1JMMA

Crystal structure of the v-region of streptococcus mutans antigen i/ii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
377
structure length
377
Chain Sequence
QKDLADYPVKLKAYEDEQASIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFLKASAVDDAFSKSTSKAKYVQKILQLDDLDITNLEQSNDVASSMELYGNFGDKAGWSTTVSNNSQVKWGSVLLERGQSATATYTNLQNSYYNGKKISKIVYKYTVDPKSKFQGQKVWLGIFTDPTLGVFASAYTGQVEKNTSIFIKNEFTFYDEDGKPINFDNALLSVASLNREHNSIEMAKDYSGKFVKISGSSIGEKNGMIYATDTLNFKQGEGGSRWTMYKNSQAGSGWDSSDAPNSWYGAGAIKMSGPNNHVTVGATSATNVMPVSDMPVVPGKDNTDGKKPNIWYSLNGKIRAVNVPKVTKEKPTPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords protein I/II V-region
publication title Crystal Structure of the V-region of Streptococcus mutans Antigen I/II at 2.4 a Resolution Suggests a Sugar Preformed Binding Site
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Immune system, membrane protein
total genus 107
structure length 377
sequence length 377
ec nomenclature
pdb deposition date 2001-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08363 GbpC Glucan-binding protein C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jmmA01
2.60.530.10 Mainly Beta Sandwich Major cell-surface adhesin PAc Major cell-surface adhesin PAc 1jmmA02
1DX7A 2FKWB 1IJDB 1NKZB 1KZUB 1WRGA 1JO5A 1LGHB 3WMM0 1JMMA
chains in the Genus database with same CATH superfamily
2A06E 2A45G 2WZ7A 1KN7A 1LP1B 2Q6QA 3QH9A 4IL6E 1ZRTD 1NTKG 3L74E 1CI6A 2FYUJ 2QE7H 4Z1MH 5APXA 3R4YA 4JPZB 3TDKA 1SQPE 3EFFK 2E74B 3EWKA 1X0TA 4OGQC 3BATA 1NTMG 3IFMA 1BE3J 3MHVA 1P84D 4JYBA 5CBNA 5APWA 1E79H 1SQXG 1SVFA 4IFDK 3P8CD 1OW8A 5CMZA 2JR8A 1KB9D 5KLVG 1OVRA 3PTZA 2KB7P 2XNDH 1L4AB 1ZW0A 1FZAA 4I7ZC 2J58A 4IL6X 2N1TA 3M9QA 1FDIA 3HE5A 2QJKB 3VYIA 3RL0g 4BXLA 1JO5A 2E74C 3HUSA 3P7KA 1JMMA 1T2KC 3RL0B 5AW1B 2PFXA 3CWBG 3W67A 3D6ZA 3L37A 2WSEH 2P58A 1NO4A 4ZMDA 1FAVA 3MTUE 1Q7YQ 2ZT9D 1GD2E 3GW6A 4RESB 1AA0A 2WPVB 1EQ7A 4IL6H 1S1CX 2SPZA 2NPSD 1Z56A 3G9RA 1KZUB 4LC1A 2QJKC 3SWYA 1PGOA 3IR9A 2FYUD 1USDA 3RL0C 1GU5A 1NTKE 4C7NB 1BGYG 1LJ2A 4GDOA 5APTA 2IZ0A 1BCCE 2IBZD 3H1KE 2KSJA 3BCCD 1N73C 1BE3D 5H2FH 2AEMA 3KZIH 4HKZH 3B71A 3PH0A 1FJKA 1SQXE 1NAYA 3V6IA 4GODA 1NU1J 5KLVE 5KAFH 1Q2NA 1URQB 1UIXA 2BCCJ 3GHGB 1JM0A 4H44D 4DT0A 1KQGB 2NPSB 3CCEP 3AE1C 1W5CE 2QVAA 1Y47A 3PRJA 1QEXA 2YNYA 4PD4D 4JBZA 1PP9J 3JSVC 1GU4A 1J1DC 5DJTB 1R8EA 1VQ6P 2H8PD 1G1IA 1DX7A 5CCHC 3CWBE 2IFNA 3MGNA 3RGUA 1IFPA 2MJZA 5GTIE 2ZXXA 1AVOA 3Q5PA 1SQBD 1URQC 3GHGC 3IN6A 4KJMA 2FYZA 2NPSC 5BU5A 1FZCC 1G2CA 3N4XA 2N1TD 5KKZC 4UB8E 1DEEG 3BRTB 1T8ZA 4H44B 3WUTA 1JB0J 1EZVI 3A0BH 1H8AA 2C0WA 1K9MQ 2KYVA 1SP4A 3CMAP 4DCKA 3PLNA 4QMAA 2J59M 2PAJA 1H88A 1HH0A 1IFNA 1KB9I 2V4HA 4EOTA 3L73J 3SFEC 4PV1B 5L8RJ 2E75D 4TLFA 3FWNA 1E5WA 2YO3A 2FYUG 3V2RA 1LTJB 3F5HA 5TJHA 1OVUA 4R4MA 2BCCD 1ZRTE 3AE6C 5C39A 3TNUB 1PPJE 2HPCB 1FE6A 2FFDA 2IBZG 1W2EA 2H89C 3VP8A 3C8VA 1IFIA 1BE3G 3KYQA 2VRSA 2QIWA 1EZVE 2R44A 3VMYA 4N78D 5GTIH 2KIKA 1IFDA 1QX8A 4I2LC 2JDIH 1KQSO 3WUVA 4PV1C 1L0LD 1GDTA 3P8CE 4PJ0H 1SQBK 1KB9E 1LTJC 4ZNCA 2GM4A 2H7HA 2JO1A 2MKVA 1N73A 4DJGA 3I5CA 1JNMA 1EC5A 3F89A 3AE7C 3L35A 3FXDA 3L72J 4UB8H 2E75B 2XV5A 2OYHA 4U3FJ 2M3BA 3H32B 1NTMD 1QGKB 3RK2C 1H0TA 2WT7B 2UWJE 1YQ4C 1ZR4A 2RN0A 4RJTA 3L71J 1N86A 2E5TA 1KMIZ 1AV1A 2YXRB 4W7YA 2L91A 1J1EB 3L73D 1IO4A 1OWAA 1NAFA 4WY4C 5AW3B 2ZVNB 2AXCA 4OGQD 5CCHA 3CX5D 1FJPA 1S5LE 1YQ3C 2HG5D 3CCJP 1DD3A 2O1JA 2G3AA 1VQPP 4W80A 1H89A 1Q81Q 3H1LE 1URQA 4PD4I 1YTZT 3GHGA 1KILE 5KJ7C 1AFOA 2OARA 4H0LD 1DIPA 2NPSA 2QJPB 4LLHA 3IAOA 3BCCE 3IF4A 5M1BA 2I1JA 1KYOD 4WWIA 1FZCA 3S9OA 1L0LK 1VPCA 2LKMA 1FOSE 1KB9H 3ITKA 1YJ9P 5AVYB 5B66E 3ABVC 4EIJA 4ASVA 1A02J 2O01H 1NU1G 4BRYB 1T2KD 1IFMA 3CMEP 2WMMA 1NKNA 2BCCG 1IK7A 2RKLA 2WQYC 1EDLA 4B86A 4WVZA 2KOGA 3HE4B 1ZP0C 1BGYD 3L72D 4JF7A 1S5LX 2HODB 1HWTC 5CJ0A 2IPPA 1NTMK 1GK4A 