1JMMA

Crystal structure of the v-region of streptococcus mutans antigen i/ii
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
377
structure length
377
Chain Sequence
b'QKDLADYPVKLKAYEDEQASIKAALAELEKHKNEDGNLTEPSAQNLVYDLEPNANLSLTTDGKFLKASAVDDAFSKSTSKAKYVQKILQLDDLDITNLEQSNDVASSMELYGNFGDKAGWSTTVSNNSQVKWGSVLLERGQSATATYTNLQNSYYNGKKISKIVYKYTVDPKSKFQGQKVWLGIFTDPTLGVFASAYTGQVEKNTSIFIKNEFTFYDEDGKPINFDNALLSVASLNREHNSIEMAKDYSGKFVKISGSSIGEKNGMIYATDTLNFKQGEGGSRWTMYKNSQAGSGWDSSDAPNSWYGAGAIKMSGPNNHVTVGATSATNVMPVSDMPVVPGKDNTDGKKPNIWYSLNGKIRAVNVPKVTKEKPTPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords protein I/II V-region
molecule tags Immune system, membrane protein
source organism Streptococcus mutans
publication title Crystal Structure of the V-region of Streptococcus mutans Antigen I/II at 2.4 a Resolution Suggests a Sugar Preformed Binding Site
pubmed doi rcsb
total genus 107
structure length 377
sequence length 377
ec nomenclature
pdb deposition date 2001-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08363 GbpC Glucan-binding protein C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jmmA01
2.60.530.10 Mainly Beta Sandwich Major cell-surface adhesin PAc Major cell-surface adhesin PAc 1jmmA02
1LGHB 1JMMA 1KZUB 1IJDB 2FKWB 1NKZB 1DX7A 3WMM0 1WRGA 1JO5A
chains in the Genus database with same CATH superfamily
2QJYB 3PHLA 1MZ9A 4WBAA 2HODB 1YIJP 3B5NB 3PLNA 1VQ9P 2P67A 1P84H 3S4RA 4YXDC 1EZVG 1SQVE 2E74C 2M5AB 3A2AA 4L76A 5AVVB 1S9KD 3SWFA 1GU4A 3T97A 1RF1A 1H8AA 1R5SA 3PRJA 5AW2B 3C9IA 4IL6X 2ZAEB 2OARA 3SWYA 3CC2P 1JM0A 4N78D 5C39A 5CMZA 4OGQC 3FWLA 3CLQA 3JCUE 3KDPB 2H43A 2WTYA 3E1RA 1HJBA 4K35A 1URQA 1QEXA 3CMAP 2ZYDA 3M9HA 4KJMA 3M0DC 1PP9G 2O1KA 1T3UA 3WUVA 5APSA 1U7JA 1NHLA 1URQB 2QVAA 1BCCG 1OIPA 3KXDA 3NTNA 3AE5C 4I6MC 1MFZA 2Q9IA 5APYA 1FZCB 1BGYJ 3L71J 4C7NA 1ZMEC 3L70E 3NXSA 1FZEA 2BCCG 2N9BA 2NRGA 4N6JA 3TYYA 1VL2A 3K5BA 3H1JG 4N78E 4IL6E 1FZCA 3CPWO 2CPSA 2W6JH 3IR9A 1SQQE 3VMZA 2QA4P 1MFTA 4AYCA 3L75J 3KYQA 3KZIH 4OWFA 3ABVC 1FOSF 1RE3A 1KN7A 1WT6A 2YKQA 1GZLA 1JCDA 1LTJA 1NO4A 2E75D 2K3RA 2KSJA 3N7NA 4H44D 1PV3A 2OTLP 5E79E 4N3YB 4TLFA 1W5CE 2M3EA 3L71D 4D6TG 5BU8B 4NPEA 1HH0A 5AVZB 1Q2NA 4L73A 3I55P 4WB4A 1NTKG 2E5TA 3AEEC 2Q5UA 3FXEA 3RL0D 1KILC 5B66H 2YIUC 1SQQG 2FXOA 2YNYA 2XZRA 4BXLA 2L91A 1SQQD 4PJ0H 3L37A 2LXCB 1LGHB 2SPZA 3GLMA 1T8ZA 2A45H 3GW6A 1KQFB 5AVXB 1P84E 3RK2D 1GW4A 3MUDA 4DCKA 1T2KD 4XFJA 3H1HD 4DT0A 1DX7A 1FJPA 4BWNA 3CWBJ 1FZAA 5B5EH 3RK3B 1QX8A 3R2PA 1PPJG 2KS1A 2KLVA 1ZR4A 1LTBC 2LXBA 3MTUE 4ZKPA 1OW7A 1Q90D 2K1AA 3B5ND 3BRVB 1KB9I 1PGOA 2KS1B 2WSCH 2Q1KA 4O9BA 1G2CA 2NPSA 2KYVA 4I7ZB 3V2PA 1RF1C 5TISH 2OYIC 1NTZG 1FZFA 2FYUJ 2QM7A 1CI6A 1L0NG 1N7SD 2P10A 3OJAB 3WU2H 5KLVJ 1DIPA 3D6YA 1HBWA 3MP7B 3U59A 1EXJA 2YO3A 3H1HE 4Y28J 2W90A 5AW8B 1VQ6P 2HPCB 3RK3D 2FXMA 5KJ7A 1IK7A 5KAFH 1KQLA 3IAOA 