1JMLA

Conversion of monomeric protein l to an obligate dimer by computational protein design
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
MHHHHHHGMEEVTIKANLIFANGSTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVVPKAYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Conversion of monomeric protein L to an obligate dimer by computational protein design.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2001-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1jmlA00
1MPEA 5BMHA 1D4BA 1KH0A 4GLSC 1K50A 4KGSA 1PGXA 1F2RI 2GB1A 2LGIA 4IKGA 1GB4A 5HG2A 2N9KA 3FILA 2KACA 1MI0A 2JWUA 1K51A 2LUMA 2RMMA 2PTLA 4HJGE 3MP9A 4D2KA 2IGDA 2ZW1A 1MVKA 1QKZA 3V3XA 1JMLA 5HI1A 1MHXA 4OZCA 1XF5L 2JU6X 2ZW0A 1YNTE 3UI3A 2J52A 1IGCA 1P7FA 2LHDA 2JZPA 1PGAA 2N7JA 1FCLA 4OZAA 1HZ5A 2IGHA 1HZ6A 1Q10A 2NMQA 2JSVX 2I2YA 4WH4A 2KQ4X 1K52A 2PLPA 4MACA 4KGRA 3FILB 4IOIE 2J53A 1F2RC 2ON8A 1PGBA 2K0PA 1FD6A 2EELA 4KGTA 1IBXA 2IGGA 3GB1A 2QSDA 5HHDG 2GI9A 2ONQA 1ZXHA 2KWDA 5BMGA 2I38A 2N9LA 2KDMA 1P7EA 1XCQL 5BMIA 1EM7A 2QMTA 1HEZE 2JXTA 1FCCC 2LHEA 2OEDA 2PW9A 1C9FA 1K53A 2RPVA 4OZBA 1UWXA 5HFYA 1IGDA 1MHHE 5JXVA 1YMHE 2KN4A 1IBXB 1GB1A 1XCTL 4HKZE
chains in the Genus database with same CATH superfamily
1E90A 2Z0DB 3CSTA 4EUTA 4OVVA 1WRDB 3PV1A 4PYUA 1ZPSA 3VTUA 2BYTA 3PT2B 5EE0A 2MP2A 2PE9A 3DHIC 3NG0A 4MJSB 3R2IA 2PJHA 4D2KA 2LFIA 1TZ1A 5HI1A 2JT4B 3C19A 3TCAA 2J0KA 2N9PC 3AE4B 3QIJA 3OJ3A 4AJYB 2VH1A 4ANUA 2DAJA 2SEBD 4JIOU 1YX5B 4KKIA 3VHTC 3K9PB 2WYQA 3ZIMA 1E10A 5KHOA 1WX8A 1N5XA 2RDGA 2AL6A 2AQ2B 4W9DA 3JSVB 3TEZA 4MACA 2IY1B 3P2BA 2J42A 4I6LB 2KDEB 1MJDA 4BBNC 2AQ3B 3ZGZA 2CU1A 2KFKA 3TEYA 4AWJA 1YD8U 4MM3A 1TS4A 3X0WA 4LDTB 1K8RB 1XEEA 2MJEA 4GIVA 4A8XC 2JZZA 2BVCA 4W9HA 3AEAB 1QZEA 4KV2A 5EE9A 2AEHA 1TBEA 3OAWA 4MH8A 4NQKE 2DX5B 2Z59B 3QC8B 1RRBA 3RD2A 4XZ4A 3NZ3A 1F77A 2BT6A 2OEDA 4XDCA 3FAHA 1IPGA 2WP9B 3GP7A 3NVWA 3WIMA 3I9V1 5JHAA 3P4PB 2LGXA 5HFYA 5JZEB 1UGJA 2DHZA 3W1YA 4AS1A 2M19A 3AMZA 3UGBB 4GXBA 4DHJD 1WH3A 2KAJA 1JROA 3N1YC 2IO0B 3AECB 4ZDVA 2CR5A 1V1PA 2JRHA 1UELA 3NS1A 1SBBB 4LLGM 3A9JA 1KRHA 2HDEA 4PYZA 1WRIA 5E6OA 2BF8B 4A20A 4K3BA 1XLOA 5CHVC 3RCZA 4X57B 2JRIB 3QX1A 3JVZX 4LNIA 2LASA 3BINA 3ZKJC 2RDBC 1J19A 1FCLA 1D5MC 2WQYB 3RI7C 2WXKA 2NTSA 1VJKA 3EA6A 4RNAA 4FULA 3RNCC 2DWQA 4IWQA 2V1YA 2V9HA 2K9XA 1BMLC 1LXDA 2ZCBA 1L7YA 2KWVB 3TSSA 2W3SA 1I42A 4BVUC 1AYFA 1VR9A 4B95A 1MG4A 1HTQA 2BWFA 2WDVB 4CYEA 1L2NA 2CHXA 3AM9A 3N20C 3PZ8A 3NZSA 5I4DA 3CF6E 1TS2A 3CWIA 4M02A 1XCQL 3KUDB 3R3MA 1ZGUB 1HEZE 2C5LC 3Q2AC 4N6EB 2LVQA 3V6EB 1XO3A 1I4QA 2LXAA 1TYGB 3NVVA 2BTEA 3RMKC 2KDFB 2OJWA 2G45B 2KN4A 3A4RA 3H7PA 5LXHA 2LEKA 1LGRA 2JVCA 4MM3B 5LXIB 4J3OD 4WJOA 4K7WA 3U52E 2CHZA 2JXXA 3RYTA 3AEBB 3ZYYX 4ACFA 3UIOB 3GS2A 1V6EA 3ZDTA 2EKEC 3QHTA 4JL9A 1TY2A 1JWAD 1ROEA 3FILA 4P16A 4WWNA 4GSWA 4DHJB 2KFJA 1T6BX 3DVNU 3HVZA 3AB5A 2G9HD 1TT5B 1XF5L 1V5OA 3CIRB 3EECA 2REXA 3AE9B 3NZUA 5EE3A 3N3KB 4GGQA 1L6UA 3H7SA 5G2NA 1U4AA 2M56B 3H8HA 1IGCA 2B76B 3PRMB 4ZRQA 3VR8B 1V1PB 2J4XA 1YQ3B 5FR6A 1Q10A 1TY0A 4G3XB 3UIPB 3A9JB 2IDYA 4ICVA 2LGYA 3U4EG 1WXSA 3PHXB 4FHKA 3MC8A 4MSMB 3EC8A 2Q5WD 1Y56A 2LXCA 1N62A 2KLCA 2KN5A 2V3PA 3HRDD 1SJED 2LD9A 2QHOA 3E56A 2C7MB 2KC2A 1FRRA 4YT0B 4GMVA 2KWUB 2JUOA 2IBIB 5E6JA 3VH4B 3EHVA 1UWMA 4DHZB 1P7EA 3BVZA 1T5XD 1RAXA 4RF1A 5AZHA 5H92C 2BW2A 1AN8A 1XXGA 1RYJA 2V3NA 4Q2JA 1ZP0B 2N9EB 3N9YC 4N59A 1P9DU 3HVDA 2RPVA 2AWTA 3APDA 3AU5A 2LGDA 3I3TB 4MGYE 1E8WA 2HD5B 2BKFA 2VZKB 5BMHA 3PLVA 1D4BA 1RFAA 2QILA 1QOFA 2INPE 3Q3MC 3DBLB 3KW5B 3DCGA 4E3CA 1VZ7A 4YSXB 3W2DA 2UWQA 2LMCA 2IJ0A 5FR3A 1SJHD 4US8A 1ZOYB 1C4PA 3NS8A 4WURA 2KD0A 2M17A 2PVGC 1JRPA 1UZXB 3RNAC 3M63B 3SFDB 2JF5A 2INCC 3DBHI 2I1KA 3NY5A 1JQ4A 1TKGA 1K52A 2D11A 3FILB 3AULA 2DYMA 2ON8A 1WJ4A 2AYOB 4NJ7A 1FD6A 4EZLA 1SE4A 4BZAA 1J7CA 4LJOB 3SEBA 3ZTCA 3M3JA 4YSZB 1R7SA 2N7EA 4XGAB 1KLUD 2JQRB 3K9OB 5D2MB 4YWGG 3D32A 3TEXA 3P4QB 3B0AA 4LK0M 1EO6A 3P4SB 2WLBA 3PHWB 1WIAA 2MBHA 1QLBB 3Q8EA 2ZJDA 1HQRD 1N63A 4PS7A 1H4RA 4TQ1A 3MTNB 4XC2A 2ACZB 4WAAA 3IAM1 3M95A 2MBOA 1OGWA 4BBNF 1QF6A 1XLQA 1LFDA 4MT5A 1MHHE 5JH5C 2NCNA 2WX0A 1OEYA 4HK2A 4YL8A 2G1EA 3ZNID 2RD0A 4HKZE 4K81A 1KF6B 1TS3A 4C80A 2M0XA 2ZZPB 2D3AA 4EOYA 3ONSA 3P1MA 4ZRIA 1A70A 2JX5A 2KACA 4NAWA 4NPNA 2LVPA 2IGDA 4F1SA 2C60A 2WXJA 2L05A 1I7HA 2KVZA 1D6EC 1MHXA 3U7DA 2WGSA 3V05A 1YNTE 3NVZA 1E7VA 2K8BA 4H2AA 1N5WA 1P0RA 3BZDB 1WSPA 2L3ZA 4ITKA 4AQ7A 2INDC 3ZRFA 1OQYA 3IHPC 3APFA 1VD2A 3BWUD 4BKTA 4O1NA 2INNE 2M1MA 3TMPB 1PGBA 2KYWA 2BPSA 4S17A 3Q8AA 4RM9A 1ZE3D 1EU3A 4HJKA 5J18A 2LVOA 2BGFA 3ZUNA 1WXMA 1FFVA 1ISNA 2MH7A 1JWUD 1NVID 4HXDA 2ZVNA 4GDLA 4LNFA 1UBIA 4HCPB 1N61A 4L1BA 3KYDD 2A5UA 4HROA 1J0GA 3BVMA 2N1WA 1D3ZA 4BKSA 4G11A 3ECIA 5D3DA 3QQ8B 2BB6A 3MHZA 4DXGA 4FHJA 3P63A 4EEWA 1NEKB 3AV8A 5JXVA 1C1YB 5AEKB 1GB1A 1FFUA 1XCTL 4WQMA 3WALA 4BKSD 2PKOA 3FKYA 1KH0A 1TTNA 1NBFC 1T0QC 1FRDA 3L10B 3DQVA 4AOFA 4QAYA 3A33B 1FEHA 1IUEA 2WXMA 2PTLA 1V9JA 4XYCA 3UQBA 5BYRA 1GUAB 1R4MI 4WWOA 2KLGA 2KT7A 2ZW1A 3Q3NC 2M8SA 1EUVB 1JMLA 1FXIA 1PYWD 2GBRA 3T3NA 3KWLA 2JU6X 4AJWA 1R4NB 4W9EA 4II2B 1J7BA 2PE6B 3ZJVA 3IBEA 2K6QA 2WX1A 1D5ZC 2V0GA 4RGNA 3DBRB 2NVUI 