1L0ND 3VMAA 2QJPC 1PP9G 3VTPC 1SQXK 3L71D 2Z5HA 4PD4E 3GF7A 4XA4A 3CXHD 1LWUA 2WSCH 1M1KQ 3CC7P 3P32A 1SQQJ 1PGPA 5EFWB 1G2CB 1NJIQ 1MZ9A 4GT1A 4H0LB 4H13B 3AEEC 3RL0D 1GMJA 3LW5H 1MKMA 3O8ZA 4KT0J 1S5LH 1SQBE 3VOPA 2C0XA 1YJWP 4I7ZB 1OW6A 3L4FA 1NOHA 3H1JJ 3WUUA 3CPWO 1YHQP 1S3JA 3U1CA 1WMKA 1SQVJ 5GTHH 3K5BA 3L70E 1LTJA 3AEFC 1LNQA 2KZIA 2OYIB 5CCGC 1KC8Q 3TNUA 2HPCA 5E79E 3L36A 4N3YB 1OFCX 2Q7CA 1QL2A 5BU8B 4I6MC 4H0LC 2K1AA 4ASWA 4H13C 2FFDB 2H88C 1YI2P 2CPSA 2XNXA 3L73G 2A45I 2Y9YA 1KQFB 2M5AA 2Q5UA 1K04A 1QLED 3FGAD 1FOSF 1K05A 1OVVA 5CCHD 1L0NK 1VQ4P 1JCCA 2OYIC 2OGUA 4PD4H 1RE4A 2JKVA 4C46A 4NPEA 4WY4A 4W7ZA 1N73B 2QM7A 3M0DC 1K8AQ 2WSEJ 2FFDC 4ZKPA 1URQD 4CPGA 1VF5B 1SQQD 1TU3F 3H32A 2OYHB 2WT7A 4N78E 3JC22 1L0LE 1R5LA 2V7QH 1H0TB 3L74J 5KJ7A 1M90Q 2WWWA 3M91A 1LT9B 1RF1B 3E1RA 3L72G 2AEFA 3CX5I 2CPBA 4U3FG 2ZYDA 1D7MA 1L0NG 3CI9A 1SQVD 2WPQA 1XTGB 5E79H 3L71G 2NRGA 1Q86Q 1NWQA 1NTZJ 1J1DB 1NTME 1VF5C 3HTKB 3D71A 1HBWA 4UB6E 2OYHC 2JJLA 3H25A 3KDPB 3CCVP 2O3JA 1VQ5P 1BSNA 1LT9C 2IFMA 3EQ2A 1X9VA 1RF1C 3D6YA 2O1KA 3L73E 4JYCA 4AQRD 2GA1A 1HVVA 2Q3EA 1FZCB 3OAKA 2RMZA 3CCQP 3AEAC 1LGHB 1LTAC 2WSSH 3CX5E 4BRYA 4L76A 5KKZB 1LTBC 2KXPB 1ZLLA 4PV1D 1KFMA 4YPCA 1KTMA 3HE4A 2OTLP 2LXBA 2HODA 5AW2B 4O9BA 1FS0E 4NPDA 3G4SP 1KYOE 2A06D 2A45H 2FYNB 1OX3A 2K9YA 2NZ2A 2R5BA 1RQUA 1JY2N 1OXZA 2E42A 2FYUK 2ZAEB 3RK3B 2E5YA 3L74D 2M3EA 5CCGA 1LWUB 1X8YA 3RK2D 1GW4A 1G1JA 4YTPC 1GZLA 3H1HJ 1BCCJ 1SQVK 2Q9IA 3CL3D 2W83C 1BGYE 4C7RA 2C9NY 3H1KJ 2KS1B 3H1IJ 1P84I 3D70A 3CD6P 1PFIA 1L0NE 3V2PA 1NTZD 1ZR2A 2KLVA 4HH2A 1LT1A 2GUVA 1VQ7P 2B9BA 1SQQG 4WY4D 2KK7A 2FYNC 3P8MC 4GOEA 1KILC 2IYOA 3L75J 3KPEA 5AW6B 4AYCA 2LXCB 3RK3C 2WPSA 1RE3C 3AE4C 1T3UA 1NU1D 2OYIA 2Y0DA 2Y0EA 1IFJA 1LWUC 3OA7A 4TT3H 3M0DA 1FDMA 4HJGH 2Z4EA 3CX5H 3H1JG 5KJ7D 5KTBA 1FDOA 3R2PA 1ZXGA 4IFMA 5AVRB 1SQVG 4U7JA 2KSEA 1PP9D 1SFCA 2OQQA 2BASA 3RK2B 2YMYA 4DZOA 1JY2P 1NGMB 2WSFH 2R32A 1MUUA 1N8RQ 1L2PA 2FKWB 1P84E 1AVYA 1MFZA 1SLQA 1T3JA 3MIWA 2M5AB 2ZJSE 1BDCA 3TSIA 5BVZA 1GW3A 1ZN5A 2Z5IA 4OVNF 5CHXA 1NVOA 3AE9C 3CCMP 3OW2O 5AVTB 3AE8C 4WY4B 1FU1A 1S9KD 4I1LA 4Y99B 3ZDMA 3CC2P 3TF5A 2KP8A 3SSUA 1FC2C 5APUA 2PRRA 3E1IA 3H1HD 2KLUA 1OIPA 1BCCD 1VDFA 3O6QB 2IBZI 1LT9A 3H1ID 1RF1A 1UIIA 2WPRA 1YYCA 4K35A 1NTZK 3V5BA 1U7MA 2P7JA 1KD1Q 3V2QA 5B5EE 1WT6A 2KZJA 2HR3A 1SS1A 1RE4C 3L75D 2A06G 1DEBA 3A2AA 1NU1K 3B5NC 2IZ1A 3HTKA 3CCSP 3L74G 4AUWA 4Y99C 3NMDA 3VMXA 2BEZF 2FYUE 2K9JB 3TGUJ 5CCGD 2N9BA 5AW0B 3E7KA 3KXDA 3OJAB 1P84H 5AVXB 4A7PA 4H13D 2IBZE 2FXPA 1EXIA 1JOCA 1SQVE 1NTZG 3C1LA 1BE3E 3PP5A 1YTZI 2QEXP 3PHLA 3MZWB 1RF0C 1IZNB 3N7NA 5AVZB 2I1KA 1JEKA 2I8DA 5AW9B 5CBOA 2JP3A 3NFQA 3BVHA 2HFED 1GK6A 2FY8A 3G3ZA 1FZBA 4U3FD 4BWNA 1KILA 1NHLA 3M9BA 1RE3A 3UIAA 1DD4A 1VQ9P 1FBMA 4WBAA 4GOFA 1M57D 2HLOA 1Q90D 2YO2A 5B5EH 3FX0A 1RHZB 1QVGO 2E43A 5AW7B 1SFCD 3A3YB 3LIEA 1A02F 2WSCJ 3W68A 5AW8B 1VQOP 2KS1A 5KAIE 5K5GB 2OTJP 2B87B 1S72P 2WVRA 4EI2A 5AVQB 1MFTA 3LW5J 3MUDC 3VMZA 3HD7C 1W2BO 1KORA 3U1AA 2D2CD 2W6AA 4HB1A 3A0HE 2W6JH 1PPJD 2XU6A 1EDJA 1OW7A 1VF5D 2W6BA 3TGUD 1JY3N 3B8EB 3V4WA 3H1HG 1BCCG 1PGQA 3BASA 3H1LJ 3H1KG 3H1IG 1VQMP 1KFNA 3AEGC 3S4RA 2POHA 1GL2C 2QSIA 2YKPA 4DOJA 3BCCJ 1J2JB 3EFGA 1S2EA 1EZVD 5B66H 2AEJA 1NTZE 3L75G 3LIDA 1IK9A 4D6TJ 5H2FE 4NPFX 1N7SB 3KZIE 3AE2C 1SFCB 1LTTC 3MD0A 1JY2O 1AQTA 1NU1E 2R3SA 4Y28J 1PV3A 1JUNA 1FZEA 2BCCE 4L74A 1GTWA 5AW4B 1PL5A 2KNCB 2W8ZA 5KAFE 1HGVA 1YJNP 3CC4P 2D2CB 3B5NA 1N2DC 4L75A 1BDDA 3II6A 2J5UA 1KQLA 1PP9E 2M8RA 1PIXA 2QRXA 3S1KA 2YKQA 5KAIH 1K73Q 1T6AA 3G6EP 1N7SC 3O6QA 1SFCC 1JY3P 3CCUP 4IFFA 5TISE 1HUCA 1L4AC 2V7QJ 3QWOC 1SQBJ 3A0HH 2FBWC 3TK1A 2B88A 3GLMA 1SQPJ 2AXTE 2G8YA 3H1JD 2P1JA 4N6JA 4M3LA 1BSHA 1EXJA 1VQLP 1S9KE 2OTKE 2D2CC 1RF0A 1U57A 1CZQA 2JWDA 2Q3IA 2FXOA 3L70J 2R3CA 1LTSC 2ZXEB 3H1LD 1KILD 4OWFA 1OZHA 4ZKUA 3H1HE 3RK3D 3AE5C 