1JMGA

Contributions of orientation and hydrogen bonding to catalysis in asn-229 mutants of thymidylate synthase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
316
structure length
316
Chain Sequence
MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDLSKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNHIWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHEEMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDTIDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHTLYQFYVNDGKLSLQLYQRSADIFLGVPFGIASYALLTHLVAHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAPTLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contributions of orientation and hydrogen bonding to catalysis in Asn229 mutants of thymidylate synthase.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Lactobacillus casei
total genus 96
structure length 316
sequence length 316
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1997-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1jmgA00
1NJBA 1BQ2A 2RD8A 4G2OX 3H9KA 3BHRA 2KCEA 2BBQA 3BNZA 4E28A 1TVVA 4IQQA 3UM6A 3EF9A 2G8AA 3CL9A 2TSRA 4EZ8A 4EILA 4GYHA 3IRMA 3HB8A 1JMIA 1F28A 3HJ3A 1TVUA 4ISKA 3QJ7A 2G86A 1TSLA 3GH0A 3IROA 2G89A 4IQBA 4O1UA 1TSWA 2H2QA 1B02A 1TLCA 1JMFA 1LCEA 3C0AA 1TSYA 3IJZA 1THYA 3HBBA 1TSZA 1BP0A 1EV5A 2RD8B 3QGTA 1JG0A 1TSMA 1F4GA 3UWLA 1NJEA 1BKOA 4FOAA 1DDUA 1SYNA 1TSXA 1DNAA 3DGAC 3DL6A 5H39A 5J7WA 3NRRA 1JTUA 1TDUA 3EHIX 3V8HA 3BZ0A 1JTQA 1TSNA 2FTOX 1TDAA 3TMSA 4KYAA 4JEFA 1BPJA 3UM8A 4Q0EA 1BO7A 4Q0DA 1TYSA 1QZFA 3IK0A 1F4BA 1TDBA 3DL5A 3EBUA 4FOGA 2TSCA 4GD7A 4H1IA 1B5DA 1AN5A 4TMSA 3DG8C 5WRNA 1BJGA 3UM5A 3UWLB 3N5EA 2OIPA 3IX6A 1LCAA 1KZIA 1TLSA 1TISA 4KY8A 1HVYA 1EVFA 1VZDA 4DP3A 3IRNA 5BY6A 2RDAA 3B5BA 1BDUA 4O7UA 3GH2X 5H38A 4KNZA 2FTNA 1AIQA 4O1XD 1B49A 2G8DA 4FQSA 1AXWA 3C06A 3OB7A 4FOXA 4EB4A 4GEVA 3B9HA 1F4CA 3N5EB 4EINA 1BSFA 1VZEA 3JSUA 4XSEA 3EDWX 4ISWA 3KGBA 2FTQA 1NJDA 1FWMA 1FFLA 4H0RA 2TDDA 5FCTA 1BO8A 3I3RA 1AJMA 1AOBA 4DPDA 3KJSA 1TSVA 1HZWA 1JMGA 2TDMA 1EV8A 1BSPA 1J3IC 1HW3A 4KY4A 1F4DA 1F4EA 1I00A 1BIDA 4XSDA 4H0UA 1VZAA 1JUTA 1TVWA 4UP1A 