1JMMA

Crystal structure of the v-region of streptococcus mutans antigen i/ii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
377
structure length
377
Chain Sequence
QKDLADYPVKLKAYEDEQASIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFLKASAVDDAFSKSTSKAKYVQKILQLDDLDITNLEQSNDVASSMELYGNFGDKAGWSTTVSNNSQVKWGSVLLERGQSATATYTNLQNSYYNGKKISKIVYKYTVDPKSKFQGQKVWLGIFTDPTLGVFASAYTGQVEKNTSIFIKNEFTFYDEDGKPINFDNALLSVASLNREHNSIEMAKDYSGKFVKISGSSIGEKNGMIYATDTLNFKQGEGGSRWTMYKNSQAGSGWDSSDAPNSWYGAGAIKMSGPNNHVTVGATSATNVMPVSDMPVVPGKDNTDGKKPNIWYSLNGKIRAVNVPKVTKEKPTPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords protein I/II V-region
publication title Crystal Structure of the V-region of Streptococcus mutans Antigen I/II at 2.4 a Resolution Suggests a Sugar Preformed Binding Site
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Immune system, membrane protein
total genus 107
structure length 377
sequence length 377
ec nomenclature
pdb deposition date 2001-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08363 GbpC Glucan-binding protein C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jmmA01
2.60.530.10 Mainly Beta Sandwich Major cell-surface adhesin PAc Major cell-surface adhesin PAc 1jmmA02
1JMMA 1KZUB 1WRGA 1LGHB 1NKZB 1IJDB 1JO5A 2FKWB 3WMM0 1DX7A
chains in the Genus database with same CATH superfamily
3L75G 1KQLA 1AVYA 3PTZA 1DIPA 4OWFA 1T6AA 1URQA 2W6BA 4GT1A 3N4XA 1S4XA 4L74A 1SLQA 5APSA 2E5YA 1R5SA 1ZV8A 3T97A 1P84D 3H1LD 3H6PA 3TYYA 3IFMA 4U3FE 2XKMA 5CCGD 1YQ3C 3RK3B 3E1IA 3L35A 2Z5IA 1JY2N 1ZRTD 3PLNA 5AVRB 3BRVB 5AVUB 5KLVE 3FXDA 1IFJA 3LIEA 3VMAA 3V4QA 3VP8A 3G4SP 3HE5B 2FXMA 2KZIA 2ZJSE 2P1JA 2OYIC 1BGYE 3UIAA 2K9YA 2YKOA 3S4RA 4EDFA 4YXDC 2H8PD 2AXTH 3H1IJ 3JCUH 1JY3O 3V4WA 3CXHI 3G3ZA 1H0TB 2OGUA 3RK2C 2H88C 4HB1A 2L91A 2N9BA 2PP6A 2E74B 1NTZG 3AE1C 3FWNA 2FYZA 2C9LY 5APWA 1RF1B 1Q86Q 4I6MC 4BWNA 2K9JB 2HG5D 1OVRA 3H1KJ 1GU4A 2POHA 1ZLLA 3CCSP 5CCHD 1OZHA 5B5EH 2RKLA 3V2NA 3RBXA 1NWQA 3L74E 4XE5B 3P7KA 1LT9A 2BEZF 5AVTB 1L0NG 4HKZH 3D71A 3LW5J 1GW4A 2FFDB 1LWUB 3CC4P 1HGVA 2R32A 4O9BA 3AEEC 1LTSC 3E7KA 4DT0A 4ZNCA 4TLFA 5AW4B 3GHGB 3CWBJ 3TK1A 1PV3A 3H1HG 1CI6B 3O6QB 4OH8B 2QA4P 1DH3A 1ZOYC 2FXOA 3Q5PA 2OTKE 5AVVB 1RF0C 3ZDMA 5CHXA 2M3EA 3B5NB 1BDDA 5KAFE 2BCCJ 1FZEA 2WSCJ 1IJDB 2OYHC 1IZNB 1NU1D 2E75D 4A7PA 1NTMG 4Y28J 4PV1D 5KLIC 1RE4A 3M0DA 2OYIB 1FE6A 1J1EC 4OVNF 1SP4A 2WQYC 4PD4I 1LNQA 1VQ7P 2YNYA 4JBZA 1M1JC 1DEEG 2M8RA 1NO4A 2ZFCA 1EDIA 1NTZE 2IX7C 1KB9E 1S72P 1Q7YQ 2IBZD 1UIXA 2WSFJ 2JR8A 3L70J 5CCHC 2O1KA 2XV5A 2B9BA 2KLVA 2WSEH 1PPJE 3G6EP 4HH2A 1A02J 1IFPA 4YPCA 4AYCA 1EDKA 3WU2E 3H1LG 3VN0A 4UB8E 2WT7B 2Y0CA 2IPPA 1USDA 1Y8AA 4RKUJ 1K8AQ 4WY4A 1L0NE 4CPGA 5KKZC 1FJPA 3AE6C 4U7JA 2YO3A 2GA1A 2WMMA 1VQ6P 3TNUB 2KNCA 1A02F 3L4FA 1H8AA 1IK7A 2HODA 3L71J 3H1ID 3M9BA 2XNDH 1LTIC 3A2AA 3H1HE 1NJIQ 2ZXXA 3RK3D 1VPCA 4IFDK 3A0HE 2Y0DA 3MUDC 4W80A 2ZYAA 3H32B 4H44C 2N1TA 3D6ZA 2QIWA 2K37A 5EFWB 1FU1A 1NOHA 1YI2P 4PJ0E 1R5LA 1EDLA 5AW2B 1T8ZA 2PAJA 1H0TA 1GTWA 1KYOI 1S2EA 5KJ7A 1YJWP 4EIJA 3PRJA 3SWFA 4PV1C 3CXHE 2B88A 1BCCJ 2OYHB 2Z4EA 1S5LE 4ZMDA 1NTME 1RF1A 3HUSA 1PGQA 4HJGH 3MIWA 1VDFA 3NTNA 2IBZI 3FWLA 3M9HA 3II6A 1DD4A 5KLIB 1PGPA 4W7YA 1J1EB 2P2UA 3OJAB 4DOJA 4D6TG 3I55P 2E42A 3P32A 1M1JB 1IFDA 1JY3N 3BCCJ 1JEKA 1S5LX 3V2RA 1FOSE 1N73A 3KYQA 1SQPG 2FFDA 1T3UA 2XZRA 5KTBA 2CK3H 1NTKK 1IFNA 1SQXD 4DZOA 3HE4B 1KC8Q 2H43A 3TGUE 3GHGA 5TISE 1LTTC 1P84E 1KB9D 1NTKJ 4L73A 3GF7A 5E79E 3Q1MA 1ZRTE 2V7QH 1ZN5A 3Q2YA 5KKZB 1W5CE 1ZW0A 1K05A 1KQFB 2C9NY 1W2EA 1UIIA 1VL2A 3B5NA 2GM4A 3HTKA 3A0BE 1NU1G 1MFTA 1LTJC 5KLVG 1KQGB 1SQQD 1VQPP 2BEQD 1RQVA 1HJBA 3L70D 1EZVI 2YMKA 1N7SA 1GZLA 2YMYA 1HBWA 3L72J 3CC7P 1KB9H 5APYA 2FYNC 1OFCX 1OWAA 2A06E 1SQVK 2B87B 4K35A 2C0XA 3D70A 1IFIA 4PV1B 1FC2C 3FXEA 3B8EB 2FBWC 1FZAA 4C7RA 2Q5UA 