Q;  1A3T A;  4R8N A;  1R4P B;  4O0A A;  4B3T L;  4QMG A;  2CHB D;  2F0D A;  2K32 A;  4JG2 A;  3Q22 A;  3HOV G;  1Q1B A;  1EZ8 A;  4DV4 Q;  3M4O H;  1PRT F;  4JYA Q;  1S72 A;  1KNA A;  5EAY A;  4LF6 L;  5FLX E;  1Z6H A;  4X64 L;  1B3Q A;  2EVB A;  5IP9 H;  1PFN A;  4ZRZ A;  2MQH A;  4TSS A;  4HED A;  2R7F A;  1STB A;  2A68 C;  3HOW G;  1E7Z A;  5KNC A;  1KAW A;  3I8Z A;  2ALY B;  1M8A A;  1SYC A;  4N9T A;  4CKB A;  1HQM C;  4QUC A;  4QJF A;  4CBV A;  4DR3 Q;  2EOT A;  4QB4 A;  5C44 B;  4R4T A;  1KLU D;  1F9Q A;  3I73 A;  2IW3 A;  5COR A;  4ALP A;  3PQI A;  3K5O A;  2KVM A;  3VA7 A;  1ILQ A;  2WIN B;  5C4X H;  1QZH A;  4E6I A;  1BXT A;  1J5E L;  4KJN A;  2ZTE A;  4YCW A;  5JEA J;  3QOL A;  4ME5 A;  1U0L A;  2AUJ D;  3T1H Q;  1HTP A;  2KBN A;  1R9T B;  2VUM B;  2WV6 D;  1EU4 A;  1DZ1 A;  1YVC A;  2F3V A;  1SEB D;  3BZC A;  1PDQ A;  1JQY D;  2ICE C;  2IPK D;  2WII B;  1L0X B;  2EIF A;  4DAP A;  3S17 H;  4ODG A;  1PH9 A;  1L0Y B;  3B6Y A;  2MO0 A;  2Q2H A;  3IKJ A;  2JA9 A;  4HJ8 A;  2F0W A;  1K73 C;  3SE0 A;  2NVX H;  2VQE L;  4FNF A;  2KCC A;  4A3K B;  1N8R C;  2A6E C;  1MBY A;  4P71 A;  5BN3 A;  1KNE A;  3MAQ A;  1JOK A;  3HOV B;  4DV7 L;  5AFW A;  5T1I A;  1MSG A;  1LTB D;  3NE5 B;  1SJH D;  2KHJ A;  3I4N H;  4K2K A;  5K5P A;  3A55 A;  3K80 C;  1NR2 A;  1SFO H;  2RKS A;  1GUT A;  3G4S A;  3OIQ A;  4Q5V A;  1TS5 A;  2KQ3 A;  4JBJ A;  3HOW B;  1QVG A;  1D5M C;  1STY A;  4I7Z C;  1JWM D;  3QB3 A;  4FVM A;  2X6L A;  5FLM G;  2DN8 A;  2RCN A;  2JA6 G;  1SAP A;  4LF4 L;  4HSP A;  1TII D;  1KDC A;  4OX9 Q;  2A1A A;  2UUC L;  1A2U A;  5HUR A;  5LL6 S;  4GNX C;  3EVQ A;  4YWK A;  4CDE C;  3QIA A;  3FKI H;  2L12 A;  3DEO A;  1S40 A;  3CCS A;  1F9S A;  4LF8 Q;  3ZJY C;  2NVT H;  4LFA Q;  1A8V A;  3OMG A;  3NTI A;  4A4I A;  4HTH A;  4IPD A;  3T1Y Q;  3KF6 B;  3WDN A;  4DR5 L;  4HID A;  4ZCK A;  1XPO A;  2K04 A;  3NEL A;  4ZUI A;  3S14 B;  2QW7 A;  1JJG A;  4WJW A;  5K36 