3CLBA 4PSGA 1CI7A 1LCBA 1TDCA 4G6WX 4O1XA 1BP6A 5H3AA 1YPVA 3N5GA 3IK1A 4ECKA 4E5OA 4FGTA 1NJAA 1TJSA 3K2HA 1ZPRA 1NJCA 3BHLA 1TRGA 4IRRA 1J3JC 1J3KC 1SEJA 1RTSA 3BFIA 3KJRA 1KCEA 3ED7A 3BYXA 3EJLA 4DQ1A 3IHIA 1EVGA 2G8XA 4XSCA 4DPHA 1B5EA 1BQ1A 1JUJA 1VZBA 5HS3A 1QQQA 4KPWA 1VZCA 3INVA 4F2VA 2AAZA 1HW4A 3QG2A 3BGXA 1JMHA 3GG5A 2ONBA 1JU6A 4LRRA 3EAWX 1TSDA 3EGYX 2A9WA 1BKPA 1KZJA 2VF0A 1NCEA 1F4FA 2VETA
chains in the Genus database with same CATH superfamily
1NJBA 1BQ2A 2RD8A 4G2OX 3H9KA 3BHRA 2KCEA 2BBQA 3BNZA 4E28A 1TVVA 4IQQA 3UM6A 3EF9A 2G8AA 3CL9A 2TSRA 4EZ8A 4EILA 4GYHA 3IRMA 3HB8A 1JMIA 1F28A 3HJ3A 1TVUA 4ISKA 3QJ7A 2G86A 1TSLA 3GH0A 3IROA 2G89A 4IQBA 4O1UA 1TSWA 2H2QA 1B02A 1TLCA 1JMFA 1LCEA 3C0AA 1TSYA 3IJZA 1THYA 3HBBA 1TSZA 1BP0A 1EV5A 2RD8B 3QGTA 1JG0A 1TSMA 1F4GA 3UWLA 1NJEA 1BKOA 4FOAA 1DDUA 1SYNA 1TSXA 1DNAA 3DGAC 3DL6A 5H39A 5J7WA 3NRRA 1JTUA 1TDUA 3EHIX 3V8HA 3BZ0A 1JTQA 1TSNA 2FTOX 1TDAA 3TMSA 4KYAA 4JEFA 1BPJA 3UM8A 4Q0EA 1BO7A 4Q0DA 1TYSA 1QZFA 3IK0A 1F4BA 1TDBA 3DL5A 3EBUA 4FOGA 2TSCA 4GD7A 4H1IA 1B5DA 1AN5A 4TMSA 3DG8C 5WRNA 1BJGA 3UM5A 3UWLB 3N5EA 2OIPA 3IX6A 1LCAA 1KZIA 1TLSA 1TISA 4KY8A 1HVYA 1EVFA 1VZDA 4DP3A 3IRNA 5BY6A 2RDAA 3B5BA 1BDUA 4O7UA 3GH2X 5H38A 4KNZA 2FTNA 1AIQA 4O1XD 1B49A 2G8DA 4FQSA 1AXWA 3C06A 3OB7A 4FOXA 4EB4A 4GEVA 3B9HA 1F4CA 3N5EB 4EINA 1BSFA 1VZEA 3JSUA 4XSEA 3EDWX 4ISWA 3KGBA 2FTQA 1NJDA 1FWMA 1FFLA 4H0RA 2TDDA 5FCTA 1BO8A 3I3RA 1AJMA 1AOBA 4DPDA 3KJSA 1TSVA 1HZWA 1JMGA 2TDMA 1EV8A 1BSPA 1J3IC 1HW3A 4KY4A 1F4DA 1F4EA 1I00A 1BIDA 4XSDA 4H0UA 1VZAA 1JUTA 1TVWA 4UP1A 3CLBA 4PSGA 1CI7A 1LCBA 1TDCA 4G6WX 4O1XA 1BP6A 5H3AA 1YPVA 3N5GA 3IK1A 4ECKA 4E5OA 4FGTA 1NJAA 1TJSA 3K2HA 1ZPRA 1NJCA 3BHLA 1TRGA 4IRRA 1J3JC 1J3KC 1SEJA 1RTSA 3BFIA 3KJRA 1KCEA 3ED7A 3BYXA 3EJLA 4DQ1A 3IHIA 1EVGA 2G8XA 4XSCA 4DPHA 1B5EA 1BQ1A 1JUJA 1VZBA 5HS3A 1QQQA 4KPWA 1VZCA 3INVA 4F2VA 2AAZA 1HW4A 3QG2A 3BGXA 1JMHA 3GG5A 2ONBA 1JU6A 4LRRA 3EAWX 1TSDA 3EGYX 2A9WA 1BKPA 1KZJA 2VF0A 1NCEA 1F4FA 2VETA
chains in the Genus database with same CATH topology