1SQVJ 3VYIA 2NRGA 3WU2H 1RY3A 2QJKC 4UB8H 2NPSA 1HTLC 2C0WA 3RK2D 2A45I 4H13D 4I2LC 2Q1KA 3Q3DA 5APVA 3JC22 2P58A 2D2CC 2RN0A 4WBAA 1U7MA 3U1AA 1M56D 3CCUP 2KOGA 2WTYA 3AE3C 1VQ8P 3CMAP 1VQ4P 2WSEJ 3H1IG 1Q81Q 1JMMA 2NZ2A 3A0HH 3D6YA 3EQ2A 5AW5B 4U3FJ 1L0LD 3KPEA 4PJ0H 1KORA 5CCGA 2AXCA 1G2CA 1AV1A 3HD7C 1VQLP 1FDMA 4C7NA 3TGUD 1NGMB 1Q2NA 1ZXGA 2E76C 3CXHH 1FZCC 4Y99C 1S5LH 1PFIA 4IFMA 1BGYJ 4IFFA 1OW6A 1NU1E 1SQBK 4JYCA 2VRSA 1EQ7A 4MN4C 3U1CA 1K04A 2ITAA 1FBMA 1KYOE 3I56P 1BE3J 1ZP0C 4GDOA 1LTJB 1SQBJ 4OGQD 3NXSA 3V2QA 1NAFA 2J59M 3H25A 1X22A 2KI7B 4GIFA 2KZJA 2P10A 1L4AA 1ZMEC 1AJYA 3CCJP 4DJGA 2IBZE 4Z1MH 1KILC 2FYNB 4WVZA 3CLQA 1XTGB 2KIKA 4LLHA 3GF3A 3V2PA 4BRYA 4H13C 3MHVA 5TISH 1X9VA 1KMIZ 1Q82Q 2JP3A 1SQXG 4YXWH 1P84H 3O8ZA 1JUNA 2A06D 4PD4D 3G71P 2QJKB 1D7MA 2IDBA 3L75J 1PPJG 3QH9A 3M91A 4GODA 1HJ0A 3EWKA 2ZXEB 1BSHA 1USEA 1N86A 3P8MC 2ZAEB 2RH0A 3A0BH 3H1IE 1YYCA 1QLED 3MP7B 3RK3E 3L72D 2QJYC 3AEGC 2KUBA 2B89A 1GL2A 2V4HA 1J2JB 3AE4C 2FYUD 1SQQG 1YTZI 3H1JD 1M1KQ 2AEFA 2JDIH 2WPRA 2Q7CA 4KT0J 4UB6E 2Q9IA 1Y9BA 2CPSA 2V7QJ 1HGZA 1LTBC 1SFCC 1Y47A 1WRGA 2W6AA 1WT6A 1JTHB 3MZWB 2XNXA 2ZYDA 3HD7B 1SQVD 4N78D 3CMEP 1VQKP 4I7ZC 1HH0A 4OGQC 2E76B 1FZCB 1URQC 3AE7C 2JWDA 2GUSA 1H89A 2W6JH 4H44D 1NTZK 5AVQB 5APTA 2QM7A 1G1JA 5APXA 3RL0C 5C39A 3WMM0 5GTIE 4IL6E 2KB7P 1NTZJ 5CJ4A 1FZGA 1KYOD 1DD3A 2KSJA 4H0LC 2M5AB 2Y9YA 3ABVC 3L73J 1J1DC 1KILB 1L0NK 4B86A 1SQXE 1LGHB 3RK2B 2GUVA 3F89A 4H13B 3AEDC 4IL6X 1OW8A 1L0LG 1LP1B 1L0NJ 3NMDA 2HPCB 3BRTB 3C1LA 1JNMA 1JCDA 2P67A 1JY2P 1FZFA 1RE3A 4NPEA 3TGUG 1VQ5P 3VP9A 1JCCA 1BE3D 1YHQP 3H1HJ 4TT3H 1S9KD 2YKPA 1KYOH 1NVOA 1SQQE 5B66E 4XFJA 2QJYB 1VQOP 2QM8A 2I8DA 3L70E 3AE5C 1LTJA 2WPSA 2JJLA 1LT9C 3OA7A 1IC2A 2KS1B 2O1JA 3HE5A 1NTMK 2JWAA 3C9IA 3CX5D 1SFCB 4ZKPA 2ZT9C 1JMBA 2CPBA 1EDJA 1NTMJ 2G8YA 4JQ0D 1AVOA 4I7ZB 1R8EA 2AEJA 1OXZA 4OGQB 3L75D 3H1KD 1URQB 1N2DC 2A06G 4ASWA 4EOTA 1FAVA 1T3JA 1MV8A 1EZVD 3QWOC 3T97B 4N6JA 3FGAD 3G9RA 2K9JA 2N1TD 2HYNA 3BASA 2ZYGA 4H0LB 2K88A 1PP9J 4IOIH 2QG4A 3B71A 2AEMA 3H1LJ 3CWBD 3L72G 1L0LE 1RQUA 1RE4C 3M0DC 3R2PA 2FYUG 2KXPB 4UB6H 3H1JG 1LWUA 3VOPA 3VTPC 2D2CD 4JYBA 4N3YB 4I1LA 2KP8A 2BCCD 1OVVA 1VF5C 5K5GB 1SQVG 4L76A 1CI6A 2OQQA 3O6QA 2H7HA 3F5HA 5CMZA 5KAFH 2IYOA 1QVGO 3WUTA 2QRXA 3CX5I 1GMJA 1GK4A 3W67A 1FZBA 5GTIH 4IL6H 5BVZA 2FXPA 1KQSO 3HD7D 4KHXA 3L73D 4WY4C 1YBKA 2E76D 1M8OB 1JM0A 1LT9B 4DCKA 3Q5RA 3WUVA 1ZR4A 2OYIA 3AEAC 4H44B 5M1BA 1PL5A 2ZT9B 3KDPB 1MZ9A 3AECC 3I5CA 1KFMA 2WSCH 3M0AA 3RGUA 4D6TJ 2DW3A 1GDTA 4PD4E 1HUCA 2YIUC 1SQPK 2IBZG 2Z5HA 4GOFA 2N1TC 3AEBC 3GMAA 2JKVA 1FDIA 3AE8C 1SQPJ 1KILD 1X8YA 4AUWA 3MGNA 1NYHA 5KJ7C 4RO0A 1YIJP 1NH4A 3L36A 3S1KA 1BE3G 1QL2A 2JEEA 5CBOA 3L71D 2SPZA 2WT7A 3L72E 5B66H 4NPFX 1RF1C 3HUSC 2FYUE 1QVFO 2FKWB 2WSFH 3H1JE 2LXBA 3TNUA 3GG2A 5H2FE 1NU1K 1SS1A 2J5UA 5GTHE 2Q3IA 5KLVK 5DJUB 1SQVE 4N78E 1M90Q 2WWWA 3RBZA 1EXJA 1NU1J 1H88A 2LXCB 1N73C 1QEXA 5TJHA 2FFDC 1AQ5A 3H32A 5KLVJ 3A5TA 2R44A 3A7OA 3VMYA 1BCCD 2OYOA 4QMAA 1Q90D 2R5BA 1AFOA 2QSIA 2LR2A 3H1KG 2IYPA 1VQNP 3GHGC 1RF0A 3AE2C 5AW7B 3CPWO 1VQ9P 1SFCD 3CCRP 1EZVG 1E5WA 1PP9D 1CZQA 2OYHA 4WY4B 3V6IA 4GKGA 1BDCA 2W27A 4RESB 4R4LA 2YO2A 3BCCD 1JY3P 5AVYB 1PGOA 3CL3D 3CCVP 1URQD 3B5NC 1HWTC 2KNCB 3PJSK 5AW9B 3JSVC 3CI9A 4JF7A 2Y9ZA 2HODB 1JO5A 3CWBG 3VMXA 1QX8A 3RL0D 1M1JA 1NTKD 2WPVB 2A45G 1PZQA 2YIUB 1N7SC 4AQRD 2N1TB 2M0BA 3LIDA 4H0LD 2IZ0A 3EFFK 5CCHA 3L74J 4NPDA 3ITKA 1JOCA 1BE3E 2BCCG 2WITA 3HE4A 5E79H 1SQBE 5L8RJ 1S9KE 1L4AD 3P8CE 1U7JA 1EXIA 3MTUE 2D2CB 3OAKA 2IFNA 3TDKA 2UWJE 3HUSB 2NPSC 2Y0EA 1EC5A 3L73G 2R3SA 4EYYQ 5APUA 1WMKA 1YITP 1YQ4C 1LJ2A 3CX5E 3NFQA 3USSA 2HLOA 4D6TD 3M9QA 5KAIE 1N8RQ 3L70G 2YKQA 3IAOA 1N73B 3MUDA 2E43A 3L75E 5BU5A 3H1KE 3CCLP 1P84I 3K5BA 2JO1A 4PD4H 1SQPD 2O3JA 5AVWB 3FX0A 1E79H 2O01H 1EZVE 4HYTB 5CCGC 4Y99B 2B87A 4KJMA 1SQXK 