4HVBA 1EU4A 2JZ3B 1WJNA 1E0ZA 1VRAB 3VFKA 4TKNA 4WH4A 2KQ4X 3QA8A 3E9SA 2AL3A 4EE2A 2WWZA 2MCNB 2A4ZA 1L0VB 2EELA 1BUIC 1UH6A 2X38A 4KDIC 2VRRB 2FCMA 1CQVA 2AX5A 1ZXHA 3IVFA 1P1AA 2FBWB 1OQQA 2IY0B 3U7ZA 1JWBD 4K3CA 2MRPA 2XK5A 2KDMA 1WFYA 1SF0A 3AEGB 3ZTDA 4IW0A 4TQ0A 1EM7A 2N0SB 3PZDA 4A90A 3H1UA 3HM3A 3V6CB 1T3QA 1K53A 3UQAA 5GMVA 1IGDA 1YMHE 3PTFC 1V1OA 4WAFA 4L2YA 2YEPF 2IO2B 5CX3A 3LB8C 4WWPA 2QEJC 1YOVB 2KHWB 4NNJB 3KYCD 4ZHPA 1ACCA 2KX0A 4GDLB 4HPLB 2M4NA 3ZLZA 2KMAA 4XE0A 2RMMA 1TKEA 4JE3B 2Z0EB 3AI5A 1M4VA 4A3PA 2PVOD 4W9CA 2WXRA 2Y3AA 2SAKA 4B0MA 1WZ3A 1L0XB 2C9WB 4IUMB 3L4PA 1GJZA 2LGSA 1HZ5A 3ZVVA 2I2YA 3R66C 4IWOA 1WX7A 5HKHA 3VTVA 1WX9A 2WU5B 5D94A 4I6NB 1KFYB 1WMHA 3QJZA 3VXWA 1I4HA 2IO1B 2WXIA 3R7RA 2V4LA 2XNAC 2QDFA 4A9AA 1YJJA 3VQIA 3UINB 1UF0A 2ONQA 1NYQA 5D3IB 3P4RB 2K1FA 1L4DB 1S1QB 5C1ZA 1QOGA 1PFDA 1JWMD 3IG3A 2MP2B 2FUG1 4DQOC 2IPKD 3ETRA 5EDSA 2WXPA 4C4VA 3I63C 5TSSA 4ANWA 1UWXA 2N1VA 1HA5A 2DZIA 4KIKA 3RULA 3GOEA 1MPEA 1DOIA 2MBQA 5G5HA 1KM7A 2WXFA 2O6VD 2NBWB 3VRAB 2XK5B 3PLUA 1T0YA 2G4SA 4RCOA 2W55A 2LJ5A 4TSSA 3GZNB 2IO3B 3DOWA 4URKA 2D3GA 2YEPB 2NS5A 2KFKB 3KQ4A 4B6WA 3AU4A 2FE8A 4E71A 4NQLB 4ZRPA 3NUHB 2K5PA 1FIQA 1SE2A 4NAMA 4ARCA 2WU2B 1FXTB 1Q1OA 1I35A 3BY4B 4MH0E 1I4RA 2IGHA 4AP4C 4C00A 1HZ6A 1YIWA 4XWTA 1YJIA 2VH2A 4PT5A 3HM6X 5IP4D 3TUOA 4FA6A 2QIEB 1C3TA 3VDZA 2XN9C 2CHWA 1YJ1A 3GE3C 4YSYB 3QARA 2DZKA 3Q3FA 1TS5A 2UU7A 1KTKA 1EWYC 4KSKC 2IZVB 2ZNVC 3RNGC 3BK2A 4MDKE 3W5UB 2NPTA 1C4CA 5C3JB 1QILA 2DYBA 2WNMA 4RH6A 1ZXIA 3N32A 1B1ZA 1IYFA 1RLFA 3UF8A 3DHGC 1ENFA 1WMHB 2RSUA 1F0ZA 4IDIA 4OZBA 3S2AA 4RGMA 3C8YA 1JWSD 5J17A 1ET6A 3L54A 5E6NA 4FADA 2R2QA 3ZNHB 1QOAA 3VH3B 3ZJUA 1VZ6A 5AZFA 2L8JA 4C7ZA 1JALA 1XD3B 2MA9B 3RN9C 4G50A 1D5XC 3OJ4B 4HDOA 5BYQA 4YXDB 4JWUC 2HTHA 2MHJA 4LNKA 3CMMB 5AZGA 4MSQB 3U2SC 4DDID 5D6JB 3QK0A 4C4VB 1GPXA 1UUPA 1KJTA 1WGGA 3L08A 4AUQC 2KQ7A 4IM3A 2H89B 1PDXA 2QJLA 1GC6A 4MELA 5CHWA 3TEWA 3ABVB 2N7JA 1PGAA 2KDIA 5GXGB 3T3OA 3WCQA 3I5JC 2WDRB 2JSVX 3PRZA 3KH0A 1E7UA 4NY0A 3L13A 4ZHOA 3QCAA 1FNVA 1C4AA 4HPMB 2FCSA 2LI5A 2MQJA 3ML8A 4KX6B 3H7PB 3L16A 2UYZB 1HXYD 4FJYA 1WGRA 3Q8CA 4NJ6A 2OHFA 3PPAA 3H6NA 2I38A 3N1XC 3R8BA 1EWCA 2ASQA 2N9LA 1RWSA 2HJ1A 5CTRC 1V80A 2BYEA 2KTFA 1LO5D 3J9CA 3HUIA 2K8HA 2DZJA 4M8MA 2YVCA 3VR9B 2R61A 2BB5A 4LJPB 3O13A 1DGJA 5IA7A 3RNFC 1WE6A 3VUYA 2PMVA 2C7NB 3PVLA 1Y8RC 1PGXA 2NPTB 3L0WB 3AEDB 3ZNZB 1ZUD2 3AXCA 1F2RI 1LQBA 1NENB 1NI2A 3WAOA 4W9LA 4ZRKA 1WM2A 3PRPB 5C23A 2J0MA 1YQBA 2WXLA 2BBCA 3ZO5B 1BXTA 5IOIA 2I1JA 1BT0A 1MVKA 4DBGA 3A9KA 2O2VA 4MGKE 2K3UA 3AH7A 4OW0A 3ZW3A 2N7DA 5AUKA 1EF5A 4MGZE 4EZJA 4WJQA 1UNSA 3ALBA 3AE3B 2PLPA 1P98A 1TJEA 3IAS1 3DDCB 2L76A 1Q0WB 1SEBD 2WXNA 3VUWA 2WXHA 3KWVA 3DWGC 3N30A 1IBXA 4JLCA 1Z5SB 3ZJTA 1Z2MA 4A55A 2KWDA 2L7RA 4S0RA 2KOXA 3OWEB 2E6XA 1UGMA 1V81A 2ZPNA 2K6DB 2BS2B 1XLPA 3NVYA 5IAAC 3A1QA 3HK0A 1FNUA 4FJVB 3LDZE 1OTRB 1NYRA 2K39A 3KLSX 4BOSC 3N1ZC 3IT4B 4IM2A 3WANA 2W3RA 2FCQA 4ZRJA 1A5RA 2WDQB 1F1HA 2MSED 2WDTB 1GAQB 1E8YA 4WIPA 2GMIC 1WXAA 4RMAA 1N60A 4US9A 1I4GA 5J2RA 1UD7A 3URYA 4FXCA 4HJGE 4LDTD 4DXFA 5L95C 4M0WA 2PIAA 1V5TA 1WYWB 3AE1B 4HEA1 1SSNA 4L23A 2MLBA 1GC7A 4RGOS 2BS4B 3W1SC 3DVGX 5LNK1 4KZCA 2D3BA 1WM3A 4WWMA 5MPOA 1NDDA 4OZAA 5DPTA 3VVWB 3R7QA 2ZVOA 2MWSB 2PPHA 1ESFA 4USAA 2KTRA 5BYSA 4UDUC 4DXAB 1YQ4B 1IP9A 4GU2A 2J53A 3IXSA 4K1RB 1V97A 1KLVA 3M62B 4PS8A 5IO9A 4ZYSA 4XX5A 2RPQA 1VDVA 4ZYNA 1ET9A 3A9KB 4RM8A 2O2VB 2QSDA 2RDHA 2GI9A 4HLEA 4TMAB 3WA0A 3EFCA 1I4XA 1QQRA 1FO4A 4K7SA 2MJ3A 2ZCCA 3X23A 2KJHB 3VTWA 4DHZE 4ANVA 2DLBA 1RM6C 4NAWB 3V62A 1C79A 2BQQA 2QMTA 3AE8B 3FC4A 1UBQA 4F8CB 1EF1A 4ANXA 2DYOA 4JQWC 5JHBA 1JW9D 2Y5CA 1MFWA 3Q3OC 1E8XA 2KKCA 1IBXB 1SGHA 3KVFB 3RNBC 1WXQA 2FNJB 4KDLB 1OQRA 2NBUA 3EFUA 1YN3A 1Q5WB 1WF9A 3TIXA 4N9F4 2JPHA 2XBBC 1E9MA 1WI0A 4KKJA 2LGIA 3SFEB 4IKGA 2Y5PA 3AE2B 5HG2A 3RZWC 2AQ1B 4K7UA 4FBJB 3A1QB 2LUMA 4MEMA 1TKYA 4A6QA 4W9GA 2KJ6A 2FIFA 2GBKA 5IKCM 3V3XA 4NJCA 2N9XA 5DPSA 1V49A 2V4IB 2XEWA 2LZ6A 3Q8BA 2D10A 5CHFA 1WGHA 3W5VB 2NMQA 3DVGY 4P6VF 4BOZB 4RFBA 3ZDMC 3T9LA 4P1CC 4B9KA 2KNBA 2ICIA 4BFRA 5LLIA 5E6PA 4JGHB 2G4DB 2K0PA 2E3TA 3OG5A 1WZ0A 3AEFB 4M0WB 4HWIB 4GN1A 4OVUA 4RF0A 3MJWA 3KUCB 1DYQA 2MEKA 2QCZA 1CK1A 2WHIA 3PREA 4CO7A 3AE5B 1CMXB 2IYDB 2KTRB 2PW9A 3MC0B 2PEAA 2GRIA 3V60A 1C9FA 2L52A 3O65B 2CS4A 3LJ3A 4M8NA 4HPPA 2W54A 3HHMA 4R3DA 1E6EB 5C2TB 3MC9A 3BYTB 4JX1C 4IM0A 3NJTA 1F9JA 4BAXA 3AEEB 1T0RC 2LWPA 2ZEQA 3WAMA 2OOBB 1K51A 3TL5A 2KXJA 2O6VA 1VCBA 3RUIB 2KMCA 2ZNVB 1FXAA 1R4NI 4N58A 3Q69A 2Y5BB 3SD5A 3W9CB 2BWES 1YN4A 2J52A 3DBRI 1P7FA 3LYYA 2MX2A 2RGFA 5FK9C 3BYYB 1F52A 5DPRA 2EMTA 1WYGA 1WWTA 2RR9A 4HDQA 3DBHB 2LUEA 1WGKA 2L1AA 2VZKD 2LRUA 1RFKA 3C0RB 2B3AA 4KGTA 3CSFA 1WE7A 3ZQ4A 2LRWA 4M00A 3VAWA 1AWDA 3TJPA 3ZXVA 3ZNGC 1WXVA 3B08A 4F7ZA 3ENEA 1XT9B 1E7PB 2JXTA 1FCCC 1QOBA 2K22A 1ZDVA 1OFFA 2EMSA 4HCNB 2MJDA 3B2GA 3PS6A 4OVZA 4CQNA 3VUXA 1B9RA 1E5WA 4P1BC 2C7HA 4DK5A 1P3QU 5T8IA 2KK8A 4TUUA 4B0EA 1AARA 5D7GA 2HJ8A 1N6ZA 2J7QB 4II3B 1SXTA 4LNNA 4ASWC 1WJ6A 1MI0A 2JWUA 2L0FA 3MP9A 3VRBB 1LM8B 4GOCA 3PZ7A 3Q6BA 4DDGD 4W9JA 4P7IA 1KLGD 3PGEA 3PSEB 3ML9A 2KMMA 3RNEC 4J6IA 1PUTA 4XWWA 3Q14C 