1NJBA 1BQ2A 2RD8A 4G2OX 3H9KA 3BHRA 2KCEA 2BBQA 3BNZA 4E28A 1TVVA 4IQQA 3UM6A 3EF9A 2G8AA 3CL9A 2TSRA 4EZ8A 4EILA 4GYHA 3IRMA 3HB8A 1JMIA 1F28A 3HJ3A 1TVUA 4ISKA 3QJ7A 2G86A 1TSLA 3GH0A 3IROA 2G89A 4IQBA 4O1UA 1TSWA 2H2QA 1B02A 1TLCA 1JMFA 1LCEA 3C0AA 1TSYA 3IJZA 1THYA 3HBBA 1TSZA 1BP0A 1EV5A 2RD8B 3QGTA 1JG0A 1TSMA 1F4GA 3UWLA 1NJEA 1BKOA 4FOAA 1DDUA 1SYNA 1TSXA 1DNAA 3DGAC 3DL6A 5H39A 5J7WA 3NRRA 1JTUA 1TDUA 3EHIX 3V8HA 3BZ0A 1JTQA 1TSNA 2FTOX 1TDAA 3TMSA 4KYAA 4JEFA 1BPJA 3UM8A 4Q0EA 1BO7A 4Q0DA 1TYSA 1QZFA 3IK0A 1F4BA 1TDBA 3DL5A 3EBUA 4FOGA 2TSCA 4GD7A 4H1IA 1B5DA 1AN5A 4TMSA 3DG8C 5WRNA 1BJGA 3UM5A 3UWLB 3N5EA 2OIPA 3IX6A 1LCAA 1KZIA 1TLSA 1TISA 4KY8A 1HVYA 1EVFA 1VZDA 4DP3A 3IRNA 5BY6A 2RDAA 3B5BA 1BDUA 4O7UA 3GH2X 5H38A 4KNZA 2FTNA 1AIQA 4O1XD 1B49A 2G8DA 4FQSA 1AXWA 3C06A 3OB7A 4FOXA 4EB4A 4GEVA 3B9HA 1F4CA 3N5EB 4EINA 1BSFA 1VZEA 3JSUA 4XSEA 3EDWX 4ISWA 3KGBA 2FTQA 1NJDA 1FWMA 1FFLA 4H0RA 2TDDA 5FCTA 1BO8A 3I3RA 1AJMA 1AOBA 4DPDA 3KJSA 1TSVA 1HZWA 1JMGA 2TDMA 1EV8A 1BSPA 1J3IC 1HW3A 4KY4A 1F4DA 1F4EA 1I00A 1BIDA 4XSDA 4H0UA 1VZAA 1JUTA 1TVWA 4UP1A 3CLBA 4PSGA 1CI7A 1LCBA 1TDCA 4G6WX 4O1XA 1BP6A 5H3AA 1YPVA 3N5GA 3IK1A 4ECKA 4E5OA 4FGTA 1NJAA 1TJSA 3K2HA 1ZPRA 1NJCA 3BHLA 1TRGA 4IRRA 1J3JC 1J3KC 1SEJA 1RTSA 3BFIA 3KJRA 1KCEA 3ED7A 3BYXA 3EJLA 4DQ1A 3IHIA 1EVGA 2G8XA 4XSCA 4DPHA 1B5EA 1BQ1A 1JUJA 1VZBA 5HS3A 1QQQA 4KPWA 1VZCA 3INVA 4F2VA 2AAZA 1HW4A 3QG2A 3BGXA 1JMHA 3GG5A 2ONBA 1JU6A 4LRRA 3EAWX 1TSDA 3EGYX 2A9WA 1BKPA 1KZJA 2VF0A 1NCEA 1F4FA 2VETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJB A;  1BQ2 A;  2RD8 A;  4G2O X;  3H9K A;  3BHR A;  2KCE A;  2BBQ A;  3BNZ A;  4E28 A;  1TVV A;  4IQQ A;  3UM6 A;  3EF9 A;  2G8A A;  3CL9 A;  2TSR A;  4EZ8 A;  4EIL A;  4GYH A;  3IRM A;  3HB8 A;  1JMI A;  1F28 A;  3HJ3 A;  1TVU A;  4ISK A;  3QJ7 A;  2G86 A;  1TSL A;  3GH0 A;  3IRO A;  2G89 A;  4IQB A;  4O1U A;  1TSW A;  2H2Q A;  1B02 A;  1TLC A;  1JMF A;  1LCE A;  3C0A A;  1TSY A;  3IJZ A;  1THY A;  3HBB A;  1TSZ A;  1BP0 A;  1EV5 A;  2RD8 B;  3QGT A;  1JG0 A;  1TSM A;  1F4G A;  3UWL A;  1NJE A;  1BKO A;  4FOA A;  1DDU A;  1SYN A;  1TSX A;  1DNA A;  3DGA C;  3DL6 A;  5H39 A;  5J7W A;  3NRR A;  1JTU A;  1TDU