3MD0A 3CX5H 1YTZI 3OAKA 3SFEC 3CC7P 1FDMA 3HE4B 1CZQA 4XA4A 2BASA 1OXZA 2XNDH 3IF4A 4BRYB 2YIUB 1NGMB 1FBMA 2PAJA 2QJKC 3HE4A 3VTPC 1VQPP 3PP5A 4H13C 1YJ9P 1QL1A 3MZWB 1SS1A 1Q86Q 2FY8A 3KQGA 1KB9D 1OW8A 2KUBA 1PGQA 1EDLA 1AA0A 1LTIC 2BEZF 2W6AA 3CCSP 3Q5PA 5KJ7C 1HWTC 5AVUB 3L73J 2R5BA 1BGYE 1MV8A 2O01H 1SQXD 2ZYAA 3C8VA 1DD3A 1FAVA 1NTKD 3QH9A 1OW6A 1YYCA 1JMMA 1S1CX 3CL3D 1SQPE 2XKMA 3H1KG 4GT1A 1N7SA 4I2LC 1GL2A 5CCHA 1BCCD 2ITAA 5CBNA 1L0LE 4UB6H 5K5GB 3CCJP 3H25A 2Y9YA 1GK4A 1ZOYC 2AEMA 3L72D 3Q2YA 3A7OA 2HFED 5AVWB 1N7SB 2M5AA 1GL2B 1KZUB 2HLOA 2Q3EA 3AE2C 3RL0C 2IZ0A 2YMKA 3T97B 4AQRD 4MN4C 3TGUG 1KD1Q 1FZCC 1J1DB 1N2DC 2QSIA 3H1IG 3E7KA 1LWUC 1S4XA 2YKOA 4UB8E 1KTMA 3V2NA 2IBZI 3AEDC 2W27A 1NTKE 2ZT9C 2D2CC 2M8RA 3FXDA 2K37A 3L70J 1EC5A 1SQPD 1USDA 2WSSH 3L72J 2HYNA 2V7QH 4OVNF 3V6IA 3CMEP 1NU1K 2KXPB 1AVYA 2B87A 2IPPA 3CX5I 3H1LJ 1JY2N 1GL2C 2YKPA 3M0AA 5CCGA 3G6EP 2VRSA 1M90Q 1KYOI 2IFMA 1VQ8P 1W2EA 5APQA 1AV1A 1NU1G 2DW3A 2B87B 1PIXA 2FYZA 2I1KA 4WY4D 2C9NY 3NFQA 5KLVK 1VQNP 2QJPC 2K88A 3L74G 1A02F 3RL0B 1M7LA 2Z5HA 2Y0CA 3FGAD 2IZ1A 2CPBA 1E5WA 2E42A 1VF5B 2P1JA 3H1JE 3W68A 4ZMDA 2AXTE 1NU1E 2RMZA 1HJ0A 1VQ4P 1TU3F 5CCHD 3RK2B 1EQ7A 1IK9A 4GOEA 3WMM0 1KQSO 1PGJA 4GKGA 1LTJB 2IFNA 1AQTA 2WPRA 1UIIA 3BCCJ 1PPJD 3FWNA 3H1ID 1RE4C 3P8CD 3M06A 4PV1C 1OZHA 2E76B 1SQBJ 2HR3A 2JP3A 3AE8C 4PJ0E 5CCGC 5M1BA 3BVHA 3CCRP 1BDCA 1HF9A 2Z5IA 2KZIA 2ZXXA 1KV4A 1OX3A 2XU6A 3B71A 4H13D 4R4MA 2AEJA 1BE3E 2N1TC 2J59M 1X9VA 1M1JB 1L0ND 4QMAA 3N4XA 4WVZA 2W8ZA 3AE1C 4Y99C 1OWAA 3A5TA 1X8YA 2YXRB 5B66E 1SVFA 5E79H 2QEXP 1SQVD 3BCCD 2W6BA 1VQLP 4GIFA 4HJGH 1SQPK 1LTAC 2E76D 2WWWA 1PP9E 1Q7YQ 1FS0E 1YQ3C 1Q81Q 1PPJE 3Q5SA 5CJ0A 2E74D 5AW4B 1KQGB 3CCUP 3VOPA 1AFOA 3M9BA 2WPQA 2JKVA 4ASVA 3M91A 2V4HA 2K9YA 2P7JA 1JNMA 4A7PA 1A02J 4HB1A 1VQ5P 1SQVJ 2B88A 1G2CB 2NPSD 2NPSB 3TNUA 3VYIA 1K73Q 4GOFA 3HTKA 1NAFA 1N73A 1CI6B 4HYTB 1L4AA 3TNUB 4Y99B 1PZQA 4OGQD 1R8EA 3HTKB 1N73B 5H2FH 2I8DA 1L4AB 3GF7A 2HPCA 3O6QA 1ZW0A 5AW6B 1GK6A 5KAFE 3F89A 2R3CA 1JOCA 4U3FE 2FBWC 3ITKA 2Q7CA 5AW9B 1FDOA 1M8OB 1H0TA 4JBZA 2WQYC 2KNCB 2O01J 4BRYA 3O6QB 3A0BE 2OYOA 2GA1A 2Y0DA 1BE3J 1EDIA 3I56P 2E75B 2E5YA 1LTJC 1NTZK 1LTTC 2KP8A 1J2JB 1S5LX 2I1JA 4L74A 1KYOH 1OMIA 2ZVNB 4EDFA 1IFDA 1NYHA 3L71E 3MIWA 3MGNA 1L0LG 4IFMA 1N7LA 1VF5C 3LIEA 1L4AD 1RH5B 4OH8B 3VN0A 4EIJA 1P84I 1PP9J 3CX5D 1T3JA 5BU5A 1ZR2A 1JY2O 2IDBA 1N7SC 3L35A 1SQBK 2BCCE 1GDTA 1RF0A 2YMYA 2ZFCA 1BGYG 3HRNA 1AVOA 3HD7C 3VMAA 3L74E 3BATA 3L71G 3U1AA 1KILE 2B9BA 2BCCJ 1IO4A 3CCLP 1MKMA 5KLIC 3TDKA 3H1JJ 3CXHD 1VQOP 1QVGO 3L4FA 1N86A 2C0XA 4H44C 3AEAC 4WWIA 1SQQK 2JWDA 5L8RJ 1Y8AA 3TK1A 4L75A 1GMJA 1WMKA 1RHZB 3H6PA 4RJTA 1Y47A 1X0TA 2WSFH 3Q1MA 3A0HH 1YJNP 1FJKA 4W7YA 2FXPA 4PD4E 1OVUA 4D6TJ 2OYIA 2YO2A 4I1LA 2E43A 2BCCD 2D2CB 2FFDA 1SQXJ 1NTME 3HUSA 2H89C 5KTBA 1QVFO 1NTKJ 3JSVC 1ZV8A 1MUUA 4W80A 1KC8Q 1NTMJ 2LR2A 