1JMLA

Conversion of monomeric protein l to an obligate dimer by computational protein design
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
MHHHHHHGMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVVPKAYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of monomeric protein L to an obligate dimer by computational protein design.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
molecule keywords Protein L
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jmlA00
4HKZE 3V3XA 2J52A 1UWXA 3UI3A 2K0PA 2ON8A 2ZW0A 2ZW1A 1C9FA 5HI1A 1Q10A 5HG2A 1FCLA 1HEZE 2JXTA 2LUMA 1K52A 1K50A 1YMHE 2PLPA 1MHHE 2J53A 2I38A 2IGHA 4OZCA 4HJGE 3FILB 1EM7A 2IGDA 1F2RI 2NMQA 2RMMA 2GI9A 1QKZA 2RPVA 2KN4A 1P7EA 2EELA 5JXVA 1HZ5A 2GB1A 4D2KA 1IGDA 2KWDA 1PGXA 2QSDA 5HFYA 4MACA 5BMHA 1PGBA 2JSVX 3MP9A 1FCCC 1K51A 2KDMA 4KGTA 4IKGA 1XCQL 2JWUA 2KQ4X 1KH0A 3GB1A 4IOIE 2LHEA 2N9LA 1MI0A 2IGGA 1F2RC 4OZAA 4WH4A 1IBXB 5BMGA 4KGSA 2N7JA 1MHXA 5BMIA 2PTLA 2ONQA 2I2YA 1IBXA 1YNTE 1FD6A 5HHDG 2QMTA 2OEDA 1MVKA 2KACA 4GLSC 1D4BA 2LGIA 1IGCA 1ZXHA 1MPEA 2PW9A 1PGAA 1XCTL 4KGRA 3FILA 1P7FA 2JU6X 4OZBA 1HZ6A 1GB4A 2N9KA 2JZPA 1JMLA 1XF5L 2LHDA 1K53A 1GB1A
chains in the Genus database with same CATH superfamily
2GBJA 1LM8B 3WANA 4OVVA 2HE7A 2BQQA 3QQ8B 1L6UA 3L17A 4RFBA 1WIAA 4NAMA 1V86A 2AX5A 4G3XB 3I5JC 3VH3B 2WXIA 3DVNU 3BYTB 1XQQA 1JWMD 5KHQA 2PVGC 4YWGG 3ZRFA 2KJHB 3Q3OC 2D07B 2IGHA 4HDQA 1YN3A 1IUEA 1UNSA 2PVOD 1OEYA 2RGFA 4ACFA 2LXCA 1B9RA 3D32A 5G2NA 2DYOA 3AEDB 3OG5A 4CQNA 1HZ5A 3AE9B 3AULA 3DBSA 3ZUNA 2NTSA 4Q2JA 3MP9A 3W5VB 2IY1B 3AE7B 4JPSA 1QQRA 2M0AA 3OAWA 3DHIC 4K3BA 3TEXA 3ZDTA 4XYCA 3Q8AA 1VZ7A 2LHEA 2L7RA 3TIXA 2NVUI 4N58A 1AYFA 4KZCA 3ML9A 1IBXA 2MJEA 1YNTE 5HHDG 2FCSA 4P7IA 2RR9A 1IGCA 1L7YA 4MGKE 1V1OA 3VFKA 4ZRQA 4KDIC 1QILA 5HKHA 4OZBA 4EUTA 5D6JB 4EZLA 4OVUA 2QCZA 4HKZE 1QOGA 4AQ7A 1J7CA 4F7ZA 1E7UA 3ZJUA 2PE6B 1BXTA 4WAAA 2FE8A 1I4PA 1L4DB 2C7MB 3ZTCA 5CHWA 4NPNA 1Q10A 2WLBA 1V9JA 1EU4A 5D7GA 4YT0B 5IA7A 3WALA 1TS3A 3PS6A 2D3BA 3TJPA 3X23A 2K8HA 2QILA 3EGRA 4F1SA 1LGRA 2EKEC 2KYWA 4HEA1 1YX5B 4C4VA 2I38A 4BKSD 1NBFC 4IM0A 3BIID 3L13A 2L0FA 2E3TA 5FR6A 1L4ZB 3AXCA 3ZQ4A 3M63B 1YQ3B 3B2GA 4PS7A 1OFFA 4HVBA 4HKQA 2PPHA 4N9F4 2KWDA 1WXQA 3RCZA 3ZO5B 2JUOA 1J7BA 1FRDA 1WX9A 2JZ3B 4MM3A 4WAFA 3MJWA 4ASWC 2GRIA 4J3OD 1DGJA 4WWOA 2JWUA 3IAM1 4NJCA 1JALA 2KQ4X 1T6BX 1D3ZA 5IAAC 3A1QA 5EE0A 2IGGA 3VRAB 4DHZB 1ENFA 1JROA 3KWLA 4P1CC 2LGSA 1Y8RC 2IJ0A 1D6EC 4CO7A 3AV8A 3RUIB 2YVCA 4TUUA 4DDID 1WFYA 3PO0A 2LASA 1WX8A 1JQ4A 1HZ6A 3TUOA 2LI5A 3AEGB 3MJ5A 1FNWA 5H92C 4LCDE 4YTMB 1WRIA 2KLCA 2XNAC 1Q5WB 3ZJTA 2FIDA 3C19A 2MP2B 3BY4B 3VHTC 4WQOB 3R2IA 2G45B 1C79A 2WXFA 1WMHB 2NBWB 2CJNA 1V8CA 2M8SA 4HCPB 4CHKA 3U2SC 4M8NA 3MC0B 2L52A 3PPAA 4E3CA 3AH7A 4YSYB 1SSNA 4BOSC 3DPDA 4HXDA 4RGOS 2HJ8A 3DBLI 1OQYA 2K9XA 1E8YA 1ZPSA 2SEBD 1EM7A 2WP9B 2XK5B 1L0YB 2G9HD 2MSED 2RPVA 3E9SA 1ET6A 3SFEB 5IP4D 2O6VD 2W54A 4DHJD 3FKYA 4W9JA 1IGDA 3LXFA 5FK9C 5FKAC 2O6VA 3WAMA 2UYZB 2NBUA 4KVGB 1K51A 4KKJA 2MWSB 2OJWA 1OGWA 4HPMB 3AEAB 1XEEA 4ZRIA 2KDFB 2MRPA 4PS3A 3HVDA 5J17A 3HM3A 1NYQA 4GDLB 5AEKB 4NQKE 1XLOA 1X1MA 2KK8A 5AZFA 1IP9A 2N7JA 1E5WA 3P4RB 1UBIA 2PTLA 2ONQA 2KJ6A 1DOYA 5D3IB 2D10A 3IAS1 2J7QB 1ZXHA 2NR2A 1XCTL 4ZHPA 4IDIA 1C1YB 1QZEA 1BUIC 1P1AA 2JU6X 2SAKA 1NEKB 4FLHA 3P42A 2LHDA 1NI2A 2G4SA 3AU4A 5LNK1 1UGJA 4XZ4A 1RM6C 4W9HA 1C9FA 3HVZA 2C9WB 5HI1A 4OVZA 3ZNID 1WXVA 1V81A 3Q8FA 4ANXA 4KZ0A 4CYEA 3T8MA 3NVZA 3QIJA 1I4XA 2CJOA 1MHHE 1XXGA 2W9NA 4OZCA 1PFDA 3WA0A 1SE2A 3JVZX 1YJ1A 3ZGZA 2N1WA 1QOFA 4AS1A 3RNEC 2DENB 2FUG1 2ZVNA 4USAA 3N9YC 3DOWA 3RT3B 2GB1A 1V1PB 2MW5A 2Y5BB 3J9CA 1J19A 1WXSA 2M19A 1UF0A 1TS2A 5C2TB 1TY0A 5EE3A 1E0ZA 4JLCA 4JE3B 1WE6A 1ZOYB 3NVWA 1TBEA 2AL3A 3VRBB 4BBNF 1SF0A 5DPTA 4HJKA 4P6VF 3NS1A 2WXOA 2V4IB 1TIFA 4BKTA 1MPEA 2INNE 4NJ6A 4WWPA 1VD2A 2RPQA 2XK5A 5GMVA 2IO1B 4HK2A 1H4RA 3RNBC 4ICUA 2O2VA 3N20C 3NG0A 5C23A 1G6JA 1T0YA 3OJ4B 4TSSA 4NZLB 4A90A 3VH4B 3Q69A 2NCNA 3V05A 1GG3A 3WIMA 4FULA 1B1ZA 1VZ8A 3QHTA 5AUKA 4OW0A 2BYTA 1TJEA 1L5PA 1WMHA 4MH8A 3NVYA 4ZYSA 4AWJA 2KWVB 5D2MB 4YL8A 2DZIA 2M4NA 3GZNI 3U30A 1TTNA 3ZIMA 3T3NA 1J8CA 3MTNB 1HA5A 4RGNA 3MHSD 2DYMA 3AEFB 4HLEA 2CHZA 2EELA 1SJED 2PJHA 5C1ZA 1P3QU 1ET9A 2EMSA 2M0XA 2BYFA 2W55A 1TZ1A 1GJZA 1WI0A 2KVZA 4W9IA 2L32A 4KGTA 5T8IA 4MT5A 4EKUA 1OQQA 4FBJB 5JHAA 1SEBD 2MQJA 2GBMA 3NRZA 4ZOHC 1MI0A 3NOBA 3SDLC 4E74A 4HWIB 2E6XA 1A5RA 4DQOC 3N30A 3JSVB 1E90A 2IO3B 1NENB 1D5XC 2XEWA 3ZYYX 1PGAA 4KIKB 4RF1A 3HK0A 4DHJB 1CQVA 3QA8A 2UU7A 4ANWA 1YX6B 2BT6A 3Q14C 2MEKA 3V3XA 3ABVB 3A1QB 3UI3A 3VUWA 2HD5B 2KDBA 4DDGD 1C4CA 4K1RB 5TR5A 1FXAA 2INDC 2KAJA 4MEMA 3EC8A 5GXGB 1K52A 4H2AA 4NY0A 2EMTA 4TV3A 5LLIA 1C4AA 4LJPB 5JH5C 3WAOA 3AEEB 3Q3MC 3DBRI 4RH6A 1V97A 3I9V1 2WHIA 1I42A 3VTUA 3ZNZB 1KJTA 1F2RI 2GI9A 2CHWA 4L23A 3OLMD 1SIJA 5AZGA 2RDBC 3QX1A 2M17A 1WJ6A 1HQRD 5CX3A 2KTFA 2QSDA 3KH0A 3P4SB 3O13A 2W3SA 2WDVB 4RGTA 2O6VB 2X38A 3ZNGC 1GC7A 2ZNVB 5C3JB 2LEKA 4ZRKA 3MFGA 4B0EA 1YQ4B 1RYJA 3BVGA 4IKGA 2VH1A 2ZCBA 4KKIA 1N5WA 1C3TA 1WGKA 2KQ7A 3BINA 1N6ZA 2N4FA 3P4PB 3KUDB 2LJ5A 2JY6A 3AE3B 1VZ6A 1JWBD 1MHXA 2PE9A 1VLBA 1R4MI 3IFWB 3DQVA 3L16A 