G;  4B3S Q;  1JWS D;  1NCV A;  1X9N A;  2ZM6 Q;  1I50 H;  1SBB B;  4AYB G;  1FJG L;  1P16 A;  2BDN A;  1WD0 A;  1N36 L;  2F0Q A;  3HKZ G;  4K5W A;  1GXD C;  2RDH A;  2BA1 A;  3MXG A;  5M5X B;  4IN3 A;  4F8M A;  1E22 A;  4OHJ A;  1PTO D;  4F7X A;  3NSW A;  1JE4 A;  4JI6 Q;  3WWV A;  3CRK C;  1SN8 A;  1H9S B;  3MFY A;  4NW2 A;  1QE6 A;  4L8J A;  1RKN A;  4AQY Q;  2RQX A;  3S2D H;  4DNR B;  4DR4 L;  2PZU A;  4RCO A;  3E6Z X;  5CV5 A;  4JBK A;  4L5T A;  1EWH A;  1CQV A;  1V43 A;  3S16 B;  3T4A C;  2UUB Q;  2RBM A;  4KJO A;  1I94 Q;  2QF7 A;  3A7A B;  4A3B G;  3D4W A;  4X66 L;  4QCL A;  1EY5 A;  1XXG A;  3OSO A;  2B2T C;  2JA6 B;  3TS0 A;  2X69 A;  5E3F A;  1S5F D;  3CCQ A;  1HQR D;  1PZJ D;  2JXM B;  3F2U A;  5IYC G;  1SJE D;  3J7Y W;  5M5W B;  1VQ7 A;  3X3N A;  4DV3 L;  4TKO B;  3MEH A;  3Q23 A;  2ES2 A;  4KKT A;  2SNM A;  1SYF A;  1VQ9 A;  3BVZ A;  1QWY A;  3GTM B;  5ELF A;  1HPC A;  2BCO A;  3CCE A;  2RHQ B;  3MXP A;  4BBS G;  1RF2 D;  2HUG A;  2R7Z H;  2UXD L;  4G7O C;  2QGQ A;  4JI8 Q;  1LO5 D;  4JI0 Q;  1IKM A;  4I65 A;  3ERS X;  2PZT A;  4BY7 G;  3PO3 G;  4RA8 A;  1E1T A;  3HEJ A;  1GD7 A;  2NVY H;  1G2T A;  2M00 A;  3CD6 A;  3DEP A;  3KDF A;  4GNX B;  1I5F A;  4AYB B;  2EY2 A;  4IPC A;  3NP8 A;  1W6K A;  2P5Z X;  1V1P B;  3HKZ B;  4LUO A;  4DR2 Q;  4QIW B;  1D6E C;  1EY4 A;  1ENF A;  5I6W A;  1AN8 A;  2RA4 A;  1EU3 A;  3H3V I;  1JOR A;  2XWB B;  5IGC A;  3P7J A;  3NWS A;  5I9O A;  4JI2 Q;  2KEE A;  4NP5 A;  5JJL A;  3N6R A;  3M85 A;  5FO9 B;  5I9P A;  3IAY A;  4DK0 A;  2F0J A;  3E3X A;  1D2B A;  1BCP D;  1H9M A;  3VR3 A;  1A0I A;  3I90 A;  1TS2 A;  4GKJ L;  1A3V A;  2K28 A;  3BZD B;  5EQ0 A;  2XRQ D;  5J39 A;  1B3A A;  4GOP A;  3DXJ C;  2HQE A;  1B50 A;  4A3E H;  2YU9 B;  4A3B B;  5K36 H;  3K7A H;  2PYK A;  4IPH A;  4UP7 A;  3WOF A;  3S1R H;  5LMN L;  1TWF B;  5F2D A;  2VB3 X;  2D0P A;  4DNT B;  5C0X J;  5KGU A;  1BBW A;  3H3V C;  4DUY L;  1KRT A;  