3I5CA 3KHUA 4PD4D 3RBZA 1G1IA 1HUCA 2E74B 3JC22 1RY3A 2OGUA 5KAIH 1HGZA 3CXHI 1S3JA 4Z1MH 3B5NC 3SSUA 1RE3C 1M56D 2JR8A 4PD4H 4KT0J 3H1HJ 5B5EE 3CWBG 3SWKA 2ZYGA 1T6AA 4LC1A 1NTMD 2ZXEB 4U7JA 2PP6A 3L73D 4HH2A 3L70D 3G71P 1FDIA 1S72P 1ZP0C 2C0WA 2A06E 1KFNA 1NKNA 1OFCX 1SFCD 5AVRB 3RK3C 3TGUD 1NTZJ 3B4SA 2WT7A 1KMIZ 1IFNA 2N1TA 2FYUG 2POHA 3EFGA 1KYOD 4JQ0D 5AVSB 2FYNB 3EQ2A 3GHGB 5KLVG 2JWAA 1LNQA 2KOGA 1PL5A 2PFXA 2QJKB 1KILA 4KHXA 5AVQB 3V2RA 3V2QA 2Y9ZA 4U3FJ 3Q3DA 1JTHA 1SQPG 1USEA 1UIXA 1M1JA 1QLED 1JY3O 3GHGA 5CJ4A 2JEEA 4D6TE 3D71A 1Q82Q 1AJYA 2N9YB 5GTIE 1KILB 2WSEH 3CC4P 2PRRA 4ASWA 1DEEG 4WY4B 3OW2O 3H1KD 3U1CA 3R4YA 1JY3N 4NPDA 1HGVA 4AUWA 3RK2C 1JB0J 5KKZC 2L5GB 1VDFA 3P32A 2LKMA 2WSEJ 3FX0A 3VP8A 5AW7B 4B86A 4DJGA 1JY3P 1KYOE 5APVA 4U3FD 2K9JB 3S1KA 1P84D 3IN6A 3OA7A 5CCGD 3L73G 1NOHA 2QJPB 1VPCA 1HTLC 2R32A 2K9JA 3W67A 3VMYA 1N8RQ 1JEKA 3V4QA 3VP9A 2IBZE 3MHVA 3H1KJ 2RN0A 1J1EC 1PFIA 1NTKK 1ZXGA 2WSCJ 3B8EB 4YTPC 3LIDA 1BCCJ 2PGDA 1K05A 3H1KE 1IFJA 3H1LE 3CX5E 2BEQD 2FKWB 3GHGC 4H0LD 3UIAA 1EZVI 2D2CD 1NKZB 2R44A 2ZT9D 2ZT9B 1S9KE 1RQVA 4H0LB 1NU1D 3H1IJ 1L2PA 1J1EB 1RE4A 2B89A 2M0BA 2KNCA 3L75D 5AW0B 3L75G 3A0BH 1LT9C 2IYPA 1SQBD 2MKVA 1LTSC 3CI9A 3CXHE 3H1IE 3L74D 1J1DC 3LW5J 4R4LA 1FU1A 1L0LK 5KJ7D 4CPGA 1FZGA 3BRTB 5CCHC 1Y9BA 1SQXK 2KSEA 2Y0EA 4RESB 5KLIB 1CW5A 1DD4A 3QWOC 4IFDK 4PD4I 3HD7B 3H1LD 1S5LE 2R5DA 3A3YB 2A45G 4K3AA 1BDDA 1NU1J 3AEGC 4C46A 3USSA 2CK3H 1NH4A 2C9LY 3WUTA 1KB9E 1SQQJ 4HKZH 3L74J 5DJUB 1LT9B 1GU5A 3L75E 1IFMA 4C7RA 1YTZT 2OTJP 3AE7C 2M3BA 1BGYD 1K04A 4GDOA 3II6A 4JPZB 1NVOA 2E75C 2WSFJ 1M57D 3NMDA 4H13B 2GUVA 3BCCG 1M1JC 5CHXA 1BCCE 3CCQP 2OQQA 4ZNCA 1SQBG 1URQD 1U7MA 3L72E 3GG2A 1QL2A 1L4AC 1H0TB 2FFDB 1K8AQ 1SFCA 3L36A 1N73C 3HUSB 2XDJA 1JY2P 2E76C 3CCMP 4OGQB 1ZLLA 3CWBE 5GTHE 3L73E 1ZRTD 2A06G 1SFCB 1IFPA 2G3AA 2OTKE 1NWQA 1L0NJ 2A06D 5KLVD 3TGUE 1LTGC 1R5LA 1KFMA 2ZVOB 5AVYB 2V7QJ 1GW3A 2Q6QA 3P8MC 1YITP 2OYIB 1LT1A 3AE3C 3GMAA 1RF1B 3CCEP 3BASA 3PH0A 1YI2P 1JUNA 1G1JA 1JMBA 3CXHH 4WY4C 4XE5B 5KAIE 1RF0C 3VMXA 3MUDC 4D6TD 2UWJE 3O8ZA 4LGDE 3JCUH 1W2BO 2FYUK 1ZN5A 2QG4A 1SFCC 2AEFA 2WPVB 4GODA 4UB8H 3CWBD 4YPCA 1LJ2A 2O1JA 3KPEA 3ZDMA 2WT7B 5KLVE 4YXWH 1D7MA 2FYNC 1OVRA 2N1TB 4JYBA 5APWA 3AE6C 3EWKA 2QM8A 3H1JD 2YXQB 3PJSK 3SFDC 3G9RA 4DZOA 2GM4A 1KILD 3WU2E 3P8CE 2GUSA 1SLQA 2RKLA 4C7NB 1JTHB 3AEFC 5BVZA 3H32B 4RKUJ 1YHQP 1DH3A 1LP1A 3RK3E 4RO0A 5EFWB 4DOJA 2O3JA 5CBOA 3H32A 2JO1A 2H8PD 3PTZA 1BE3G 1LP1B 4WY4A 3LW5H 1IJDB 1BE3D 2O01N 4NPFX 2KZJA 1L0NE 3TGUJ 3RBXA 1VQKP 1OVVA 1KB9H 1WRGA 3IFMA 1GTWA 1FOSE 1L0LJ 1X79B 2JJLA 3V4WA 2QIWA 2XV5A 3HUSC 4IOIH 2OYHC 3BCCE 1PP9D 3Q5RA 3C1LA 2FFDC 1RQUA 4PV1D 3A0HE 1EDJA 1K9MQ 1SQBE 3L70G 3L72G 1SQXE 2A45I 1URQC 2KI7B 3G3ZA 3H1LG 5GTHH 4EYYQ 2FYUD 5AVTB 2WVRA 5AW5B 1GD2E 1IZNB 1S2EA 5DJTB 3RGUA 1VQ7P 1JO5A 2MJZA 1FZBA 1EXIA 2N1TD 1NTMK 1L0LD 2QRXA 4H0LC 