3TSSA 1QT9A 5LXHA 2ZVOA 1F1HA 2PW9A 3NY5A 3EHVA 3Q3JA 1ZXIA 2IZVB 4FN2A 2LVOA 3RMKC 2V3PA 3O65B 5DPRA 2CKHB 4BBNC 3N32A 4KX6B 2BGFA 3TEYA 3EFUA 1UWMA 2MX2A 1ZP0B 1V2YA 2Z0DB 1LFDA 2KJRA 2H88B 2KOXA 2ZW0A 4ARIA 4HPLB 3V6EB 4A9AA 2C5LC 2DX5B 2JXXA 3B9JA 2FCQA 1LXDA 2JQRB 4NAWA 2QJLA 2HTHA 3A9JB 2WXMA 3RNCC 1EO6A 4B0MA 4JIOU 2LJIA 3VTVA 4TQ0A 1TKEA 3GE3C 4YSZB 1FPYA 1RFAA 2IGDA 2V3NA 3KW5B 2D2QA 2N7EA 1F52A 1V5OA 1P7EA 3AE6B 4KIKA 5MPOA 3OWEB 3UF8A 3UQBA 3N1XC 5BYRA 4I6NB 1PYWD 4EZKA 4R3DA 1FCCC 2L83A 4GMVA 1C4PA 3TEZA 1GC6A 3RD2A 2KN5A 2VRRB 2ZEQA 3RNGC 2AQ1B 1E7VA 2DYBA 4HCNB 4P16A 1CMXB 3PVLA 2D5GA 2BB5A 4AJWA 1TGZB 2K6QA 5E6JA 2K1FA 4GB9A 4NNJB 5H8YE 1FNUA 2KWCA 2M56B 2Z8LA 4XGAB 2J4XA 2WQYB 4W9LA 3N1ZC 4NJ7A 2VH2A 4TKNA 1EUVB 2WXPA 5E6PA 3RPFC 2INCC 4ANUA 1JMLA 2WXQA 2ZJDA 3RYTA 4M00A 2O2VB 1KLVA 3B1LX 3W2DA 1WYGA 4A20A 2KQSA 4AOFA 1RRBA 2WXNA 3VR9B 4FA6A 3LDZE 3W1SA 1WR6E 5D3DA 3RNFC 4GDLA 5G5GA 2KX3A 4M0WA 3Q8BA 1HTQA 1YMHE 2JZZA 2IO0B 1ZE3D 1YJJA 2JPHA 3KVFB 2JT4B 3U7DA 5J18A 4G50A 5L83A 1N62A 2GBKA 4HJGE 3UQAA 1U4AA 2NMQA 4DXAB 3ZRCA 4XE0A 1L2NA 4XDCA 3QAQA 1A70A 2N7DA 3TBLD 3AI5A 2MJ3A 2BKRB 2MA9B 4WURA 2KKCA 2PEAA 4JQWC 2JVCA 2LXAA 3PT2B 1T3QA 4LDTB 4KSLC 1OQRA 2KD0A 3ZXVA 3TL5A 4REZA 2AYOB 3BVZA 3HUIA 2JX5A 1WJUA 2NPTA 4G0NB 2ACZB 2L0TA 2IDYA 3R2TA 4PT5A 1JCKB 1VR9A 1AARA 2KT7A 2ASQA 1STEA 1D5ZC 1WE7A 1KLGD 1WH3A 2B3AA 2KTRB 1WM3A 3BWUD 4GLSC 2LRWA 1HXYD 3CWIA 1N63A 3ML8A 3OJ3A 1J0GA 2LWPA 1ZDVA 1WSPA 1KM7A 3UINB 4E71A 3RZFA 5CHFA 4F8CB 1J7AA 2L05A 2RSUA 2MLBA 3I63C 3W5UB 2XN9C 2WGSA 3C8YA 3VDZA 3AMZA 2WYQA 2W82A 3IT4B 4FXCA 1FFVA 3ZTDA 4EZJA 2ZPYA 4IWPA 2GBNA 4C4VB 4NQLB 1TT5B 2G1EA 1L0XB 2J53A 4LNNA 3RZWC 3AEBB 5JZEB 3RFZB 3H7PB 4FJYA 2Q5WD 2WWZA 3FILB 4W9FA 3AE4B 1M4VA 3PLUA 3WCQA 3BVMA 1BT0A 1F77A 4XWWA 3H8HA 1MJDA 4LTUA 2Y5CA 2VZKD 2XBBC 3UIOB 5BYQA 3X0WA 3BK1A 4D2KA 1NYRA 4MACA 2MH7A 3PHWB 3T9LA 3PV1A 2K25A 2WDTB 4XDDA 3R66C 4C80A 4W9GA 1E6EB 3IBEA 5BYSA 5KHOA 2BKFA 4WJQA 4XX5A 2REXA 3KLSX 2RDGA 2IO2B 1FM0D 3V61A 1HE8A 4KSKC 2BS2B 1Z2MA 1YIWA 1WGRA 1I4QA 3VAWA 1QF6A 3ZVVA 3TMPB 5FR3A 2BS4B 5E6OA 3RN9C 3KYDD 1YJIA 4BKGA 1FO4A 1XF5L 2WS3B 3L08A 5EDSA 5CHVC 2I1JA 4WWMA 4KV2A 2ZW1A 4GSWA 5DPWA 5IO9A 3QK0A 4YTPB 1FNVA 3Q3NC 4ICVA 4S17A 3E56A 2DZMA 1HEZE 3ENEA 2JXTA 3L4PA 3ZW3A 2N0SB 2BB6A 4C7ZA 4GDKA 4MJSA 3V6CB 2KXJA 3PRZA 3W1YA 4C00A 4C7YA 1UELA 1V80A 3P4QB 4BFRA 2FAZA 4EOYA 4ZRJA 2PKOA 2MCNB 3NS8A 2QHOA 3R7RA 2Y5PA 2YEPF 2KC2A 3PLVA 5HFYA 2CS4A 4XC2A 2BW2A 3KQ4A 4K81A 1N60A 2V1YA 4DXGA 1WZ0A 1WGGA 2BTEA 3SU8X 5IKCM 4LNOA 1R7SA 3S2AA 4M8MA 2DBYA 2WXHA 2K8CA 2KMCA 2BS3B 4RMAA 3DWMA 4M02A 5BO4B 2KDEB 2WXKA 5I4DA 1KF6B 3NZUA 2KMAA 5L95C 4WH4A 2C7HA 4N6EB 1UUPA 3VVWB 1Y56A 2QMTA 4O1NA 4MSMB 1ZGUB 3L0WB 3Q8CA 2C60A 2WNMA 1NVID 4AP4C 2LGXA 4JGHB 2DHZA 3FILA 3SEBA 2D3AA 3CMMB 3GZNB 1ZUD2 2KO3A 2OHFA 2CU3A 2BBCA 1EWYC 3IVFA 2Z0EB 5IOIA 1UWXA 3ECIA 1EF5A 2LFIA 1SJHD 3PRPB 4A3PA 3P63A 2L3ZA 4J6IA 5AUIA 1AWDA 2BPSA 4ARCA 3P2BA 2DAFA 1WY8A 3N1YC 3TEWA 1MG4A 3QCAA 2DLBA 3U7ZA 1MFWA 5DPSA 1XLPA 3W1SC 2HJ1A 3NVVA 2X8XX 4II2B 2JRIB 2GBRA 4PYZA 2A5UA 4RNAA 3M3JA 1K8RB 1T0QC 2ICIA 2D11A 3A9KB 3AECB 1SGHA 2OOBB 3ONSA 2K6DB 3PGEA 4BZAA 3I3TB 4UDUC 4AUQC 1IYFA 2IBIB 1E8WA 2UWQA 2OJRA 4HROA 1TKGA 4IM3A 3H9DA 1YN5A 4HRSA 1C77A 3Q3FA 2PMVA 3SR6A 5G5HA 2DAJA 2R2OA 4BAXA 1MG8A 3BZDB 3APCA 1D5MC 4OZAA 4X57B 2DNFA 1ZDXA 1ROEA 4GDKB 2WDRB 2OEDA 1DYQA 2LZ6A 2MBEA 3CF6E 3CSFA 1M94A 1I35A 4KGRA 2Y3AA 4LLGM 4K7SA 3IG3A 1EF1A 2J42A 1E10A 3TCAA 2G4DB 2LD9A 3DBLB 2MJDA 3VQIA 2LMCA 3BK2A 4LNFA 2ON8A 4ZDVA 3DWGC 4LNIA 1T0RC 2NTTA 1XT9B 1S1QB 5HG2A 1ZW7A 1HTOA 2LGYA 4BVUC 2W3RA 1XLNA 3L10B 3VTWA 1FIQA 1WJ4A 3H7SA 4JWSC 1NDDA 2CU1A 2KANA 1FRRA 3GP7A 2A4ZA 1T0SC 2BYEA 2K39A 2RMMA 1WGHA 2NBVB 1EWCA 2BVCA 4G11A 4W9DA 4MGIE 2ZNVC 3JSVA 4FHJA 3ZJVA 1JRUA 2K3UA 4QAYA 2QDFA 2MBQA 1PGBA 4JX1C 4YXDB 4HPPA 4LDTD 3IHPC 3DDCB 2WXGA 1VJKA 3U8ZA 4DHZE 4DXFA 4M0WB 1Q1OA 4RF0A 1AW7A 3ZXRA 2L1AA 3L54A 3NHEB 3H6NA 2WXLA 2IY0B 3I57A 2KX0A 1SE3A 3M95A 4US9A 3M62B 1R4MB 4FJVB 2J0KA 3LJ3A 1F9JA 1GAQB 2I2YA 1PQSA 2PIAA 2EKIA 4IM2A 3P1MA 3UGBB 3R8BA 3PREA 3PZ7A 2WXJA 4PYUA 3HRDD 3ETRA 1FXIA 4N59A 1GB4A 3U52E 1L0VB 4WJOA 1OEYJ 2BWFA 2LUEA 1AN8A 3MC9A 2JYEA 2R61A 1WXMA 1RWSA 2TSSA 3NJTA 4PS8A 3SHQA 3ZLZA 3URYA 2NPTB 3ZKJC 4LK0M 1QOAA 3LYYA 3B0AA 5G55A 2YEPB 4ZHOA 4URKA 2D3GA 3JW0X 5EE1A 3AE2B 3C0RB 3KUCB 3HIZA 2LRUA 3AM9A 2KHWB 3KWVA 2PLPA 3PZ8A 4MDKE 5D94A 4MGYE 3Q8EA 4MJSB 3PRMB 1VCBA 3DVGY 2KMMA 1H8CA 4BKSA 2KVRA 3IXSA 4GIVA 4YTNB 2KN4A 2V3SA 4DBGA 4IWOA 1KFYB 1WJNA 3NZ3A 4PK1A 4ZYNA 2N1VA 1YD8U 1SBBB 2AQ3B 3BYYB 2KDMA 1DOXA 4IW0A 3VUYA 2ZPNA 3WAPA 2KFKA 1TKYA 1WGDA 1XCQL 2ZZPB 4ANVA 4DWFA 1JWUD 4IOIE 2GLSA 1EU3A 4BOZB 5CTRC 4JWUC 4KGSA 2QIEB 4EEWA 1QOBA 1YN4A 4GGQA 4XWTA 1V1PA 2L76A 3DHGC 3QWZB 1KTKA 2LGIA 1JWAD 3GE8C 2MBHA 2MHJA 2KLGA 4WIPA 4A8XC 3R7QA 1R4NB 1Z5SB 4FHKA 5AZHA 2N9KA 2Z59B 5LXIB 3PHXB 1UBQA 4US8A 2J52A 3ZDMC 3A4SC 4K7WA 3LB8C 3NUHB 3RNAC 3A4RA 3V62A 1FXTB 1YQBA 3V60A 3SFDB 1IPGA 3MC8A 2KNBA 3A9JA 2WU2B 1RFKA 1CK1A 2FBWB 2K8BA 1UZXB 1K50A 3W9CB 1C78A 1TZOA 1WZ3A 1PUTA 1E8XA 4MH0E 1LQBA 2B76B 2DZJA 4IUMB 3Q6BA 1WM2A 3FAHA 