4LCDE 3NHEB 3T8MA 1L6VA 4FN2A 3P42A 1CZPA 3BIID 4XDDA 1NI3A 1X1MA 3ZRCA 3I57A 3DWMA 3B9JA 1F2RC 3Q3JA 3W1SA 3IFWB 1M94A 4C56C 2O6VB 3JW0X 2OJRA 2FAZA 2WXQA 4KIKB 3SHQA 2NR2A 2IGGA 2WXOA 2GBJA 1TZOA 1HE8A 4RGTA 2J0JA 2WXGA 2DNFA 4ZOHC 1QT9A 4EZKA 4GB9A 3BVGA 3DPDA 2EKIA 4W9KA 1YX6B 2TSSA 1WR6E 4I6PA 4WJNA 3AE6B 5DPWA 3WAPA 3MHSD 3U30A 3V61A 2JY6A 2LHEA 3L17A 1OEYJ 1STEA 1TIFA 2CJNA 2R2OA 4JPSA 3IT6B 3BK1A 1ZKHA 5L83A 1T0SC 1AW7A 2MBEA 3GE8C 4EKUA 4JWSC 4WJPA 2BKRB 2G3QB 2CJOA 4GLSC 2BYFA 2L0TA 4KGSA 1L0YB 1XQQA 3MJ5A 2CU3A 2JYEA 2KDBA 1GG3A 3GZNI 1GOZA 2N9KA 3DHHC 2FCNA 2KJRA 5EE1A 1VLBA 3SU8X 2CKHB 3TBLD 2V3SA 3DBSA 4GDKA 1FMAD 1JRUA 1WJUA 3RZFA 1R4MB 4HKQA 1HTOA 1CJEA 2W82A 4OZCA 2ZW0A 2MBBB 2D3CA 3UI3A 2GBMA 2WS3B 2KWCA 2LHDA 2JZPA 4FLHA 3OLMD 2LJIA 1SE9A 2JWZA 2KVRA 4FJZA 5G5GA 3JYUA 3R2TA 4LNOA 2DBYA 1FM0D 2JYTA 1GNUA 4BKGA 4YTMB 2KO3A 3SDLC 1ZDXA 3EUB2 4YTPB 2DENB 4IC7B 3LXFA 3SR6A 3RPFC 1SB3C 1SE3A 4CHKA 5BMGA 3NOBA 1YN5A 2M0AA 1L5PA 4ICUA 2DZMA 2L00B 2ZPYA 1WGYA 2BYVE 1V86A 4IG7B 4MJSA 2W9NA 1TGZB 5AUIA 3A4SC 3RFZB 5BO4B 1S3SG 5DCNA 4NZLB 4OHJA 1DOXA 5FKAC 2D5GA 3DVNV 3EGRA 3AE7B 2X8XX 3HIZA 2NTTA 4IWPA 2MW5A 1L4ZB 2K8CA 4KSLC 1J7AA 3QWZB 2KQSA 2Z8LA 1J8CA 5IN7A 3QAQA 1K50A 2GOWA 2KC1A 2FUHB 2GB1A 4MGIE 1GB4A 1SIFA 1DOYA 3JSVA 3B2FA 2KANA 4LTUA 1I4PA 1G6JA 2DAFA 1WY8A 2YLMA 2QC8A 4YTNB 1FPYA 2L32A 4A3OA 1QKZA 4KZ0A 1FNWA 3ZXRA 3RT3B 3KUZA 2D07B 2GBNA 4W9IA 4C7YA 1ZW7A 2D2QA 3MFGA 3DBLI 1C78A 3H9DA 2KX3A 3AN1A 4E74A 1JCKB 1XLNA 3NRZA 1E8ZA 1VZ8A 4PS3A 4PK1A 3B1LX 2NBVB 4KGRA 4W9FA 1MG8A 4IOIE 1V2YA 2K25A 2BS3B 4HRSA 4DWFA 4GDKB 5KHQA 2HTME 4G0NB 3GB1A 4EFOA 1PQSA 5TR5A 5HHDG 3U8ZA 3APCA 2GLSA 5H8YE 1KOTA 2FIDA 2KZRA 5G55A 4REZA 1C77A 4WQOB 4KVGB 4M01A 5BMIA 1SIJA 2HE7A 2L83A 1H8CA 2N4FA 1V8CA 4ARIA 1WR1A 2H88B 1C76A 1WGDA 3Q8FA 3PO0A 4TV3A
chains in the Genus database with same CATH topology
1KF6B 3ZJUA 1VZ6A 1TS3A 4C80A 3P1MA 1ZPSA 3AEEB 2BYTA 1A70A 4C7ZA 2JX5A 1JALA 5EE0A 2KACA 3R2IA 1D5XC 1K51A 5BYQA 4D2KA 4YXDB 4JWUC 2IGDA 3U2SC 2LFIA 1FXAA 2WXJA 1I7HA 1GPXA 1UUPA 5HI1A 1D6EC 1MHXA 4N58A 3Q69A 2H89B 3V05A 1YNTE 3NVZA 1PDXA 3AE4B 3W9CB 2QJLA 1YN4A 2J52A 1N5WA 4H2AA 2SEBD 4KKIA 1P7FA 3LYYA 3BZDB 3TEWA 3ABVB 1WSPA 2N7JA 1PGAA 5GXGB 1E10A 3T3OA 4ITKA 5FK9C 3BYYB 3WCQA 2WDRB 4AQ7A 1WYGA 2JSVX 1WWTA 1N5XA 3BWUD 2RDGA 2AQ2B 4O1NA 3TEZA 2INNE 4MACA 2J42A 1WGKA 4ZHOA 2L1AA 2VZKD 1FNVA 1C4AA 1PGBA 1RFKA 2AQ3B 3ZGZA 3Q8AA 4KX6B 4KGTA 1ZE3D 1EU3A 3TEYA 1HXYD 1TS4A 1FFVA 1XEEA 2MJEA 3ZQ4A 2MH7A 4A8XC 3Q8CA 1JWUD 1NVID 1AWDA 2OHFA 2I38A 3R8BA 3AEAB 1EWCA 2N9LA 5EE9A 1RWSA 4MH8A 3NZ3A 1N61A 4L1BA 1E7PB 2JXTA 1F77A 1FCCC 1LO5D 2BT6A 3J9CA 4HROA 1QOBA 2OEDA 3BVMA 4XDCA 2K22A 1ZDVA 3FAHA 3HUIA 1OFFA 2WP9B 5D3DA 3GP7A 3NVWA 3I9V1 3P4PB 2BB6A 3MHZA 4DXGA 3VR9B 2MJDA 3P63A 5HFYA 1NEKB 1UGJA 2R61A 2BB5A 3AV8A 2M19A 4AS1A 3AMZA 5JXVA 3B2GA 3O13A 1DGJA 4OVZA 2KAJA 1JROA 4CQNA 1B9RA 1GB1A 1FFUA 1XCTL 3AECB 4WQMA 2PMVA 5T8IA 1V1PA 2PKOA 1KH0A 4B0EA 1PGXA 3NS1A 3AEDB 1ZUD2 1SBBB 1F2RI 1FRDA 1NENB 5D7GA 4LLGM 1KRHA 1SXTA 2HDEA 1FEHA 1MI0A 1WRIA 2JWUA 1IUEA 2WXMA 2PTLA 2WXLA 3MP9A 3VRBB 2BBCA 5BYRA 3PZ7A 1BXTA 1XLOA 2ZW1A 1MVKA 1KLGD 1JMLA 1FXIA 1PYWD 2K3UA 3T3NA 3KWLA 2JU6X 3AH7A 2KMMA 4OW0A 1J7BA 1PUTA 3ZJVA 4XWWA 5AUKA 1D5ZC 2V0GA 4RGNA 1FCLA 1D5MC 2WQYB 1L6VA 1EU4A 2WXKA 1E0ZA 1UNSA 2NTSA 3AE3B 3P42A 1VRAB 1VJKA 2KQ4X 3EA6A 1CZPA 4RNAA 3BIID 4WH4A 2DWQA 4XDDA 2PLPA 3E9SA 1TJEA 1NI3A 2K9XA 4EE2A 3I57A 1BMLC 3IAS1 3DWMA 3B9JA 1F2RC 3TSSA 3W1SA 2W3SA 1L0VB 1SEBD 2WXNA 4C56C 1AYFA 1VR9A 2WXHA 3KWVA 2EELA 2WXQA 3DWGC 1BUIC 1IBXA 2IGGA 2WDVB 2WXOA 2X38A 3ZJTA 1TZOA 4RGTA 1CQVA 2AX5A 1ZXHA 4A55A 2KWDA 2FBWB 1OQQA 2WXGA 3AM9A 3PZ8A 4ZOHC 1QT9A 3OWEB 2E6XA 3U7ZA 5I4DA 3BVGA 1JWBD 2KDMA 1TS2A 2EKIA 3CWIA 2BS2B 1XLPA 1XCQL 2TSSA 3NVYA 1SF0A 3AEGB 4TQ0A 3AE6B 1EM7A 2N0SB 1FNUA 1HEZE 2LHEA 4A90A 1STEA 1NYRA 2CJNA 4N6EB 3KLSX 4JPSA 1T3QA 3IT6B 1K53A 3IT4B 1XO3A 1I4QA 3BK1A 1TYGB 2W3RA 1IGDA 3NVVA 2BTEA 1YMHE 2KN4A 1AW7A 2LEKA 1V1OA 4WAFA 4L2YA 2YEPF 2WDQB 4MM3B 4JWSC 4J3OD 3U52E 3LB8C 1GAQB 2CJOA 3AEBB 4GLSC 3ZYYX 4KGSA 1L0YB 4WIPA 2QEJC 3MJ5A 2CU3A 2JYEA 3GS2A 1TY2A 1GOZA 2N9KA 4ZHPA 1JWAD 1ACCA 1N60A 1ROEA 1I4GA 3FILA 4GDLB 4P16A 4US9A 5EE1A 3URYA 4XE0A 2RMMA 4FXCA 1VLBA 4HJGE 1TKEA 4JE3B 4DXFA 1M4VA 1FMAD 2PVOD 1T6BX 3HVZA 4HKQA 3AB5A 4M0WA 2WXRA 2PIAA 2Y3AA 2G9HD 3AE1B 1CJEA 2SAKA 2W82A 4HEA1 1SSNA 1XF5L 4OZCA 4L23A 4B0MA 2ZW0A 1L0XB 3CIRB 4RGOS 2BS4B 3UI3A 3AE9B 5EE3A 1L6UA 5LNK1 2WS3B 2M56B 3H8HA 3L4PA 1IGCA 2B76B 4ZRQA 2LHDA 2JZPA 4WWMA 5MPOA 3VR8B 1V1PB 4OZAA 2J4XA 1HZ5A 2LJIA 1YQ3B 1Q10A 1TY0A 5G5GA 2I2YA 3R2TA 1ESFA 4USAA 2DBYA 1FM0D 2IDYA 2JYTA 2WU5B 5BYSA 4UDUC 1KFYB 3U4EG 1YQ4B 4YTMB 1I4HA 2WXIA 2J53A 1ZDXA 2XNAC 3IXSA 3EUB2 1V97A 2Q5WD 1Y56A 4A9AA 4ZYSA 4YTPB 1N62A 2V3PA 3HRDD 1YJJA 1VDVA 3LXFA 1SJED 3VQIA 1ET9A 3SR6A 2QSDA 3RPFC 2RDHA 3E56A 1SB3C 2GI9A 1SE3A 4TMAB 2ONQA 1NYQA 1I4XA 1QQRA 5D3IB 1FO4A 3P4RB 5BMGA 2MJ3A 1YN5A 2M0AA 1FRRA 4YT0B 1L5PA 1L4DB 1QOGA 5E6JA 1PFDA 1JWMD 2DLBA 1RM6C 1UWMA 2FUG1 1P7EA 3BVZA 4NAWB 1T5XD 4RF1A 5AUIA 1C79A 3RFZB 5H92C 2BW2A 2QMTA 1AN8A 3AE8B 3FC4A 1XXGA 1RYJA 4DQOC 2V3NA 