1KORA 2ZJSE 1XTCC 1BSNA 1LWUB 1FC2C 1U57A 4UB6E 4W7ZA 3AE9C 2HG5D 5TJHA 4EI2A 3M0DA 1H88A 1H89A 1AQ5A 1GL2D 1IFIA 3KZIE 4IFFA 4H44B 2KK7A 1LWUA 3GF3A 2RH0A 4PV1B 2KB7P 1FE6A 1S5LH 1T2KC 3D6ZA 2QE7H 2H7HA 2J5UA 1NAYA 2NPSC 1SQXG 1HVVA 3EFFK 3D70A 2WITA 1NJIQ 5APUA 3RL0g 2FYUE 2G8YA 1NTMG 2KIKA 2W83C 3HD7D 2KLUA 4I7ZC 3E1IA 4JF7A 5AW1B 3HE5A 5GTIH 3HD7A 1VF5D 3P7KA 1NTZE 1DEBA 3S9OA 1L0NK 1YJWP 2IX7C 2QJYC 5APTA 1VQMP 1BSHA 3HE5B 3G4SP 5KKZB 1EZVD 3CD6P 1YBKA 1JCCA 2IYOA 1CSBA 2P58A 3WUUA 1LT9A 4IL6H 1E79H 1PGPA 3F5HA 2P2UA 3H1HG 5AW3B 5H2FE 5APXA 2OYHB 1ZRTE 3AE4C 2R3SA 3M9QA 1YQ4C 2WMMA 2NZ2A 2WPSA 2XNXA 3AECC 1IC2A 4JYCA 2Z4EA 2JDIH 2WZ7A 4LLHA 2AXCA 2OYHA 1M1KQ 4TT3H 2Q3IA 1SP4A 1SQVK 1QGKB 1NTZD 3CCVP 4EOTA 1XTGB 2J58A 4M3LA 3TF5A 1Z56A 2AXTH 2H88C 5TISE 1X22A 4ZKUA 1EDKA 2HODA 1EZVE 1SQVG 2IBZD 3B5NA 3V5BA 3AEBC 2IBZG 4U3FG 3TSIA 1SQPJ
chains in the Genus database with same CATH topology
1MZ9A 4WBAA 2HODB 3B5NB 2P67A 5AVVB 1S9KD 1GU4A 3A2AA 2OYIA 1RF1A 3SWFA 3T97A 1H8AA 5AW2B 3C9IA 2OARA 3SWYA 4N78D 5CMZA 3CLQA 3KDPB 2H43A 2WTYA 1HJBA 1URQA 3M9HA 3M0DC 2O1KA 1T3UA 5APSA 1NHLA 1URQB 3NTNA 4I6MC 2Q9IA 1MFZA 5APYA 1FZCB 4C7NA 3NXSA 3TYYA 1FZEA 2N9BA 4N6JA 4N78E 1FZCA 2CPSA 3IR9A 3VMZA 4AYCA 1FOSF 3KYQA 1RE3A 1WT6A 2YKQA 1GZLA 1JCDA 1LTJA 1NO4A 2KSJA 3N7NA 4N3YB 5BU8B 1HH0A 5AVZB 4WB4A 3RL0D 2Q5UA 1KILC 2YNYA 2XZRA 3L37A 1LGHB 1T8ZA 2A45H 5AVXB 3RK2D 1GW4A 3MUDA 1DX7A 1FJPA 1FZAA 3RK3B 3R2PA 2KLVA 1ZR4A 1LTBC 3MTUE 4ZKPA 3B5ND 3BRVB 2WSCH 4O9BA 1RF1C 1G2CA 2NPSA 2KYVA 3V2PA 2OYIC 1FZFA 2QM7A 1CI6A 1N7SD 3OJAB 1HBWA 3U59A 2YO3A 5AW8B 2HPCB 3RK3D 2FXMA 5KJ7A 1KQLA 3MD0A 1YTZI 3OAKA 1FDMA 3HE4B 1CZQA 4XA4A 2BASA 1OXZA 1FBMA 2PAJA 3HE4A 3VTPC 3PP5A 1QL1A 3KQGA 1LTIC 2W6AA 1HWTC 5KJ7C 5AVUB 2R5BA 2O01H 1MV8A 1FAVA 1YYCA 1JMMA 4GT1A 3CL3D 2XKMA 4I2LC 5CCHA 1N7SA 1GL2A 1GK4A 3A7OA 2HFED 5AVWB 1N7SB 1GL2B 1KZUB 2HLOA 3RL0C 4AQRD 1FZCC 1J1DB 1N2DC 1LWUC 2YKOA 3V2NA 2W27A 2M8RA 2HYNA 1NU1K 2IPPA 2C9NY 1JY2N 1GL2C 2YKPA 3M0AA 5CCGA 2VRSA 2IFMA 1W2EA 5APQA 2FYZA 2I1KA 4WY4D 3NFQA 5KLVK 1A02F 3RL0B 1M7LA 2Z5HA 2CPBA 1E5WA 2E42A 2P1JA 5CCHD 3RK2B 1EQ7A 1IK9A 3WMM0 4GKGA 1LTJB 2IFNA 2WPRA 3P8CD 1CW5A 1RE4C 3M06A 5CCGC 3BVHA 2Z5IA 2XU6A 2N1TC 2J59M 1X9VA 1M1JB 3A5TA 3N4XA 1JNMA 4Y99C 1OWAA 1X8YA 1SVFA 2W6BA 4GIFA 1SQPK 1LTAC 2WWWA 5CJ0A 5AW4B 3VOPA 1AFOA 3M9BA 2WPQA 3M91A 2P7JA 1A02J 1G2CB 2NPSD 2NPSB 3TNUA 3VYIA 3HTKA 1NAFA 1N73A 1CI6B 4HYTB 1L4AA 3TNUB 4Y99B 3HTKB 1N73B 1L4AB 2HPCA 5AW6B 1GK6A 2R3CA 1JOCA 2Q7CA 5AW9B 2OYHC 2KP8A 1LTJC 1NTZK 1LTTC 1J2JB 2I1JA 1IFDA 3MIWA 4IFMA 3MGNA 4EIJA 1N7LA 3LIEA 3VN0A 1L4AD 4OH8B 1T2KD 1ZR2A 5BU5A 1T3JA 1JY2O 1N7SC 3L35A 1SQBK 1GDTA 1RF0A 2YMYA 2ZFCA 3HRNA 3HD7C 3U1AA 3BATA 1IO4A 1JUNA 3L4FA 1N86A 2C0XA 1SQQK 3TK1A 3H6PA 2WSFH 1FJKA 4W7YA 2E43A 2YO2A 4I1LA 2FFDA 3HUSA 5KTBA 1ZV8A 1MUUA 4W80A 3I5CA 1G1IA 1HUCA 1RY3A 1HGZA 