A;  3EHI X;  3V8H A;  3BZ0 A;  1JTQ A;  1TSN A;  2FTO X;  1TDA A;  3TMS A;  4KYA A;  4JEF A;  1BPJ A;  3UM8 A;  4Q0E A;  1BO7 A;  4Q0D A;  1TYS A;  1QZF A;  3IK0 A;  1F4B A;  1TDB A;  3DL5 A;  3EBU A;  4FOG A;  2TSC A;  4GD7 A;  4H1I A;  1B5D A;  1AN5 A;  4TMS A;  3DG8 C;  5WRN A;  1BJG A;  3UM5 A;  3UWL B;  3N5E A;  2OIP A;  3IX6 A;  1LCA A;  1KZI A;  1TLS A;  1TIS A;  4KY8 A;  1HVY A;  1EVF A;  1VZD A;  4DP3 A;  3IRN A;  5BY6 A;  2RDA A;  3B5B A;  1BDU A;  4O7U A;  3GH2 X;  5H38 A;  4KNZ A;  2FTN A;  1AIQ A;  4O1X D;  1B49 A;  2G8D A;  4FQS A;  1AXW A;  3C06 A;  3OB7 A;  4FOX A;  4EB4 A;  4GEV A;  3B9H A;  1F4C A;  3N5E B;  4EIN A;  1BSF A;  1VZE A;  3JSU A;  4XSE A;  3EDW X;  4ISW A;  3KGB A;  2FTQ A;  1NJD A;  1FWM A;  1FFL A;  4H0R A;  2TDD A;  5FCT A;  1BO8 A;  3I3R A;  1AJM A;  1AOB A;  4DPD A;  3KJS A;  1TSV A;  1HZW A;  1JMG A;  2TDM A;  1EV8 A;  1BSP A;  1J3I C;  1HW3 A;  4KY4 A;  1F4D A;  1F4E A;  1I00 A;  1BID A;  4XSD A;  4H0U A;  1VZA A;  1JUT A;  1TVW A;  4UP1 A;  3CLB A;  4PSG A;  1CI7 A;  1LCB A;  1TDC A;  4G6W X;  4O1X A;  1BP6 A;  5H3A A;  1YPV A;  3N5G A;  3IK1 A;  4ECK A;  4E5O A;  4FGT A;  1NJA A;  1TJS A;  3K2H A;  1ZPR A;  1NJC A;  3BHL A;  1TRG A;  4IRR A;  1J3J C;  1J3K C;  1SEJ A;  1RTS A;  3BFI A;  3KJR A;  1KCE A;  3ED7 A;  3BYX A;  3EJL A;  4DQ1 A;  3IHI A;  1EVG A;  2G8X A;  4XSC A;  4DPH A;  1B5E A;  1BQ1 A;  1JUJ A;  1VZB A;  5HS3 A;  1QQQ A;  4KPW A;  1VZC A;  3INV A;  4F2V A;  2AAZ A;  1HW4 A;  3QG2 A;  3BGX A;  1JMH A;  3GG5 A;  2ONB A;  1JU6 A;  4LRR A;  3EAW X;  1TSD A;  3EGY X;  2A9W A;  1BKP A;  1KZJ A;  2VF0 A;  1NCE A;  1F4F A;  2VET A; 
#chains in the Genus database with same CATH topology
 1NJB A;  1BQ2 A;  2RD8 A;  4G2O X;  3H9K A;  3BHR A;  2KCE A;  2BBQ A;  3BNZ A;  4E28 A;  1TVV A;  4IQQ A;  3UM6 A;  3EF9 A;  2G8A A;  3CL9 A;  2TSR A;  4EZ8 A;  4EIL A;  4GYH A;  3IRM A;  3HB8 A;  1JMI A;  1F28 A;  3HJ3 A;  1TVU A;  4ISK A;  3QJ7 A;  2G86 A;  1TSL A;  3GH0 A;  3IRO A;  2G89 A;  4IQB A;  4O1U A;  1TSW A;  2H2Q A;  1B02 A;  1TLC A;  1JMF A;  1LCE A;  3C0A A;  1TSY A;  3IJZ A;  1THY A;  3HBB