3PH0A 1GL2D 2QVAA 2PGDA 1Z56A 2ZT9D 1KTMA 1LTAC 3B4SA 4WB4A 5AW0B 1XTCC 1SQXJ 3W68A 2FY8A 3KQGA 4K3AA 4YTPC 2KYVA 1K9MQ 3L71G 3CWBE 1BSNA 3HTKB 1GK6A 2QEXP 2WSSH 4U3FD 5CBNA 2K1AA 5H2FH 1N7LA 3Q5SA 5GTHH 4EI2A 1W2BO 1M57D 5KLVD 3CD6P 1YJ9P 1L4AC 1N7SB 3GW6A 2BCCE 1SQQK 2WVRA 4JPZB 2XDJA 3R4YA 1MUUA 1BGYD 2PRRA 2O01N 2J58A 1SQQJ 1BCCG 2I1KA 1TU3F 5AW6B 2KSEA 2YXQB 3OW2O 1KN7A 1MKMA 3M06A 1FS0E 1SQBD 3V5BA 3L73E 4WWIA 1LT1A 2NPSB 3P8CD 3AEFC 3SWYA 4ZKUA 1PP9G 1VF5D 1FDOA 2PFXA 4RJTA 3BCCG 1RH5B 1RHZB 2W90A 2OARA 3CC2P 1PGJA 1JY2O 2MKVA 1NKNA 1S1CX 2E5TA 1QGKB 2QJPC 1GL2C 2KK7A 2Q3EA 1KZUB 2R3CA 3L74D 5AW3B 2WZ7A 4WY4D 1NKZB 4BXLA 1NTKG 1NHLA 1S3JA 2IFMA 4L75A 1OX3A 1JB0J 1PIXA 2YXRB 1CW5A 3KZIE 1K73Q 1KILE 1G2CB 2WPQA 1L0LK 2L5GB 1CSBA 3KHUA 1YTZT 4C7NB 5APQA 3L71E 2E75C 1L0LJ 3RL0B 2OTJP 3IN6A 3CCMP 2R5DA 3SFEC 4ASVA 3TGUJ 3KXDA 1J1DB 3CX5H 5KJ7D 3PHLA 5AVXB 1GU5A 5KAIH 2XU6A 1T2KD 2W8ZA 3TSIA 1L4AB 1G1IA 2E74D 1FOSF 1VQMP 3HRNA 3MD0A 2H89C 3E1RA 1KD1Q 5CJ0A 1BCCE 5AW8B 1OIPA 2P7JA 1AA0A 4BRYB 1KFNA 1OMIA 2AXTE 3RL0g 4XA4A 3JCUE 1DX7A 1JTHA 3HD7A 3SWKA 1GD2E 1M7LA 1PP9E 1GW3A 2ZVOB 2LKMA 4W7ZA 1NTZD 3LW5H 3C8VA 1FZCA 1OW7A 3CCEP 3H1LE 1RE3C 3BCCE 3PP5A 1YJNP 1PPJD 1FJKA 3S9OA 3VMZA 2HFED 4M3LA 3RK3C 2A45H 3SSUA 1LTGC 2Q6QA 4U3FG 2O01J 2IZ1A 5B5EE 1NTKE 1L0ND 2QJPB 1GL2B 1DEBA 4LC1A 3AE9C 4LGDE 1HF9A 2M5AA 2KLUA 2ZVNB 5BU8B 1KILA 3WUUA 3B5ND 2FYUK 1KV4A 3IR9A 5AVZB 1X79B 1X0TA 1IO4A 1LP1A 3H1HD 4C46A 3GLMA 3TF5A 1BGYG 2N9YB 2FYUJ 2HPCA 3H1JJ 2E75B 1NAYA 1QL1A 2QE7H 3N7NA 1IFMA 3EFGA 1SQBG 1N7SD 1OVUA 1T2KC 2E74C 1MFZA 5AW1B 2MJZA 1SVFA 2RMZA 3A3YB 1L2PA 1U57A 3U59A 2M3BA 5AVSB 3CXHD 4D6TE 2OTLP 3SFDC 4R4MA 1NTMD 4GOEA 5DJTB 2W83C 3L37A 2HR3A 2G3AA 2I1JA 1HVVA 2BASA 1KB9I 3IF4A 3CCQP 1ZR2A 2NPSD 1SQPE 3BVHA 2KS1A 3L74G 3BATA 1AQTA 2K3RA 1VF5B 1SFCA 1LWUC 3KZIH 1IK9A
chains in the Genus database with same CATH topology
2HLOA 1KQLA 3M9QA 2YKQA 1N73B 3MUDA 2E43A 1ZN5A 2QM8A 5BU5A 1URQA 2W6BA 1LTJA 4GT1A 2C9NY 1W2EA 2WPSA 2JJLA 3N4XA 1LT9C 3B5NA 5AVWB 2GM4A 1SLQA 3OA7A 1IC2A 2O1JA 3HE5A 1NTMK 2O01H 5APSA 3C9IA 1ZV8A 3HTKA 4HYTB 3T97A 5CCGC 4Y99B 3H6PA 1SFCB 3TYYA 3IFMA 4ZKPA 2XKMA 1LTJC 1SQXK 5CCGD 3RK3B 3E1IA 3L35A 1GL2D 2CPBA 2Z5IA 1Z56A 1JY2N 5AVRB 1LTAC 3BRVB 1OXZA 5AVUB 5AW0B 4WB4A 1XTCC 1IFJA 1HJBA 1URQB 3LIEA 1N7SA 3KQGA 1GZLA 2YMYA 2KYVA 1HBWA 3V4QA 1N2DC 4EOTA 1FAVA 3VP8A 1T3JA 3HE5B 5APYA 2FXMA 1OWAA 1MV8A 3HTKB 1GK6A 2P1JA 2OYIC 3UIAA 2YKOA 4N6JA 1SQVK 2C0XA 2H8PD 1N7LA 1IFIA 3B8EB 2N1TD 2HYNA 1JY3O 3V4WA 1FZAA 4C7RA 3G3ZA 2Q5UA 3VYIA 3BASA 3RK2C 1L4AC 1RY3A 1N7SB 1SQQK 2NPSA 1HTLC 2C0WA 3RK2D 2A45I 2XDJA 4I2LC 2N9BA 2PP6A 5APVA 1MUUA 2FYZA 1RE4C 3M0DC 3R2PA 2C9LY 2J58A 5APWA 1RF1B 2I1KA 1LWUA 4WBAA 4I6MC 3U1AA 5AW6B 2HG5D 2KOGA 3VOPA 3VTPC 4JYBA 2WTYA 1GU4A 2POHA 3M06A 4N3YB 1ZLLA 4I1LA 3V5BA 5CCHD 2KP8A 1JMMA 2NPSB 3EQ2A 3V2NA 1NWQA 1CI6A 3P8CD 2H7HA 5AW5B 3SWYA 4ZKUA 4XE5B 3P7KA 1LT9A 5CMZA 5AVTB 3KPEA 5CCGA 1GW4A 2FFDB 1G2CA 1LWUB 1HGVA 2R32A 4O9BA 2OARA 1GK4A 1LTSC 1FZBA 3HD7C 1JY2O 1FDMA 5BVZA 1NKNA 4C7NA 5AW4B 3GHGB 3HD7D 4KHXA 4WY4C 3TK1A 1GL2C 1FZCC 1KZUB 4Y99C 2R3CA 1CI6B 5AW3B 4OH8B 2WZ7A 1PFIA 4IFMA 4IFFA 4WY4D 1SQBK 1NKZB 1LT9B 1DH3A 4JYCA 1NHLA 2IFMA 2VRSA 1EQ7A 1CW5A 3U1CA 1ZR4A 5AVVB 1FBMA 2OYIA 1RF0C 1G2CB 2WPQA 3KDPB 1LTJB 1MZ9A 1L0LK 3NXSA 3V2QA 5CHXA 1NAFA 2J59M 3B5NB 3I5CA 2L5GB 1CSBA 1FZEA 1YTZT 4C7NB 1KFMA 2WSCH 5APQA 3M0AA 4GIFA 1IJDB 2OYHC 1GDTA 1HUCA 1L4AA 1SQPK 2Z5HA 3RL0B 2N1TC 1KILC 2R5DA 3CLQA 1XTGB 4LLHA 2OYIB 1KILD 1RE4A 3M0DA 1X8YA 3V2PA 4AUWA 3MGNA 1J1EC 5KJ7C 1SP4A 1X9VA 1NH4A 3L36A 1J1DB 2YNYA 3O8ZA 1QL2A 1JUNA 5KJ7D 1M1JC 2JEEA 2M8RA 1NO4A 5AVXB 1GU5A 2ZFCA 2WT7A 2XU6A 1T2KD 3TSIA 1L4AB 1G1IA 1FOSF 3HRNA 1RF1C 2IX7C 3MD0A 3HUSC 2FKWB 5CJ0A 3M91A 2WSFH 5AW8B 2P7JA 5CCHC 2O1KA 2XV5A 3TNUA 2KLVA 2WSEH 2ZXEB 