3B5NC 1RE3C 4LC1A 2ZXEB 2PP6A 4HH2A 2C0WA 5AVRB 1KFNA 1NKNA 1SFCD 3RK3C 2WT7A 3EFGA 1IFNA 2N1TA 2POHA 5AVSB 3EQ2A 3GHGB 2KOGA 3V2RA 3V2QA 1KILA 4KHXA 5AVQB 1JTHA 3GHGA 1M1JA 5CJ4A 1JY3O 2JEEA 1KILB 2WSEH 4WY4B 4AUWA 3U1CA 1JY3N 1HGVA 3RK2C 2L5GB 1VDFA 3P32A 2LKMA 3VP8A 4B86A 5AW7B 1JY3P 5APVA 3OA7A 5CCGD 1NOHA 1VPCA 1HTLC 2R32A 3VMYA 3V4QA 3VP9A 1J1EC 1PFIA 1NTKK 3B8EB 3LIDA 1IFJA 2FKWB 3GHGC 3UIAA 1S9KE 1NKZB 1RE4A 1J1EB 5AW0B 1LT9C 3CI9A 1LTSC 5KJ7D 1J1DC 1FU1A 1L0LK 1FZGA 3BRTB 5CCHC 1SQXK 4RESB 4IFDK 3HD7B 2R5DA 3A3YB 2A45G 4C46A 1NH4A 2C9LY 1GU5A 1LT9B 1IFMA 4C7RA 1YTZT 2M3BA 3II6A 3NMDA 2GUVA 1M1JC 5CHXA 1URQD 1QL2A 1L4AC 2FFDB 1N73C 1SFCA 3L36A 3HUSB 2XDJA 1JY2P 1ZLLA 1SFCB 1NWQA 1LTGC 1KFMA 5AVYB 1GW3A 3P8MC 2OYIB 1RF1B 3BASA 1G1JA 4WY4C 4XE5B 1RF0C 3VMXA 3O8ZA 4LGDE 2FYUK 1ZN5A 1SFCC 2O1JA 3KPEA 2WT7B 2N1TB 4JYBA 5APWA 2QM8A 4DZOA 2GM4A 1KILD 3P8CE 2GUSA 1SLQA 4C7NB 5BVZA 1JTHB 3H32B 1DH3A 4DOJA 3H32A 2H8PD 4WY4A 3LW5H 1IJDB 1WRGA 3IFMA 1GTWA 1FOSE 1X79B 2JJLA 3V4WA 2XV5A 3HUSC 2FFDC 2A45I 1URQC 3G3ZA 5AVTB 1GD2E 5AW5B 1JO5A 2MJZA 1FZBA 2N1TD 1NTMK 1XTCC 1LWUB 4W7ZA 2HG5D 1H89A 1H88A 3M0DA 1AQ5A 1GL2D 1IFIA 4IFFA 1LWUA 2KB7P 1T2KC 2H7HA 2NPSC 1HVVA 2WITA 5APUA 5AW1B 3HD7D 3E1IA 4JF7A 3HE5A 3HD7A 3P7KA 1DEBA 1L0NK 2IX7C 5APTA 3HE5B 1JCCA 1CSBA 1LT9A 5AW3B 2P2UA 5APXA 2OYHB 3M9QA 2WPSA 2XNXA 1IC2A 4JYCA 2Z4EA 2WZ7A 4LLHA 2OYHA 2Q3IA 1SP4A 1SQVK 4EOTA 1XTGB 2J58A 4M3LA 1Z56A 4ZKUA 2HODA 3B5NA 3V5BA 3TSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LGH B;  1JMM A;  1KZU B;  1IJD B;  2FKW B;  1NKZ B;  1DX7 A;  3WMM 0;  1WRG A;  1JO5 A; 
#chains in the Genus database with same CATH topology
 2QJY B;  3PHL A;  1MZ9 A;  4WBA A;  2HOD B;  1YIJ P;  3B5N B;  3PLN A;  1VQ9 P;  2P67 A;  1P84 H;  3S4R A;  4YXD C;  1EZV G;  1SQV E;  2E74 C;  2M5A B;  3A2A A;  4L76 A;  5AVV B;  1S9K D;  3SWF A;  1GU4 A;  3T97 A;  1RF1 A;  1H8A A;  1R5S A;  3PRJ A;  5AW2 B;  3C9I A;  4IL6 X;  2ZAE B;  2OAR A;  3SWY A;  3CC2 P;  1JM0 A;  4N78 D;  5C39 A;  5CMZ A;  4OGQ C;  3FWL A;  3CLQ A;  3JCU E;  3KDP B;  2H43 A;  2WTY A;  3E1R A;  1HJB A;  4K35 A;  1URQ A;  1QEX A;  3CMA P;  2ZYD A;  3M9H A;  4KJM A;  3M0D C;  1PP9 G;  2O1K A;  1T3U A;  3WUV A;  5APS A;  1U7J A;  1NHL A;  1URQ B;  2QVA A;  1BCC G;  1OIP A;  3KXD A;  3NTN A;  3AE5 C;  4I6M C;  1MFZ A;  2Q9I A;  5APY A;  1FZC B;  1BGY J;  3L71 J;  4C7N A;  1ZME C;  3L70 E;  3NXS A;  1FZE A;  2BCC G;  2N9B A;  2NRG A;  4N6J A;  3TYY A;  1VL2 A;  3K5B A;  3H1J G;  4N78 E;  4IL6 E;  1FZC A;  3CPW O;  2CPS A;  2W6J H;  3IR9 A;  1SQQ E;  3VMZ A;  2QA4 P;  1MFT A;  4AYC A;  3L75 J;  3KYQ A;  3KZI H;  4OWF A;  3ABV C;  1FOS F;  1RE3 A;  1KN7 A;  1WT6 A;  2YKQ A;  1GZL A;  1JCD A;  1LTJ A;  1NO4 A;  2E75 D;  2K3R A;  2KSJ A;  3N7N A;  4H44 D;  1PV3 A;  2OTL P;  5E79 E;  4N3Y B;  4TLF A;  1W5C E;  2M3E A;  3L71 D;  