2K9JA 2JEEA 1HJBA 3H1IE 4LGDE 1KYOI 2QJYB 1XTCC 1X79B 1WRGA 4D6TD 5KLIB 3A0BE 1EDKA 3V4QA 1M7LA 4EDFA 3JCUE 5APQA 2ZFCA 3L75E 3Q5SA 1S4XA 2K88A 2OYOA 1AJYA 4HYTB 3AECC 2QM8A 4WB4A 1PPJG 5DJUB 3GG2A 2ZT9B 1MV8A 3RBZA 3TGUG 2CK3H 1M8OB 1YITP 3T97B 4YXDC 1PZQA 2RH0A 5APYA 1U7JA 3FXEA 1M1JB 2JWAA 3MUDA 2R5DA 3CXHI 3HD7A 2QJYC 3HRNA 1EZVG 5APSA 1SQQK 1HJ0A 3WU2E 5KLIC 1HF9A 3MP7B 2GUSA 3U59A 1KILB 2KUBA 5TISH 2E76D 2XKMA 1USEA 1L0LJ 1YBKA 2O01N 1QL1A 2IX7C 2AXTH 5CJ4A 1GL2A 1NTKJ 2ZT9C 2DW3A 1NKZB 4PJ0E 1SQPD 4GKGA 3SWFA 2B87A 3Q2YA 1JTHB 4GIFA 2IYPA 3L72E 4JQ0D 1M1JC 2P2UA 1PGJA 4U3FE 3L70D 4UB6H 2Q1KA 3SWKA 1LP1A 1M56D 1NTMJ 1Y8AA 1AQ5A 1RQVA 2H43A 3L71E 3CXHE 1SQXJ 2L5GB 3B5ND 1CI6B 3FWLA 5KLVJ 3JCUH 3I56P 2ZYAA 4EYYQ 1VQNP 2ZVOB 2Y9ZA 3KHUA 4MN4C 3VP9A 2YXQB 2E76B 1KV4A 1N7SA 2HYNA 3H1LG 3TYYA 4H44C 3CWBJ 3TGUE 1IC2A 1L4AA 3V2NA 3WU2H 1X22A 3VN0A 3AEDC 3BCCG 3M9HA 1KYOH 2WSFJ 2KNCA 2QA4P 2FXMA 3NXSA 3KQGA 3SFDC 1RY3A 1JCDA 4L73A 2N1TB 1LTGC 4D6TG 3HE5B 1JMBA 5AVUB 3GMAA 3BRVB 2B89A 3HUSB 1N7LA 3B5NB 2E76C 1Q82Q 1NTKD 3WMM0 1SQPK 2XZRA 3PJSK 2KI7B 1FZGA 1IJDB 2YIUB 1BGYJ 1JY3O 3H1KD 4YXWH 2K3RA 1HTLC 4R4LA 2N9YB 5AVSB 2P10A 1L0NJ 3CXHH 3B4SA 5APVA 4XE5B 5AW5B 1FZFA 2N1TC 1VQ8P 1ZOYC 1SQXD 1NH4A 3HD7D 4C7NA 3HUSC 3NTNA 1SQQE 2C9LY 5KLVD 2YKOA 2W27A 1HGZA 3AE3C 3AEBC 2IDBA 1DH3A 1SQBG 3Q3DA 5AVWB 2YIUC 1CSBA 4RO0A 1VL2A 1SQPG 2E75C 1GL2D 4KHXA 1OMIA 2XDJA 3H1JE 1ZMEC 3L70G 5AVVB 1QVFO 3CWBD 2PGDA 4RKUJ 4IOIH 5GTHE 2W90A 3T97A 1VQKP 3RK3E 2BEQD 4K3AA 3CLQA 2M0BA 4OH8B 1LTIC 2QG4A 2P67A 1M1JA 3A7OA 1J1EC 3G71P 2O01J 2WITA 3A5TA 3C9IA 4D6TE 1NYHA 3HD7B 1NTKK 3USSA 2E74D 2K37A 2ITAA 3CCLP 1CW5A 2WTYA 1RH5B 4XFJA 3M06A 2LR2A 1ZV8A 1EDIA 3RBXA 1Y9BA 2PP6A 1N7SD 2YMKA 1YIJP 2ZYGA 1GL2B 3H6PA 3GF3A 4OGQB 3M0AA 3Q1MA 1JTHA 3CCRP 1L4AD 1R5SA 3I55P 3Q5RA 5KLVK 2Y0CA 1L0LG
chains in the Genus database with same CATH topology
4N6JA 4M3LA 2A45G 2WZ7A 1S9KE 1RF0A 1PFIA 1CI6A 1CZQA 4W7YA 3V2PA 2Q3IA 1ZR2A 2R3CA 1LTSC 2ZXEB 1J1EB 2KLVA 4HH2A 2GUVA 5APXA 1IO4A 1KILD 4WY4D 3P8MC 4ZKUA 1OWAA 1KILC 1NAFA 4WY4C 5AW3B 3RK3D 3KPEA 5AW6B 4AYCA 2JEEA 3RK3C 2WPSA 1HJBA 1RE3C 1T3UA 4LGDE 5CCHA 2OYIA 1FJPA 1IFJA 1LWUC 1XTCC 3BATA 3IFMA 3OA7A 2HG5D 1X79B 1WRGA 2O1JA 4JYBA 3M0DA 1FDMA 5APWA 4W80A 1SVFA 3V4QA 1M7LA 4IFDK 3P8CD 5CMZA 1H89A 2Z4EA 5APQA 1URQA 2ZFCA 5KJ7D 5KTBA 1YTZT 3GHGA 3R2PA 5KJ7C 4IFMA 1AFOA 2OARA 5AVRB 2NPSA 4HYTB 2QM8A 4WB4A 4LLHA 2KB7P 1SFCA 2I1JA 2BASA 3RK2B 2YMYA 1FZCA 1MV8A 4DZOA 1L4AB 1JY2P 1L0LK 1FZAA 1VPCA 2LKMA 1FOSE 2WSFH 2R32A 1MUUA 2FKWB 1MFZA 2J58A 5AVYB 1SLQA 1T3JA 2N1TA 3M9QA 3HE5A 4EIJA 3VYIA 3MIWA 5APYA 1A02J 2O01H 1JO5A 1M1JB 3HUSA 3MUDA 2R5DA 3TSIA 3HD7A 3HRNA 1IFMA 1GW3A 5BVZA 1T2KD 3P7KA 1ZN5A 5APSA 1JMMA 1T2KC 2Z5IA 1NKNA 1SQQK 3RL0B 4B86A 5AW1B 5CHXA 2KOGA 3HE4B 2GUSA 3U59A 4JF7A 3L37A 1KILB 5AVTB 2WSEH 4WY4B 1FU1A 2HODB 1S9KD 2XKMA 4I1LA 1HWTC 1NO4A 5CJ0A 2IPPA 1NTMK 1GK4A 4Y99B 1FAVA 1QL1A 3MTUE 2IX7C 2KP8A 3VTPC 5CJ4A 1SQXK 5APUA 1GL2A 2Z5HA 1GD2E 4XA4A 1NKZB 1LWUA 3E1IA 2WSCH 4RESB 1EQ7A 1VDFA 4GKGA 2NPSD 1Z56A 1KZUB 3SWFA 1LT9A 3P32A 4LC1A 1RF1A 1JTHB 2WPRA 4GIFA 1G2CB 3SWYA 1YYCA 3IR9A 1MZ9A 1NTZK 1M1JC 3V5BA 2P2UA 4GT1A 2P7JA 3V2QA 1WT6A 3RL0D 3LW5H 3O8ZA 3RL0C 1GU5A 4C7NB 1AQ5A 2H43A 1RE4C 5APTA 1DEBA 3VOPA 2C0XA 3A2AA 1NU1K 2L5GB 3B5ND 3L4FA 3B5NC 1CI6B 1NOHA 3HTKA 2KSJA 4Y99C 4AUWA 3NMDA 3U1CA 1N73C 3VMXA 1LTJA 3VP9A 5CCGD 1FJKA 2N9BA 2OYIB 5AW0B 5CCGC 3TNUA 2HPCA 3L36A 4N3YB 2Q7CA 1QL2A 3OJAB 5BU8B 4I6MC 5AVXB 1N7SA 1JOCA 2FFDB 1URQB 2CPSA 2HYNA 2XNXA 3TYYA 3GHGB 3PP5A 1YTZI 2A45I 1IC2A 2NPSB 1L4AA 3V2NA 1RF0C 3VN0A 3M9HA 3N7NA 5AVZB 2I1KA 2YNYA 2Q5UA 2FXMA 3NXSA 3KQGA 1RY3A 5AW9B 1JCDA 3NFQA 1GU4A 2N1TB 1LTGC 3HE5B 3BVHA 1J1DC 1FOSF 2HFED 5AVUB 1GK6A 2H8PD 1G1IA 3G3ZA 5CCHD 1DX7A 1L0NK 3BRVB 5CCHC 1JCCA 3HUSB 2OYIC 1FZBA 