1NU1K 1KFNA 4HH2A 1A02J 1N86A 3P8MC 4AYCA 4XA4A 1YYCA 2Q3IA 1DX7A 5KLVK 1JTHA 3HD7A 4N78E 1GD2E 2WWWA 1M7LA 3VN0A 1H88A 2WT7B 2IPPA 1GW3A 3LW5H 2LKMA 4W7ZA 1N73C 4WY4A 1GL2A 1FZCA 1J2JB 2FFDC 1FJPA 1AQ5A 3H32A 3A7OA 3A5TA 1RE3C 2YO3A 3PP5A 3VMYA 1YTZI 2R5BA 1AFOA 3TNUB 2WPRA 2Q7CA 1FJKA 3GHGC 1A02F 3L4FA 2Q9IA 2CPSA 1H8AA 1RF0A 1HGZA 1LTBC 1SFCC 2HODA 3M9BA 3VMZA 1WRGA 2HFED 2W6AA 4M3LA 1WT6A 1JTHB 5AW7B 1LTIC 2XNXA 3A2AA 1SFCD 3HD7B 4N78D 2A45H 3RK3C 1E5WA 1LTGC 1HH0A 3RK3D 1VPCA 4IFDK 1CZQA 2OYHA 4WY4B 1GL2B 1DEBA 1FZCB 4LC1A 4GKGA 2W27A 4W80A 4RESB 4LGDE 1URQC 2YO2A 3H32B 2N1TA 2GUSA 1H89A 1JY3P 5AVYB 1FU1A 3CL3D 5BU8B 1NOHA 1URQD 3B5NC 1KILA 1NTZK 1HWTC 5AVQB 5AW9B 5APTA 3B5ND 2FYUK 2QM7A 5AW2B 3CI9A 1T8ZA 2PAJA 4JF7A 1G1JA 2HODB 5APXA 1GTWA 3IR9A 5AVZB 5KJ7A 1X79B 3RL0C 1JO5A 4EIJA 3WMM0 3VMXA 1IO4A 2KB7P 4C46A 3SWFA 5CJ4A 3RL0D 1M1JA 2HPCA 1FZGA 2A45G 2OYHB 2KSJA 2Z4EA 1QL1A 3N7NA 1N7SC 4AQRD 2N1TB 1IFMA 1RF1A 3HUSA 3EFGA 3LIDA 1J1DC 1N7SD 1KILB 3MIWA 5CCHA 1T2KC 1VDFA 1L0NK 3NTNA 4B86A 1MFZA 3M9HA 1LGHB 1JOCA 3II6A 2WITA 3HE4A 3RK2B 2GUVA 5AW1B 2MJZA 4W7YA 1J1EB 2P2UA 3OJAB 1SVFA 4DOJA 1S9KE 3A3YB 2E42A 3U59A 2M3BA 3P32A 3NMDA 1L4AD 3P8CE 5AVSB 1M1JB 1IFDA 2HPCB 1JY3N 3BRTB 1JNMA 3V2RA 1FOSE 1JCDA 1N73A 3MTUE 3KYQA 2P67A 3L37A 3OAKA 2IFNA 2FFDA 3HUSB 1JY2P 1FZFA 2NPSC 1T3UA 2XZRA 1RE3A 2I1JA 1HVVA 5KTBA 2BASA 1NTKK 1ZR2A 2NPSD 3VP9A 1JCCA 1IFNA 3BVHA 4DZOA 3HE4B 5APUA 2H43A 3GHGA 1LTTC 3BATA 1S9KD 1SFCA 2YKPA 1LWUC 3NFQA 1IK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMM A;  1KZU B;  1WRG A;  1LGH B;  1NKZ B;  1IJD B;  1JO5 A;  2FKW B;  3WMM 0;  1DX7 A; 
#chains in the Genus database with same CATH topology
 3L75 G;  1KQL A;  1AVY A;  3PTZ A;  1DIP A;  4OWF A;  1T6A A;  1URQ A;  2W6B A;  4GT1 A;  3N4X A;  1S4X A;  4L74 A;  1SLQ A;  5APS A;  2E5Y A;  1R5S A;  1ZV8 A;  3T97 A;  1P84 D;  3H1L D;  3H6P A;  3TYY A;  3IFM A;  4U3F E;  2XKM A;  5CCG D;  1YQ3 C;  3RK3 B;  3E1I A;  3L35 A;  2Z5I A;  1JY2 N;  1ZRT D;  3PLN A;  5AVR B;  3BRV B;  5AVU B;  5KLV E;  3FXD A;  1IFJ A;  3LIE A;  3VMA A;  3V4Q A;  3VP8 A;  3G4S P;  3HE5 B;  2FXM A;  2KZI A;  2ZJS E;  2P1J A;  2OYI C;  1BGY E;  3UIA A;  2K9Y A;  2YKO A;  3S4R A;  4EDF A;  4YXD C;  2H8P D;  2AXT H;  3H1I J;  3JCU H;  1JY3 O;  3V4W A;  3CXH I;  3G3Z A;  1H0T B;  2OGU A;  3RK2 C;  2H88 C;  4HB1 A;  2L91 A;  2N9B A;  2PP6 A;  2E74 B;  1NTZ G;  3AE1 C;  3FWN A;  2FYZ A;  2C9L Y;  5APW A;  1RF1 B;  1Q86 Q;  4I6M C;  4BWN A;  2K9J B;  2HG5 D;  1OVR A;  3H1K J;  1GU4 A;  2POH A;  1ZLL A;  3CCS P;  5CCH D;  1OZH A;  5B5E H;  2RKL A;  3V2N A;  3RBX A;  1NWQ A;  3L74 E;  4XE5 B;  3P7K A;  1LT9 A;  2BEZ F;  5AVT B;  1L0N G;  4HKZ H;  3D71 A;  3LW5 J;  1GW4 A;  2FFD B;  1LWU B;  3CC4 P;  1HGV A;  2R32 A;  4O9B A;  3AEE C;  1LTS C;  3E7K A;  4DT0 A;  4ZNC A;  4TLF A;  5AW4 B;  3GHG B;  3CWB J;  3TK1 A;  1PV3 A;  3H1H G;  1CI6 B;  3O6Q B;  4OH8 B;  2QA4 P;  1DH3 A;  1ZOY C;  2FXO A;  3Q5P A;  2OTK E;  5AVV B;  1RF0 C;  3ZDM A;  5CHX A;  2M3E A;  3B5N B;  1BDD A;  5KAF E;  2BCC J;  1FZE A;  2WSC J;  1IJD B;  2OYH C;  1IZN B;  1NU1 D;  2E75 D;  4A7P A;  1NTM G;  4Y28 J;  4PV1 D;  5KLI C;  1RE4 A;  3M0D A;  2OYI B;  1FE6 A;  1J1E C;  4OVN F;  1SP4 A;  2WQY C;  4PD4 I;  1LNQ A;  1VQ7 P;  2YNY A;  4JBZ A;  1M1J C;  1DEE G;  2M8R A;  1NO4 A;  2ZFC A;  1EDI A;  1NTZ E;  2IX7 C;  1KB9 E;  1S72 P;  1Q7Y Q;  2IBZ D;  1UIX A;  2WSF J;  2JR8 A;  3L70 J;  5CCH C;  2O1K A;  2XV5 A;  2B9B A;  2KLV A;  2WSE H;  1PPJ E;  3G6E P;  4HH2 A;  1A02 J;  1IFP A;  4YPC A;  4AYC A;  1EDK A;  3WU2 E;  3H1L G;  3VN0 A;  4UB8 E;  2WT7 B;  2Y0C A;  2IPP A;  1USD A;  1Y8A A;  4RKU J;  1K8A Q;  4WY4 A;  1L0N E;  4CPG A;  5KKZ C;  1FJP A;  3AE6 C;  4U7J A;  2YO3 A;  2GA1 A;  2WMM A;  1VQ6 P;  3TNU B;  2KNC A;  1A02 F;  3L4F A;  