4D6T G;  5BU8 B;  4NPE A;  1HH0 A;  5AVZ B;  1Q2N A;  4L73 A;  3I55 P;  4WB4 A;  1NTK G;  2E5T A;  3AEE C;  2Q5U A;  3FXE A;  3RL0 D;  1KIL C;  5B66 H;  2YIU C;  1SQQ G;  2FXO A;  2YNY A;  2XZR A;  4BXL A;  2L91 A;  1SQQ D;  4PJ0 H;  3L37 A;  2LXC B;  1LGH B;  2SPZ A;  3GLM A;  1T8Z A;  2A45 H;  3GW6 A;  1KQF B;  5AVX B;  1P84 E;  3RK2 D;  1GW4 A;  3MUD A;  4DCK A;  1T2K D;  4XFJ A;  3H1H D;  4DT0 A;  1DX7 A;  1FJP A;  4BWN A;  3CWB J;  1FZA A;  5B5E H;  3RK3 B;  1QX8 A;  3R2P A;  1PPJ G;  2KS1 A;  2KLV A;  1ZR4 A;  1LTB C;  2LXB A;  3MTU E;  4ZKP A;  1OW7 A;  1Q90 D;  2K1A A;  3B5N D;  3BRV B;  1KB9 I;  1PGO A;  2KS1 B;  2WSC H;  2Q1K A;  4O9B A;  1G2C A;  2NPS A;  2KYV A;  4I7Z B;  3V2P A;  1RF1 C;  5TIS H;  2OYI C;  1NTZ G;  1FZF A;  2FYU J;  2QM7 A;  1CI6 A;  1L0N G;  1N7S D;  2P10 A;  3OJA B;  3WU2 H;  5KLV J;  1DIP A;  3D6Y A;  1HBW A;  3MP7 B;  3U59 A;  1EXJ A;  2YO3 A;  3H1H E;  4Y28 J;  2W90 A;  5AW8 B;  1VQ6 P;  2HPC B;  3RK3 D;  2FXM A;  5KJ7 A;  1IK7 A;  5KAF H;  1KQL A;  3IAO A;  3MD0 A;  3CX5 H;  1YTZ I;  3OAK A;  3SFE C;  3CC7 P;  1FDM A;  3HE4 B;  1CZQ A;  4XA4 A;  2BAS A;  1OXZ A;  2XND H;  3IF4 A;  4BRY B;  2YIU B;  1NGM B;  1FBM A;  2PAJ A;  2QJK C;  3HE4 A;  3VTP C;  1VQP P;  3PP5 A;  4H13 C;  1YJ9 P;  1QL1 A;  3MZW B;  1SS1 A;  1Q86 Q;  2FY8 A;  3KQG A;  1KB9 D;  1OW8 A;  2KUB A;  1PGQ A;  1EDL A;  1AA0 A;  1LTI C;  2BEZ F;  2W6A A;  3CCS P;  3Q5P A;  5KJ7 C;  1HWT C;  5AVU B;  3L73 J;  2R5B A;  1BGY E;  1MV8 A;  2O01 H;  1SQX D;  2ZYA A;  3C8V A;  1DD3 A;  1FAV A;  1NTK D;  3QH9 A;  1OW6 A;  1YYC A;  1JMM A;  1S1C X;  3CL3 D;  1SQP E;  2XKM A;  3H1K G;  4GT1 A;  1N7S A;  4I2L C;  1GL2 A;  5CCH A;  1BCC D;  2ITA A;  5CBN A;  1L0L E;  4UB6 H;  5K5G B;  3CCJ P;  3H25 A;  2Y9Y A;  1GK4 A;  1ZOY C;  2AEM A;  3L72 D;  3Q2Y A;  3A7O A;  2HFE D;  5AVW B;  1N7S B;  2M5A A;  1GL2 B;  1KZU B;  2HLO A;  2Q3E A;  3AE2 C;  3RL0 C;  2IZ0 A;  2YMK A;  3T97 B;  4AQR D;  4MN4 C;  3TGU G;  1KD1 Q;  1FZC C;  1J1D B;  1N2D C;  2QSI A;  3H1I G;  3E7K A;  1LWU C;  1S4X A;  2YKO A;  4UB8 E;  1KTM A;  3V2N A;  2IBZ I;  3AED C;  2W27 A;  1NTK E;  2ZT9 C;  2D2C C;  2M8R A;  3FXD A;  2K37 A;  3L70 J;  1EC5 A;  1SQP D;  1USD A;  2WSS H;  3L72 J;  2HYN A;  2V7Q H;  4OVN F;  3V6I A;  3CME P;  1NU1 K;  2KXP B;  1AVY A;  2B87 A;  2IPP A;  3CX5 I;  3H1L J;  1JY2 N;  1GL2 C;  2YKP A;  3M0A A;  5CCG A;  3G6E P;  2VRS A;  1M90 Q;  1KYO I;  2IFM A;  1VQ8 P;  1W2E A;  5APQ A;  1AV1 A;  1NU1 G;  2DW3 A;  2B87 B;  1PIX A;  2FYZ A;  2I1K A;  4WY4 D;  2C9N Y;  3NFQ A;  5KLV K;  1VQN P;  2QJP C;  2K88 A;  3L74 G;  1A02 F;  3RL0 B;  1M7L A;  2Z5H A;  2Y0C A;  3FGA D;  2IZ1 A;  2CPB A;  1E5W A;  2E42 A;  1VF5 B;  2P1J A;  3H1J E;  3W68 A;  4ZMD A;  2AXT E;  1NU1 E;  2RMZ A;  1HJ0 A;  1VQ4 P;  1TU3 F;  5CCH D;  3RK2 B;  1EQ7 A;  1IK9 A;  4GOE A;  3WMM 0;  1KQS O;  