5EE9A 1Q0WB 3Q2AC 1DOIA 1XO3A 1SE9A 2NS5A 4IWQA 1GPXA 1T5XD 4L2YA 2WDQB 4P1BC 1NI3A 3ZNHB 2YLMA 4LNKA 4S0RA 2V4LA 1WRDB 1XD3B 3A9KA 3AB5A 3DVNV 1I4RA 4KDLB 2JYTA 1LO5D 2GMIC 3A33B 4AJYB 1E7PB 3QJZA 2FCMA 2RD0A 3GOEA 2VZKB 3RI7C 3T3OA 2CHXA 4A6QA 2AQ2B 1I4GA 3AE8B 2R2QA 3AE1B 1IBXB 2FNJB 2WU5B 2N9EB 1V49A 1L6VA 2KZRA 2G3QB 1WYWB 5E6NA 5JHBA 4K3CA 4A55A 1SE4A 1YOVB 4WJPA 1FEHA 1GB1A 1ACCA 4L1BA 4MGZE 1UH6A 3GS2A 4RM9A 3R3MA 2FIFA 3EUB2 2L00B 1I4HA 3EA6A 2C7NB 2JRHA 1WGYA 2J0MA 1S3SG 2LUMA 4MSQB 4WWNA 4GOCA 4RGMA 2KFKB 4B95A 4RCOA 1ZKHA 4RM8A 2LVPA 1WWTA 4HDOA 3KUZA 3AE5B 3N3KB 2WX1A 3B08A 4GXBA 2FCNA 1WR1A 3APFA 1FMAD 4I6LB 3MHZA 2MBBB 2DWQA 3VR8B 1SB3C 1C76A 3DBHB 2HDEA 5JXVA 1QLBB 2QEJC 3DBRB 1E8ZA 2D3CA 4MM3B 5BMHA 3DVGX 2IPKD 1GUAB 1ISNA 5J2RA 3KYCD 4WJNA 1KRHA 1SIFA 3AN1A 1WXAA 4W9CA 1TS4A 1GOZA 2MBOA 3HHMA 2N9XA 1JRPA 1RAXA 2J0JA 4IC7B 1SXTA 4LJOB 2V9HA 2AL6A 2M1MA 2AEHA 2K22A 3QC8B 3B2FA 3NZSA 5BMGA 2JF5A 5BMIA 1ESFA 3HM6X 2KWUB 4ZRPA 2JWZA 2QC8A 4FADA 1N5XA 1MVKA 2L8JA 2KFJA 3PSEB 1R4NI 4WQMA 4YSXB 3CSTA 2LVQA 1VDVA 4IG7B 2K5PA 2LGDA 3RULA 1P7FA 2BF8B 2H89B 2ZCCA 3PTFC 2CR5A 3VUXA 3H7PA 3PZDA 3K9PB 1TS5A 2AWTA 4MELA 2K0PA 3IT6B 4TQ1A 3APDA 1BMLC 1I7HA 2BWES 2HTME 1GNUA 1FCLA 2BYVE 4NAWB 4GN1A 3JYUA 1PDXA 3K9OB 1P9DU 4EFOA 1TYGB 3EECA 4JL9A 3AU5A 2I1KA 2N9PC 1UGMA 3EFCA 1V6EA 4ITKA 1CJEA 5IN7A 1CZPA 1RLFA 1QKZA 4TMAB 4C56C 4OHJA 4B6WA 1TY2A 1KOTA 2RDHA 3QARA 1PGXA 4DK5A 3DCGA 3U4EG 1VRAB 1JW9D 2WXRA 2JSVX 3VXWA 1OTRB 3ALBA 5DCNA 5TSSA 1F0ZA 1XLQA 4II3B 4B9KA 4I6PA 3FC4A 4M01A 3CIRB 1V5TA 4FJZA 4GU2A 1WF9A 1KH0A 2FUHB 3GB1A 2DZKA 2INPE 4W9KA 1P0RA 2KDIA 3DBHI 2N9LA 1WX7A 4A3OA 2GOWA 1F2RC 4K7UA 1KLUD 2KTRA 3H1UA 3SD5A 1UD7A 1FD6A 1P98A 2KC1A 1FFUA 2KACA 4EE2A 1D4BA 2WX0A 2IYDB 4W9EA 3UIPB 2V0GA 1N61A 2JZPA 1JWSD 1E9MA 1K53A 2MP2A 3DHHC
chains in the Genus database with same CATH topology
2JYEA 2R61A 1RWSA 2TSSA 3W5UB 4TSSA 4NZLB 2XN9C 4A90A 3C8YA 3AMZA 3Q69A 1L6UA 2W82A 3IT4B 4RFBA 4FXCA 1FFVA 3URYA 3V05A 4NAMA 4LK0M 1QOAA 1B1ZA 1VZ8A 2AX5A 3LYYA 5AUKA 2YEPB 4OW0A 2BYTA 2WXIA 1TJEA 4ZHOA 3BYTB 1L5PA 1JWMD 5EE1A 2PVGC 3AE2B 4MH8A 3NVYA 4YWGG 4ZYSA 3AM9A 3KWVA 2PLPA 3PZ8A 2G1EA 1L0XB 2J53A 3Q8EA 2IGHA 3AEBB 3RFZB 3T3NA 1YN3A 2Q5WD 3FILB 1IUEA 1UNSA 2PVOD 1HA5A 4RGNA 3AE4B 1M4VA 3WCQA 3BVMA 1F77A 2DYMA 2KMMA 3AEFB 4XWWA 3H8HA 4YTNB 3IXSA 4LTUA 2KN4A 2Y5CA 1B9RA 2DYOA 3AEDB 2VZKD 2EELA 4CQNA 1SJED 5BYQA 1HZ5A 3BK1A 4D2KA 3AE9B 1ET9A 1NYRA 2NTSA 1KFYB 4MACA 2MH7A 3NZ3A 2W55A 4Q2JA 3MP9A 3W5VB 3AE7B 4JPSA 4XDDA 1QQRA 1SBBB 2AQ3B 2L32A 2KDMA 3BYYB 4KGTA 4C80A 1DOXA 2M0AA 5T8IA 4MT5A 1E6EB 1TKYA 1XCQL 1OQQA 5BYSA 3TEXA 3Q8AA 1JWUD 1SEBD 1VZ7A 3KLSX 4IOIE 2LHEA 2RDGA 1EU3A 3NRZA 4ZOHC 1FM0D 1MI0A 4N58A 1AYFA 4JWUC 2E6XA 4KGSA 2QIEB 1YN4A 1QOBA 4XWTA 4DQOC 1IBXA 1V1PA 1YNTE 2MJEA 5HHDG 1KTKA 2BS2B 1NENB 1D5XC 2LGIA 1IGCA 1I4QA 1JWAD 1QF6A 3ZYYX 1PGAA 4RF1A 1V1OA 4A8XC 4WIPA 4ZRQA 5FR3A 2BS4B 1CQVA 1QILA 1YJIA 4OZBA 2N9KA 1FO4A 1XF5L 2WS3B 2BT6A 4HKZE 1QOGA 2MEKA 1J7CA 3V3XA 3ABVB 4US8A 4AQ7A 2J52A 3UI3A 3ZJUA 3LB8C 4WWMA 1BXTA 3NUHB 2ZW1A 2FE8A 1I4PA 1L4DB 3SFDB 1C4CA 4YTPB 1FNVA 1Q10A 1FXAA 3E56A 2WLBA 2KAJA 2WU2B 1HEZE 1RFKA 1CK1A 2JXTA 2FBWB 1EU4A 5D7GA 5GXGB 3L4PA 4YT0B 1K52A 1K50A 2N0SB 2BB6A 4H2AA 1C78A 3W9CB 1TS3A 4C7ZA 1TZOA 2QILA 1C4AA 3EGRA 1PUTA 3AEEB 2B76B 4HEA1 4C7YA 4RH6A 2I38A 1V97A 3I9V1 3FAHA 3BIID 5EE9A 3P4QB 2E3TA 1DOIA 1F2RI 1XO3A 2GI9A 1L4ZB 4L23A 1SIJA 3ZQ4A 1GPXA 1YQ3B 2PKOA 1T5XD 4L2YA 2WDQB 3B2GA 1OFFA 2Y5PA 1HQRD 1NI3A 4HKQA 2KWDA 2YEPF 1WXQA 2QSDA 3P4SB 3O13A 5HFYA 2W3SA 2WDVB 1J7BA 1FRDA 4RGTA 2BW2A 3AB5A 3KQ4A 2X38A 1I4RA 1N60A 4WAFA 4DXGA 5C3JB 2LEKA 2BTEA 2JYTA 1LO5D 1R7SA 3MFGA 4B0EA 1YQ4B 2GRIA 1RYJA 2DBYA 1DGJA 2WXHA 3BVGA 4IKGA 4J3OD 1E7PB 2JWUA 4KKIA 3IAM1 2VZKB 4NJCA 1N5WA 1JALA 2KQ4X 3T3OA 1T6BX 2BS3B 3DWMA 4A6QA 1WGKA 2AQ2B 3P4PB 2WXKA 5I4DA 5EE0A 1KF6B 2IGGA 3VRAB 1I4GA 3AE3B 3AE8B 4WH4A 3AE1B 1IBXB 1VZ6A 4N6EB 1JWBD 1ENFA 1MHXA 1JROA 3KWLA 1UUPA 1VLBA 2WU5B 1Y56A 2QMTA 2IJ0A 4O1NA 3TSSA 1D6EC 1QT9A 3AV8A 3Q8CA 2PW9A 2WNMA 1L6VA 1NVID 3PO0A 1ZXIA 2V3PA 4A55A 1SE4A 3FILA 3SEBA 1JQ4A 1HZ6A 4KX6B 1ZUD2 3TUOA 3TEYA 2OHFA 1UWMA 3AEGB 1FEHA 1FNWA 3MJ5A 2CU3A 2BBCA 5H92C 1GB1A 1EWYC 1ACCA 1ZP0B 4L1BA 4YTMB 1WRIA 2XNAC 3ZJTA 3GS2A 2H88B 1UWXA 2LFIA 1SJHD 3R2IA 2ZW0A 1C79A 4ARIA 3EUB2 4A9AA 3P63A 2WXFA 1I4HA 3B9JA 2JQRB 5AUIA 2CJNA 1AWDA 1V8CA 3EA6A 4ARCA 2QJLA 3U2SC 2WXMA 2LUMA 3MC0B 2L52A 4RGMA 4RCOA 4B0MA 3AH7A 1WWTA 3TEWA 2LJIA 4YSYB 1SSNA 3AE5B 4RGOS 4TQ0A 1TKEA 2DLBA 3U7ZA 4YSZB 2K9XA 1ZPSA 2SEBD 1FMAD 1XLPA 1EM7A 2IGDA 2WP9B 3MHZA 2DWQA 1L0YB 3NVVA 3VR8B 2G9HD 3E9SA 2RPVA 2V3NA 1ET6A 1SB3C 1P7EA 3SFEB 3AE6B 4RNAA 1C76A 2HDEA 2W54A 3OWEB 5JXVA 5MPOA 1QLBB 2ICIA 2QEJC 5BYRA 1IGDA 3LXFA 5FK9C 5FKAC 3AECB 4MM3B 5BMHA 1PYWD 2IPKD 4R3DA 1FCCC 1K51A 2L83A 4KKJA 1C4PA 4UDUC 1KRHA 3TEZA 3AN1A 1TS4A 1GOZA 4HROA 3AEAB 1TKGA 1YN5A 1XEEA 4HRSA 2AQ1B 1JRPA 1C77A 2PMVA 3HVDA 3SR6A 1SXTA 5G5HA 1NYQA 4GDLB 4P16A 2D5GA 1XLOA 2BB5A 3BZDB 2K22A 1D5MC 4OZAA 5E6JA 3B2FA 5BMGA 2N7JA 3P4RB 1ZDXA 1ROEA 4GDKB 2PTLA 2ONQA 1ESFA 5BMIA 5H8YE 1FNUA 2WDRB 4ZRPA 1DOYA 2OEDA 5D3IB 1N5XA 