A;  1TSZ A;  1BP0 A;  1EV5 A;  2RD8 B;  3QGT A;  1JG0 A;  1TSM A;  1F4G A;  3UWL A;  1NJE A;  1BKO A;  4FOA A;  1DDU A;  1SYN A;  1TSX A;  1DNA A;  3DGA C;  3DL6 A;  5H39 A;  5J7W A;  3NRR A;  1JTU A;  1TDU A;  3EHI X;  3V8H A;  3BZ0 A;  1JTQ A;  1TSN A;  2FTO X;  1TDA A;  3TMS A;  4KYA A;  4JEF A;  1BPJ A;  3UM8 A;  4Q0E A;  1BO7 A;  4Q0D A;  1TYS A;  1QZF A;  3IK0 A;  1F4B A;  1TDB A;  3DL5 A;  3EBU A;  4FOG A;  2TSC A;  4GD7 A;  4H1I A;  1B5D A;  1AN5 A;  4TMS A;  3DG8 C;  5WRN A;  1BJG A;  3UM5 A;  3UWL B;  3N5E A;  2OIP A;  3IX6 A;  1LCA A;  1KZI A;  1TLS A;  1TIS A;  4KY8 A;  1HVY A;  1EVF A;  1VZD A;  4DP3 A;  3IRN A;  5BY6 A;  2RDA A;  3B5B A;  1BDU A;  4O7U A;  3GH2 X;  5H38 A;  4KNZ A;  2FTN A;  1AIQ A;  4O1X D;  1B49 A;  2G8D A;  4FQS A;  1AXW A;  3C06 A;  3OB7 A;  4FOX A;  4EB4 A;  4GEV A;  3B9H A;  1F4C A;  3N5E B;  4EIN A;  1BSF A;  1VZE A;  3JSU A;  4XSE A;  3EDW X;  4ISW A;  3KGB A;  2FTQ A;  1NJD A;  1FWM A;  1FFL A;  4H0R A;  2TDD A;  5FCT A;  1BO8 A;  3I3R A;  1AJM A;  1AOB A;  4DPD A;  3KJS A;  1TSV A;  1HZW A;  1JMG A;  2TDM A;  1EV8 A;  1BSP A;  1J3I C;  1HW3 A;  4KY4 A;  1F4D A;  1F4E A;  1I00 A;  1BID A;  4XSD A;  4H0U A;  1VZA A;  1JUT A;  1TVW A;  4UP1 A;  3CLB A;  4PSG A;  1CI7 A;  1LCB A;  1TDC A;  4G6W X;  4O1X A;  1BP6 A;  5H3A A;  1YPV A;  3N5G A;  3IK1 A;  4ECK A;  4E5O A;  4FGT A;  1NJA A;  1TJS A;  3K2H A;  1ZPR A;  1NJC A;  3BHL A;  1TRG A;  4IRR A;  1J3J C;  1J3K C;  1SEJ A;  1RTS A;  3BFI A;  3KJR A;  1KCE A;  3ED7 A;  3BYX A;  3EJL A;  4DQ1 A;  3IHI A;  1EVG A;  2G8X A;  4XSC A;  4DPH A;  1B5E A;  1BQ1 A;  1JUJ A;  1VZB A;  5HS3 A;  1QQQ A;  4KPW A;  1VZC A;  3INV A;  4F2V A;  2AAZ A;  1HW4 A;  3QG2 A;  3BGX A;  1JMH A;  3GG5 A;  2ONB A;  1JU6 A;  4LRR A;  3EAW X;  1TSD A;  3EGY X;  2A9W A;  1BKP A;  1KZJ A;  2VF0 A;  1NCE A;  1F4F A;  2VET A; 
#chains in the Genus database with same CATH homology