1PGJ A;  4GKG A;  1LTJ B;  2IFN A;  1AQT A;  2WPR A;  1UII A;  3BCC J;  1PPJ D;  3FWN A;  3H1I D;  1RE4 C;  3P8C D;  3M06 A;  4PV1 C;  1OZH A;  2E76 B;  1SQB J;  2HR3 A;  2JP3 A;  3AE8 C;  4PJ0 E;  5CCG C;  5M1B A;  3BVH A;  3CCR P;  1BDC A;  1HF9 A;  2Z5I A;  2KZI A;  2ZXX A;  1KV4 A;  1OX3 A;  2XU6 A;  3B71 A;  4H13 D;  4R4M A;  2AEJ A;  1BE3 E;  2N1T C;  2J59 M;  1X9V A;  1M1J B;  1L0N D;  4QMA A;  3N4X A;  4WVZ A;  2W8Z A;  3AE1 C;  4Y99 C;  1OWA A;  3A5T A;  1X8Y A;  2YXR B;  5B66 E;  1SVF A;  5E79 H;  2QEX P;  1SQV D;  3BCC D;  2W6B A;  1VQL P;  4GIF A;  4HJG H;  1SQP K;  1LTA C;  2E76 D;  2WWW A;  1PP9 E;  1Q7Y Q;  1FS0 E;  1YQ3 C;  1Q81 Q;  1PPJ E;  3Q5S A;  5CJ0 A;  2E74 D;  5AW4 B;  1KQG B;  3CCU P;  3VOP A;  1AFO A;  3M9B A;  2WPQ A;  2JKV A;  4ASV A;  3M91 A;  2V4H A;  2K9Y A;  2P7J A;  1JNM A;  4A7P A;  1A02 J;  4HB1 A;  1VQ5 P;  1SQV J;  2B88 A;  1G2C B;  2NPS D;  2NPS B;  3TNU A;  3VYI A;  1K73 Q;  4GOF A;  3HTK A;  1NAF A;  1N73 A;  1CI6 B;  4HYT B;  1L4A A;  3TNU B;  4Y99 B;  1PZQ A;  4OGQ D;  1R8E A;  3HTK B;  1N73 B;  5H2F H;  2I8D A;  1L4A B;  3GF7 A;  2HPC A;  3O6Q A;  1ZW0 A;  5AW6 B;  1GK6 A;  5KAF E;  3F89 A;  2R3C A;  1JOC A;  4U3F E;  2FBW C;  3ITK A;  2Q7C A;  5AW9 B;  1FDO A;  1M8O B;  1H0T A;  4JBZ A;  2WQY C;  2KNC B;  2O01 J;  4BRY A;  3O6Q B;  3A0B E;  2OYO A;  2GA1 A;  2Y0D A;  1BE3 J;  1EDI A;  3I56 P;  2E75 B;  2E5Y A;  1LTJ C;  1NTZ K;  1LTT C;  2KP8 A;  1J2J B;  1S5L X;  2I1J A;  4L74 A;  1KYO H;  1OMI A;  2ZVN B;  4EDF A;  1IFD A;  1NYH A;  3L71 E;  3MIW A;  3MGN A;  1L0L G;  4IFM A;  1N7L A;  1VF5 C;  3LIE A;  1L4A D;  1RH5 B;  4OH8 B;  3VN0 A;  4EIJ A;  1P84 I;  1PP9 J;  3CX5 D;  1T3J A;  5BU5 A;  1ZR2 A;  1JY2 O;  2IDB A;  1N7S C;  3L35 A;  1SQB K;  2BCC E;  1GDT A;  1RF0 A;  2YMY A;  2ZFC A;  1BGY G;  3HRN A;  1AVO A;  3HD7 C;  3VMA A;  3L74 E;  3BAT A;  3L71 G;  3U1A A;  1KIL E;  2B9B A;  2BCC J;  1IO4 A;  3CCL P;  1MKM A;  5KLI C;  3TDK A;  3H1J J;  3CXH D;  1VQO P;  1QVG O;  3L4F A;  1N86 A;  2C0X A;  4H44 C;  3AEA C;  4WWI A;  1SQQ K;  2JWD A;  5L8R J;  1Y8A A;  3TK1 A;  4L75 A;  1GMJ A;  1WMK A;  1RHZ B;  3H6P A;  4RJT A;  1Y47 A;  1X0T A;  2WSF H;  3Q1M A;  3A0H H;  1YJN P;  1FJK A;  4W7Y A;  2FXP A;  4PD4 E;  1OVU A;  4D6T J;  2OYI A;  2YO2 A;  4I1L A;  2E43 A;  2BCC D;  2D2C B;  2FFD A;  1SQX J;  1NTM E;  3HUS A;  2H89 C;  5KTB A;  1QVF O;  1NTK J;  3JSV C;  1ZV8 A;  1MUU A;  4W80 A;  1KC8 Q;  1NTM J;  2LR2 A;  3I5C A;  3KHU A;  4PD4 D;  3RBZ A;  1G1I A;  1HUC A;  2E74 B;  3JC2 2;  1RY3 A;  2OGU A;  5KAI H;  1HGZ A;  3CXH I;  1S3J A;  4Z1M H;  3B5N C;  3SSU A;  1RE3 C;  1M56 D;  2JR8 A;  4PD4 H;  4KT0 J;  3H1H J;  5B5E E;  3CWB G;  3SWK A;  2ZYG A;  1T6A A;  4LC1 A;  1NTM D;  2ZXE B;  4U7J A;  2PP6 A;  3L73 D;  4HH2 A;  3L70 D;  3G71 P;  1FDI A;  1S72 P;  1ZP0 C;  2C0W A;  2A06 E;  1KFN A;  