1MVKA 1DYQA 2M56B 3IAS1 1ZXHA 4WQMA 4YSXB 2Z8LA 2J4XA 2WQYB 1XCTL 1VDVA 4ZHPA 4KGRA 4IDIA 2Y3AA 2K5PA 2WXPA 1P7FA 4LLGM 3RPFC 1BUIC 2JU6X 2SAKA 1NEKB 2H89B 2J42A 1E10A 1JMLA 2WXQA 3P42A 2LHDA 2MJDA 3VQIA 1TS5A 2LMCA 3BK2A 5LNK1 1UGJA 2K0PA 1RM6C 2ON8A 3W2DA 1WYGA 3DWGC 3IT6B 1C9FA 3HVZA 4TQ1A 5HI1A 4OVZA 2WXNA 3Q8FA 2NTTA 3VR9B 3W1SA 1BMLC 1I7HA 5D3DA 2HTME 5HG2A 5G5GA 1FCLA 4NAWB 4M0WA 3Q8BA 1PDXA 3NVZA 1YMHE 2W3RA 1ZE3D 1TYGB 1YJJA 1XLNA 1I4XA 2CJOA 1FIQA 1MHHE 4JWSC 1N62A 1XXGA 1FRRA 3GP7A 4OZCA 1PFDA 4HJGE 4ITKA 1CJEA 1SE2A 2NMQA 1CZPA 2RMMA 3ZGZA 1QKZA 1QOFA 4AS1A 4XE0A 4TMAB 4C56C 1EWCA 4OHJA 2FUG1 4XDCA 4USAA 3N9YC 1TY2A 1A70A 2GB1A 1V1PB 2RDHA 1PGXA 3ZJVA 2MJ3A 2K3UA 3J9CA 3U4EG 1VRAB 1JW9D 4YXDB 2WXRA 1PGBA 2JSVX 4JX1C 4WURA 2M19A 1T3QA 1TS2A 2WXGA 1OQRA 5C2TB 1VJKA 5TSSA 1TY0A 4DXFA 1F0ZA 1XLQA 4REZA 4RF0A 3BVZA 5EE3A 3HUIA 2JX5A 1E0ZA 1AW7A 4JE3B 3FC4A 1ZOYB 2L1AA 3CIRB 3NVWA 3VRBB 1KH0A 2WXLA 3GB1A 2INPE 1SF0A 2ACZB 3I57A 2IDYA 1SE3A 2N9LA 3R2TA 4PT5A 1F2RC 4US9A 1JCKB 1VR9A 1KLUD 4P6VF 3NS1A 1STEA 1D5ZC 1GAQB 1KLGD 2I2YA 2WXOA 2V4IB 1FD6A 2PIAA 2EKIA 1FFUA 3BWUD 2KACA 4GLSC 4EE2A 1D4BA 1HXYD 3CWIA 1N63A 1MPEA 2INNE 3P1MA 3R8BA 1ZDVA 3PZ7A 1WSPA 2WXJA 3HRDD 2V0GA 3ETRA 1N61A 1FXIA 4N59A 1GB4A 3U52E 2JZPA 1JWSD 1L0VB 1E9MA 1J7AA 1K53A 1AN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKZ E;  3V3X A;  2J52 A;  1UWX A;  3UI3 A;  2K0P A;  2ON8 A;  2ZW0 A;  2ZW1 A;  1C9F A;  5HI1 A;  1Q10 A;  5HG2 A;  1FCL A;  1HEZ E;  2JXT A;  2LUM A;  1K52 A;  1K50 A;  1YMH E;  2PLP A;  1MHH E;  2J53 A;  2I38 A;  2IGH A;  4OZC A;  4HJG E;  3FIL B;  1EM7 A;  2IGD A;  1F2R I;  2NMQ A;  2RMM A;  2GI9 A;  1QKZ A;  2RPV A;  2KN4 A;  1P7E A;  2EEL A;  5JXV A;  1HZ5 A;  2GB1 A;  4D2K A;  1IGD A;  2KWD A;  1PGX A;  2QSD A;  5HFY A;  4MAC A;  5BMH A;  1PGB A;  2JSV X;  3MP9 A;  1FCC C;  1K51 A;  2KDM A;  4KGT A;  4IKG A;  1XCQ L;  2JWU A;  2KQ4 X;  1KH0 A;  3GB1 A;  4IOI E;  2LHE A;  2N9L A;  1MI0 A;  2IGG A;  1F2R C;  4OZA A;  4WH4 A;  1IBX B;  5BMG A;  4KGS A;  2N7J A;  1MHX A;  5BMI A;  2PTL A;  2ONQ A;  2I2Y A;  1IBX A;  1YNT E;  1FD6 A;  5HHD G;  2QMT A;  2OED A;  1MVK A;  2KAC A;  4GLS C;  1D4B A;  2LGI A;  1IGC A;  1ZXH A;  1MPE A;  2PW9 A;  1PGA A;  1XCT L;  4KGR A;  3FIL A;  1P7F A;  2JU6 X;  4OZB A;  1HZ6 A;  1GB4 A;  2N9K A;  2JZP A;  1JML A;  1XF5 L;  2LHD A;  1K53 A;  1GB1 A; 
#chains in the Genus database with same CATH topology
 2GBJ A;  1LM8 B;  3WAN A;  4OVV A;  2HE7 A;  2BQQ A;  3QQ8 B;  1L6U A;  3L17 A;  4RFB A;  1WIA A;  4NAM A;  1V86 A;  2AX5 A;  4G3X B;  3I5J C;  3VH3 B;  2WXI A;  3DVN U;  3BYT B;  1XQQ A;  1JWM D;  5KHQ A;  2PVG C;  4YWG G;  3ZRF A;  2KJH B;  3Q3O C;  2D07 B;  2IGH A;  4HDQ A;  1YN3 A;  1IUE A;  1UNS A;  2PVO D;  1OEY A;  2RGF A;  4ACF A;  2LXC A;  1B9R A;  3D32 A;  5G2N A;  2DYO A;  3AED B;  3OG5 A;  4CQN A;  1HZ5 A;  3AE9 B;  3AUL A;  3DBS A;  3ZUN A;  2NTS A;  4Q2J A;  3MP9 A;  3W5V B;  2IY1 B;  3AE7 B;  4JPS A;  1QQR A;  2M0A A;  3OAW A;  3DHI C;  4K3B A;  3TEX A;  3ZDT A;  4XYC A;  3Q8A A;  1VZ7 A;  2LHE A;  2L7R A;  3TIX A;  2NVU I;  4N58 A;  1AYF A;  4KZC A;  3ML9 A;  1IBX A;  2MJE A;  1YNT E;  5HHD G;  2FCS A;  4P7I A;  2RR9 A;  1IGC A;  1L7Y A;  4MGK E;  1V1O A;  3VFK A;  4ZRQ A;  4KDI C;  1QIL A;  5HKH A;  4OZB A;  4EUT A;  5D6J B;  4EZL A;  4OVU A;  2QCZ A;  4HKZ E;  1QOG A;  4AQ7 A;  1J7C A;  4F7Z A;  1E7U A;  3ZJU A;  2PE6 B;  1BXT A;  4WAA A;  2FE8 A;  1I4P A;  1L4D B;  2C7M B;  3ZTC A;  5CHW A;  4NPN A;  1Q10 A;  2WLB A;  1V9J A;  1EU4 A;  5D7G A;  4YT0 B;  5IA7 A;  3WAL A;  1TS3 A;  3PS6 A;  2D3B A;  3TJP A;  3X23 A;  2K8H A;  2QIL A;  3EGR A;  4F1S A;  1LGR A;  2EKE C;  2KYW A;  4HEA 1;  1YX5 B;  4C4V A;  2I38 A;  4BKS D;  1NBF C;  4IM0 A;  3BII D;  3L13 A;  2L0F A;  2E3T A;  5FR6 A;  1L4Z B;  3AXC A;  3ZQ4 A;  3M63 B;  1YQ3 B;  3B2G A;  4PS7 A;  1OFF A;  4HVB A;  4HKQ A;  2PPH A;  4N9F 4;  2KWD A;  1WXQ A;  3RCZ A;  3ZO5 B;  2JUO A;  1J7B A;  1FRD A;  1WX9 A;  2JZ3 B;  4MM3 A;  4WAF A;  3MJW A;  4ASW C;  2GRI A;  4J3O D;  1DGJ A;  4WWO A;  2JWU A;  3IAM 1;  4NJC A;  1JAL A;  2KQ4 X;  1T6B X;  1D3Z A;  5IAA C;  3A1Q A;  5EE0 A;  2IGG A;  3VRA B;  4DHZ B;  1ENF A;  1JRO A;  3KWL A;  4P1C C;  2LGS A;  1Y8R C;  2IJ0 A;  1D6E C;  4CO7 A;  3AV8 A;  3RUI B;  2YVC A;  4TUU A;  4DDI D;  1WFY A;  3PO0 A;  2LAS A;  1WX8 A;  1JQ4 A;  1HZ6 A;  3TUO A;  2LI5 A;  3AEG B;  3MJ5 A;  1FNW A;  5H92 C;  4LCD E;  4YTM B;  1WRI A;  2KLC A;  2XNA C;  1Q5W B;  3ZJT A;  2FID A;  3C19 A;  2MP2 B;  3BY4 B;  3VHT C;  4WQO B;  3R2I A;  2G45 B;  1C79 A;  2WXF A;  1WMH B;  2NBW B;  2CJN A;  1V8C A;  2M8S A;  4HCP B;  4CHK A;  3U2S C;  4M8N A;  3MC0 B;  2L52 A;  3PPA A;  4E3C A;  3AH7 A;  4YSY B;  1SSN A;  4BOS C;  3DPD A;  4HXD A;  4RGO S;  2HJ8 A;  3DBL I;  1OQY A;  2K9X A;  1E8Y A;  1ZPS A;  2SEB D;  1EM7 A;  2WP9 B;  2XK5 B;  1L0Y B;  2G9H D;  2MSE D;  2RPV A;  3E9S A;  1ET6 A;  3SFE B;  5IP4 D;  2O6V D;  2W54 A;  4DHJ D;  3FKY A;  4W9J A;  1IGD A;  3LXF A;  5FK9 C;  5FKA C;  2O6V A;  3WAM A;  2UYZ B;  2NBU A;  4KVG B;  1K51 A;  4KKJ A;  2MWS B;  2OJW A;  1OGW A;  4HPM B;  