4Q2JA 2IPKD 1ZP0B 4NZLB 4OHJA 1DOXA 3ETRA 2DYOA 5FKAC 2D5GA 3N9YC 2WXPA 3EGRA 3AE7B 4N59A 1JW9D 2Y5CA 3HVDA 5TSSA 2RPVA 1UWXA 1HA5A 2NTTA 1IBXB 1L4ZB 1J7AA 2Z8LA 1WXQA 2VZKB 1OQRA 1MPEA 1DOIA 5G5HA 5BMHA 1D4BA 1YN3A 1K50A 2WXFA 2QILA 1QOFA 1E9MA 2INPE 4KKJA 2GB1A 2LGIA 4IKGA 3SFEB 2Y5PA 1GB4A 3AE2B 3VRAB 5HG2A 1DOYA 2AQ1B 3B2FA 4RCOA 4LTUA 1I4PA 2W55A 4TSSA 2LUMA 1VZ7A 4YTNB 1TKYA 4YSXB 3W2DA 4A6QA 2LMCA 2IJ0A 5FR3A 2L32A 1SJHD 2YEPB 1QKZA 4US8A 3KQ4A 1ZOYB 1FNWA 1C4PA 3V3XA 2FE8A 4NJCA 4WURA 4C7YA 4ZRPA 2V4IB 2PVGC 3NUHB 1JRPA 3MFGA 2K5PA 1FIQA 1SE2A 4NAMA 3Q8BA 1C78A 2WU2B 4ARCA 3SFDB 3AN1A 3W5VB 1JCKB 1XLNA 1I4RA 3NRZA 2IGHA 1HZ6A 2NMQA 4XWTA 1YJIA 4P6VF 4PT5A 1VZ8A 1JQ4A 4RFBA 3TUOA 1TKGA 1K52A 2QIEB 2ICIA 4KGRA 3FILB 2DYMA 4IOIE 2XN9C 2BS3B 4YSYB 2ON8A 4HRSA 4GDKB 2K0PA 1FD6A 2E3TA 1SE4A 1J7CA 2HTME 3SEBA 3AEFB 1TS5A 3GB1A 1KTKA 4YSZB 1EWYC 5HHDG 1R7SA 4RF0A 1KLUD 2JQRB 5H8YE 4YWGG 3BK2A 3W5UB 1DYQA 2MEKA 1CK1A 1C4CA 3TEXA 3P4QB 5C3JB 1QILA 4LK0M 4REZA 2WNMA 1C77A 3P4SB 2WLBA 3AE5B 4RH6A 1ZXIA 5BMIA 1SIJA 1B1ZA 1QLBB 3Q8EA 2L83A 1V8CA 4ARIA 2PW9A 3MC0B 1ENFA 2GRIA 1HQRD 1C9FA 2H88B 2L52A 1N63A 1C76A 1F0ZA 4TQ1A 2ACZB 2W54A 4IDIA 4OZBA 3IAM1 3Q8FA 4RGMA 3C8YA 1JWSD 1XLQA 4R3DA 1QF6A 4MT5A 1MHHE 1ET6A 1E6EB 3PO0A 5C2TB 3BYTB 4JX1C 2G1EA 4HKZE 1QOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPE A;  5BMH A;  1D4B A;  1KH0 A;  4GLS C;  1K50 A;  4KGS A;  1PGX A;  1F2R I;  2GB1 A;  2LGI A;  4IKG A;  1GB4 A;  5HG2 A;  2N9K A;  3FIL A;  2KAC A;  1MI0 A;  2JWU A;  1K51 A;  2LUM A;  2RMM A;  2PTL A;  4HJG E;  3MP9 A;  4D2K A;  2IGD A;  2ZW1 A;  1MVK A;  1QKZ A;  3V3X A;  1JML A;  5HI1 A;  1MHX A;  4OZC A;  1XF5 L;  2JU6 X;  2ZW0 A;  1YNT E;  3UI3 A;  2J52 A;  1IGC A;  1P7F A;  2LHD A;  2JZP A;  1PGA A;  2N7J A;  1FCL A;  4OZA A;  1HZ5 A;  2IGH A;  1HZ6 A;  1Q10 A;  2NMQ A;  2JSV X;  2I2Y A;  4WH4 A;  2KQ4 X;  1K52 A;  2PLP A;  4MAC A;  4KGR A;  3FIL B;  4IOI E;  2J53 A;  1F2R C;  2ON8 A;  1PGB A;  2K0P A;  1FD6 A;  2EEL A;  4KGT A;  1IBX A;  2IGG A;  3GB1 A;  2QSD A;  5HHD G;  2GI9 A;  2ONQ A;  1ZXH A;  2KWD A;  5BMG A;  2I38 A;  2N9L A;  2KDM A;  1P7E A;  1XCQ L;  5BMI A;  1EM7 A;  2QMT A;  1HEZ E;  2JXT A;  1FCC C;  2LHE A;  2OED A;  2PW9 A;  1C9F A;  1K53 A;  2RPV A;  4OZB A;  1UWX A;  5HFY A;  1IGD A;  1MHH E;  5JXV A;  1YMH E;  2KN4 A;  1IBX B;  1GB1 A;  1XCT L;  4HKZ E; 
#chains in the Genus database with same CATH topology
 1E90 A;  2Z0D B;  3CST A;  4EUT A;  4OVV A;  1WRD B;  3PV1 A;  4PYU A;  1ZPS A;  3VTU A;  2BYT A;  3PT2 B;  5EE0 A;  2MP2 A;  2PE9 A;  3DHI C;  3NG0 A;  4MJS B;  3R2I A;  2PJH A;  4D2K A;  2LFI A;  1TZ1 A;  5HI1 A;  2JT4 B;  3C19 A;  3TCA A;  2J0K A;  2N9P C;  3AE4 B;  3QIJ A;  3OJ3 A;  4AJY B;  2VH1 A;  4ANU A;  2DAJ A;  2SEB D;  4JIO U;  1YX5 B;  4KKI A;  3VHT C;  3K9P B;  2WYQ A;  3ZIM A;  1E10 A;  5KHO A;  1WX8 A;  1N5X A;  2RDG A;  2AL6 A;  2AQ2 B;  4W9D A;  3JSV B;  3TEZ A;  4MAC A;  2IY1 B;  3P2B A;  2J42 A;  4I6L B;  2KDE B;  1MJD A;  4BBN C;  2AQ3 B;  3ZGZ A;  2CU1 A;  2KFK A;  3TEY A;  4AWJ A;  1YD8 U;  4MM3 A;  1TS4 A;  3X0W A;  4LDT B;  1K8R B;  1XEE A;  2MJE A;  4GIV A;  4A8X C;  2JZZ A;  2BVC A;  4W9H A;  3AEA B;  1QZE A;  4KV2 A;  5EE9 A;  2AEH A;  1TBE A;  3OAW A;  4MH8 A;  4NQK E;  2DX5 B;  2Z59 B;  3QC8 B;  1RRB A;  3RD2 A;  4XZ4 A;  3NZ3 A;  1F77 A;  2BT6 A;  2OED A;  4XDC A;  3FAH A;  1IPG A;  2WP9 B;  3GP7 A;  3NVW A;  3WIM A;  3I9V 1;  5JHA A;  3P4P B;  2LGX A;  5HFY A;  5JZE B;  1UGJ A;  2DHZ A;  3W1Y A;  4AS1 A;  2M19 A;  3AMZ A;  3UGB B;  4GXB A;  4DHJ D;  1WH3 A;  2KAJ A;  1JRO A;  3N1Y C;  2IO0 B;  3AEC B;  4ZDV A;  2CR5 A;  1V1P A;  2JRH A;  1UEL A;  3NS1 A;  1SBB B;  4LLG M;  3A9J A;  1KRH A;  2HDE A;  4PYZ A;  1WRI A;  5E6O A;  2BF8 B;  4A20 A;  4K3B A;  1XLO A;  5CHV C;  3RCZ A;  4X57 B;  2JRI B;  3QX1 A;  3JVZ X;  4LNI A;  2LAS A;  3BIN A;  3ZKJ C;  2RDB C;  1J19 A;  1FCL A;  1D5M C;  2WQY B;  3RI7 C;  2WXK A;  2NTS A;  1VJK A;  3EA6 A;  4RNA A;  4FUL A;  3RNC C;  2DWQ A;  4IWQ A;  2V1Y A;  2V9H A;  2K9X A;  1BML C;  1LXD A;  2ZCB A;  1L7Y A;  2KWV B;  3TSS A;  2W3S A;  1I42 A;  4BVU C;  1AYF A;  1VR9 A;  4B95 A;  1MG4 A;  1HTQ A;  2BWF A;  2WDV B;  4CYE A;  1L2N A;  2CHX A;  3AM9 A;  3N20 C;  3PZ8 A;  3NZS A;  5I4D A;  3CF6 E;  1TS2 A;  3CWI A;  4M02 A;  1XCQ L;  3KUD B;  3R3M A;  1ZGU B;  1HEZ E;  2C5L C;  3Q2A C;  4N6E B;  2LVQ A;  3V6E B;  1XO3 A;  1I4Q A;  2LXA A;  1TYG B;  3NVV A;  2BTE A;  3RMK C;  2KDF B;  2OJW A;  2G45 B;  2KN4 A;  3A4R A;  3H7P A;  5LXH A;  2LEK A;  1LGR A;  2JVC A;  4MM3 B;  5LXI B;  4J3O D;  4WJO A;  4K7W A;  3U52 E;  2CHZ A;  2JXX A;  3RYT A;  3AEB B;  3ZYY X;  4ACF A;  3UIO B;  3GS2 A;  1V6E A;  3ZDT A;  2EKE C;  3QHT A;  4JL9 A;  1TY2 A;  1JWA D;  1ROE A;  3FIL A;  4P16 A;  4WWN A;  4GSW A;  4DHJ B;  2KFJ A;  1T6B X;  3DVN U;  3HVZ A;  3AB5 A;  2G9H D;  1TT5 B;  1XF5 L;  1V5O A;  3CIR B;  3EEC A;  2REX A;  3AE9 B;  3NZU A;  5EE3 A;  3N3K B;  4GGQ A;  1L6U A;  3H7S A;  5G2N A;  1U4A A;  2M56 B;  3H8H A;  1IGC A;  2B76 B;  3PRM B;  4ZRQ A;  3VR8 B;  1V1P B;  2J4X A;  1YQ3 B;  5FR6 A;  1Q10 A;  1TY0 