4FXG C;  3VYR A;  1HNX L;  1VF5 C;  1BBU A;  2JA5 G;  1C48 A;  1TU2 B;  2PPB C;  2EYM A;  4OO1 I;  4PZ6 A;  2PMZ B;  3HGB A;  4LNQ A;  1VQH A;  4UY8 C;  5DNF A;  2AKW B;  4L6T B;  4B08 A;  4EGV A;  3GTP H;  2VW9 A;  3KYH C;  3L0O A;  5EKL A;  4BBS B;  1Y1V G;  2KA7 A;  4B9W A;  1VQE A;  1SNO A;  1IBL L;  5FJ8 H;  5CV6 A;  1X3G A;  3PO3 B;  4BY7 B;  1HUN A;  1LTT D;  3MEF A;  2EXD A;  4KHV A;  2A19 A;  2ZXP A;  3PIP A;  1PFS A;  3CHB D;  3F2C A;  2HDM A;  3FVQ A;  4GKK L;  1WFQ A;  1EY8 A;  4O2D A;  1K8A C;  3GTQ B;  3CMA A;  1WTP A;  1TWA B;  1X3E A;  1P8L A;  2R92 H;  5HGT A;  1I4R A;  4UP8 A;  1J9O A;  1O78 A;  3TS2 A;  1IL8 A;  2WP8 J;  1HTL D;  1Q3L A;  5D3D A;  5A2Q L;  1SXT A;  3NUC A;  1TWH B;  4GOP C;  1LTA D;  1KL9 A;  2MNA A;  1EYA A;  1PTO H;  2B63 H;  2F52 A;  4GLX A;  1FGB D;  3UDF A;  2XIW A;  3E5S A;  2ATW A;  3CC7 A;  2N3S A;  5DM6 3;  3KLR A;  3A56 A;  2AQ2 B;  1LTI D;  2F0F A;  1UE6 A;  1WCM H;  3M7G A;  3MXU A;  3T13 A;  1PRT D;  3VR5 A;  2BE5 D;  1G6Z A;  2ID0 A;  1MKH A;  4LF7 L;  4OO1 G;  1PYS B;  2YYZ A;  3T53 B;  2HT1 A;  4Y52 H;  2AUK A;  1MGS A;  1BUV T;  2EYP A;  3TQY A;  2CWA A;  2MP1 A;  3PIO A;  3S1N H;  1EEI D;  4EQ5 A;  5FLX L;  1SSO A;  1N33 L;  3HOY G;  3I55 A;  5EBC A;  4R9W A;  2KOL A;  3TP7 A;  3X3M A;  4DV0 Q;  4FF3 A;  2M9V A;  2JYO A;  3CU7 A;  4R4O A;  1SND A;  3RR5 A;  3JC6 6;  4TVA B;  2UU9 L;  3PUV A;  5C5L A;  4HMJ A;  2K6A A;  2MFI A;  1VDZ A;  2B2V A;  2MO1 A;  4OGQ C;  2JA5 B;  2EQS A;  2C5C A;  4ULL A;  4IOC A;  2I5M X;  1TKW B;  5C5M A;  3S15 H; 
#chains in the Genus database with same CATH homology
 1X65 A;  1VQK A;  2K5V A;  2NZH A;  5HGQ A;  4A3K G;  1C7Y A;  2OTL A;  1XJV A;  3PO2 G;  2UXB L;  4X6A H;  3CCR A;  1TXY A;  4DUZ Q;  1XMO Q;  1B8A A;  1WJJ A;  3S1Q H;  5M3M H;  4DAY B;  1RIP A;  2KEN A;  2R7D A;  3CQZ H;  4YWM A;  4O0A A;  4JI1 L;  3ULJ A;  3W1G A;  1VQ4 A;  1UWV A;  3Q8D A;  4B3T L;  3S1M