1RE4A 1N7LA 3B5NB 2IFNA 3MGNA 4C46A 1KILA 4WY4A 4W7ZA 2MJZA 1N73B 1NHLA 2QM7A 3M0DC 3WMM0 3M9BA 1SQPK 2XZRA 1RE3A 3UIAA 2FFDC 4ZKPA 1FZGA 1URQD 1FBMA 4WBAA 1IJDB 1URQC 2HLOA 3GHGC 2YO2A 3H32A 2OYHB 2FYZA 1JY3O 2WT7A 2NPSC 4N78E 2E43A 5AW7B 1HTLC 1SFCD 5BU5A 3A3YB 3LIEA 1A02F 5AVSB 1FZCC 5AW8B 1G2CA 5KJ7A 5APVA 2WWWA 3N4XA 3M91A 4XE5B 1LT9B 5AW5B 2N1TD 1FZFA 1RF1B 2N1TC 3BRTB 1T8ZA 1NH4A 5AVQB 3HD7D 2CPBA 4C7NA 3HUSC 3VMZA 3HD7C 3NTNA 2C9LY 3U1AA 2W6AA 2YKOA 3CI9A 1H8AA 2C0WA 2WPQA 2W27A 2KYVA 1HGZA 1SP4A 1XTGB 2XU6A 2J59M 2PAJA 1H88A 1DH3A 1HH0A 2W6BA 5AVWB 1JY3N 3B8EB 1CSBA 1J1DB 3V4WA 1NWQA 3HTKB 1IFNA 3BASA 1HBWA 4EOTA 2OYHC 1KFNA 2JJLA 1GL2D 4KHXA 2POHA 2XDJA 1E5WA 2YO3A 1GL2C 3KDPB 2YKPA 4DOJA 3V2RA 1LTJB 1J2JB 3EFGA 5AVVB 1LT9C 2IFMA 3EQ2A 1X9VA 3TNUB 1RF1C 2HPCB 2FFDA 3LIDA 1IK9A 2O1KA 1N7SB 4JYCA 1W2EA 3T97A 4AQRD 3VP8A 1SFCB 1LTTC 3MD0A 1HVVA 1JY2O 1FZCB 3OAKA 1IFIA 3CLQA 4OH8B 1LTIC 3KYQA 2VRSA 2P67A 1LGHB 1LTAC 1M1JA 3A7OA 1J1EC 1LTBC 2WITA 1JUNA 1FZEA 3A5TA 3VMYA 4N78D 1ZLLA 3C9IA 1IFDA 1GTWA 4I2LC 5AW4B 1KFMA 1GDTA 3HD7B 3HE4A 1HGVA 1NTKK 3P8CE 1SQBK 1CW5A 1LTJC 2HODA 3B5NA 1N2DC 5AW2B 2WTYA 4O9BA 2GM4A 2H7HA 3II6A 1N73A 3M06A 1KQLA 1ZV8A 3I5CA 2M8RA 1JNMA 2A45H 2YKQA 2PP6A 2R5BA 1N7SD 3L35A 1JY2N 1OXZA 2E42A 2FYUK 3RK3B 1N7SC 2XV5A 2OYHA 1SFCC 1GL2B 3H6PA 5CCGA 3M0AA 1JY3P 1LWUB 1X8YA 3RK2D 2M3BA 1JTHA 3H32B 4IFFA 3RK2C 1GW4A 1L4AD 2WT7B 1ZR4A 1HUCA 1G1JA 1L4AC 3TK1A 5KLVK 1GZLA 1SQVK 2Q9IA 3CL3D 1N86A 4C7RA 2P1JA 2C9NY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DX7 A;  2FKW B;  1IJD B;  1NKZ B;  1KZU B;  1WRG A;  1JO5 A;  1LGH B;  3WMM 0;  1JMM A; 
#chains in the Genus database with same CATH topology
 2A06 E;  2A45 G;  2WZ7 A;  1KN7 A;  1LP1 B;  2Q6Q A;  3QH9 A;  4IL6 E;  1ZRT D;  1NTK G;  3L74 E;  1CI6 A;  2FYU J;  2QE7 H;  4Z1M H;  5APX A;  3R4Y A;  4JPZ B;  3TDK A;  1SQP E;  3EFF K;  2E74 B;  3EWK A;  1X0T A;  4OGQ C;  3BAT A;  1NTM G;  3IFM A;  1BE3 J;  3MHV A;  1P84 D;  4JYB A;  5CBN A;  5APW A;  1E79 H;  1SQX G;  1SVF A;  4IFD K;  3P8C D;  1OW8 A;  5CMZ A;  2JR8 A;  1KB9 D;  5KLV G;  1OVR A;  3PTZ A;  2KB7 P;  2XND H;  1L4A B;  1ZW0 A;  1FZA A;  4I7Z C;  2J58 A;  4IL6 X;  2N1T A;  3M9Q A;  1FDI A;  3HE5 A;  2QJK B;  3VYI A;  3RL0 g;  4BXL A;  1JO5 A;  2E74 C;  3HUS A;  3P7K A;  1JMM A;  1T2K C;  3RL0 B;  5AW1 B;  2PFX A;  3CWB G;  3W67 A;  3D6Z A;  3L37 A;  2WSE H;  2P58 A;  1NO4 A;  4ZMD A;  1FAV A;  3MTU E;  1Q7Y Q;  2ZT9 D;  1GD2 E;  3GW6 A;  4RES B;  1AA0 A;  2WPV B;  1EQ7 A;  4IL6 H;  1S1C X;  2SPZ A;  2NPS D;  1Z56 A;  3G9R A;  1KZU B;  4LC1 A;  2QJK C;  3SWY A;  1PGO A;  3IR9 A;  2FYU D;  1USD A;  3RL0 C;  1GU5 A;  1NTK E;  4C7N B;  1BGY G;  1LJ2 A;  4GDO A;  5APT A;  2IZ0 A;  1BCC E;  2IBZ D;  3H1K E;  2KSJ A;  3BCC D;  1N73 C;  1BE3 D;  5H2F H;  2AEM A;  3KZI H;  4HKZ H;  3B71 A;  3PH0 A;  1FJK A;  1SQX E;  1NAY A;  3V6I A;  4GOD A;  1NU1 J;  5KLV E;  5KAF H;  1Q2N A;  1URQ B;  1UIX A;  2BCC J;  3GHG B;  1JM0 A;  4H44 D;  4DT0 A;  1KQG B;  2NPS B;  3CCE P;  3AE1 C;  1W5C E;  2QVA A;  1Y47 A;  3PRJ A;  1QEX A;  2YNY A;  4PD4 D;  4JBZ A;  1PP9 J;  3JSV C;  1GU4 A;  1J1D C;  5DJT B;  1R8E A;  1VQ6 P;  2H8P D;  1G1I A;  1DX7 A;  5CCH C;  3CWB E;  2IFN A;  3MGN A;  3RGU A;  1IFP A;  2MJZ A;  5GTI E;  2ZXX A;  1AVO A;  3Q5P A;  1SQB D;  1URQ C;  3GHG C;  3IN6 A;  4KJM A;  2FYZ A;  2NPS C;  5BU5 A;  1FZC C;  1G2C A;  3N4X A;  2N1T D;  5KKZ C;  4UB8 E;  1DEE G;  3BRT B;  1T8Z A;  4H44 B;  3WUT A;  1JB0 J;  1EZV I;  3A0B H;  1H8A A;  2C0W A;  1K9M Q;  2KYV A;  1SP4 A;  3CMA P;  4DCK A;  3PLN A;  4QMA A;  2J59 M;  2PAJ A;  1H88 A;  1HH0 A;  1IFN A;  1KB9 I;  2V4H A;  4EOT A;  3L73 J;  3SFE C;  4PV1 B;  5L8R J;  2E75 D;  4TLF A;  3FWN A;  1E5W A;  2YO3 A;  2FYU G;  3V2R A;  1LTJ B;  3F5H A;  5TJH A;  1OVU A;  4R4M A;  