3AEA B;  1XEE A;  4ZRI A;  2KDF B;  2MRP A;  4PS3 A;  3HVD A;  5J17 A;  3HM3 A;  1NYQ A;  4GDL B;  5AEK B;  4NQK E;  1XLO A;  1X1M A;  2KK8 A;  5AZF A;  1IP9 A;  2N7J A;  1E5W A;  3P4R B;  1UBI A;  2PTL A;  2ONQ A;  2KJ6 A;  1DOY A;  5D3I B;  2D10 A;  3IAS 1;  2J7Q B;  1ZXH A;  2NR2 A;  1XCT L;  4ZHP A;  4IDI A;  1C1Y B;  1QZE A;  1BUI C;  1P1A A;  2JU6 X;  2SAK A;  1NEK B;  4FLH A;  3P42 A;  2LHD A;  1NI2 A;  2G4S A;  3AU4 A;  5LNK 1;  1UGJ A;  4XZ4 A;  1RM6 C;  4W9H A;  1C9F A;  3HVZ A;  2C9W B;  5HI1 A;  4OVZ A;  3ZNI D;  1WXV A;  1V81 A;  3Q8F A;  4ANX A;  4KZ0 A;  4CYE A;  3T8M A;  3NVZ A;  3QIJ A;  1I4X A;  2CJO A;  1MHH E;  1XXG A;  2W9N A;  4OZC A;  1PFD A;  3WA0 A;  1SE2 A;  3JVZ X;  1YJ1 A;  3ZGZ A;  2N1W A;  1QOF A;  4AS1 A;  3RNE C;  2DEN B;  2FUG 1;  2ZVN A;  4USA A;  3N9Y C;  3DOW A;  3RT3 B;  2GB1 A;  1V1P B;  2MW5 A;  2Y5B B;  3J9C A;  1J19 A;  1WXS A;  2M19 A;  1UF0 A;  1TS2 A;  5C2T B;  1TY0 A;  5EE3 A;  1E0Z A;  4JLC A;  4JE3 B;  1WE6 A;  1ZOY B;  3NVW A;  1TBE A;  2AL3 A;  3VRB B;  4BBN F;  1SF0 A;  5DPT A;  4HJK A;  4P6V F;  3NS1 A;  2WXO A;  2V4I B;  1TIF A;  4BKT A;  1MPE A;  2INN E;  4NJ6 A;  4WWP A;  1VD2 A;  2RPQ A;  2XK5 A;  5GMV A;  2IO1 B;  4HK2 A;  1H4R A;  3RNB C;  4ICU A;  2O2V A;  3N20 C;  3NG0 A;  5C23 A;  1G6J A;  1T0Y A;  3OJ4 B;  4TSS A;  4NZL B;  4A90 A;  3VH4 B;  3Q69 A;  2NCN A;  3V05 A;  1GG3 A;  3WIM A;  4FUL A;  1B1Z A;  1VZ8 A;  3QHT A;  5AUK A;  4OW0 A;  2BYT A;  1TJE A;  1L5P A;  1WMH A;  4MH8 A;  3NVY A;  4ZYS A;  4AWJ A;  2KWV B;  5D2M B;  4YL8 A;  2DZI A;  2M4N A;  3GZN I;  3U30 A;  1TTN A;  3ZIM A;  3T3N A;  1J8C A;  3MTN B;  1HA5 A;  4RGN A;  3MHS D;  2DYM A;  3AEF B;  4HLE A;  2CHZ A;  2EEL A;  1SJE D;  2PJH A;  5C1Z A;  1P3Q U;  1ET9 A;  2EMS A;  2M0X A;  2BYF A;  2W55 A;  1TZ1 A;  1GJZ A;  1WI0 A;  2KVZ A;  4W9I A;  2L32 A;  4KGT A;  5T8I A;  4MT5 A;  4EKU A;  1OQQ A;  4FBJ B;  5JHA A;  1SEB D;  2MQJ A;  2GBM A;  3NRZ A;  4ZOH C;  1MI0 A;  3NOB A;  3SDL C;  4E74 A;  4HWI B;  2E6X A;  1A5R A;  4DQO C;  3N30 A;  3JSV B;  1E90 A;  2IO3 B;  1NEN B;  1D5X C;  2XEW A;  3ZYY X;  1PGA A;  4KIK B;  4RF1 A;  3HK0 A;  4DHJ B;  1CQV A;  3QA8 A;  2UU7 A;  4ANW A;  1YX6 B;  2BT6 A;  3Q14 C;  2MEK A;  3V3X A;  3ABV B;  3A1Q B;  3UI3 A;  3VUW A;  2HD5 B;  2KDB A;  4DDG D;  1C4C A;  4K1R B;  5TR5 A;  1FXA A;  2IND C;  2KAJ A;  4MEM A;  3EC8 A;  5GXG B;  1K52 A;  4H2A A;  4NY0 A;  2EMT A;  4TV3 A;  5LLI A;  1C4A A;  4LJP B;  5JH5 C;  3WAO A;  3AEE B;  3Q3M C;  3DBR I;  4RH6 A;  1V97 A;  3I9V 1;  2WHI A;  1I42 A;  3VTU A;  3ZNZ B;  1KJT A;  1F2R I;  2GI9 A;  2CHW A;  4L23 A;  3OLM D;  1SIJ A;  5AZG A;  2RDB C;  3QX1 A;  2M17 A;  1WJ6 A;  1HQR D;  5CX3 A;  2KTF A;  2QSD A;  3KH0 A;  3P4S B;  3O13 A;  2W3S A;  2WDV B;  4RGT A;  2O6V B;  2X38 A;  3ZNG C;  1GC7 A;  2ZNV B;  5C3J B;  2LEK A;  4ZRK A;  3MFG A;  4B0E A;  1YQ4 B;  1RYJ A;  3BVG A;  4IKG A;  2VH1 A;  2ZCB A;  4KKI A;  1N5W A;  1C3T A;  1WGK A;  2KQ7 A;  3BIN A;  1N6Z A;  2N4F A;  3P4P B;  3KUD B;  2LJ5 A;  2JY6 A;  3AE3 B;  1VZ6 A;  1JWB D;  1MHX A;  2PE9 A;  1VLB A;  1R4M I;  3IFW B;  3DQV A;  3L16 A;  3TSS A;  1QT9 A;  5LXH A;  2ZVO A;  1F1H A;  2PW9 A;  3NY5 A;  3EHV A;  3Q3J A;  1ZXI A;  2IZV B;  4FN2 A;  2LVO A;  3RMK C;  2V3P A;  3O65 B;  5DPR A;  2CKH B;  4BBN C;  3N32 A;  4KX6 B;  2BGF A;  3TEY A;  3EFU A;  1UWM A;  2MX2 A;  1ZP0 B;  1V2Y A;  2Z0D B;  1LFD A;  2KJR A;  2H88 B;  2KOX A;  2ZW0 A;  4ARI A;  4HPL B;  3V6E B;  4A9A A;  2C5L C;  2DX5 B;  2JXX A;  3B9J A;  2FCQ A;  1LXD A;  2JQR B;  4NAW A;  2QJL A;  2HTH A;  3A9J B;  2WXM A;  3RNC C;  1EO6 A;  4B0M A;  4JIO U;  2LJI A;  3VTV A;  4TQ0 A;  1TKE A;  3GE3 C;  4YSZ B;  1FPY A;  1RFA A;  2IGD A;  2V3N A;  3KW5 B;  2D2Q A;  2N7E A;  1F52 A;  1V5O A;  1P7E A;  3AE6 B;  4KIK A;  5MPO A;  3OWE B;  3UF8 A;  3UQB A;  3N1X C;  5BYR A;  4I6N B;  1PYW D;  4EZK A;  4R3D A;  1FCC C;  2L83 A;  4GMV A;  1C4P A;  3TEZ A;  1GC6 A;  3RD2 A;  2KN5 A;  2VRR B;  2ZEQ A;  3RNG C;  2AQ1 B;  1E7V A;  2DYB A;  4HCN B;  4P16 A;  1CMX B;  3PVL A;  2D5G A;  2BB5 A;  4AJW A;  1TGZ B;  2K6Q A;  5E6J A;  2K1F A;  4GB9 A;  4NNJ B;  5H8Y E;  1FNU A;  2KWC A;  2M56 B;  2Z8L A;  4XGA B;  2J4X A;  2WQY B;  4W9L A;  3N1Z C;  4NJ7 A;  2VH2 A;  4TKN A;  1EUV B;  2WXP A;  5E6P A;  3RPF C;  2INC C;  4ANU A;  1JML A;  2WXQ A;  2ZJD A;  3RYT A;  4M00 A;  2O2V B;  1KLV A;  3B1L X;  3W2D A;  1WYG A;  4A20 A;  2KQS A;  4AOF A;  1RRB A;  2WXN A;  3VR9 B;  4FA6 A;  3LDZ E;  3W1S A;  1WR6 E;  5D3D A;  3RNF C;  4GDL A;  5G5G A;  2KX3 A;  4M0W A;  3Q8B A;  1HTQ A;  1YMH E;  2JZZ A;  2IO0 B;  1ZE3 D;  1YJJ A;  2JPH A;  3KVF B;  2JT4 B;  3U7D A;  5J18 A;  4G50 A;  5L83 A;  1N62 A;  2GBK A;  4HJG E;  3UQA A;  1U4A A;  2NMQ A;  4DXA B;  3ZRC A;  4XE0 A;  1L2N A;  4XDC A;  3QAQ A;  1A70 A;  2N7D A;  3TBL D;  3AI5 A;  2MJ3 A;  2BKR B;  2MA9 B;  4WUR A;  2KKC A;  2PEA A;  4JQW C;  2JVC A;  2LXA A;  3PT2 B;  1T3Q A;  4LDT B;  4KSL C;  1OQR A;  2KD0 A;  3ZXV A;  3TL5 A;  4REZ A;  2AYO B;  3BVZ A;  3HUI A;  2JX5 A;  1WJU A;  2NPT A;  4G0N B;  2ACZ B;  2L0T A;  2IDY A;  3R2T A;  4PT5 A;  1JCK