H;  4JG2 A;  3HOV G;  3I2Z A;  1Q1B A;  3STB C;  4DK3 C;  1YIT A;  3VDY A;  2BA0 A;  3HKS A;  1YJW A;  1XPR A;  4DV4 Q;  4B3M Q;  3M4O H;  2LSS A;  3W1B A;  4JYA Q;  1IBK Q;  1D8L A;  4NXM Q;  5JJI A;  2OQ0 A;  5J3B A;  2I5L X;  4DR2 L;  1S72 A;  1H95 A;  2UXC L;  5EAY A;  3U50 C;  2VS1 A;  3LGJ A;  4A76 A;  1YHQ A;  1PH4 A;  4LF6 L;  4WJ4 A;  4DPG A;  1TWG H;  1OXU A;  4KHZ A;  1KHI A;  4X64 L;  5IP9 H;  3F1Z A;  1L1O A;  3HOU H;  4JCV E;  3G6E A;  3UDX A;  2MQH A;  2LXJ A;  2JA8 G;  4LFC Q;  2R7F A;  3H15 A;  4JI2 L;  4DR4 Q;  3HOW G;  1E7Z A;  4NXN Q;  3A5U A;  3RZD H;  1KAW A;  2JA7 G;  4A3M H;  4DR6 L;  1N32 Q;  3M4Q A;  2IX0 A;  5LMN W;  1WI5 A;  4QQB X;  3M3Y H;  1AE3 A;  3FHW A;  2ALY B;  4JI3 L;  3M9B A;  4A3E G;  1PH6 A;  1LYL A;  4LUV A;  4IFD I;  2PI2 A;  4A3L H;  1OXV A;  3D0F A;  4QJF A;  4A93 G;  4DR3 Q;  1PHJ A;  3CCL A;  4X66 Q;  4DR1 Q;  4JI4 L;  4K0K Q;  3K81 C;  4IFD J;  1PH3 A;  5BR8 Q;  1CSP A;  4R4T A;  4L5Q A;  3M4P A;  4OON A;  4DR7 Q;  3D31 A;  1K3R A;  4ALP A;  1KRS A;  4YCV A;  4C2M H;  1V9P A;  4KLK A;  5C4X H;  2Q2I A;  4A3B H;  1NMG A;  1QZH A;  1J5E L;  3J81 i;  2AMC B;  5IT9 c;  4PG3 A;  1K9M C;  2ZTE A;  4YCW A;  3H0G H;  3S24 A;  4GLV B;  5JEA J;  1U0L A;  3T1H Q;  1TWF H;  1CKM A;  1SLJ A;  4DV3 Q;  2DUD A;  4NPS A;  4A3J H;  3K0X A;  2KBN A;  1NJI C;  3CXC A;  1Z47 A;  2ASB A;  1YVC A;  4JI7 L;  4BA1 I;  1X55 A;  3BZC A;  2GVB A;  1Y1W H;  1IBM L;  2KHI A;  3UDG A;  5IYC H;  5LMU Q;  2Y0S G;  4YHH L;  3J81 c;  2UXD Q;  3BZK A;  5FJ8 G;  3HOZ H;  3AFP A;  5GAD C;  4LUZ A;  1HR0 L;  1UE5 A;  1CKN A;  1VQ5 A;  2EIF A;  1FL0 A;  1SE8 A;  1X6O A;  2K50 A;  4DR3 L;  3S17 H;  4WJ3 M;  1PH9 A;  3B6Y A;  2MO0 A;  1MJC A;  2Q2H A;  5M3F H;  2JA9 A;  1Q7Y C;  1U5K A;  4YCU A;  4HJ8 A;  1D7Q A;  5GQO A;  4BBS H;  3RZO H;  4BY1 G;  5GAH C;  1X3F A;  1K73 C;  2ZJQ A;  2A8V A;  1VCI A;  2NVX H;  2Q2U A;  3KFU A;  1I6H H;  4JV5 Q;  4A3I