2BCC D;  1ZRT E;  3AE6 C;  5C39 A;  3TNU B;  1PPJ E;  2HPC B;  1FE6 A;  2FFD A;  2IBZ G;  1W2E A;  2H89 C;  3VP8 A;  3C8V A;  1IFI A;  1BE3 G;  3KYQ A;  2VRS A;  2QIW A;  1EZV E;  2R44 A;  3VMY A;  4N78 D;  5GTI H;  2KIK A;  1IFD A;  1QX8 A;  4I2L C;  2JDI H;  1KQS O;  3WUV A;  4PV1 C;  1L0L D;  1GDT A;  3P8C E;  4PJ0 H;  1SQB K;  1KB9 E;  1LTJ C;  4ZNC A;  2GM4 A;  2H7H A;  2JO1 A;  2MKV A;  1N73 A;  4DJG A;  3I5C A;  1JNM A;  1EC5 A;  3F89 A;  3AE7 C;  3L35 A;  3FXD A;  3L72 J;  4UB8 H;  2E75 B;  2XV5 A;  2OYH A;  4U3F J;  2M3B A;  3H32 B;  1NTM D;  1QGK B;  3RK2 C;  1H0T A;  2WT7 B;  2UWJ E;  1YQ4 C;  1ZR4 A;  2RN0 A;  4RJT A;  3L71 J;  1N86 A;  2E5T A;  1KMI Z;  1AV1 A;  2YXR B;  4W7Y A;  2L91 A;  1J1E B;  3L73 D;  1IO4 A;  1OWA A;  1NAF A;  4WY4 C;  5AW3 B;  2ZVN B;  2AXC A;  4OGQ D;  5CCH A;  3CX5 D;  1FJP A;  1S5L E;  1YQ3 C;  2HG5 D;  3CCJ P;  1DD3 A;  2O1J A;  2G3A A;  1VQP P;  4W80 A;  1H89 A;  1Q81 Q;  3H1L E;  1URQ A;  4PD4 I;  1YTZ T;  3GHG A;  1KIL E;  5KJ7 C;  1AFO A;  2OAR A;  4H0L D;  1DIP A;  2NPS A;  2QJP B;  4LLH A;  3IAO A;  3BCC E;  3IF4 A;  5M1B A;  2I1J A;  1KYO D;  4WWI A;  1FZC A;  3S9O A;  1L0L K;  1VPC A;  2LKM A;  1FOS E;  1KB9 H;  3ITK A;  1YJ9 P;  5AVY B;  5B66 E;  3ABV C;  4EIJ A;  4ASV A;  1A02 J;  2O01 H;  1NU1 G;  4BRY B;  1T2K D;  1IFM A;  3CME P;  2WMM A;  1NKN A;  2BCC G;  1IK7 A;  2RKL A;  2WQY C;  1EDL A;  4B86 A;  4WVZ A;  2KOG A;  3HE4 B;  1ZP0 C;  1BGY D;  3L72 D;  4JF7 A;  1S5L X;  2HOD B;  1HWT C;  5CJ0 A;  2IPP A;  1NTM K;  1GK4 A;  1L0N D;  3VMA A;  2QJP C;  1PP9 G;  3VTP C;  1SQX K;  3L71 D;  2Z5H A;  4PD4 E;  3GF7 A;  4XA4 A;  3CXH D;  1LWU A;  2WSC H;  1M1K Q;  3CC7 P;  3P32 A;  1SQQ J;  1PGP A;  5EFW B;  1G2C B;  1NJI Q;  1MZ9 A;  4GT1 A;  4H0L B;  4H13 B;  3AEE C;  3RL0 D;  1GMJ A;  3LW5 H;  1MKM A;  3O8Z A;  4KT0 J;  1S5L H;  1SQB E;  3VOP A;  2C0X A;  1YJW P;  4I7Z B;  1OW6 A;  3L4F A;  1NOH A;  3H1J J;  3WUU A;  3CPW O;  1YHQ P;  1S3J A;  3U1C A;  1WMK A;  1SQV J;  5GTH H;  3K5B A;  3L70 E;  1LTJ A;  3AEF C;  1LNQ A;  2KZI A;  2OYI B;  5CCG C;  1KC8 Q;  3TNU A;  2HPC A;  5E79 E;  3L36 A;  4N3Y B;  1OFC X;  2Q7C A;  1QL2 A;  5BU8 B;  4I6M C;  4H0L C;  2K1A A;  4ASW A;  4H13 C;  2FFD B;  2H88 C;  1YI2 P;  2CPS A;  2XNX A;  3L73 G;  2A45 I;  2Y9Y A;  1KQF B;  2M5A A;  2Q5U A;  1K04 A;  1QLE D;  3FGA D;  1FOS F;  1K05 A;  1OVV A;  5CCH D;  1L0N K;  1VQ4 P;  1JCC A;  2OYI C;  2OGU A;  4PD4 H;  1RE4 A;  2JKV A;  4C46 A;  4NPE A;  4WY4 A;  4W7Z A;  1N73 B;  2QM7 A;  3M0D C;  1K8A Q;  2WSE J;  2FFD C;  4ZKP A;  1URQ D;  4CPG A;  1VF5 B;  1SQQ D;  1TU3 F;  3H32 A;  2OYH B;  2WT7 A;  4N78 E;  3JC2 2;  1L0L E;  1R5L A;  2V7Q H;  1H0T B;  3L74 J;  5KJ7 A;  1M90 Q;  2WWW A;  3M91 A;  1LT9 B;  1RF1 B;  3E1R A;  3L72 G;  2AEF A;  3CX5 I;  2CPB A;  4U3F G;  2ZYD A;  1D7M A;  1L0N G;  3CI9 A;  1SQV D;  2WPQ A;  1XTG B;  5E79 H;  3L71 G;  2NRG A;  1Q86 Q;  1NWQ A;  1NTZ J;  1J1D B;  1NTM E;  1VF5 C;  3HTK B;  3D71 A;  1HBW A;  4UB6 E;  2OYH C;  2JJL A;  3H25 A;  3KDP B;  3CCV P;  2O3J A;  1VQ5 P;  1BSN A;  1LT9 C;  2IFM A;  3EQ2 A;  1X9V A;  1RF1 C;  3D6Y A;  2O1K A;  3L73 E;  4JYC A;  4AQR D;  2GA1 A;  1HVV A;  2Q3E A;  1FZC B;  3OAK A;  2RMZ A;  3CCQ P;  3AEA C;  1LGH B;  1LTA C;  2WSS H;  3CX5 E;  4BRY A;  4L76 A;  5KKZ B;  1LTB C;  2KXP B;  1ZLL A;  4PV1 D;  1KFM A;  4YPC A;  1KTM A;  3HE4 A;  2OTL P;  2LXB A;  2HOD A;  5AW2 B;  4O9B A;  1FS0 E;  4NPD A;  3G4S P;  1KYO E;  2A06 D;  2A45 H;  2FYN B;  1OX3 A;  2K9Y A;  2NZ2 A;  2R5B A;  1RQU A;  1JY2 N;  1OXZ A;  2E42 A;  2FYU K;  2ZAE B;  3RK3 B;  2E5Y A;  3L74 D;  2M3E A;  5CCG A;  1LWU B;  1X8Y A;  3RK2 D;  1GW4 A;  1G1J A;  4YTP C;  1GZL A;  3H1H J;  1BCC J;  1SQV K;  2Q9I A;  3CL3 D;  2W83 C;  1BGY E;  4C7R A;  2C9N Y;  3H1K J;  2KS1 B;  3H1I J;  1P84 