1H8A A;  1IK7 A;  2HOD A;  3L71 J;  3H1I D;  3M9B A;  2XND H;  1LTI C;  3A2A A;  3H1H E;  1NJI Q;  2ZXX A;  3RK3 D;  1VPC A;  4IFD K;  3A0H E;  2Y0D A;  3MUD C;  4W80 A;  2ZYA A;  3H32 B;  4H44 C;  2N1T A;  3D6Z A;  2QIW A;  2K37 A;  5EFW B;  1FU1 A;  1NOH A;  1YI2 P;  4PJ0 E;  1R5L A;  1EDL A;  5AW2 B;  1T8Z A;  2PAJ A;  1H0T A;  1GTW A;  1KYO I;  1S2E A;  5KJ7 A;  1YJW P;  4EIJ A;  3PRJ A;  3SWF A;  4PV1 C;  3CXH E;  2B88 A;  1BCC J;  2OYH B;  2Z4E A;  1S5L E;  4ZMD A;  1NTM E;  1RF1 A;  3HUS A;  1PGQ A;  4HJG H;  3MIW A;  1VDF A;  3NTN A;  2IBZ I;  3FWL A;  3M9H A;  3II6 A;  1DD4 A;  5KLI B;  1PGP A;  4W7Y A;  1J1E B;  2P2U A;  3OJA B;  4DOJ A;  4D6T G;  3I55 P;  2E42 A;  3P32 A;  1M1J B;  1IFD A;  1JY3 N;  3BCC J;  1JEK A;  1S5L X;  3V2R A;  1FOS E;  1N73 A;  3KYQ A;  1SQP G;  2FFD A;  1T3U A;  2XZR A;  5KTB A;  2CK3 H;  1NTK K;  1IFN A;  1SQX D;  4DZO A;  3HE4 B;  1KC8 Q;  2H43 A;  3TGU E;  3GHG A;  5TIS E;  1LTT C;  1P84 E;  1KB9 D;  1NTK J;  4L73 A;  3GF7 A;  5E79 E;  3Q1M A;  1ZRT E;  2V7Q H;  1ZN5 A;  3Q2Y A;  5KKZ B;  1W5C E;  1ZW0 A;  1K05 A;  1KQF B;  2C9N Y;  1W2E A;  1UII A;  1VL2 A;  3B5N A;  2GM4 A;  3HTK A;  3A0B E;  1NU1 G;  1MFT A;  1LTJ C;  5KLV G;  1KQG B;  1SQQ D;  1VQP P;  2BEQ D;  1RQV A;  1HJB A;  3L70 D;  1EZV I;  2YMK A;  1N7S A;  1GZL A;  2YMY A;  1HBW A;  3L72 J;  3CC7 P;  1KB9 H;  5APY A;  2FYN C;  1OFC X;  1OWA A;  2A06 E;  1SQV K;  2B87 B;  4K35 A;  2C0X A;  3D70 A;  1IFI A;  4PV1 B;  1FC2 C;  3FXE A;  3B8E B;  2FBW C;  1FZA A;  4C7R A;  2Q5U A;  1SQV J;  3VYI A;  2NRG A;  3WU2 H;  1RY3 A;  2QJK C;  4UB8 H;  2NPS A;  1HTL C;  2C0W A;  3RK2 D;  2A45 I;  4H13 D;  4I2L C;  2Q1K A;  3Q3D A;  5APV A;  3JC2 2;  2P58 A;  2D2C C;  2RN0 A;  4WBA A;  1U7M A;  3U1A A;  1M56 D;  3CCU P;  2KOG A;  2WTY A;  3AE3 C;  1VQ8 P;  3CMA P;  1VQ4 P;  2WSE J;  3H1I G;  1Q81 Q;  1JMM A;  2NZ2 A;  3A0H H;  3D6Y A;  3EQ2 A;  5AW5 B;  4U3F J;  1L0L D;  3KPE A;  4PJ0 H;  1KOR A;  5CCG A;  2AXC A;  1G2C A;  1AV1 A;  3HD7 C;  1VQL P;  1FDM A;  4C7N A;  3TGU D;  1NGM B;  1Q2N A;  1ZXG A;  2E76 C;  3CXH H;  1FZC C;  4Y99 C;  1S5L H;  1PFI A;  4IFM A;  1BGY J;  4IFF A;  1OW6 A;  1NU1 E;  1SQB K;  4JYC A;  2VRS A;  1EQ7 A;  4MN4 C;  3U1C A;  1K04 A;  2ITA A;  1FBM A;  1KYO E;  3I56 P;  1BE3 J;  1ZP0 C;  4GDO A;  1LTJ B;  1SQB J;  4OGQ D;  3NXS A;  3V2Q A;  1NAF A;  2J59 M;  3H25 A;  1X22 A;  2KI7 B;  4GIF A;  2KZJ A;  2P10 A;  1L4A A;  1ZME C;  1AJY A;  3CCJ P;  4DJG A;  2IBZ E;  4Z1M H;  1KIL C;  2FYN B;  4WVZ A;  3CLQ A;  1XTG B;  2KIK A;  4LLH A;  3GF3 A;  3V2P A;  4BRY A;  4H13 C;  3MHV A;  5TIS H;  1X9V A;  1KMI Z;  1Q82 Q;  2JP3 A;  1SQX G;  4YXW H;  1P84 H;  3O8Z A;  1JUN A;  2A06 D;  4PD4 D;  3G71 P;  2QJK B;  1D7M A;  2IDB A;  3L75 J;  1PPJ G;  3QH9 A;  3M91 A;  4GOD A;  1HJ0 A;  3EWK A;  2ZXE B;  1BSH A;  1USE A;  1N86 A;  3P8M C;  2ZAE B;  2RH0 A;  3A0B H;  3H1I E;  1YYC A;  1QLE D;  3MP7 B;  3RK3 E;  3L72 D;  2QJY C;  3AEG C;  2KUB A;  2B89 A;  1GL2 A;  2V4H A;  1J2J B;  3AE4 C;  2FYU D;  1SQQ G;  1YTZ I;  3H1J D;  1M1K Q;  2AEF A;  2JDI H;  2WPR A;  2Q7C A;  4KT0 J;  4UB6 E;  2Q9I A;  1Y9B A;  2CPS A;  2V7Q J;  1HGZ A;  1LTB C;  1SFC C;  1Y47 A;  1WRG A;  2W6A A;  1WT6 A;  1JTH B;  3MZW B;  2XNX A;  2ZYD A;  3HD7 B;  1SQV D;  4N78 D;  3CME P;  1VQK P;  4I7Z C;  1HH0 A;  4OGQ C;  2E76 B;  1FZC B;  1URQ C;  3AE7 C;  2JWD A;  2GUS A;  1H89 A;  2W6J H;  4H44 D;  1NTZ K;  5AVQ B;  5APT A;  2QM7 A;  1G1J A;  5APX A;  3RL0 C;  5C39 A;  3WMM 0;  5GTI E;  4IL6 E;  2KB7 P;  1NTZ J;  5CJ4 A;  1FZG A;  1KYO D;  1DD3 A;  2KSJ A;  4H0L C;  2M5A B;  2Y9Y A;  3ABV C;  3L73 J;  1J1D C;  1KIL B;  1L0N K;  4B86 A;  1SQX E;  1LGH B;  3RK2 B;  2GUV A;  3F89 A;  4H13 B;  3AED C;  4IL6 X;  1OW8 A;  1L0L G;  1LP1 B;  1L0N J;  3NMD A;  2HPC B;  3BRT B;  3C1L