G;  2OQK A;  2VQE L;  1XPU A;  3E9I A;  1Y14 B;  1N8R C;  2DGY A;  2R92 G;  4BY7 H;  3PO3 H;  2XGT A;  4P71 A;  1VQJ A;  2R93 H;  4PMW A;  2K5H A;  2WB1 E;  3U4V A;  5IP7 H;  2OCE A;  5FLX c;  3G48 A;  3J7A 5;  1JT8 A;  2AWN A;  4DV7 L;  1KC8 C;  1MJE A;  2NVQ H;  3IRB A;  2R6G A;  2B63 G;  3J80 i;  3AYH B;  3ULP A;  4KHP Q;  2KHJ A;  3GTQ H;  4BBR H;  3I4N H;  1TWA H;  4XIG S;  4DKA C;  1IYJ B;  4OWX B;  1CKO A;  3K80 C;  2OTJ A;  2K4K A;  1SFO H;  3I4M G;  2GN5 A;  3ER0 A;  2WFW A;  1SR3 A;  2BH2 A;  4LFB Q;  1WCM G;  1SMX A;  1G6P A;  3I4O A;  4A3D H;  4TQU S;  3G4S A;  1JJ2 A;  3OTO Q;  1JB7 A;  4HIK A;  1TWH H;  3FP9 A;  3HFZ B;  4JBJ A;  3J80 c;  2N78 A;  1QVG A;  1LTL A;  1MIU A;  4GKJ Q;  2HHH Q;  1LUZ A;  3L2P A;  1XMQ Q;  1NY4 A;  5C3E H;  4QGU A;  1QVC A;  4GN4 B;  5FLM G;  4IJL A;  4JOI C;  2AHO B;  2RCN A;  2JA6 G;  3GTO H;  4LF4 L;  1C0A A;  3ULL A;  1EUJ A;  1CSQ A;  1VQM A;  1VQI A;  3AEV A;  4OX9 Q;  2E8G A;  1Q1E A;  5LMN Q;  1OXT A;  5JJK A;  3PSI A;  4RG1 A;  2A1A A;  2UUC L;  3M7N A;  1OXS C;  1E3P A;  4PZ8 A;  3F2B A;  4DUY Q;  3HOX G;  4GNX C;  4YWK A;  2N49 A;  1HNX Q;  3KF8 B;  4DV0 L;  3KDF B;  3RN5 A;  3FKI H;  3GTL H;  1PH7 A;  2CQO A;  1YZ6 A;  3RN2 A;  3OW2 A;  3OTO L;  1S40 A;  3A5Z B;  1HNW Q;  3GO5 A;  2Y0S E;  3UE0 A;  1Q46 A;  1HNZ Q;  3CME A;  3CCS A;  3U58 A;  4J15 A;  3ZJY C;  4A3F H;  1HZA A;  3F2D A;  1VQP A;  1YJ9 A;  1YNX A;  4LFA Q;  1OTC A;  1ASZ A;  2NVT H;  1A8V A;  3CP0 A;  5C4J H;  3GDE A;  4P73 A;  3J81 j;  4A4I A;  4R4I A;  4IPD A;  5IYD H;  1HZC A;  4QY7 A;  3T1Y Q;  4LF9 L;  3KF6 B;  2HIX A;  5M3M G;  1E24 A;  4DR5 L;  2JA5 H;  4POG A;  2VNU D;  5JEA G;  3SGI A;  2E5L Q;  4HID A;  4AIM A;  1XPO A;  3PGZ A;  2F3I A;  3NEL A;  3PV0 A;  4PZ7 A;  3RLO A;  1YI2 A;  4JBM A;  4JI5 Q;  3J7Z C;  4A3G G;  1YEZ A;  5K36 G;  3CF5 A;  4B3S Q;  1JJG A;  5IYB H;  2VZA A;  2ZM6 Q;  4DUZ L;  1I50 H;  1Y1V H;  1XMO L;  4AYB