A;  4G3X B;  3UIP B;  3A9J B;  2IDY A;  4ICV A;  2LGY A;  3U4E G;  1WXS A;  3PHX B;  4FHK A;  3MC8 A;  4MSM B;  3EC8 A;  2Q5W D;  1Y56 A;  2LXC A;  1N62 A;  2KLC A;  2KN5 A;  2V3P A;  3HRD D;  1SJE D;  2LD9 A;  2QHO A;  3E56 A;  2C7M B;  2KC2 A;  1FRR A;  4YT0 B;  4GMV A;  2KWU B;  2JUO A;  2IBI B;  5E6J A;  3VH4 B;  3EHV A;  1UWM A;  4DHZ B;  1P7E A;  3BVZ A;  1T5X D;  1RAX A;  4RF1 A;  5AZH A;  5H92 C;  2BW2 A;  1AN8 A;  1XXG A;  1RYJ A;  2V3N A;  4Q2J A;  1ZP0 B;  2N9E B;  3N9Y C;  4N59 A;  1P9D U;  3HVD A;  2RPV A;  2AWT A;  3APD A;  3AU5 A;  2LGD A;  3I3T B;  4MGY E;  1E8W A;  2HD5 B;  2BKF A;  2VZK B;  5BMH A;  3PLV A;  1D4B A;  1RFA A;  2QIL A;  1QOF A;  2INP E;  3Q3M C;  3DBL B;  3KW5 B;  3DCG A;  4E3C A;  1VZ7 A;  4YSX B;  3W2D A;  2UWQ A;  2LMC A;  2IJ0 A;  5FR3 A;  1SJH D;  4US8 A;  1ZOY B;  1C4P A;  3NS8 A;  4WUR A;  2KD0 A;  2M17 A;  2PVG C;  1JRP A;  1UZX B;  3RNA C;  3M63 B;  3SFD B;  2JF5 A;  2INC C;  3DBH I;  2I1K A;  3NY5 A;  1JQ4 A;  1TKG A;  1K52 A;  2D11 A;  3FIL B;  3AUL A;  2DYM A;  2ON8 A;  1WJ4 A;  2AYO B;  4NJ7 A;  1FD6 A;  4EZL A;  1SE4 A;  4BZA A;  1J7C A;  4LJO B;  3SEB A;  3ZTC A;  3M3J A;  4YSZ B;  1R7S A;  2N7E A;  4XGA B;  1KLU D;  2JQR B;  3K9O B;  5D2M B;  4YWG G;  3D32 A;  3TEX A;  3P4Q B;  3B0A A;  4LK0 M;  1EO6 A;  3P4S B;  2WLB A;  3PHW B;  1WIA A;  2MBH A;  1QLB B;  3Q8E A;  2ZJD A;  1HQR D;  1N63 A;  4PS7 A;  1H4R A;  4TQ1 A;  3MTN B;  4XC2 A;  2ACZ B;  4WAA A;  3IAM 1;  3M95 A;  2MBO A;  1OGW A;  4BBN F;  1QF6 A;  1XLQ A;  1LFD A;  4MT5 A;  1MHH E;  5JH5 C;  2NCN A;  2WX0 A;  1OEY A;  4HK2 A;  4YL8 A;  2G1E A;  3ZNI D;  2RD0 A;  4HKZ E;  4K81 A;  1KF6 B;  1TS3 A;  4C80 A;  2M0X A;  2ZZP B;  2D3A A;  4EOY A;  3ONS A;  3P1M A;  4ZRI A;  1A70 A;  2JX5 A;  2KAC A;  4NAW A;  4NPN A;  2LVP A;  2IGD A;  4F1S A;  2C60 A;  2WXJ A;  2L05 A;  1I7H A;  2KVZ A;  1D6E C;  1MHX A;  3U7D A;  2WGS A;  3V05 A;  1YNT E;  3NVZ A;  1E7V A;  2K8B A;  4H2A A;  1N5W A;  1P0R A;  3BZD B;  1WSP A;  2L3Z A;  4ITK A;  4AQ7 A;  2IND C;  3ZRF A;  1OQY A;  3IHP C;  3APF A;  1VD2 A;  3BWU D;  4BKT A;  4O1N A;  2INN E;  2M1M A;  3TMP B;  1PGB A;  2KYW A;  2BPS A;  4S17 A;  3Q8A A;  4RM9 A;  1ZE3 D;  1EU3 A;  4HJK A;  5J18 A;  2LVO A;  2BGF A;  3ZUN A;  1WXM A;  1FFV A;  1ISN A;  2MH7 A;  1JWU D;  1NVI D;  4HXD A;  2ZVN A;  4GDL A;  4LNF A;  1UBI A;  4HCP B;  1N61 A;  4L1B A;  3KYD D;  2A5U A;  4HRO A;  1J0G A;  3BVM A;  2N1W A;  1D3Z A;  4BKS A;  4G11 A;  3ECI A;  5D3D A;  3QQ8 B;  2BB6 A;  3MHZ A;  4DXG A;  4FHJ A;  3P63 A;  4EEW A;  1NEK B;  3AV8 A;  5JXV A;  1C1Y B;  5AEK B;  1GB1 A;  1FFU A;  1XCT L;  4WQM A;  3WAL A;  4BKS D;  2PKO A;  3FKY A;  1KH0 A;  1TTN A;  1NBF C;  1T0Q C;  1FRD A;  3L10 B;  3DQV A;  4AOF A;  4QAY A;  3A33 B;  1FEH A;  1IUE A;  2WXM A;  2PTL A;  1V9J A;  4XYC A;  3UQB A;  5BYR A;  1GUA B;  1R4M I;  4WWO A;  2KLG A;  2KT7 A;  2ZW1 A;  3Q3N C;  2M8S A;  1EUV B;  1JML A;  1FXI A;  1PYW D;  2GBR A;  3T3N A;  3KWL A;  2JU6 X;  4AJW A;  1R4N B;  4W9E A;  4II2 B;  1J7B A;  2PE6 B;  3ZJV A;  3IBE A;  2K6Q A;  2WX1 A;  1D5Z C;  2V0G A;  4RGN A;  3DBR B;  2NVU I;  4HVB A;  1EU4 A;  2JZ3 B;  1WJN A;  1E0Z A;  1VRA B;  3VFK A;  4TKN A;  4WH4 A;  2KQ4 X;  3QA8 A;  3E9S A;  2AL3 A;  4EE2 A;  2WWZ A;  2MCN B;  2A4Z A;  1L0V B;  2EEL A;  1BUI C;  1UH6 A;  2X38 A;  4KDI C;  2VRR B;  2FCM A;  1CQV A;  2AX5 A;  1ZXH A;  3IVF A;  1P1A A;  2FBW B;  1OQQ A;  2IY0 B;  3U7Z A;  1JWB D;  4K3C A;  2MRP A;  2XK5 A;  2KDM A;  1WFY A;  1SF0 A;  3AEG B;  3ZTD A;  4IW0 A;  4TQ0 A;  1EM7 A;  2N0S B;  3PZD A;  4A90 A;  3H1U A;  3HM3 A;  3V6C B;  1T3Q A;  1K53 A;  3UQA A;  5GMV A;  1IGD A;  1YMH E;  3PTF C;  1V1O A;  4WAF A;  4L2Y A;  2YEP F;  2IO2 B;  5CX3 A;  3LB8 C;  4WWP A;  2QEJ C;  1YOV B;  2KHW B;  4NNJ B;  3KYC D;  4ZHP A;  1ACC A;  2KX0 A;  4GDL B;  4HPL B;  2M4N A;  3ZLZ A;  2KMA A;  4XE0 A;  2RMM A;  1TKE A;  4JE3 B;  2Z0E B;  3AI5 A;  1M4V A;  4A3P A;  2PVO D;  4W9C A;  2WXR A;  2Y3A A;  2SAK A;  4B0M A;  1WZ3 A;  1L0X B;  2C9W B;  4IUM B;  3L4P A;  1GJZ A;  2LGS A;  1HZ5 A;  3ZVV A;  2I2Y A;  3R66 C;  4IWO A;  1WX7 A;  5HKH A;  3VTV A;  1WX9 A;  2WU5 B;  5D94 A;  4I6N B;  1KFY B;  1WMH A;  3QJZ A;  3VXW A;  1I4H A;  2IO1 B;  2WXI A;  3R7R A;  2V4L A;  2XNA C;  2QDF A;  4A9A A;  1YJJ A;  3VQI A;  3UIN B;  1UF0 A;  2ONQ A;  1NYQ A;  5D3I B;  3P4R B;  2K1F A;  1L4D B;  1S1Q B;  5C1Z A;  1QOG A;  1PFD A;  1JWM D;  3IG3 A;  2MP2 B;  2FUG 1;  4DQO C;  2IPK D;  3ETR A;  5EDS A;  2WXP A;  4C4V A;  3I63 C;  5TSS A;  4ANW A;  1UWX A;  2N1V A;  1HA5 A;  2DZI A;  4KIK A;  3RUL A;  3GOE A;  1MPE A;  1DOI A;  2MBQ A;  5G5H A;  1KM7 A;  2WXF A;  2O6V D;  2NBW B;  3VRA B;  2XK5 B;  3PLU A;  1T0Y A;  2G4S A;  4RCO A;  2W55 A;  2LJ5 A;  4TSS A;  3GZN B;  2IO3 B;  3DOW A;  4URK A;  2D3G A;  2YEP B;  2NS5 A;  2KFK B;  3KQ4 A;  4B6W A;  3AU4 A;  2FE8 A;  4E71 A;  4NQL B;  4ZRP A;  3NUH B;  2K5P A;  1FIQ A;  1SE2 A;  4NAM A;  4ARC A;  2WU2 B;  1FXT B;  1Q1O A;  1I35 A;  3BY4 B;  4MH0 E;  1I4R A;  2IGH A;  4AP4 C;  4C00 A;  1HZ6 A;  1YIW A;  4XWT A;  1YJI A;  2VH2 A;  4PT5 A;  3HM6 X;  5IP4 D;  