A;  1JNM A;  1JCD A;  2P67 A;  1JY2 P;  1FZF A;  1RE3 A;  4NPE A;  3TGU G;  1VQ5 P;  3VP9 A;  1JCC A;  1BE3 D;  1YHQ P;  3H1H J;  4TT3 H;  1S9K D;  2YKP A;  1KYO H;  1NVO A;  1SQQ E;  5B66 E;  4XFJ A;  2QJY B;  1VQO P;  2QM8 A;  2I8D A;  3L70 E;  3AE5 C;  1LTJ A;  2WPS A;  2JJL A;  1LT9 C;  3OA7 A;  1IC2 A;  2KS1 B;  2O1J A;  3HE5 A;  1NTM K;  2JWA A;  3C9I A;  3CX5 D;  1SFC B;  4ZKP A;  2ZT9 C;  1JMB A;  2CPB A;  1EDJ A;  1NTM J;  2G8Y A;  4JQ0 D;  1AVO A;  4I7Z B;  1R8E A;  2AEJ A;  1OXZ A;  4OGQ B;  3L75 D;  3H1K D;  1URQ B;  1N2D C;  2A06 G;  4ASW A;  4EOT A;  1FAV A;  1T3J A;  1MV8 A;  1EZV D;  3QWO C;  3T97 B;  4N6J A;  3FGA D;  3G9R A;  2K9J A;  2N1T D;  2HYN A;  3BAS A;  2ZYG A;  4H0L B;  2K88 A;  1PP9 J;  4IOI H;  2QG4 A;  3B71 A;  2AEM A;  3H1L J;  3CWB D;  3L72 G;  1L0L E;  1RQU A;  1RE4 C;  3M0D C;  3R2P A;  2FYU G;  2KXP B;  4UB6 H;  3H1J G;  1LWU A;  3VOP A;  3VTP C;  2D2C D;  4JYB A;  4N3Y B;  4I1L A;  2KP8 A;  2BCC D;  1OVV A;  1VF5 C;  5K5G B;  1SQV G;  4L76 A;  1CI6 A;  2OQQ A;  3O6Q A;  2H7H A;  3F5H A;  5CMZ A;  5KAF H;  2IYO A;  1QVG O;  3WUT A;  2QRX A;  3CX5 I;  1GMJ A;  1GK4 A;  3W67 A;  1FZB A;  5GTI H;  4IL6 H;  5BVZ A;  2FXP A;  1KQS O;  3HD7 D;  4KHX A;  3L73 D;  4WY4 C;  1YBK A;  2E76 D;  1M8O B;  1JM0 A;  1LT9 B;  4DCK A;  3Q5R A;  3WUV A;  1ZR4 A;  2OYI A;  3AEA C;  4H44 B;  5M1B A;  1PL5 A;  2ZT9 B;  3KDP B;  1MZ9 A;  3AEC C;  3I5C A;  1KFM A;  2WSC H;  3M0A A;  3RGU A;  4D6T J;  2DW3 A;  1GDT A;  4PD4 E;  1HUC A;  2YIU C;  1SQP K;  2IBZ G;  2Z5H A;  4GOF A;  2N1T C;  3AEB C;  3GMA A;  2JKV A;  1FDI A;  3AE8 C;  1SQP J;  1KIL D;  1X8Y A;  4AUW A;  3MGN A;  1NYH A;  5KJ7 C;  4RO0 A;  1YIJ P;  1NH4 A;  3L36 A;  3S1K A;  1BE3 G;  1QL2 A;  2JEE A;  5CBO A;  3L71 D;  2SPZ A;  2WT7 A;  3L72 E;  5B66 H;  4NPF X;  1RF1 C;  3HUS C;  2FYU E;  1QVF O;  2FKW B;  2WSF H;  3H1J E;  2LXB A;  3TNU A;  3GG2 A;  5H2F E;  1NU1 K;  1SS1 A;  2J5U A;  5GTH E;  2Q3I A;  5KLV K;  5DJU B;  1SQV E;  4N78 E;  1M90 Q;  2WWW A;  3RBZ A;  1EXJ A;  1NU1 J;  1H88 A;  2LXC B;  1N73 C;  1QEX A;  5TJH A;  2FFD C;  1AQ5 A;  3H32 A;  5KLV J;  3A5T A;  2R44 A;  3A7O A;  3VMY A;  1BCC D;  2OYO A;  4QMA A;  1Q90 D;  2R5B A;  1AFO A;  2QSI A;  2LR2 A;  3H1K G;  2IYP A;  1VQN P;  3GHG C;  1RF0 A;  3AE2 C;  5AW7 B;  3CPW O;  1VQ9 P;  1SFC D;  3CCR P;  1EZV G;  1E5W A;  1PP9 D;  1CZQ A;  2OYH A;  4WY4 B;  3V6I A;  4GKG A;  1BDC A;  2W27 A;  4RES B;  4R4L A;  2YO2 A;  3BCC D;  1JY3 P;  5AVY B;  1PGO A;  3CL3 D;  3CCV P;  1URQ D;  3B5N C;  1HWT C;  2KNC B;  3PJS K;  5AW9 B;  3JSV C;  3CI9 A;  4JF7 A;  2Y9Z A;  2HOD B;  1JO5 A;  3CWB G;  3VMX A;  1QX8 A;  3RL0 D;  1M1J A;  1NTK D;  2WPV B;  2A45 G;  1PZQ A;  2YIU B;  1N7S C;  4AQR D;  2N1T B;  2M0B A;  3LID A;  4H0L D;  2IZ0 A;  3EFF K;  5CCH A;  3L74 J;  4NPD A;  3ITK A;  1JOC A;  1BE3 E;  2BCC G;  2WIT A;  3HE4 A;  5E79 H;  1SQB E;  5L8R J;  1S9K E;  1L4A D;  3P8C E;  1U7J A;  1EXI A;  3MTU E;  2D2C B;  3OAK A;  2IFN A;  3TDK A;  2UWJ E;  3HUS B;  2NPS C;  2Y0E A;  1EC5 A;  3L73 G;  2R3S A;  4EYY Q;  5APU A;  1WMK A;  1YIT P;  1YQ4 C;  1LJ2 A;  3CX5 E;  3NFQ A;  3USS A;  2HLO A;  4D6T D;  3M9Q A;  5KAI E;  1N8R Q;  3L70 G;  2YKQ A;  3IAO A;  1N73 B;  3MUD A;  2E43 A;  3L75 E;  5BU5 A;  3H1K E;  3CCL P;  1P84 I;  3K5B A;  2JO1 A;  4PD4 H;  1SQP D;  2O3J A;  5AVW B;  3FX0 A;  1E79 H;  2O01 H;  1EZV E;  4HYT B;  5CCG C;  4Y99 B;  2B87 A;  4KJM A;  1SQX K;  3PH0 A;  1GL2 D;  2QVA A;  2PGD A;  1Z56 A;  2ZT9 D;  1KTM A;  1LTA C;  3B4S A;  4WB4 A;  5AW0 B;  1XTC C;  1SQX J;  3W68 A;  2FY8 A;  3KQG A;  4K3A A;  4YTP C;  2KYV A;  1K9M Q;  3L71 G;  3CWB E;  1BSN A;  3HTK B;  1GK6 A;  2QEX P;  2WSS H;  4U3F D;  5CBN A;  2K1A A;  5H2F H;  1N7L A;  3Q5S A;  5GTH H;  4EI2 A;  1W2B O;  1M57 D;  5KLV D;  3CD6 P;  1YJ9 P;  