G;  1X9N A;  3NBH B;  1FJG L;  1P16 A;  1N36 L;  3HKZ G;  1VQO A;  3GTJ H;  4GKK Q;  4GLA C;  2BA1 A;  3OYY A;  4DV5 Q;  5IP9 G;  3HOU G;  4X62 Q;  4DV4 L;  4NB3 A;  4B3M L;  1L2F A;  1UEB A;  1E22 A;  4JYA L;  1IBK L;  4NXM L;  4JI6 Q;  5IE8 A;  3WWV A;  2ZJP A;  2YU9 H;  1QUQ B;  1SN8 A;  2BH8 A;  3PF5 A;  4L5R C;  4GOP B;  4LW1 A;  4A3M G;  1PH5 A;  2C35 B;  4BXX H;  1VQB A;  3CCU A;  4DV2 Q;  2VQF Q;  5GRO A;  2D62 A;  4AQY Q;  2UUA L;  3E9H A;  4C3I H;  4JC0 A;  3S2D H;  4A3L G;  4LFC L;  1Q8K A;  3A74 A;  4AH6 A;  4DR4 L;  4QL5 A;  1K83 H;  4NXN L;  1DGS A;  2PNH A;  4MNO A;  4JBK A;  4L5T A;  1YJN A;  1N32 L;  2IHE A;  4DV1 Q;  1V43 A;  1FGU A;  2K52 A;  3BU2 A;  1PV4 A;  2UUB Q;  3CW2 C;  1Z9F A;  1WYD A;  1N36 Q;  2VY3 A;  4A75 A;  2IY5 B;  4C3H H;  1I94 Q;  4B3R Q;  1YHA A;  1N9W A;  2Q2T A;  5C4X G;  1SRO A;  4A3B G;  4X66 L;  1B70 B;  4DR1 L;  4LF7 Q;  4K0K L;  1X54 A;  2AWO A;  3H0G G;  3AQQ A;  4GN3 B;  5BR8 L;  3PUY A;  5AJ3 Q;  2OWO A;  3W5O A;  1OXX K;  4A3J G;  1PH1 A;  2F4V Q;  4DR7 L;  4DNI A;  5C44 H;  1IZ6 A;  3TS0 A;  4P75 A;  1E1O A;  3CCQ A;  2I5H A;  5IWA Q;  1L1O C;  1YHB A;  1KQS A;  1N34 Q;  1Y1W G;  1N33 Q;  1BVS A;  5IYC G;  2B3G A;  1O7I A;  1VQ7 A;  3T1H L;  4A3C H;  3HOZ G;  3U4Z A;  1B7Y B;  4DV3 L;  4IO9 A;  2ES2 A;  1XNQ Q;  1VQ9 A;  3CCJ A;  2YV5 A;  4IFD G;  1EQQ A;  3GTG H;  2UU9 Q;  3CCE A;  5M3F G;  1R9T H;  2VUM H;  3HOY H;  1S3O A;  2RHQ B;  3CCM A;  1I3Q H;  4X65 Q;  4DV1 L;  1X56 A;  3GTK H;  4BBS G;  5LMU L;  3PCO B;  2R7Z H;  4MZ9 A;  2QEX A;  2UXD L;  2QGQ A;  4JI8 Q;  2NZO A;  3I56 A;  3MXN B;  2HIV A;  1IXR A;  4DV6 Q;  4JI0 Q;  4LF5 Q;  1CUK A;  1W2B A;  3EIV A;  2IX1 A;  3ERS X;  5M5Y H;  1XNR Q;  4BY7 G;  3PO3 G;  4YY3 Q;  2CFM A;  2UUA Q;  1LM0 A;  3STB D;  2UXB Q;  4HJA A;  1E1T A;  2R93 G;  5IP7 G;  5ELN A;  1GD7 A;  2NVY H;  3KJO A;  4JV5 L;  3CD6 A;  4JI1 Q;  1HZB A;  3KDF A;  4B3T Q;  4GNX B;  