3TUO A;  4FA6 A;  2QIE B;  1C3T A;  3VDZ A;  2XN9 C;  2CHW A;  1YJ1 A;  3GE3 C;  4YSY B;  3QAR A;  2DZK A;  3Q3F A;  1TS5 A;  2UU7 A;  1KTK A;  1EWY C;  4KSK C;  2IZV B;  2ZNV C;  3RNG C;  3BK2 A;  4MDK E;  3W5U B;  2NPT A;  1C4C A;  5C3J B;  1QIL A;  2DYB A;  2WNM A;  4RH6 A;  1ZXI A;  3N32 A;  1B1Z A;  1IYF A;  1RLF A;  3UF8 A;  3DHG C;  1ENF A;  1WMH B;  2RSU A;  1F0Z A;  4IDI A;  4OZB A;  3S2A A;  4RGM A;  3C8Y A;  1JWS D;  5J17 A;  1ET6 A;  3L54 A;  5E6N A;  4FAD A;  2R2Q A;  3ZNH B;  1QOA A;  3VH3 B;  3ZJU A;  1VZ6 A;  5AZF A;  2L8J A;  4C7Z A;  1JAL A;  1XD3 B;  2MA9 B;  3RN9 C;  4G50 A;  1D5X C;  3OJ4 B;  4HDO A;  5BYQ A;  4YXD B;  4JWU C;  2HTH A;  2MHJ A;  4LNK A;  3CMM B;  5AZG A;  4MSQ B;  3U2S C;  4DDI D;  5D6J B;  3QK0 A;  4C4V B;  1GPX A;  1UUP A;  1KJT A;  1WGG A;  3L08 A;  4AUQ C;  2KQ7 A;  4IM3 A;  2H89 B;  1PDX A;  2QJL A;  1GC6 A;  4MEL A;  5CHW A;  3TEW A;  3ABV B;  2N7J A;  1PGA A;  2KDI A;  5GXG B;  3T3O A;  3WCQ A;  3I5J C;  2WDR B;  2JSV X;  3PRZ A;  3KH0 A;  1E7U A;  4NY0 A;  3L13 A;  4ZHO A;  3QCA A;  1FNV A;  1C4A A;  4HPM B;  2FCS A;  2LI5 A;  2MQJ A;  3ML8 A;  4KX6 B;  3H7P B;  3L16 A;  2UYZ B;  1HXY D;  4FJY A;  1WGR A;  3Q8C A;  4NJ6 A;  2OHF A;  3PPA A;  3H6N A;  2I38 A;  3N1X C;  3R8B A;  1EWC A;  2ASQ A;  2N9L A;  1RWS A;  2HJ1 A;  5CTR C;  1V80 A;  2BYE A;  2KTF A;  1LO5 D;  3J9C A;  3HUI A;  2K8H A;  2DZJ A;  4M8M A;  2YVC A;  3VR9 B;  2R61 A;  2BB5 A;  4LJP B;  3O13 A;  1DGJ A;  5IA7 A;  3RNF C;  1WE6 A;  3VUY A;  2PMV A;  2C7N B;  3PVL A;  1Y8R C;  1PGX A;  2NPT B;  3L0W B;  3AED B;  3ZNZ B;  1ZUD 2;  3AXC A;  1F2R I;  1LQB A;  1NEN B;  1NI2 A;  3WAO A;  4W9L A;  4ZRK A;  1WM2 A;  3PRP B;  5C23 A;  2J0M A;  1YQB A;  2WXL A;  2BBC A;  3ZO5 B;  1BXT A;  5IOI A;  2I1J A;  1BT0 A;  1MVK A;  4DBG A;  3A9K A;  2O2V A;  4MGK E;  2K3U A;  3AH7 A;  4OW0 A;  3ZW3 A;  2N7D A;  5AUK A;  1EF5 A;  4MGZ E;  4EZJ A;  4WJQ A;  1UNS A;  3ALB A;  3AE3 B;  2PLP A;  1P98 A;  1TJE A;  3IAS 1;  3DDC B;  2L76 A;  1Q0W B;  1SEB D;  2WXN A;  3VUW A;  2WXH A;  3KWV A;  3DWG C;  3N30 A;  1IBX A;  4JLC A;  1Z5S B;  3ZJT A;  1Z2M A;  4A55 A;  2KWD A;  2L7R A;  4S0R A;  2KOX A;  3OWE B;  2E6X A;  1UGM A;  1V81 A;  2ZPN A;  2K6D B;  2BS2 B;  1XLP A;  3NVY A;  5IAA C;  3A1Q A;  3HK0 A;  1FNU A;  4FJV B;  3LDZ E;  1OTR B;  1NYR A;  2K39 A;  3KLS X;  4BOS C;  3N1Z C;  3IT4 B;  4IM2 A;  3WAN A;  2W3R A;  2FCQ A;  4ZRJ A;  1A5R A;  2WDQ B;  1F1H A;  2MSE D;  2WDT B;  1GAQ B;  1E8Y A;  4WIP A;  2GMI C;  1WXA A;  4RMA A;  1N60 A;  4US9 A;  1I4G A;  5J2R A;  1UD7 A;  3URY A;  4FXC A;  4HJG E;  4LDT D;  4DXF A;  5L95 C;  4M0W A;  2PIA A;  1V5T A;  1WYW B;  3AE1 B;  4HEA 1;  1SSN A;  4L23 A;  2MLB A;  1GC7 A;  4RGO S;  2BS4 B;  3W1S C;  3DVG X;  5LNK 1;  4KZC A;  2D3B A;  1WM3 A;  4WWM A;  5MPO A;  1NDD A;  4OZA A;  5DPT A;  3VVW B;  3R7Q A;  2ZVO A;  2MWS B;  2PPH A;  1ESF A;  4USA A;  2KTR A;  5BYS A;  4UDU C;  4DXA B;  1YQ4 B;  1IP9 A;  4GU2 A;  2J53 A;  3IXS A;  4K1R B;  1V97 A;  1KLV A;  3M62 B;  4PS8 A;  5IO9 A;  4ZYS A;  4XX5 A;  2RPQ A;  1VDV A;  4ZYN A;  1ET9 A;  3A9K B;  4RM8 A;  2O2V B;  2QSD A;  2RDH A;  2GI9 A;  4HLE A;  4TMA B;  3WA0 A;  3EFC A;  1I4X A;  1QQR A;  1FO4 A;  4K7S A;  2MJ3 A;  2ZCC A;  3X23 A;  2KJH B;  3VTW A;  4DHZ E;  4ANV A;  2DLB A;  1RM6 C;  4NAW B;  3V62 A;  1C79 A;  2BQQ A;  2QMT A;  3AE8 B;  3FC4 A;  1UBQ A;  4F8C B;  1EF1 A;  4ANX A;  2DYO A;  4JQW C;  5JHB A;  1JW9 D;  2Y5C A;  1MFW A;  3Q3O C;  1E8X A;  2KKC A;  1IBX B;  1SGH A;  3KVF B;  3RNB C;  1WXQ A;  2FNJ B;  4KDL B;  1OQR A;  2NBU A;  3EFU A;  1YN3 A;  1Q5W B;  1WF9 A;  3TIX A;  4N9F 4;  2JPH A;  2XBB C;  1E9M A;  1WI0 A;  4KKJ A;  2LGI A;  3SFE B;  4IKG A;  2Y5P A;  3AE2 B;  5HG2 A;  3RZW C;  2AQ1 B;  4K7U A;  4FBJ B;  3A1Q B;  2LUM A;  4MEM A;  1TKY A;  4A6Q A;  4W9G A;  2KJ6 A;  2FIF A;  2GBK A;  5IKC M;  3V3X A;  4NJC A;  2N9X A;  5DPS A;  1V49 A;  2V4I B;  2XEW A;  2LZ6 A;  3Q8B A;  2D10 A;  5CHF A;  1WGH A;  3W5V B;  2NMQ A;  3DVG Y;  4P6V F;  4BOZ B;  4RFB A;  3ZDM C;  3T9L A;  4P1C C;  4B9K A;  2KNB A;  2ICI A;  4BFR A;  5LLI A;  5E6P A;  4JGH B;  2G4D B;  2K0P A;  2E3T A;  3OG5 A;  1WZ0 A;  3AEF B;  4M0W B;  4HWI B;  4GN1 A;  4OVU A;  4RF0 A;  3MJW A;  3KUC B;  1DYQ A;  2MEK A;  2QCZ A;  1CK1 A;  2WHI A;  3PRE A;  4CO7 A;  3AE5 B;  1CMX B;  2IYD B;  2KTR B;  2PW9 A;  3MC0 B;  2PEA A;  2GRI A;  3V60 A;  1C9F A;  2L52 A;  3O65 B;  2CS4 A;  3LJ3 A;  4M8N A;  4HPP A;  2W54 A;  3HHM A;  4R3D A;  1E6E B;  5C2T B;  3MC9 A;  3BYT B;  4JX1 C;  4IM0 A;  3NJT A;  1F9J A;  4BAX A;  3AEE B;  1T0R C;  2LWP A;  2ZEQ A;  3WAM A;  2OOB B;  1K51 A;  3TL5 A;  2KXJ A;  2O6V A;  1VCB A;  3RUI B;  2KMC A;  2ZNV B;  1FXA A;  1R4N I;  4N58 A;  3Q69 A;  2Y5B B;  3SD5 A;  3W9C B;  2BWE S;  1YN4 A;  2J52 A;  3DBR I;  1P7F A;  3LYY A;  2MX2 A;  2RGF A;  5FK9 C;  3BYY B;  1F52 A;  5DPR A;  2EMT A;  1WYG A;  1WWT A;  2RR9 A;  4HDQ A;  3DBH B;  2LUE A;  1WGK A;  2L1A A;  2VZK D;  2LRU A;  1RFK A;  3C0R B;  2B3A A;  4KGT A;  3CSF A;  1WE7 A;  3ZQ4 A;  2LRW A;  4M00 A;  3VAW A;  1AWD A;  3TJP A;  3ZXV A;  3ZNG C;  1WXV