B;  1VR9 A;  1AAR A;  2KT7 A;  2ASQ A;  1STE A;  1D5Z C;  1WE7 A;  1KLG D;  1WH3 A;  2B3A A;  2KTR B;  1WM3 A;  3BWU D;  4GLS C;  2LRW A;  1HXY D;  3CWI A;  1N63 A;  3ML8 A;  3OJ3 A;  1J0G A;  2LWP A;  1ZDV A;  1WSP A;  1KM7 A;  3UIN B;  4E71 A;  3RZF A;  5CHF A;  4F8C B;  1J7A A;  2L05 A;  2RSU A;  2MLB A;  3I63 C;  3W5U B;  2XN9 C;  2WGS A;  3C8Y A;  3VDZ A;  3AMZ A;  2WYQ A;  2W82 A;  3IT4 B;  4FXC A;  1FFV A;  3ZTD A;  4EZJ A;  2ZPY A;  4IWP A;  2GBN A;  4C4V B;  4NQL B;  1TT5 B;  2G1E A;  1L0X B;  2J53 A;  4LNN A;  3RZW C;  3AEB B;  5JZE B;  3RFZ B;  3H7P B;  4FJY A;  2Q5W D;  2WWZ A;  3FIL B;  4W9F A;  3AE4 B;  1M4V A;  3PLU A;  3WCQ A;  3BVM A;  1BT0 A;  1F77 A;  4XWW A;  3H8H A;  1MJD A;  4LTU A;  2Y5C A;  2VZK D;  2XBB C;  3UIO B;  5BYQ A;  3X0W A;  3BK1 A;  4D2K A;  1NYR A;  4MAC A;  2MH7 A;  3PHW B;  3T9L A;  3PV1 A;  2K25 A;  2WDT B;  4XDD A;  3R66 C;  4C80 A;  4W9G A;  1E6E B;  3IBE A;  5BYS A;  5KHO A;  2BKF A;  4WJQ A;  4XX5 A;  2REX A;  3KLS X;  2RDG A;  2IO2 B;  1FM0 D;  3V61 A;  1HE8 A;  4KSK C;  2BS2 B;  1Z2M A;  1YIW A;  1WGR A;  1I4Q A;  3VAW A;  1QF6 A;  3ZVV A;  3TMP B;  5FR3 A;  2BS4 B;  5E6O A;  3RN9 C;  3KYD D;  1YJI A;  4BKG A;  1FO4 A;  1XF5 L;  2WS3 B;  3L08 A;  5EDS A;  5CHV C;  2I1J A;  4WWM A;  4KV2 A;  2ZW1 A;  4GSW A;  5DPW A;  5IO9 A;  3QK0 A;  4YTP B;  1FNV A;  3Q3N C;  4ICV A;  4S17 A;  3E56 A;  2DZM A;  1HEZ E;  3ENE A;  2JXT A;  3L4P A;  3ZW3 A;  2N0S B;  2BB6 A;  4C7Z A;  4GDK A;  4MJS A;  3V6C B;  2KXJ A;  3PRZ A;  3W1Y A;  4C00 A;  4C7Y A;  1UEL A;  1V80 A;  3P4Q B;  4BFR A;  2FAZ A;  4EOY A;  4ZRJ A;  2PKO A;  2MCN B;  3NS8 A;  2QHO A;  3R7R A;  2Y5P A;  2YEP F;  2KC2 A;  3PLV A;  5HFY A;  2CS4 A;  4XC2 A;  2BW2 A;  3KQ4 A;  4K81 A;  1N60 A;  2V1Y A;  4DXG A;  1WZ0 A;  1WGG A;  2BTE A;  3SU8 X;  5IKC M;  4LNO A;  1R7S A;  3S2A A;  4M8M A;  2DBY A;  2WXH A;  2K8C A;  2KMC A;  2BS3 B;  4RMA A;  3DWM A;  4M02 A;  5BO4 B;  2KDE B;  2WXK A;  5I4D A;  1KF6 B;  3NZU A;  2KMA A;  5L95 C;  4WH4 A;  2C7H A;  4N6E B;  1UUP A;  3VVW B;  1Y56 A;  2QMT A;  4O1N A;  4MSM B;  1ZGU B;  3L0W B;  3Q8C A;  2C60 A;  2WNM A;  1NVI D;  4AP4 C;  2LGX A;  4JGH B;  2DHZ A;  3FIL A;  3SEB A;  2D3A A;  3CMM B;  3GZN B;  1ZUD 2;  2KO3 A;  2OHF A;  2CU3 A;  2BBC A;  1EWY C;  3IVF A;  2Z0E B;  5IOI A;  1UWX A;  3ECI A;  1EF5 A;  2LFI A;  1SJH D;  3PRP B;  4A3P A;  3P63 A;  2L3Z A;  4J6I A;  5AUI A;  1AWD A;  2BPS A;  4ARC A;  3P2B A;  2DAF A;  1WY8 A;  3N1Y C;  3TEW A;  1MG4 A;  3QCA A;  2DLB A;  3U7Z A;  1MFW A;  5DPS A;  1XLP A;  3W1S C;  2HJ1 A;  3NVV A;  2X8X X;  4II2 B;  2JRI B;  2GBR A;  4PYZ A;  2A5U A;  4RNA A;  3M3J A;  1K8R B;  1T0Q C;  2ICI A;  2D11 A;  3A9K B;  3AEC B;  1SGH A;  2OOB B;  3ONS A;  2K6D B;  3PGE A;  4BZA A;  3I3T B;  4UDU C;  4AUQ C;  1IYF A;  2IBI B;  1E8W A;  2UWQ A;  2OJR A;  4HRO A;  1TKG A;  4IM3 A;  3H9D A;  1YN5 A;  4HRS A;  1C77 A;  3Q3F A;  2PMV A;  3SR6 A;  5G5H A;  2DAJ A;  2R2O A;  4BAX A;  1MG8 A;  3BZD B;  3APC A;  1D5M C;  4OZA A;  4X57 B;  2DNF A;  1ZDX A;  1ROE A;  4GDK B;  2WDR B;  2OED A;  1DYQ A;  2LZ6 A;  2MBE A;  3CF6 E;  3CSF A;  1M94 A;  1I35 A;  4KGR A;  2Y3A A;  4LLG M;  4K7S A;  3IG3 A;  1EF1 A;  2J42 A;  1E10 A;  3TCA A;  2G4D B;  2LD9 A;  3DBL B;  2MJD A;  3VQI A;  2LMC A;  3BK2 A;  4LNF A;  2ON8 A;  4ZDV A;  3DWG C;  4LNI A;  1T0R C;  2NTT A;  1XT9 B;  1S1Q B;  5HG2 A;  1ZW7 A;  1HTO A;  2LGY A;  4BVU C;  2W3R A;  1XLN A;  3L10 B;  3VTW A;  1FIQ A;  1WJ4 A;  3H7S A;  4JWS C;  1NDD A;  2CU1 A;  2KAN A;  1FRR A;  3GP7 A;  2A4Z A;  1T0S C;  2BYE A;  2K39 A;  2RMM A;  1WGH A;  2NBV B;  1EWC A;  2BVC A;  4G11 A;  4W9D A;  4MGI E;  2ZNV C;  3JSV A;  4FHJ A;  3ZJV A;  1JRU A;  2K3U A;  4QAY A;  2QDF A;  2MBQ A;  1PGB A;  4JX1 C;  4YXD B;  4HPP A;  4LDT D;  3IHP C;  3DDC B;  2WXG A;  1VJK A;  3U8Z A;  4DHZ E;  4DXF A;  4M0W B;  1Q1O A;  4RF0 A;  1AW7 A;  3ZXR A;  2L1A A;  3L54 A;  3NHE B;  3H6N A;  2WXL A;  2IY0 B;  3I57 A;  2KX0 A;  1SE3 A;  3M95 A;  4US9 A;  3M62 B;  1R4M B;  4FJV B;  2J0K A;  3LJ3 A;  1F9J A;  1GAQ B;  2I2Y A;  1PQS A;  2PIA A;  2EKI A;  4IM2 A;  3P1M A;  3UGB B;  3R8B A;  3PRE A;  3PZ7 A;  2WXJ A;  4PYU A;  3HRD D;  3ETR A;  1FXI A;  4N59 A;  1GB4 A;  3U52 E;  1L0V B;  4WJO A;  1OEY J;  2BWF A;  2LUE A;  1AN8 A;  3MC9 A;  2JYE A;  2R61 A;  1WXM A;  1RWS A;  2TSS A;  3NJT A;  4PS8 A;  3SHQ A;  3ZLZ A;  3URY A;  2NPT B;  3ZKJ C;  4LK0 M;  1QOA A;  3LYY A;  3B0A A;  5G55 A;  2YEP B;  4ZHO A;  4URK A;  2D3G A;  3JW0 X;  5EE1 A;  3AE2 B;  3C0R B;  3KUC B;  3HIZ A;  2LRU A;  3AM9 A;  2KHW B;  3KWV A;  2PLP A;  3PZ8 A;  4MDK E;  5D94 A;  4MGY E;  3Q8E A;  4MJS B;  3PRM B;  1VCB A;  3DVG Y;  2KMM A;  1H8C A;  4BKS A;  2KVR A;  3IXS A;  4GIV A;  4YTN B;  2KN4 A;  2V3S A;  4DBG A;  4IWO A;  1KFY B;  1WJN A;  3NZ3 A;  4PK1 A;  4ZYN A;  2N1V A;  1YD8 U;  1SBB B;  2AQ3 B;  3BYY B;  2KDM A;  1DOX A;  4IW0 A;  3VUY A;  2ZPN A;  3WAP A;  2KFK A;  1TKY A;  1WGD A;  1XCQ L;  2ZZP B;  4ANV A;  4DWF A;  1JWU D;  4IOI E;  2GLS A;  1EU3 A;  4BOZ B;  5CTR C;  4JWU C;  4KGS A;  2QIE B;  4EEW A;  1QOB A;  1YN4 A;  4GGQ A;  4XWT