1I5F A;  1EIY B;  2JQO A;  3K7U C;  1PA6 A;  1VQD A;  4QIW E;  2JEA I;  2CKZ B;  3S2H H;  4R1J A;  4BBR G;  3EN2 A;  3I4N G;  4A3G H;  4A3K H;  2JJQ A;  4IPC A;  1VQN A;  4FDB A;  3PO2 H;  1Q86 C;  3K8A A;  5GAE C;  2ZJR A;  4LUO A;  1VS0 A;  2K14 A;  2WAQ G;  4DR2 Q;  1AH9 A;  5HY6 A;  2CCZ A;  4A3D G;  2UXC Q;  2JEB I;  3KF6 A;  1PYB A;  4IPG A;  4LF6 Q;  2PQA B;  3F8T A;  3H3V I;  3PUZ A;  3HOV H;  4KHP L;  2K75 A;  3RLF A;  1A63 A;  1TWC H;  4JBW A;  5DLQ E;  1NMF A;  1XTD A;  3KJP A;  1NTG A;  2JE6 I;  2NN6 I;  1WOC A;  1GVP A;  1W3S A;  4JI2 Q;  5JJL A;  4LFB L;  1Q82 C;  1UE7 A;  3DM3 A;  3UDI A;  3M85 A;  2RHS B;  5C3E G;  4DR6 Q;  4OXP A;  2L15 A;  4YY3 L;  2QA4 A;  1PH2 A;  4HJ9 A;  4GN5 A;  4HIO A;  4JI3 Q;  2XTI A;  2JA8 H;  1A0I A;  4XTC S;  2GVA A;  4GKJ L;  4Y7N H;  1KIX A;  2HHH L;  2Z6K A;  5ELO A;  3HOW H;  4BA2 I;  1XMQ L;  2VL6 A;  4JI4 Q;  3PUW A;  2YTV A;  1Q12 A;  2JA7 H;  1QUQ A;  1KXL A;  1IBL Q;  1QZG A;  4GOP A;  1NBW A;  1PH8 A;  4A3E H;  3K7A H;  4YWL A;  2WB1 G;  4HJ5 A;  1K8G A;  2K5N A;  4A93 H;  3FKI G;  1GKH A;  4IPH A;  2JK8 A;  4UP7 A;  3S1R H;  4OX9 L;  5LMN L;  5H1S E;  1G51 A;  1J5E Q;  2D0P A;  5C0X J;  1RL2 A;  5GAG C;  1ASY A;  4A3F G;  3H3V H;  2PMZ E;  1BBW A;  4DUY L;  1EFW A;  1KRT A;  2V1C C;  1HNX L;  4H02 A;  3G71 A;  5IYD G;  1HZ9 A;  4JI7 Q;  3PUX A;  1BBU A;  1V1Q A;  1M90 C;  4HJ7 A;  2JA5 G;  1T9H A;  2ZTC A;  4OO1 I;  1IBM Q;  1HNW L;  4PZ6 A;  1HNZ L;  4HIM A;  1VQH A;  4YHH Q;  1Q81 C;  4LF8 L;  4LNQ A;  2AKW B;  4UY8 C;  4LFA L;  4MTN A;  1HR0 Q;  3GTP H;  2VW9 A;  3KYH C;  4DK6 C;  5IYB G;  3L0O A;  1Y1V G;  3T1Y L;  3CCV A;  1VQ6 A;  1VQE A;  4POF A;  2E5L L;  3RLN A;  1FVI A;  4RMF A;  1IBL L;  2I0Q A;  1SRU A;  3CC4 A;  1L1O B;  2YTY A;  4JI5 L;  5FJ8 H;  2HQL A;  4UPA A;  1X3G A;  3TEH B;  2VQE Q;  4B3S L;  3ICE A;  2NN6 G;  1GO3 E;  2ZM6 L;  2PI2 E;  3S14 H;  1EYG A;  3MEF A;  2EXD A;  2Z0S A;  