I;  3D70 A;  3CD6 P;  1PFI A;  1L0N E;  3V2P A;  1NTZ D;  1ZR2 A;  2KLV A;  4HH2 A;  1LT1 A;  2GUV A;  1VQ7 P;  2B9B A;  1SQQ G;  4WY4 D;  2KK7 A;  2FYN C;  3P8M C;  4GOE A;  1KIL C;  2IYO A;  3L75 J;  3KPE A;  5AW6 B;  4AYC A;  2LXC B;  3RK3 C;  2WPS A;  1RE3 C;  3AE4 C;  1T3U A;  1NU1 D;  2OYI A;  2Y0D A;  2Y0E A;  1IFJ A;  1LWU C;  3OA7 A;  4TT3 H;  3M0D A;  1FDM A;  4HJG H;  2Z4E A;  3CX5 H;  3H1J G;  5KJ7 D;  5KTB A;  1FDO A;  3R2P A;  1ZXG A;  4IFM A;  5AVR B;  1SQV G;  4U7J A;  2KSE A;  1PP9 D;  1SFC A;  2OQQ A;  2BAS A;  3RK2 B;  2YMY A;  4DZO A;  1JY2 P;  1NGM B;  2WSF H;  2R32 A;  1MUU A;  1N8R Q;  1L2P A;  2FKW B;  1P84 E;  1AVY A;  1MFZ A;  1SLQ A;  1T3J A;  3MIW A;  2M5A B;  2ZJS E;  1BDC A;  3TSI A;  5BVZ A;  1GW3 A;  1ZN5 A;  2Z5I A;  4OVN F;  5CHX A;  1NVO A;  3AE9 C;  3CCM P;  3OW2 O;  5AVT B;  3AE8 C;  4WY4 B;  1FU1 A;  1S9K D;  4I1L A;  4Y99 B;  3ZDM A;  3CC2 P;  3TF5 A;  2KP8 A;  3SSU A;  1FC2 C;  5APU A;  2PRR A;  3E1I A;  3H1H D;  2KLU A;  1OIP A;  1BCC D;  1VDF A;  3O6Q B;  2IBZ I;  1LT9 A;  3H1I D;  1RF1 A;  1UII A;  2WPR A;  1YYC A;  4K35 A;  1NTZ K;  3V5B A;  1U7M A;  2P7J A;  1KD1 Q;  3V2Q A;  5B5E E;  1WT6 A;  2KZJ A;  2HR3 A;  1SS1 A;  1RE4 C;  3L75 D;  2A06 G;  1DEB A;  3A2A A;  1NU1 K;  3B5N C;  2IZ1 A;  3HTK A;  3CCS P;  3L74 G;  4AUW A;  4Y99 C;  3NMD A;  3VMX A;  2BEZ F;  2FYU E;  2K9J B;  3TGU J;  5CCG D;  2N9B A;  5AW0 B;  3E7K A;  3KXD A;  3OJA B;  1P84 H;  5AVX B;  4A7P A;  4H13 D;  2IBZ E;  2FXP A;  1EXI A;  1JOC A;  1SQV E;  1NTZ G;  3C1L A;  1BE3 E;  3PP5 A;  1YTZ I;  2QEX P;  3PHL A;  3MZW B;  1RF0 C;  1IZN B;  3N7N A;  5AVZ B;  2I1K A;  1JEK A;  2I8D A;  5AW9 B;  5CBO A;  2JP3 A;  3NFQ A;  3BVH A;  2HFE D;  1GK6 A;  2FY8 A;  3G3Z A;  1FZB A;  4U3F D;  4BWN A;  1KIL A;  1NHL A;  3M9B A;  1RE3 A;  3UIA A;  1DD4 A;  1VQ9 P;  1FBM A;  4WBA A;  4GOF A;  1M57 D;  2HLO A;  1Q90 D;  2YO2 A;  5B5E H;  3FX0 A;  1RHZ B;  1QVG O;  2E43 A;  5AW7 B;  1SFC D;  3A3Y B;  3LIE A;  1A02 F;  2WSC J;  3W68 A;  5AW8 B;  1VQO P;  2KS1 A;  5KAI E;  5K5G B;  2OTJ P;  2B87 B;  1S72 P;  2WVR A;  4EI2 A;  5AVQ B;  1MFT A;  3LW5 J;  3MUD C;  3VMZ A;  3HD7 C;  1W2B O;  1KOR A;  3U1A A;  2D2C D;  2W6A A;  4HB1 A;  3A0H E;  2W6J H;  1PPJ D;  2XU6 A;  1EDJ A;  1OW7 A;  1VF5 D;  2W6B A;  3TGU D;  1JY3 N;  3B8E B;  3V4W A;  3H1H G;  1BCC G;  1PGQ A;  3BAS A;  3H1L J;  3H1K G;  3H1I G;  1VQM P;  1KFN A;  3AEG C;  3S4R A;  2POH A;  1GL2 C;  2QSI A;  2YKP A;  4DOJ A;  3BCC J;  1J2J B;  3EFG A;  1S2E A;  1EZV D;  5B66 H;  2AEJ A;  1NTZ E;  3L75 G;  3LID A;  1IK9 A;  4D6T J;  5H2F E;  4NPF X;  1N7S B;  3KZI E;  3AE2 C;  1SFC B;  1LTT C;  3MD0 A;  1JY2 O;  1AQT A;  1NU1 E;  2R3S A;  4Y28 J;  1PV3 A;  1JUN A;  1FZE A;  2BCC E;  4L74 A;  1GTW A;  5AW4 B;  1PL5 A;  2KNC B;  2W8Z A;  5KAF E;  1HGV A;  1YJN P;  3CC4 P;  2D2C B;  3B5N A;  1N2D C;  4L75 A;  1BDD A;  3II6 A;  2J5U A;  1KQL A;  1PP9 E;  2M8R A;  1PIX A;  2QRX A;  3S1K A;  2YKQ A;  5KAI H;  1K73 Q;  1T6A A;  3G6E P;  1N7S C;  3O6Q A;  1SFC C;  1JY3 P;  3CCU P;  4IFF A;  5TIS E;  1HUC A;  1L4A C;  2V7Q J;  3QWO C;  1SQB J;  3A0H H;  2FBW C;  3TK1 A;  2B88 A;  3GLM A;  1SQP J;  2AXT E;  2G8Y A;  3H1J D;  2P1J A;  4N6J A;  4M3L A;  1BSH A;  1EXJ A;  1VQL P;  1S9K E;  2OTK E;  2D2C C;  1RF0 A;  1U57 A;  1CZQ A;  2JWD A;  2Q3I A;  2FXO A;  3L70 J;  2R3C A;  1LTS C;  2ZXE B;  3H1L D;  1KIL D;  4OWF A;  1OZH A;  4ZKU A;  3H1H E;  3RK3 D;  3AE5 C;  2K9J A;  2JEE A;  1HJB A;  3H1I E;  4LGD E;  1KYO I;  2QJY B;  1XTC C;  1X79 B;  1WRG A;  4D6T D;  5KLI B;  3A0B E;  1EDK A;  3V4Q A;  1M7L A;  4EDF A;  3JCU E;  5APQ A;  2ZFC A;  3L75 E;  3Q5S A;  1S4X A;  2K88 A;  2OYO A;  1AJY A;  4HYT B;  3AEC C;  2QM8 A;  4WB4 A;  1PPJ G;  5DJU B;  3GG2 A;  2ZT9 B;  1MV8 A;  3RBZ A;  3TGU G;  2CK3 H;  1M8O B;  