A;  1V1P A;  2L76 A;  3DHG C;  3QWZ B;  1KTK A;  2LGI A;  1JWA D;  3GE8 C;  2MBH A;  2MHJ A;  2KLG A;  4WIP A;  4A8X C;  3R7Q A;  1R4N B;  1Z5S B;  4FHK A;  5AZH A;  2N9K A;  2Z59 B;  5LXI B;  3PHX B;  1UBQ A;  4US8 A;  2J52 A;  3ZDM C;  3A4S C;  4K7W A;  3LB8 C;  3NUH B;  3RNA C;  3A4R A;  3V62 A;  1FXT B;  1YQB A;  3V60 A;  3SFD B;  1IPG A;  3MC8 A;  2KNB A;  3A9J A;  2WU2 B;  1RFK A;  1CK1 A;  2FBW B;  2K8B A;  1UZX B;  1K50 A;  3W9C B;  1C78 A;  1TZO A;  1WZ3 A;  1PUT A;  1E8X A;  4MH0 E;  1LQB A;  2B76 B;  2DZJ A;  4IUM B;  3Q6B A;  1WM2 A;  3FAH A;  5EE9 A;  1Q0W B;  3Q2A C;  1DOI A;  1XO3 A;  1SE9 A;  2NS5 A;  4IWQ A;  1GPX A;  1T5X D;  4L2Y A;  2WDQ B;  4P1B C;  1NI3 A;  3ZNH B;  2YLM A;  4LNK A;  4S0R A;  2V4L A;  1WRD B;  1XD3 B;  3A9K A;  3AB5 A;  3DVN V;  1I4R A;  4KDL B;  2JYT A;  1LO5 D;  2GMI C;  3A33 B;  4AJY B;  1E7P B;  3QJZ A;  2FCM A;  2RD0 A;  3GOE A;  2VZK B;  3RI7 C;  3T3O A;  2CHX A;  4A6Q A;  2AQ2 B;  1I4G A;  3AE8 B;  2R2Q A;  3AE1 B;  1IBX B;  2FNJ B;  2WU5 B;  2N9E B;  1V49 A;  1L6V A;  2KZR A;  2G3Q B;  1WYW B;  5E6N A;  5JHB A;  4K3C A;  4A55 A;  1SE4 A;  1YOV B;  4WJP A;  1FEH A;  1GB1 A;  1ACC A;  4L1B A;  4MGZ E;  1UH6 A;  3GS2 A;  4RM9 A;  3R3M A;  2FIF A;  3EUB 2;  2L00 B;  1I4H A;  3EA6 A;  2C7N B;  2JRH A;  1WGY A;  2J0M A;  1S3S G;  2LUM A;  4MSQ B;  4WWN A;  4GOC A;  4RGM A;  2KFK B;  4B95 A;  4RCO A;  1ZKH A;  4RM8 A;  2LVP A;  1WWT A;  4HDO A;  3KUZ A;  3AE5 B;  3N3K B;  2WX1 A;  3B08 A;  4GXB A;  2FCN A;  1WR1 A;  3APF A;  1FMA D;  4I6L B;  3MHZ A;  2MBB B;  2DWQ A;  3VR8 B;  1SB3 C;  1C76 A;  3DBH B;  2HDE A;  5JXV A;  1QLB B;  2QEJ C;  3DBR B;  1E8Z A;  2D3C A;  4MM3 B;  5BMH A;  3DVG X;  2IPK D;  1GUA B;  1ISN A;  5J2R A;  3KYC D;  4WJN A;  1KRH A;  1SIF A;  3AN1 A;  1WXA A;  4W9C A;  1TS4 A;  1GOZ A;  2MBO A;  3HHM A;  2N9X A;  1JRP A;  1RAX A;  2J0J A;  4IC7 B;  1SXT A;  4LJO B;  2V9H A;  2AL6 A;  2M1M A;  2AEH A;  2K22 A;  3QC8 B;  3B2F A;  3NZS A;  5BMG A;  2JF5 A;  5BMI A;  1ESF A;  3HM6 X;  2KWU B;  4ZRP A;  2JWZ A;  2QC8 A;  4FAD A;  1N5X A;  1MVK A;  2L8J A;  2KFJ A;  3PSE B;  1R4N I;  4WQM A;  4YSX B;  3CST A;  2LVQ A;  1VDV A;  4IG7 B;  2K5P A;  2LGD A;  3RUL A;  1P7F A;  2BF8 B;  2H89 B;  2ZCC A;  3PTF C;  2CR5 A;  3VUX A;  3H7P A;  3PZD A;  3K9P B;  1TS5 A;  2AWT A;  4MEL A;  2K0P A;  3IT6 B;  4TQ1 A;  3APD A;  1BML C;  1I7H A;  2BWE S;  2HTM E;  1GNU A;  1FCL A;  2BYV E;  4NAW B;  4GN1 A;  3JYU A;  1PDX A;  3K9O B;  1P9D U;  4EFO A;  1TYG B;  3EEC A;  4JL9 A;  3AU5 A;  2I1K A;  2N9P C;  1UGM A;  3EFC A;  1V6E A;  4ITK A;  1CJE A;  5IN7 A;  1CZP A;  1RLF A;  1QKZ A;  4TMA B;  4C56 C;  4OHJ A;  4B6W A;  1TY2 A;  1KOT A;  2RDH A;  3QAR A;  1PGX A;  4DK5 A;  3DCG A;  3U4E G;  1VRA B;  1JW9 D;  2WXR A;  2JSV X;  3VXW A;  1OTR B;  3ALB A;  5DCN A;  5TSS A;  1F0Z A;  1XLQ A;  4II3 B;  4B9K A;  4I6P A;  3FC4 A;  4M01 A;  3CIR B;  1V5T A;  4FJZ A;  4GU2 A;  1WF9 A;  1KH0 A;  2FUH B;  3GB1 A;  2DZK A;  2INP E;  4W9K A;  1P0R A;  2KDI A;  3DBH I;  2N9L A;  1WX7 A;  4A3O A;  2GOW A;  1F2R C;  4K7U A;  1KLU D;  2KTR A;  3H1U A;  3SD5 A;  1UD7 A;  1FD6 A;  1P98 A;  2KC1 A;  1FFU A;  2KAC A;  4EE2 A;  1D4B A;  2WX0 A;  2IYD B;  4W9E A;  3UIP B;  2V0G A;  1N61 A;  2JZP A;  1JWS D;  1E9M A;  1K53 A;  2MP2 A;  3DHH C; 
#chains in the Genus database with same CATH homology
 2JYE A;  2R61 A;  1RWS A;  2TSS A;  3W5U B;  4TSS A;  4NZL B;  2XN9 C;  4A90 A;  3C8Y A;  3AMZ A;  3Q69 A;  1L6U A;  2W82 A;  3IT4 B;  4RFB A;  4FXC A;  1FFV A;  3URY A;  3V05 A;  4NAM A;  4LK0 M;  1QOA A;  1B1Z A;  1VZ8 A;  2AX5 A;  3LYY A;  5AUK A;  2YEP B;  4OW0 A;  2BYT A;  2WXI A;  1TJE A;  4ZHO A;  3BYT B;  1L5P A;  1JWM D;  5EE1 A;  2PVG C;  3AE2 B;  4MH8 A;  3NVY A;  4YWG G;  4ZYS A;  3AM9 A;  3KWV A;  2PLP A;  3PZ8 A;  2G1E A;  1L0X B;  2J53 A;  3Q8E A;  2IGH A;  3AEB B;  3RFZ B;  3T3N A;  1YN3 A;  2Q5W D;  3FIL B;  1IUE A;  1UNS A;  2PVO D;  1HA5 A;  4RGN A;  3AE4 B;  1M4V A;  3WCQ A;  3BVM A;  1F77 A;  2DYM A;  2KMM A;  3AEF B;  4XWW A;  3H8H A;  4YTN B;  3IXS A;  4LTU A;  2KN4 A;  2Y5C A;  1B9R A;  2DYO A;  3AED B;  2VZK D;  2EEL A;  4CQN A;  1SJE D;  5BYQ A;  1HZ5 A;  3BK1 A;  4D2K A;  3AE9 B;  1ET9 A;  1NYR A;  2NTS A;  1KFY B;  4MAC A;  2MH7 A;  3NZ3 A;  2W55 A;  4Q2J A;  3MP9 A;  3W5V B;  3AE7 B;  4JPS A;  4XDD A;  1QQR A;  1SBB B;  2AQ3 B;  2L32 A;  2KDM A;  3BYY B;  4KGT A;  4C80 A;  1DOX A;  2M0A A;  5T8I A;  4MT5 A;  1E6E B;  1TKY A;  1XCQ L;  1OQQ A;  5BYS A;  3TEX A;  3Q8A A;  1JWU D;  1SEB D;  1VZ7 A;  3KLS X;  4IOI E;  2LHE A;  2RDG A;  1EU3 A;  3NRZ A;  4ZOH C;  1FM0 D;  1MI0 A;  4N58 A;  1AYF A;  4JWU C;  2E6X A;  4KGS A;  2QIE B;  1YN4 A;  1QOB A;  4XWT A;  4DQO C;  1IBX A;  1V1P A;  1YNT E;  2MJE A;  5HHD G;  1KTK A;  2BS2 B;  1NEN B;  1D5X C;  2LGI A;  1IGC A;  1I4Q A;  1JWA D;  1QF6 A;  3ZYY X;  1PGA A;  4RF1 A;  1V1O A;  4A8X C;  4WIP A;  4ZRQ A;  5FR3 A;  2BS4 B;  1CQV A;  1QIL A;  1YJI A;  4OZB A;  2N9K A;  1FO4 A;  1XF5 L;  2WS3 B;  2BT6 A;  4HKZ E;  1QOG A;  2MEK A;  1J7C A;  3V3X A;  3ABV B;  4US8 A;  4AQ7 A;  2J52 A;  3UI3 A;  3ZJU A;  3LB8 C;  