A;  3B08 A;  4F7Z A;  3ENE A;  1XT9 B;  1E7P B;  2JXT A;  1FCC C;  1QOB A;  2K22 A;  1ZDV A;  1OFF A;  2EMS A;  4HCN B;  2MJD A;  3B2G A;  3PS6 A;  4OVZ A;  4CQN A;  3VUX A;  1B9R A;  1E5W A;  4P1B C;  2C7H A;  4DK5 A;  1P3Q U;  5T8I A;  2KK8 A;  4TUU A;  4B0E A;  1AAR A;  5D7G A;  2HJ8 A;  1N6Z A;  2J7Q B;  4II3 B;  1SXT A;  4LNN A;  4ASW C;  1WJ6 A;  1MI0 A;  2JWU A;  2L0F A;  3MP9 A;  3VRB B;  1LM8 B;  4GOC A;  3PZ7 A;  3Q6B A;  4DDG D;  4W9J A;  4P7I A;  1KLG D;  3PGE A;  3PSE B;  3ML9 A;  2KMM A;  3RNE C;  4J6I A;  1PUT A;  4XWW A;  3Q14 C;  4LCD E;  3NHE B;  3T8M A;  1L6V A;  4FN2 A;  3P42 A;  1CZP A;  3BII D;  4XDD A;  1NI3 A;  1X1M A;  3ZRC A;  3I57 A;  3DWM A;  3B9J A;  1F2R C;  3Q3J A;  3W1S A;  3IFW B;  1M94 A;  4C56 C;  2O6V B;  3JW0 X;  2OJR A;  2FAZ A;  2WXQ A;  4KIK B;  3SHQ A;  2NR2 A;  2IGG A;  2WXO A;  2GBJ A;  1TZO A;  1HE8 A;  4RGT A;  2J0J A;  2WXG A;  2DNF A;  4ZOH C;  1QT9 A;  4EZK A;  4GB9 A;  3BVG A;  3DPD A;  2EKI A;  4W9K A;  1YX6 B;  2TSS A;  1WR6 E;  4I6P A;  4WJN A;  3AE6 B;  5DPW A;  3WAP A;  3MHS D;  3U30 A;  3V61 A;  2JY6 A;  2LHE A;  3L17 A;  1OEY J;  1STE A;  1TIF A;  2CJN A;  2R2O A;  4JPS A;  3IT6 B;  3BK1 A;  1ZKH A;  5L83 A;  1T0S C;  1AW7 A;  2MBE A;  3GE8 C;  4EKU A;  4JWS C;  4WJP A;  2BKR B;  2G3Q B;  2CJO A;  4GLS C;  2BYF A;  2L0T A;  4KGS A;  1L0Y B;  1XQQ A;  3MJ5 A;  2CU3 A;  2JYE A;  2KDB A;  1GG3 A;  3GZN I;  1GOZ A;  2N9K A;  3DHH C;  2FCN A;  2KJR A;  5EE1 A;  1VLB A;  3SU8 X;  2CKH B;  3TBL D;  2V3S A;  3DBS A;  4GDK A;  1FMA D;  1JRU A;  1WJU A;  3RZF A;  1R4M B;  4HKQ A;  1HTO A;  1CJE A;  2W82 A;  4OZC A;  2ZW0 A;  2MBB B;  2D3C A;  3UI3 A;  2GBM A;  2WS3 B;  2KWC A;  2LHD A;  2JZP A;  4FLH A;  3OLM D;  2LJI A;  1SE9 A;  2JWZ A;  2KVR A;  4FJZ A;  5G5G A;  3JYU A;  3R2T A;  4LNO A;  2DBY A;  1FM0 D;  2JYT A;  1GNU A;  4BKG A;  4YTM B;  2KO3 A;  3SDL C;  1ZDX A;  3EUB 2;  4YTP B;  2DEN B;  4IC7 B;  3LXF A;  3SR6 A;  3RPF C;  1SB3 C;  1SE3 A;  4CHK A;  5BMG A;  3NOB A;  1YN5 A;  2M0A A;  1L5P A;  4ICU A;  2DZM A;  2L00 B;  2ZPY A;  1WGY A;  2BYV E;  1V86 A;  4IG7 B;  4MJS A;  2W9N A;  1TGZ B;  5AUI A;  3A4S C;  3RFZ B;  5BO4 B;  1S3S G;  5DCN A;  4NZL B;  4OHJ A;  1DOX A;  5FKA C;  2D5G A;  3DVN V;  3EGR A;  3AE7 B;  2X8X X;  3HIZ A;  2NTT A;  4IWP A;  2MW5 A;  1L4Z B;  2K8C A;  4KSL C;  1J7A A;  3QWZ B;  2KQS A;  2Z8L A;  1J8C A;  5IN7 A;  3QAQ A;  1K50 A;  2GOW A;  2KC1 A;  2FUH B;  2GB1 A;  4MGI E;  1GB4 A;  1SIF A;  1DOY A;  3JSV A;  3B2F A;  2KAN A;  4LTU A;  1I4P A;  1G6J A;  2DAF A;  1WY8 A;  2YLM A;  2QC8 A;  4YTN B;  1FPY A;  2L32 A;  4A3O A;  1QKZ A;  4KZ0 A;  1FNW A;  3ZXR A;  3RT3 B;  3KUZ A;  2D07 B;  2GBN A;  4W9I A;  4C7Y A;  1ZW7 A;  2D2Q A;  3MFG A;  3DBL I;  1C78 A;  3H9D A;  2KX3 A;  3AN1 A;  4E74 A;  1JCK B;  1XLN A;  3NRZ A;  1E8Z A;  1VZ8 A;  4PS3 A;  4PK1 A;  3B1L X;  2NBV B;  4KGR A;  4W9F A;  1MG8 A;  4IOI E;  1V2Y A;  2K25 A;  2BS3 B;  4HRS A;  4DWF A;  4GDK B;  5KHQ A;  2HTM E;  4G0N B;  3GB1 A;  4EFO A;  1PQS A;  5TR5 A;  5HHD G;  3U8Z A;  3APC A;  2GLS A;  5H8Y E;  1KOT A;  2FID A;  2KZR A;  5G55 A;  4REZ A;  1C77 A;  4WQO B;  4KVG B;  4M01 A;  5BMI A;  1SIJ A;  2HE7 A;  2L83 A;  1H8C A;  2N4F A;  1V8C A;  4ARI A;  1WR1 A;  2H88 B;  1C76 A;  1WGD A;  3Q8F A;  3PO0 A;  4TV3 A; 
#chains in the Genus database with same CATH homology
 1KF6 B;  3ZJU A;  1VZ6 A;  1TS3 A;  4C80 A;  3P1M A;  1ZPS A;  3AEE B;  2BYT A;  1A70 A;  4C7Z A;  2JX5 A;  1JAL A;  5EE0 A;  2KAC A;  3R2I A;  1D5X C;  1K51 A;  5BYQ A;  4D2K A;  4YXD B;  4JWU C;  2IGD A;  3U2S C;  2LFI A;  1FXA A;  2WXJ A;  1I7H A;  1GPX A;  1UUP A;  5HI1 A;  1D6E C;  1MHX A;  4N58 A;  3Q69 A;  2H89 B;  3V05 A;  1YNT E;  3NVZ A;  1PDX A;  3AE4 B;  3W9C B;  2QJL A;  1YN4 A;  2J52 A;  1N5W A;  4H2A A;  2SEB D;  4KKI A;  1P7F A;  3LYY A;  3BZD B;  3TEW A;  3ABV B;  1WSP A;  2N7J A;  1PGA A;  5GXG B;  1E10 A;  3T3O A;  4ITK A;  5FK9 C;  3BYY B;  3WCQ A;  2WDR B;  4AQ7 A;  1WYG A;  2JSV X;  1WWT A;  1N5X A;  3BWU D;  2RDG A;  2AQ2 B;  4O1N A;  3TEZ A;  2INN E;  4MAC A;  2J42 A;  1WGK A;  4ZHO A;  2L1A A;  2VZK D;  1FNV A;  1C4A A;  1PGB A;  1RFK A;  2AQ3 B;  3ZGZ A;  3Q8A A;  4KX6 B;  4KGT A;  1ZE3 D;  1EU3 A;  3TEY A;  1HXY D;  1TS4 A;  1FFV A;  1XEE A;  2MJE A;  3ZQ4 A;  2MH7 A;  4A8X C;  3Q8C A;  1JWU D;  1NVI D;  1AWD A;  2OHF A;  2I38 A;  3R8B A;  3AEA B;  1EWC A;  2N9L A;  5EE9 A;  1RWS A;  4MH8 A;  3NZ3 A;  1N61 A;  4L1B A;  1E7P B;  2JXT A;  1F77 A;  1FCC C;  1LO5 D;  2BT6 A;  3J9C A;  4HRO A;  1QOB A;  2OED A;  3BVM A;  4XDC A;  2K22 A;  1ZDV A;  3FAH A;  3HUI A;  1OFF A;  2WP9 B;  5D3D A;  3GP7 A;  3NVW A;  3I9V 1;  3P4P B;  2BB6 A;  3MHZ A;  4DXG A;  3VR9 B;  2MJD A;  3P63 A;  5HFY A;  1NEK B;  1UGJ A;  2R61 A;  2BB5 A;  3AV8 A;  2M19 A;  4AS1 A;  3AMZ A;  5JXV A;  3B2G A;  3O13 A;  1DGJ A;  4OVZ A;  2KAJ A;  1JRO A;  4CQN A;  1B9R A;  1GB1 A;  1FFU A;  1XCT L;  3AEC B;  4WQM A;  2PMV A;  5T8I A;  1V1P A;  2PKO A;  1KH0 A;  4B0E A;  1PGX A;  3NS1 A;  3AED B;  1ZUD 2;  1SBB B;  1F2R I;  1FRD A;  1NEN B;  5D7G A;  4LLG M;  1KRH A;  1SXT A;  2HDE A;  1FEH A;  