1YIT P;  3T97 B;  4YXD C;  1PZQ A;  2RH0 A;  5APY A;  1U7J A;  3FXE A;  1M1J B;  2JWA A;  3MUD A;  2R5D A;  3CXH I;  3HD7 A;  2QJY C;  3HRN A;  1EZV G;  5APS A;  1SQQ K;  1HJ0 A;  3WU2 E;  5KLI C;  1HF9 A;  3MP7 B;  2GUS A;  3U59 A;  1KIL B;  2KUB A;  5TIS H;  2E76 D;  2XKM A;  1USE A;  1L0L J;  1YBK A;  2O01 N;  1QL1 A;  2IX7 C;  2AXT H;  5CJ4 A;  1GL2 A;  1NTK J;  2ZT9 C;  2DW3 A;  1NKZ B;  4PJ0 E;  1SQP D;  4GKG A;  3SWF A;  2B87 A;  3Q2Y A;  1JTH B;  4GIF A;  2IYP A;  3L72 E;  4JQ0 D;  1M1J C;  2P2U A;  1PGJ A;  4U3F E;  3L70 D;  4UB6 H;  2Q1K A;  3SWK A;  1LP1 A;  1M56 D;  1NTM J;  1Y8A A;  1AQ5 A;  1RQV A;  2H43 A;  3L71 E;  3CXH E;  1SQX J;  2L5G B;  3B5N D;  1CI6 B;  3FWL A;  5KLV J;  3JCU H;  3I56 P;  2ZYA A;  4EYY Q;  1VQN P;  2ZVO B;  2Y9Z A;  3KHU A;  4MN4 C;  3VP9 A;  2YXQ B;  2E76 B;  1KV4 A;  1N7S A;  2HYN A;  3H1L G;  3TYY A;  4H44 C;  3CWB J;  3TGU E;  1IC2 A;  1L4A A;  3V2N A;  3WU2 H;  1X22 A;  3VN0 A;  3AED C;  3BCC G;  3M9H A;  1KYO H;  2WSF J;  2KNC A;  2QA4 P;  2FXM A;  3NXS A;  3KQG A;  3SFD C;  1RY3 A;  1JCD A;  4L73 A;  2N1T B;  1LTG C;  4D6T G;  3HE5 B;  1JMB A;  5AVU B;  3GMA A;  3BRV B;  2B89 A;  3HUS B;  1N7L A;  3B5N B;  2E76 C;  1Q82 Q;  1NTK D;  3WMM 0;  1SQP K;  2XZR A;  3PJS K;  2KI7 B;  1FZG A;  1IJD B;  2YIU B;  1BGY J;  1JY3 O;  3H1K D;  4YXW H;  2K3R A;  1HTL C;  4R4L A;  2N9Y B;  5AVS B;  2P10 A;  1L0N J;  3CXH H;  3B4S A;  5APV A;  4XE5 B;  5AW5 B;  1FZF A;  2N1T C;  1VQ8 P;  1ZOY C;  1SQX D;  1NH4 A;  3HD7 D;  4C7N A;  3HUS C;  3NTN A;  1SQQ E;  2C9L Y;  5KLV D;  2YKO A;  2W27 A;  1HGZ A;  3AE3 C;  3AEB C;  2IDB A;  1DH3 A;  1SQB G;  3Q3D A;  5AVW B;  2YIU C;  1CSB A;  4RO0 A;  1VL2 A;  1SQP G;  2E75 C;  1GL2 D;  4KHX A;  1OMI A;  2XDJ A;  3H1J E;  1ZME C;  3L70 G;  5AVV B;  1QVF O;  3CWB D;  2PGD A;  4RKU J;  4IOI H;  5GTH E;  2W90 A;  3T97 A;  1VQK P;  3RK3 E;  2BEQ D;  4K3A A;  3CLQ A;  2M0B A;  4OH8 B;  1LTI C;  2QG4 A;  2P67 A;  1M1J A;  3A7O A;  1J1E C;  3G71 P;  2O01 J;  2WIT A;  3A5T A;  3C9I A;  4D6T E;  1NYH A;  3HD7 B;  1NTK K;  3USS A;  2E74 D;  2K37 A;  2ITA A;  3CCL P;  1CW5 A;  2WTY A;  1RH5 B;  4XFJ A;  3M06 A;  2LR2 A;  1ZV8 A;  1EDI A;  3RBX A;  1Y9B A;  2PP6 A;  1N7S D;  2YMK A;  1YIJ P;  2ZYG A;  1GL2 B;  3H6P A;  3GF3 A;  4OGQ B;  3M0A A;  3Q1M A;  1JTH A;  3CCR P;  1L4A D;  1R5S A;  3I55 P;  3Q5R A;  5KLV K;  2Y0C A;  1L0L G; 
#chains in the Genus database with same CATH homology
 4N6J A;  4M3L A;  2A45 G;  2WZ7 A;  1S9K E;  1RF0 A;  1PFI A;  1CI6 A;  1CZQ A;  4W7Y A;  3V2P A;  2Q3I A;  1ZR2 A;  2R3C A;  1LTS C;  2ZXE B;  1J1E B;  2KLV A;  4HH2 A;  2GUV A;  5APX A;  1IO4 A;  1KIL D;  4WY4 D;  3P8M C;  4ZKU A;  1OWA A;  1KIL C;  1NAF A;  4WY4 C;  5AW3 B;  3RK3 D;  3KPE A;  5AW6 B;  4AYC A;  2JEE A;  3RK3 C;  2WPS A;  1HJB A;  1RE3 C;  1T3U A;  4LGD E;  5CCH A;  2OYI A;  1FJP A;  1IFJ A;  1LWU C;  1XTC C;  3BAT A;  3IFM A;  3OA7 A;  2HG5 D;  1X79 B;  1WRG A;  2O1J A;  4JYB A;  3M0D A;  1FDM A;  5APW A;  4W80 A;  1SVF A;  3V4Q A;  1M7L A;  4IFD K;  3P8C D;  5CMZ A;  1H89 A;  2Z4E A;  5APQ A;  1URQ A;  2ZFC A;  5KJ7 D;  5KTB A;  1YTZ T;  3GHG A;  3R2P A;  5KJ7 C;  4IFM A;  1AFO A;  2OAR A;  5AVR B;  2NPS A;  4HYT B;  2QM8 A;  4WB4 A;  4LLH A;  2KB7 P;  1SFC A;  2I1J A;  2BAS A;  3RK2 B;  2YMY A;  1FZC A;  1MV8 A;  4DZO A;  1L4A B;  1JY2 P;  1L0L K;  1FZA A;  1VPC A;  2LKM A;  1FOS E;  2WSF H;  2R32 A;  1MUU A;  2FKW B;  1MFZ A;  2J58 A;  5AVY B;  1SLQ A;  1T3J A;  2N1T A;  3M9Q A;  3HE5 A;  4EIJ A;  3VYI A;  3MIW A;  5APY A;  1A02 J;  2O01 H;  1JO5 A;  1M1J B;  3HUS A;  3MUD A;  2R5D A;  3TSI A;  3HD7 A;  3HRN A;  1IFM A;  1GW3 A;  5BVZ A;  1T2K D;  3P7K A;  1ZN5 A;  5APS A;  1JMM A;  1T2K C;  2Z5I A;  1NKN A;  1SQQ K;  3RL0 B;  4B86 A;  5AW1 B;  5CHX A;  2KOG A;  3HE4 B;  2GUS A;  