1L4A C;  1N7S B;  3GW6 A;  2BCC E;  1SQQ K;  2WVR A;  4JPZ B;  2XDJ A;  3R4Y A;  1MUU A;  1BGY D;  2PRR A;  2O01 N;  2J58 A;  1SQQ J;  1BCC G;  2I1K A;  1TU3 F;  5AW6 B;  2KSE A;  2YXQ B;  3OW2 O;  1KN7 A;  1MKM A;  3M06 A;  1FS0 E;  1SQB D;  3V5B A;  3L73 E;  4WWI A;  1LT1 A;  2NPS B;  3P8C D;  3AEF C;  3SWY A;  4ZKU A;  1PP9 G;  1VF5 D;  1FDO A;  2PFX A;  4RJT A;  3BCC G;  1RH5 B;  1RHZ B;  2W90 A;  2OAR A;  3CC2 P;  1PGJ A;  1JY2 O;  2MKV A;  1NKN A;  1S1C X;  2E5T A;  1QGK B;  2QJP C;  1GL2 C;  2KK7 A;  2Q3E A;  1KZU B;  2R3C A;  3L74 D;  5AW3 B;  2WZ7 A;  4WY4 D;  1NKZ B;  4BXL A;  1NTK G;  1NHL A;  1S3J A;  2IFM A;  4L75 A;  1OX3 A;  1JB0 J;  1PIX A;  2YXR B;  1CW5 A;  3KZI E;  1K73 Q;  1KIL E;  1G2C B;  2WPQ A;  1L0L K;  2L5G B;  1CSB A;  3KHU A;  1YTZ T;  4C7N B;  5APQ A;  3L71 E;  2E75 C;  1L0L J;  3RL0 B;  2OTJ P;  3IN6 A;  3CCM P;  2R5D A;  3SFE C;  4ASV A;  3TGU J;  3KXD A;  1J1D B;  3CX5 H;  5KJ7 D;  3PHL A;  5AVX B;  1GU5 A;  5KAI H;  2XU6 A;  1T2K D;  2W8Z A;  3TSI A;  1L4A B;  1G1I A;  2E74 D;  1FOS F;  1VQM P;  3HRN A;  3MD0 A;  2H89 C;  3E1R A;  1KD1 Q;  5CJ0 A;  1BCC E;  5AW8 B;  1OIP A;  2P7J A;  1AA0 A;  4BRY B;  1KFN A;  1OMI A;  2AXT E;  3RL0 g;  4XA4 A;  3JCU E;  1DX7 A;  1JTH A;  3HD7 A;  3SWK A;  1GD2 E;  1M7L A;  1PP9 E;  1GW3 A;  2ZVO B;  2LKM A;  4W7Z A;  1NTZ D;  3LW5 H;  3C8V A;  1FZC A;  1OW7 A;  3CCE P;  3H1L E;  1RE3 C;  3BCC E;  3PP5 A;  1YJN P;  1PPJ D;  1FJK A;  3S9O A;  3VMZ A;  2HFE D;  4M3L A;  3RK3 C;  2A45 H;  3SSU A;  1LTG C;  2Q6Q A;  4U3F G;  2O01 J;  2IZ1 A;  5B5E E;  1NTK E;  1L0N D;  2QJP B;  1GL2 B;  1DEB A;  4LC1 A;  3AE9 C;  4LGD E;  1HF9 A;  2M5A A;  2KLU A;  2ZVN B;  5BU8 B;  1KIL A;  3WUU A;  3B5N D;  2FYU K;  1KV4 A;  3IR9 A;  5AVZ B;  1X79 B;  1X0T A;  1IO4 A;  1LP1 A;  3H1H D;  4C46 A;  3GLM A;  3TF5 A;  1BGY G;  2N9Y B;  2FYU J;  2HPC A;  3H1J J;  2E75 B;  1NAY A;  1QL1 A;  2QE7 H;  3N7N A;  1IFM A;  3EFG A;  1SQB G;  1N7S D;  1OVU A;  1T2K C;  2E74 C;  1MFZ A;  5AW1 B;  2MJZ A;  1SVF A;  2RMZ A;  3A3Y B;  1L2P A;  1U57 A;  3U59 A;  2M3B A;  5AVS B;  3CXH D;  4D6T E;  2OTL P;  3SFD C;  4R4M A;  1NTM D;  4GOE A;  5DJT B;  2W83 C;  3L37 A;  2HR3 A;  2G3A A;  2I1J A;  1HVV A;  2BAS A;  1KB9 I;  3IF4 A;  3CCQ P;  1ZR2 A;  2NPS D;  1SQP E;  3BVH A;  2KS1 A;  3L74 G;  3BAT A;  1AQT A;  2K3R A;  1VF5 B;  1SFC A;  1LWU C;  3KZI H;  1IK9 A; 
#chains in the Genus database with same CATH homology
 2HLO A;  1KQL A;  3M9Q A;  2YKQ A;  1N73 B;  3MUD A;  2E43 A;  1ZN5 A;  2QM8 A;  5BU5 A;  1URQ A;  2W6B A;  1LTJ A;  4GT1 A;  2C9N Y;  1W2E A;  2WPS A;  2JJL A;  3N4X A;  1LT9 C;  3B5N A;  5AVW B;  2GM4 A;  1SLQ A;  3OA7 A;  1IC2 A;  2O1J A;  3HE5 A;  1NTM K;  2O01 H;  5APS A;  3C9I A;  1ZV8 A;  3HTK A;  4HYT B;  3T97 A;  5CCG C;  4Y99 B;  3H6P A;  1SFC B;  3TYY A;  3IFM A;  4ZKP A;  2XKM A;  1LTJ C;  1SQX K;  5CCG D;  3RK3 B;  3E1I A;  3L35 A;  1GL2 D;  2CPB A;  2Z5I A;  1Z56 A;  1JY2 N;  5AVR B;  1LTA C;  3BRV B;  1OXZ A;  5AVU B;  5AW0 B;  4WB4 A;  1XTC C;  1IFJ A;  1HJB A;  1URQ B;  3LIE A;  1N7S A;  3KQG A;  1GZL A;  2YMY A;  2KYV A;  1HBW A;  3V4Q A;  1N2D C;  4EOT A;  1FAV A;  3VP8 A;  1T3J A;  3HE5 B;  5APY A;  2FXM A;  1OWA A;  1MV8 A;  3HTK B;  1GK6 A;  2P1J A;  2OYI C;  3UIA A;  2YKO A;  4N6J A;  1SQV K;  2C0X A;  2H8P D;  1N7L A;  1IFI A;  3B8E B;  2N1T D;  2HYN A;  1JY3 O;  3V4W A;  1FZA A;  4C7R A;  3G3Z A;  2Q5U A;  3VYI A;  3BAS A;  3RK2 C;  1L4A C;  1RY3 A;  1N7S B;  1SQQ K;  2NPS A;  1HTL C;  2C0W A;  3RK2 D;  2A45 I;  2XDJ A;  4I2L C;  2N9B A;  2PP6 A;  5APV A;  1MUU A;  2FYZ A;  1RE4 C;  3M0D C;  3R2P A;  2C9L Y;  2J58 A;  5APW A;  1RF1 B;  2I1K A;  1LWU A;  4WBA A;  4I6M C;  3U1A A;  5AW6 B;  2HG5 D;  2KOG A;  3VOP A;  3VTP C;  4JYB A;  2WTY A;  1GU4 A;  2POH A;  3M06 A;  4N3Y B;  