 1NJB A;  1BQ2 A;  2RD8 A;  4G2O X;  3H9K A;  3BHR A;  2KCE A;  2BBQ A;  3BNZ A;  4E28 A;  1TVV A;  4IQQ A;  3UM6 A;  3EF9 A;  2G8A A;  3CL9 A;  2TSR A;  4EZ8 A;  4EIL A;  4GYH A;  3IRM A;  3HB8 A;  1JMI A;  1F28 A;  3HJ3 A;  1TVU A;  4ISK A;  3QJ7 A;  2G86 A;  1TSL A;  3GH0 A;  3IRO A;  2G89 A;  4IQB A;  4O1U A;  1TSW A;  2H2Q A;  1B02 A;  1TLC A;  1JMF A;  1LCE A;  3C0A A;  1TSY A;  3IJZ A;  1THY A;  3HBB A;  1TSZ A;  1BP0 A;  1EV5 A;  2RD8 B;  3QGT A;  1JG0 A;  1TSM A;  1F4G A;  3UWL A;  1NJE A;  1BKO A;  4FOA A;  1DDU A;  1SYN A;  1TSX A;  1DNA A;  3DGA C;  3DL6 A;  5H39 A;  5J7W A;  3NRR A;  1JTU A;  1TDU A;  3EHI X;  3V8H A;  3BZ0 A;  1JTQ A;  1TSN A;  2FTO X;  1TDA A;  3TMS A;  4KYA A;  4JEF A;  1BPJ A;  3UM8 A;  4Q0E A;  1BO7 A;  4Q0D A;  1TYS A;  1QZF A;  3IK0 A;  1F4B A;  1TDB A;  3DL5 A;  3EBU A;  4FOG A;  2TSC A;  4GD7 A;  4H1I A;  1B5D A;  1AN5 A;  4TMS A;  3DG8 C;  5WRN A;  1BJG A;  3UM5 A;  3UWL B;  3N5E A;  2OIP A;  3IX6 A;  1LCA A;  1KZI A;  1TLS A;  1TIS A;  4KY8 A;  1HVY A;  1EVF A;  1VZD A;  4DP3 A;  3IRN A;  5BY6 A;  2RDA A;  3B5B A;  1BDU A;  4O7U A;  3GH2 X;  5H38 A;  4KNZ A;  2FTN A;  1AIQ A;  4O1X D;  1B49 A;  2G8D A;  4FQS A;  1AXW A;  3C06 A;  3OB7 A;  4FOX A;  4EB4 A;  4GEV A;  3B9H A;  1F4C A;  3N5E B;  4EIN A;  1BSF A;  1VZE A;  3JSU A;  4XSE A;  3EDW X;  4ISW A;  3KGB A;  2FTQ A;  1NJD A;  1FWM A;  1FFL A;  4H0R A;  2TDD A;  5FCT A;  1BO8 A;  3I3R A;  1AJM A;  1AOB A;  4DPD A;  3KJS A;  1TSV A;  1HZW A;  1JMG A;  2TDM A;  1EV8 A;  1BSP A;  1J3I C;  1HW3 A;  4KY4 A;  1F4D A;  1F4E A;  1I00 A;  1BID A;  4XSD A;  4H0U A;  1VZA A;  1JUT A;  1TVW A;  4UP1 A;  3CLB A;  4PSG A;  1CI7 A;  1LCB A;  1TDC A;  4G6W X;  4O1X A;  1BP6 A;  5H3A A;  1YPV A;  3N5G A;  3IK1 A;  4ECK A;  4E5O A;  4FGT A;  1NJA A;  1TJS A;  3K2H A;  1ZPR A;  1NJC A;  3BHL A;  1TRG A;  4IRR A;  1J3J C;  1J3K C;  1SEJ A;  1RTS A;  3BFI A;  3KJR A;  1KCE A;  3ED7 A;  3BYX A;  3EJL A;  4DQ1 A;  3IHI A;  1EVG A;  2G8X A;  4XSC A;  4DPH A;  1B5E A;  1BQ1 A;  1JUJ A;  1VZB A;  5HS3 A;  1QQQ A;  4KPW A;  1VZC A;  3INV A;  4F2V A;  2AAZ A;  1HW4 A;  3QG2 A;  3BGX A;  1JMH A;  3GG5 A;  2ONB A;  1JU6 A;  4LRR A;  3EAW X;  1TSD A;  3EGY X;  2A9W A;  1BKP A;  1KZJ A;  2VF0 A;  1NCE A;  1F4F A;  2VET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...