1C9O A;  2A19 A;  1EWI A;  4P74 A;  1PFS A;  3GD7 A;  3PIP A;  3F2C A;  4BY1 H;  4OWW B;  4BXX G;  4GKK L;  1WFQ A;  1UE1 A;  2WAQ E;  2N8N A;  4C3J H;  1L0W A;  4KI0 A;  4DV5 L;  4JOI A;  4O2D A;  3CAM A;  4X62 L;  5C0X I;  3CMA A;  4DV7 Q;  4A3I H;  1K8A C;  3L7Z C;  1X3E A;  1VQF A;  2IT1 A;  1HR0 W;  3TRE A;  4JI6 L;  1AE2 A;  1P8L A;  3E0E A;  4APV A;  5M5X H;  2R92 H;  3TRZ A;  3KOJ A;  1HH2 P;  4R4Q A;  3CPW A;  1NE3 A;  4UP8 A;  2Z6K C;  1JMC A;  4R4C A;  3TS2 A;  1VQC A;  2WP8 J;  1YBY A;  1YIJ A;  1FJG Q;  4LWC A;  4DAM A;  2VQF L;  4DV2 L;  4UP9 A;  4GOP C;  4AQY L;  1G29 1;  1KL9 A;  2MNA A;  2B63 H;  2F52 A;  4GLX A;  3EBE A;  4GNX A;  3CC2 A;  4IOA A;  3UDF A;  2ATW A;  4OWT B;  3KLW A;  3CC7 A;  4EX5 A;  2LXK A;  2N3S A;  2YTX A;  1KD1 C;  4L5S A;  3I4M H;  3A0J A;  2UUB L;  1UE6 A;  1WCM H;  3NEN A;  1VQ8 A;  5C44 G;  1I94 L;  4B3R L;  3S16 H;  2ZTD A;  2D0O A;  2ID0 A;  1MKH A;  2PQA A;  4LF7 L;  3JAM i;  4OO1 G;  2YYZ A;  1PYS B;  2RF4 A;  2HT1 A;  4Y52 H;  4LF4 Q;  1QVF A;  4A3C G;  1CKN B;  2CWP A;  5AJ3 L;  4AYB E;  3TQY A;  3UE1 A;  2E2I H;  2F4V L;  2CWA A;  1PVO A;  2B29 A;  4GS3 A;  3HKZ E;  4P72 A;  1HJP A;  3PIO A;  3S1N H;  3I7F A;  4EQ5 A;  5IWA L;  5FLM H;  2UUC Q;  5E7N A;  1N34 L;  2H5X A;  1EOV A;  2KCT A;  2JA6 H;  1EQR A;  1A62 A;  1K0R A;  1N33 L;  2VUM G;  3HOY G;  2KCM A;  3I55 A;  1EIF A;  2R7Z G;  5IY0 A;  3JAM c;  3PF4 A;  4DV0 Q;  1VQL A;  4LF8 Q;  3NEM A;  1XNQ L;  1VQG A;  2E2H H;  3AFQ A;  4R4O A;  5M5W H;  4IJH A;  1GM5 A;  3RR5 A;  3JC6 6;  4TVA B;  2FXQ A;  2UU9 L;  3PUV A;  1IL2 A;  2MFI A;  1VQA A;  2MO1 A;  4X64 Q;  4X65 L;  3HOX H;  2IHF A;  3DLL A;  1M1K C;  3CPF A;  3GTM H;  4JI8 L;  3RNU A;  2EQS A;  4LF9 Q;  4DR5 Q;  3S15 H;  1BKB A;  5C0X G;  4DV6 L;  4JI0 L;  4LF5 L;  4IOC A;  2I5M X;  4ME3 A;  1JE5 A;  1XNR L;  2E2J H;  3BJU A;  1J6Q A;  1JJC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...