4WWM A;  1BXT A;  3NUH B;  2ZW1 A;  2FE8 A;  1I4P A;  1L4D B;  3SFD B;  1C4C A;  4YTP B;  1FNV A;  1Q10 A;  1FXA A;  3E56 A;  2WLB A;  2KAJ A;  2WU2 B;  1HEZ E;  1RFK A;  1CK1 A;  2JXT A;  2FBW B;  1EU4 A;  5D7G A;  5GXG B;  3L4P A;  4YT0 B;  1K52 A;  1K50 A;  2N0S B;  2BB6 A;  4H2A A;  1C78 A;  3W9C B;  1TS3 A;  4C7Z A;  1TZO A;  2QIL A;  1C4A A;  3EGR A;  1PUT A;  3AEE B;  2B76 B;  4HEA 1;  4C7Y A;  4RH6 A;  2I38 A;  1V97 A;  3I9V 1;  3FAH A;  3BII D;  5EE9 A;  3P4Q B;  2E3T A;  1DOI A;  1F2R I;  1XO3 A;  2GI9 A;  1L4Z B;  4L23 A;  1SIJ A;  3ZQ4 A;  1GPX A;  1YQ3 B;  2PKO A;  1T5X D;  4L2Y A;  2WDQ B;  3B2G A;  1OFF A;  2Y5P A;  1HQR D;  1NI3 A;  4HKQ A;  2KWD A;  2YEP F;  1WXQ A;  2QSD A;  3P4S B;  3O13 A;  5HFY A;  2W3S A;  2WDV B;  1J7B A;  1FRD A;  4RGT A;  2BW2 A;  3AB5 A;  3KQ4 A;  2X38 A;  1I4R A;  1N60 A;  4WAF A;  4DXG A;  5C3J B;  2LEK A;  2BTE A;  2JYT A;  1LO5 D;  1R7S A;  3MFG A;  4B0E A;  1YQ4 B;  2GRI A;  1RYJ A;  2DBY A;  1DGJ A;  2WXH A;  3BVG A;  4IKG A;  4J3O D;  1E7P B;  2JWU A;  4KKI A;  3IAM 1;  2VZK B;  4NJC A;  1N5W A;  1JAL A;  2KQ4 X;  3T3O A;  1T6B X;  2BS3 B;  3DWM A;  4A6Q A;  1WGK A;  2AQ2 B;  3P4P B;  2WXK A;  5I4D A;  5EE0 A;  1KF6 B;  2IGG A;  3VRA B;  1I4G A;  3AE3 B;  3AE8 B;  4WH4 A;  3AE1 B;  1IBX B;  1VZ6 A;  4N6E B;  1JWB D;  1ENF A;  1MHX A;  1JRO A;  3KWL A;  1UUP A;  1VLB A;  2WU5 B;  1Y56 A;  2QMT A;  2IJ0 A;  4O1N A;  3TSS A;  1D6E C;  1QT9 A;  3AV8 A;  3Q8C A;  2PW9 A;  2WNM A;  1L6V A;  1NVI D;  3PO0 A;  1ZXI A;  2V3P A;  4A55 A;  1SE4 A;  3FIL A;  3SEB A;  1JQ4 A;  1HZ6 A;  4KX6 B;  1ZUD 2;  3TUO A;  3TEY A;  2OHF A;  1UWM A;  3AEG B;  1FEH A;  1FNW A;  3MJ5 A;  2CU3 A;  2BBC A;  5H92 C;  1GB1 A;  1EWY C;  1ACC A;  1ZP0 B;  4L1B A;  4YTM B;  1WRI A;  2XNA C;  3ZJT A;  3GS2 A;  2H88 B;  1UWX A;  2LFI A;  1SJH D;  3R2I A;  2ZW0 A;  1C79 A;  4ARI A;  3EUB 2;  4A9A A;  3P63 A;  2WXF A;  1I4H A;  3B9J A;  2JQR B;  5AUI A;  2CJN A;  1AWD A;  1V8C A;  3EA6 A;  4ARC A;  2QJL A;  3U2S C;  2WXM A;  2LUM A;  3MC0 B;  2L52 A;  4RGM A;  4RCO A;  4B0M A;  3AH7 A;  1WWT A;  3TEW A;  2LJI A;  4YSY B;  1SSN A;  3AE5 B;  4RGO S;  4TQ0 A;  1TKE A;  2DLB A;  3U7Z A;  4YSZ B;  2K9X A;  1ZPS A;  2SEB D;  1FMA D;  1XLP A;  1EM7 A;  2IGD A;  2WP9 B;  3MHZ A;  2DWQ A;  1L0Y B;  3NVV A;  3VR8 B;  2G9H D;  3E9S A;  2RPV A;  2V3N A;  1ET6 A;  1SB3 C;  1P7E A;  3SFE B;  3AE6 B;  4RNA A;  1C76 A;  2HDE A;  2W54 A;  3OWE B;  5JXV A;  5MPO A;  1QLB B;  2ICI A;  2QEJ C;  5BYR A;  1IGD A;  3LXF A;  5FK9 C;  5FKA C;  3AEC B;  4MM3 B;  5BMH A;  1PYW D;  2IPK D;  4R3D A;  1FCC C;  1K51 A;  2L83 A;  4KKJ A;  1C4P A;  4UDU C;  1KRH A;  3TEZ A;  3AN1 A;  1TS4 A;  1GOZ A;  4HRO A;  3AEA B;  1TKG A;  1YN5 A;  1XEE A;  4HRS A;  2AQ1 B;  1JRP A;  1C77 A;  2PMV A;  3HVD A;  3SR6 A;  1SXT A;  5G5H A;  1NYQ A;  4GDL B;  4P16 A;  2D5G A;  1XLO A;  2BB5 A;  3BZD B;  2K22 A;  1D5M C;  4OZA A;  5E6J A;  3B2F A;  5BMG A;  2N7J A;  3P4R B;  1ZDX A;  1ROE A;  4GDK B;  2PTL A;  2ONQ A;  1ESF A;  5BMI A;  5H8Y E;  1FNU A;  2WDR B;  4ZRP A;  1DOY A;  2OED A;  5D3I B;  1N5X A;  1MVK A;  1DYQ A;  2M56 B;  3IAS 1;  1ZXH A;  4WQM A;  4YSX B;  2Z8L A;  2J4X A;  2WQY B;  1XCT L;  1VDV A;  4ZHP A;  4KGR A;  4IDI A;  2Y3A A;  2K5P A;  2WXP A;  1P7F A;  4LLG M;  3RPF C;  1BUI C;  2JU6 X;  2SAK A;  1NEK B;  2H89 B;  2J42 A;  1E10 A;  1JML A;  2WXQ A;  3P42 A;  2LHD A;  2MJD A;  3VQI A;  1TS5 A;  2LMC A;  3BK2 A;  5LNK 1;  1UGJ A;  2K0P A;  1RM6 C;  2ON8 A;  3W2D A;  1WYG A;  3DWG C;  3IT6 B;  1C9F A;  3HVZ A;  4TQ1 A;  5HI1 A;  4OVZ A;  2WXN A;  3Q8F A;  2NTT A;  3VR9 B;  3W1S A;  1BML C;  1I7H A;  5D3D A;  2HTM E;  5HG2 A;  5G5G A;  1FCL A;  4NAW B;  4M0W A;  3Q8B A;  1PDX A;  3NVZ A;  1YMH E;  2W3R A;  1ZE3 D;  1TYG B;  1YJJ A;  1XLN A;  1I4X A;  2CJO A;  1FIQ A;  1MHH E;  4JWS C;  1N62 A;  1XXG A;  1FRR A;  3GP7 A;  4OZC A;  1PFD A;  4HJG E;  4ITK A;  1CJE A;  1SE2 A;  2NMQ A;  1CZP A;  2RMM A;  3ZGZ A;  1QKZ A;  1QOF A;  4AS1 A;  4XE0 A;  4TMA B;  4C56 C;  1EWC A;  4OHJ A;  2FUG 1;  4XDC A;  4USA A;  3N9Y C;  1TY2 A;  1A70 A;  2GB1 A;  1V1P B;  2RDH A;  1PGX A;  3ZJV A;  2MJ3 A;  2K3U A;  3J9C A;  3U4E G;  1VRA B;  1JW9 D;  4YXD B;  2WXR A;  1PGB A;  2JSV X;  4JX1 C;  4WUR A;  2M19 A;  1T3Q A;  1TS2 A;  2WXG A;  1OQR A;  5C2T B;  1VJK A;  5TSS A;  1TY0 A;  4DXF A;  1F0Z A;  1XLQ A;  4REZ A;  4RF0 A;  3BVZ A;  5EE3 A;  3HUI A;  2JX5 A;  1E0Z A;  1AW7 A;  4JE3 B;  3FC4 A;  1ZOY B;  2L1A A;  3CIR B;  3NVW A;  3VRB B;  1KH0 A;  2WXL A;  3GB1 A;  2INP E;  1SF0 A;  2ACZ B;  3I57 A;  2IDY A;  1SE3 A;  2N9L A;  3R2T A;  4PT5 A;  1F2R C;  4US9 A;  1JCK B;  1VR9 A;  1KLU D;  4P6V F;  3NS1 A;  1STE A;  1D5Z C;  1GAQ B;  1KLG D;  2I2Y A;  2WXO A;  2V4I B;  1FD6 A;  2PIA A;  2EKI A;  1FFU A;  3BWU D;  2KAC A;  4GLS C;  4EE2 A;  1D4B A;  1HXY D;  3CWI A;  1N63 A;  1MPE A;  2INN E;  3P1M A;  3R8B A;  1ZDV A;  3PZ7 A;  1WSP A;  2WXJ A;  3HRD D;  2V0G A;  3ETR A;  1N61 A;  1FXI A;  4N59 A;  1GB4 A;  3U52 E;  2JZP A;  1JWS D;  1L0V B;  1E9M A;  1J7A A;  1K53 A;  1AN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...