1ZLL A;  4I1L A;  3V5B A;  5CCH D;  2KP8 A;  1JMM A;  2NPS B;  3EQ2 A;  3V2N A;  1NWQ A;  1CI6 A;  3P8C D;  2H7H A;  5AW5 B;  3SWY A;  4ZKU A;  4XE5 B;  3P7K A;  1LT9 A;  5CMZ A;  5AVT B;  3KPE A;  5CCG A;  1GW4 A;  2FFD B;  1G2C A;  1LWU B;  1HGV A;  2R32 A;  4O9B A;  2OAR A;  1GK4 A;  1LTS C;  1FZB A;  3HD7 C;  1JY2 O;  1FDM A;  5BVZ A;  1NKN A;  4C7N A;  5AW4 B;  3GHG B;  3HD7 D;  4KHX A;  4WY4 C;  3TK1 A;  1GL2 C;  1FZC C;  1KZU B;  4Y99 C;  2R3C A;  1CI6 B;  5AW3 B;  4OH8 B;  2WZ7 A;  1PFI A;  4IFM A;  4IFF A;  4WY4 D;  1SQB K;  1NKZ B;  1LT9 B;  1DH3 A;  4JYC A;  1NHL A;  2IFM A;  2VRS A;  1EQ7 A;  1CW5 A;  3U1C A;  1ZR4 A;  5AVV B;  1FBM A;  2OYI A;  1RF0 C;  1G2C B;  2WPQ A;  3KDP B;  1LTJ B;  1MZ9 A;  1L0L K;  3NXS A;  3V2Q A;  5CHX A;  1NAF A;  2J59 M;  3B5N B;  3I5C A;  2L5G B;  1CSB A;  1FZE A;  1YTZ T;  4C7N B;  1KFM A;  2WSC H;  5APQ A;  3M0A A;  4GIF A;  1IJD B;  2OYH C;  1GDT A;  1HUC A;  1L4A A;  1SQP K;  2Z5H A;  3RL0 B;  2N1T C;  1KIL C;  2R5D A;  3CLQ A;  1XTG B;  4LLH A;  2OYI B;  1KIL D;  1RE4 A;  3M0D A;  1X8Y A;  3V2P A;  4AUW A;  3MGN A;  1J1E C;  5KJ7 C;  1SP4 A;  1X9V A;  1NH4 A;  3L36 A;  1J1D B;  2YNY A;  3O8Z A;  1QL2 A;  1JUN A;  5KJ7 D;  1M1J C;  2JEE A;  2M8R A;  1NO4 A;  5AVX B;  1GU5 A;  2ZFC A;  2WT7 A;  2XU6 A;  1T2K D;  3TSI A;  1L4A B;  1G1I A;  1FOS F;  3HRN A;  1RF1 C;  2IX7 C;  3MD0 A;  3HUS C;  2FKW B;  5CJ0 A;  3M91 A;  2WSF H;  5AW8 B;  2P7J A;  5CCH C;  2O1K A;  2XV5 A;  3TNU A;  2KLV A;  2WSE H;  2ZXE B;  1NU1 K;  1KFN A;  4HH2 A;  1A02 J;  1N86 A;  3P8M C;  4AYC A;  4XA4 A;  1YYC A;  2Q3I A;  1DX7 A;  5KLV K;  1JTH A;  3HD7 A;  4N78 E;  1GD2 E;  2WWW A;  1M7L A;  3VN0 A;  1H88 A;  2WT7 B;  2IPP A;  1GW3 A;  3LW5 H;  2LKM A;  4W7Z A;  1N73 C;  4WY4 A;  1GL2 A;  1FZC A;  1J2J B;  2FFD C;  1FJP A;  1AQ5 A;  3H32 A;  3A7O A;  3A5T A;  1RE3 C;  2YO3 A;  3PP5 A;  3VMY A;  1YTZ I;  2R5B A;  1AFO A;  3TNU B;  2WPR A;  2Q7C A;  1FJK A;  3GHG C;  1A02 F;  3L4F A;  2Q9I A;  2CPS A;  1H8A A;  1RF0 A;  1HGZ A;  1LTB C;  1SFC C;  2HOD A;  3M9B A;  3VMZ A;  1WRG A;  2HFE D;  2W6A A;  4M3L A;  1WT6 A;  1JTH B;  5AW7 B;  1LTI C;  2XNX A;  3A2A A;  1SFC D;  3HD7 B;  4N78 D;  2A45 H;  3RK3 C;  1E5W A;  1LTG C;  1HH0 A;  3RK3 D;  1VPC A;  4IFD K;  1CZQ A;  2OYH A;  4WY4 B;  1GL2 B;  1DEB A;  1FZC B;  4LC1 A;  4GKG A;  2W27 A;  4W80 A;  4RES B;  4LGD E;  1URQ C;  2YO2 A;  3H32 B;  2N1T A;  2GUS A;  1H89 A;  1JY3 P;  5AVY B;  1FU1 A;  3CL3 D;  5BU8 B;  1NOH A;  1URQ D;  3B5N C;  1KIL A;  1NTZ K;  1HWT C;  5AVQ B;  5AW9 B;  5APT A;  3B5N D;  2FYU K;  2QM7 A;  5AW2 B;  3CI9 A;  1T8Z A;  2PAJ A;  4JF7 A;  1G1J A;  2HOD B;  5APX A;  1GTW A;  3IR9 A;  5AVZ B;  5KJ7 A;  1X79 B;  3RL0 C;  1JO5 A;  4EIJ A;  3WMM 0;  3VMX A;  1IO4 A;  2KB7 P;  4C46 A;  3SWF A;  5CJ4 A;  3RL0 D;  1M1J A;  2HPC A;  1FZG A;  2A45 G;  2OYH B;  2KSJ A;  2Z4E A;  1QL1 A;  3N7N A;  1N7S C;  4AQR D;  2N1T B;  1IFM A;  1RF1 A;  3HUS A;  3EFG A;  3LID A;  1J1D C;  1N7S D;  1KIL B;  3MIW A;  5CCH A;  1T2K C;  1VDF A;  1L0N K;  3NTN A;  4B86 A;  1MFZ A;  3M9H A;  1LGH B;  1JOC A;  3II6 A;  2WIT A;  3HE4 A;  3RK2 B;  2GUV A;  5AW1 B;  2MJZ A;  4W7Y A;  1J1E B;  2P2U A;  3OJA B;  1SVF A;  4DOJ A;  1S9K E;  3A3Y B;  2E42 A;  3U59 A;  2M3B A;  3P32 A;  3NMD A;  1L4A D;  3P8C E;  5AVS B;  1M1J B;  1IFD A;  2HPC B;  1JY3 N;  3BRT B;  1JNM A;  3V2R A;  1FOS E;  1JCD A;  1N73 A;  3MTU E;  3KYQ A;  2P67 A;  3L37 A;  3OAK A;  2IFN A;  2FFD A;  3HUS B;  1JY2 P;  1FZF A;  2NPS C;  1T3U A;  2XZR A;  1RE3 A;  2I1J A;  1HVV A;  5KTB A;  2BAS A;  1NTK K;  1ZR2 A;  2NPS D;  3VP9 A;  1JCC A;  1IFN A;  3BVH A;  4DZO A;  3HE4 B;  5APU A;  2H43 A;  3GHG A;  1LTT C;  3BAT A;  1S9K D;  1SFC A;  2YKP A;  1LWU C;  3NFQ A;  1IK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...