3U59 A;  4JF7 A;  3L37 A;  1KIL B;  5AVT B;  2WSE H;  4WY4 B;  1FU1 A;  2HOD B;  1S9K D;  2XKM A;  4I1L A;  1HWT C;  1NO4 A;  5CJ0 A;  2IPP A;  1NTM K;  1GK4 A;  4Y99 B;  1FAV A;  1QL1 A;  3MTU E;  2IX7 C;  2KP8 A;  3VTP C;  5CJ4 A;  1SQX K;  5APU A;  1GL2 A;  2Z5H A;  1GD2 E;  4XA4 A;  1NKZ B;  1LWU A;  3E1I A;  2WSC H;  4RES B;  1EQ7 A;  1VDF A;  4GKG A;  2NPS D;  1Z56 A;  1KZU B;  3SWF A;  1LT9 A;  3P32 A;  4LC1 A;  1RF1 A;  1JTH B;  2WPR A;  4GIF A;  1G2C B;  3SWY A;  1YYC A;  3IR9 A;  1MZ9 A;  1NTZ K;  1M1J C;  3V5B A;  2P2U A;  4GT1 A;  2P7J A;  3V2Q A;  1WT6 A;  3RL0 D;  3LW5 H;  3O8Z A;  3RL0 C;  1GU5 A;  4C7N B;  1AQ5 A;  2H43 A;  1RE4 C;  5APT A;  1DEB A;  3VOP A;  2C0X A;  3A2A A;  1NU1 K;  2L5G B;  3B5N D;  3L4F A;  3B5N C;  1CI6 B;  1NOH A;  3HTK A;  2KSJ A;  4Y99 C;  4AUW A;  3NMD A;  3U1C A;  1N73 C;  3VMX A;  1LTJ A;  3VP9 A;  5CCG D;  1FJK A;  2N9B A;  2OYI B;  5AW0 B;  5CCG C;  3TNU A;  2HPC A;  3L36 A;  4N3Y B;  2Q7C A;  1QL2 A;  3OJA B;  5BU8 B;  4I6M C;  5AVX B;  1N7S A;  1JOC A;  2FFD B;  1URQ B;  2CPS A;  2HYN A;  2XNX A;  3TYY A;  3GHG B;  3PP5 A;  1YTZ I;  2A45 I;  1IC2 A;  2NPS B;  1L4A A;  3V2N A;  1RF0 C;  3VN0 A;  3M9H A;  3N7N A;  5AVZ B;  2I1K A;  2YNY A;  2Q5U A;  2FXM A;  3NXS A;  3KQG A;  1RY3 A;  5AW9 B;  1JCD A;  3NFQ A;  1GU4 A;  2N1T B;  1LTG C;  3HE5 B;  3BVH A;  1J1D C;  1FOS F;  2HFE D;  5AVU B;  1GK6 A;  2H8P D;  1G1I A;  3G3Z A;  5CCH D;  1DX7 A;  1L0N K;  3BRV B;  5CCH C;  1JCC A;  3HUS B;  2OYI C;  1FZB A;  1RE4 A;  1N7L A;  3B5N B;  2IFN A;  3MGN A;  4C46 A;  1KIL A;  4WY4 A;  4W7Z A;  2MJZ A;  1N73 B;  1NHL A;  2QM7 A;  3M0D C;  3WMM 0;  3M9B A;  1SQP K;  2XZR A;  1RE3 A;  3UIA A;  2FFD C;  4ZKP A;  1FZG A;  1URQ D;  1FBM A;  4WBA A;  1IJD B;  1URQ C;  2HLO A;  3GHG C;  2YO2 A;  3H32 A;  2OYH B;  2FYZ A;  1JY3 O;  2WT7 A;  2NPS C;  4N78 E;  2E43 A;  5AW7 B;  1HTL C;  1SFC D;  5BU5 A;  3A3Y B;  3LIE A;  1A02 F;  5AVS B;  1FZC C;  5AW8 B;  1G2C A;  5KJ7 A;  5APV A;  2WWW A;  3N4X A;  3M91 A;  4XE5 B;  1LT9 B;  5AW5 B;  2N1T D;  1FZF A;  1RF1 B;  2N1T C;  3BRT B;  1T8Z A;  1NH4 A;  5AVQ B;  3HD7 D;  2CPB A;  4C7N A;  3HUS C;  3VMZ A;  3HD7 C;  3NTN A;  2C9L Y;  3U1A A;  2W6A A;  2YKO A;  3CI9 A;  1H8A A;  2C0W A;  2WPQ A;  2W27 A;  2KYV A;  1HGZ A;  1SP4 A;  1XTG B;  2XU6 A;  2J59 M;  2PAJ A;  1H88 A;  1DH3 A;  1HH0 A;  2W6B A;  5AVW B;  1JY3 N;  3B8E B;  1CSB A;  1J1D B;  3V4W A;  1NWQ A;  3HTK B;  1IFN A;  3BAS A;  1HBW A;  4EOT A;  2OYH C;  1KFN A;  2JJL A;  1GL2 D;  4KHX A;  2POH A;  2XDJ A;  1E5W A;  2YO3 A;  1GL2 C;  3KDP B;  2YKP A;  4DOJ A;  3V2R A;  1LTJ B;  1J2J B;  3EFG A;  5AVV B;  1LT9 C;  2IFM A;  3EQ2 A;  1X9V A;  3TNU B;  1RF1 C;  2HPC B;  2FFD A;  3LID A;  1IK9 A;  2O1K A;  1N7S B;  4JYC A;  1W2E A;  3T97 A;  4AQR D;  3VP8 A;  1SFC B;  1LTT C;  3MD0 A;  1HVV A;  1JY2 O;  1FZC B;  3OAK A;  1IFI A;  3CLQ A;  4OH8 B;  1LTI C;  3KYQ A;  2VRS A;  2P67 A;  1LGH B;  1LTA C;  1M1J A;  3A7O A;  1J1E C;  1LTB C;  2WIT A;  1JUN A;  1FZE A;  3A5T A;  3VMY A;  4N78 D;  1ZLL A;  3C9I A;  1IFD A;  1GTW A;  4I2L C;  5AW4 B;  1KFM A;  1GDT A;  3HD7 B;  3HE4 A;  1HGV A;  1NTK K;  3P8C E;  1SQB K;  1CW5 A;  1LTJ C;  2HOD A;  3B5N A;  1N2D C;  5AW2 B;  2WTY A;  4O9B A;  2GM4 A;  2H7H A;  3II6 A;  1N73 A;  3M06 A;  1KQL A;  1ZV8 A;  3I5C A;  2M8R A;  1JNM A;  2A45 H;  2YKQ A;  2PP6 A;  2R5B A;  1N7S D;  3L35 A;  1JY2 N;  1OXZ A;  2E42 A;  2FYU K;  3RK3 B;  1N7S C;  2XV5 A;  2OYH A;  1SFC C;  1GL2 B;  3H6P A;  5CCG A;  3M0A A;  1JY3 P;  1LWU B;  1X8Y A;  3RK2 D;  2M3B A;  1JTH A;  3H32 B;  4IFF A;  3RK2 C;  1GW4 A;  1L4A D;  2WT7 B;  1ZR4 A;  1HUC A;  1G1J A;  1L4A C;  3TK1 A;  5KLV K;  1GZL A;  1SQV K;  2Q9I A;  3CL3 D;  1N86 A;  4C7R A;  2P1J A;  2C9N Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...