1MI0 A;  1WRI A;  2JWU A;  1IUE A;  2WXM A;  2PTL A;  2WXL A;  3MP9 A;  3VRB B;  2BBC A;  5BYR A;  3PZ7 A;  1BXT A;  1XLO A;  2ZW1 A;  1MVK A;  1KLG D;  1JML A;  1FXI A;  1PYW D;  2K3U A;  3T3N A;  3KWL A;  2JU6 X;  3AH7 A;  2KMM A;  4OW0 A;  1J7B A;  1PUT A;  3ZJV A;  4XWW A;  5AUK A;  1D5Z C;  2V0G A;  4RGN A;  1FCL A;  1D5M C;  2WQY B;  1L6V A;  1EU4 A;  2WXK A;  1E0Z A;  1UNS A;  2NTS A;  3AE3 B;  3P42 A;  1VRA B;  1VJK A;  2KQ4 X;  3EA6 A;  1CZP A;  4RNA A;  3BII D;  4WH4 A;  2DWQ A;  4XDD A;  2PLP A;  3E9S A;  1TJE A;  1NI3 A;  2K9X A;  4EE2 A;  3I57 A;  1BML C;  3IAS 1;  3DWM A;  3B9J A;  1F2R C;  3TSS A;  3W1S A;  2W3S A;  1L0V B;  1SEB D;  2WXN A;  4C56 C;  1AYF A;  1VR9 A;  2WXH A;  3KWV A;  2EEL A;  2WXQ A;  3DWG C;  1BUI C;  1IBX A;  2IGG A;  2WDV B;  2WXO A;  2X38 A;  3ZJT A;  1TZO A;  4RGT A;  1CQV A;  2AX5 A;  1ZXH A;  4A55 A;  2KWD A;  2FBW B;  1OQQ A;  2WXG A;  3AM9 A;  3PZ8 A;  4ZOH C;  1QT9 A;  3OWE B;  2E6X A;  3U7Z A;  5I4D A;  3BVG A;  1JWB D;  2KDM A;  1TS2 A;  2EKI A;  3CWI A;  2BS2 B;  1XLP A;  1XCQ L;  2TSS A;  3NVY A;  1SF0 A;  3AEG B;  4TQ0 A;  3AE6 B;  1EM7 A;  2N0S B;  1FNU A;  1HEZ E;  2LHE A;  4A90 A;  1STE A;  1NYR A;  2CJN A;  4N6E B;  3KLS X;  4JPS A;  1T3Q A;  3IT6 B;  1K53 A;  3IT4 B;  1XO3 A;  1I4Q A;  3BK1 A;  1TYG B;  2W3R A;  1IGD A;  3NVV A;  2BTE A;  1YMH E;  2KN4 A;  1AW7 A;  2LEK A;  1V1O A;  4WAF A;  4L2Y A;  2YEP F;  2WDQ B;  4MM3 B;  4JWS C;  4J3O D;  3U52 E;  3LB8 C;  1GAQ B;  2CJO A;  3AEB B;  4GLS C;  3ZYY X;  4KGS A;  1L0Y B;  4WIP A;  2QEJ C;  3MJ5 A;  2CU3 A;  2JYE A;  3GS2 A;  1TY2 A;  1GOZ A;  2N9K A;  4ZHP A;  1JWA D;  1ACC A;  1N60 A;  1ROE A;  1I4G A;  3FIL A;  4GDL B;  4P16 A;  4US9 A;  5EE1 A;  3URY A;  4XE0 A;  2RMM A;  4FXC A;  1VLB A;  4HJG E;  1TKE A;  4JE3 B;  4DXF A;  1M4V A;  1FMA D;  2PVO D;  1T6B X;  3HVZ A;  4HKQ A;  3AB5 A;  4M0W A;  2WXR A;  2PIA A;  2Y3A A;  2G9H D;  3AE1 B;  1CJE A;  2SAK A;  2W82 A;  4HEA 1;  1SSN A;  1XF5 L;  4OZC A;  4L23 A;  4B0M A;  2ZW0 A;  1L0X B;  3CIR B;  4RGO S;  2BS4 B;  3UI3 A;  3AE9 B;  5EE3 A;  1L6U A;  5LNK 1;  2WS3 B;  2M56 B;  3H8H A;  3L4P A;  1IGC A;  2B76 B;  4ZRQ A;  2LHD A;  2JZP A;  4WWM A;  5MPO A;  3VR8 B;  1V1P B;  4OZA A;  2J4X A;  1HZ5 A;  2LJI A;  1YQ3 B;  1Q10 A;  1TY0 A;  5G5G A;  2I2Y A;  3R2T A;  1ESF A;  4USA A;  2DBY A;  1FM0 D;  2IDY A;  2JYT A;  2WU5 B;  5BYS A;  4UDU C;  1KFY B;  3U4E G;  1YQ4 B;  4YTM B;  1I4H A;  2WXI A;  2J53 A;  1ZDX A;  2XNA C;  3IXS A;  3EUB 2;  1V97 A;  2Q5W D;  1Y56 A;  4A9A A;  4ZYS A;  4YTP B;  1N62 A;  2V3P A;  3HRD D;  1YJJ A;  1VDV A;  3LXF A;  1SJE D;  3VQI A;  1ET9 A;  3SR6 A;  2QSD A;  3RPF C;  2RDH A;  3E56 A;  1SB3 C;  2GI9 A;  1SE3 A;  4TMA B;  2ONQ A;  1NYQ A;  1I4X A;  1QQR A;  5D3I B;  1FO4 A;  3P4R B;  5BMG A;  2MJ3 A;  1YN5 A;  2M0A A;  1FRR A;  4YT0 B;  1L5P A;  1L4D B;  1QOG A;  5E6J A;  1PFD A;  1JWM D;  2DLB A;  1RM6 C;  1UWM A;  2FUG 1;  1P7E A;  3BVZ A;  4NAW B;  1T5X D;  4RF1 A;  5AUI A;  1C79 A;  3RFZ B;  5H92 C;  2BW2 A;  2QMT A;  1AN8 A;  3AE8 B;  3FC4 A;  1XXG A;  1RYJ A;  4DQO C;  2V3N A;  4Q2J A;  2IPK D;  1ZP0 B;  4NZL B;  4OHJ A;  1DOX A;  3ETR A;  2DYO A;  5FKA C;  2D5G A;  3N9Y C;  2WXP A;  3EGR A;  3AE7 B;  4N59 A;  1JW9 D;  2Y5C A;  3HVD A;  5TSS A;  2RPV A;  1UWX A;  1HA5 A;  2NTT A;  1IBX B;  1L4Z B;  1J7A A;  2Z8L A;  1WXQ A;  2VZK B;  1OQR A;  1MPE A;  1DOI A;  5G5H A;  5BMH A;  1D4B A;  1YN3 A;  1K50 A;  2WXF A;  2QIL A;  1QOF A;  1E9M A;  2INP E;  4KKJ A;  2GB1 A;  2LGI A;  4IKG A;  3SFE B;  2Y5P A;  1GB4 A;  3AE2 B;  3VRA B;  5HG2 A;  1DOY A;  2AQ1 B;  3B2F A;  4RCO A;  4LTU A;  1I4P A;  2W55 A;  4TSS A;  2LUM A;  1VZ7 A;  4YTN B;  1TKY A;  4YSX B;  3W2D A;  4A6Q A;  2LMC A;  2IJ0 A;  5FR3 A;  2L32 A;  1SJH D;  2YEP B;  1QKZ A;  4US8 A;  3KQ4 A;  1ZOY B;  1FNW A;  1C4P A;  3V3X A;  2FE8 A;  4NJC A;  4WUR A;  4C7Y A;  4ZRP A;  2V4I B;  2PVG C;  3NUH B;  1JRP A;  3MFG A;  2K5P A;  1FIQ A;  1SE2 A;  4NAM A;  3Q8B A;  1C78 A;  2WU2 B;  4ARC A;  3SFD B;  3AN1 A;  3W5V B;  1JCK B;  1XLN A;  1I4R A;  3NRZ A;  2IGH A;  1HZ6 A;  2NMQ A;  4XWT A;  1YJI A;  4P6V F;  4PT5 A;  1VZ8 A;  1JQ4 A;  4RFB A;  3TUO A;  1TKG A;  1K52 A;  2QIE B;  2ICI A;  4KGR A;  3FIL B;  2DYM A;  4IOI E;  2XN9 C;  2BS3 B;  4YSY B;  2ON8 A;  4HRS A;  4GDK B;  2K0P A;  1FD6 A;  2E3T A;  1SE4 A;  1J7C A;  2HTM E;  3SEB A;  3AEF B;  1TS5 A;  3GB1 A;  1KTK A;  4YSZ B;  1EWY C;  5HHD G;  1R7S A;  4RF0 A;  1KLU D;  2JQR B;  5H8Y E;  4YWG G;  3BK2 A;  3W5U B;  1DYQ A;  2MEK A;  1CK1 A;  1C4C A;  3TEX A;  3P4Q B;  5C3J B;  1QIL A;  4LK0 M;  4REZ A;  2WNM A;  1C77 A;  3P4S B;  2WLB A;  3AE5 B;  4RH6 A;  1ZXI A;  5BMI A;  1SIJ A;  1B1Z A;  1QLB B;  3Q8E A;  2L83 A;  1V8C A;  4ARI A;  2PW9 A;  3MC0 B;  1ENF A;  2GRI A;  1HQR D;  1C9F A;  2H88 B;  2L52 A;  1N63 A;  1C76 A;  1F0Z A;  4TQ1 A;  2ACZ B;  2W54 A;  4IDI A;  4OZB A;  3IAM 1;  3Q8F A;  4RGM A;  3C8Y A;  1JWS D;  1XLQ A;  4R3D A;  1QF6 A;  4MT5 A;  1MHH E;  1ET6 A;  1E6E B;  3PO0 A;  5C2T B;  3BYT B;  4JX1 C;  2G1E A;  4HKZ E;  1QOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...