1NKN A;  1OFC X;  1SFC D;  5AVR B;  3RK3 C;  3TGU D;  1NTZ J;  3B4S A;  2WT7 A;  1KMI Z;  1IFN A;  2N1T A;  2FYU G;  2POH A;  3EFG A;  1KYO D;  4JQ0 D;  5AVS B;  2FYN B;  3EQ2 A;  3GHG B;  5KLV G;  2JWA A;  1LNQ A;  2KOG A;  1PL5 A;  2PFX A;  2QJK B;  1KIL A;  4KHX A;  5AVQ B;  3V2R A;  3V2Q A;  2Y9Z A;  4U3F J;  3Q3D A;  1JTH A;  1SQP G;  1USE A;  1UIX A;  1M1J A;  1QLE D;  1JY3 O;  3GHG A;  5CJ4 A;  2JEE A;  4D6T E;  3D71 A;  1Q82 Q;  1AJY A;  2N9Y B;  5GTI E;  1KIL B;  2WSE H;  3CC4 P;  2PRR A;  4ASW A;  1DEE G;  4WY4 B;  3OW2 O;  3H1K D;  3U1C A;  3R4Y A;  1JY3 N;  4NPD A;  1HGV A;  4AUW A;  3RK2 C;  1JB0 J;  5KKZ C;  2L5G B;  1VDF A;  3P32 A;  2LKM A;  2WSE J;  3FX0 A;  3VP8 A;  5AW7 B;  4B86 A;  4DJG A;  1JY3 P;  1KYO E;  5APV A;  4U3F D;  2K9J B;  3S1K A;  1P84 D;  3IN6 A;  3OA7 A;  5CCG D;  3L73 G;  1NOH A;  2QJP B;  1VPC A;  1HTL C;  2R32 A;  2K9J A;  3W67 A;  3VMY A;  1N8R Q;  1JEK A;  3V4Q A;  3VP9 A;  2IBZ E;  3MHV A;  3H1K J;  2RN0 A;  1J1E C;  1PFI A;  1NTK K;  1ZXG A;  2WSC J;  3B8E B;  4YTP C;  3LID A;  1BCC J;  2PGD A;  1K05 A;  3H1K E;  1IFJ A;  3H1L E;  3CX5 E;  2BEQ D;  2FKW B;  3GHG C;  4H0L D;  3UIA A;  1EZV I;  2D2C D;  1NKZ B;  2R44 A;  2ZT9 D;  2ZT9 B;  1S9K E;  1RQV A;  4H0L B;  1NU1 D;  3H1I J;  1L2P A;  1J1E B;  1RE4 A;  2B89 A;  2M0B A;  2KNC A;  3L75 D;  5AW0 B;  3L75 G;  3A0B H;  1LT9 C;  2IYP A;  1SQB D;  2MKV A;  1LTS C;  3CI9 A;  3CXH E;  3H1I E;  3L74 D;  1J1D C;  3LW5 J;  4R4L A;  1FU1 A;  1L0L K;  5KJ7 D;  4CPG A;  1FZG A;  3BRT B;  5CCH C;  1Y9B A;  1SQX K;  2KSE A;  2Y0E A;  4RES B;  5KLI B;  1CW5 A;  1DD4 A;  3QWO C;  4IFD K;  4PD4 I;  3HD7 B;  3H1L D;  1S5L E;  2R5D A;  3A3Y B;  2A45 G;  4K3A A;  1BDD A;  1NU1 J;  3AEG C;  4C46 A;  3USS A;  2CK3 H;  1NH4 A;  2C9L Y;  3WUT A;  1KB9 E;  1SQQ J;  4HKZ H;  3L74 J;  5DJU B;  1LT9 B;  1GU5 A;  3L75 E;  1IFM A;  4C7R A;  1YTZ T;  2OTJ P;  3AE7 C;  2M3B A;  1BGY D;  1K04 A;  4GDO A;  3II6 A;  4JPZ B;  1NVO A;  2E75 C;  2WSF J;  1M57 D;  3NMD A;  4H13 B;  2GUV A;  3BCC G;  1M1J C;  5CHX A;  1BCC E;  3CCQ P;  2OQQ A;  4ZNC A;  1SQB G;  1URQ D;  1U7M A;  3L72 E;  3GG2 A;  1QL2 A;  1L4A C;  1H0T B;  2FFD B;  1K8A Q;  1SFC A;  3L36 A;  1N73 C;  3HUS B;  2XDJ A;  1JY2 P;  2E76 C;  3CCM P;  4OGQ B;  1ZLL A;  3CWB E;  5GTH E;  3L73 E;  1ZRT D;  2A06 G;  1SFC B;  1IFP A;  2G3A A;  2OTK E;  1NWQ A;  1L0N J;  2A06 D;  5KLV D;  3TGU E;  1LTG C;  1R5L A;  1KFM A;  2ZVO B;  5AVY B;  2V7Q J;  1GW3 A;  2Q6Q A;  3P8M C;  1YIT P;  2OYI B;  1LT1 A;  3AE3 C;  3GMA A;  1RF1 B;  3CCE P;  3BAS A;  3PH0 A;  1YI2 P;  1JUN A;  1G1J A;  1JMB A;  3CXH H;  4WY4 C;  4XE5 B;  5KAI E;  1RF0 C;  3VMX A;  3MUD C;  4D6T D;  2UWJ E;  3O8Z A;  4LGD E;  3JCU H;  1W2B O;  2FYU K;  1ZN5 A;  2QG4 A;  1SFC C;  2AEF A;  2WPV B;  4GOD A;  4UB8 H;  3CWB D;  4YPC A;  1LJ2 A;  2O1J A;  3KPE A;  3ZDM A;  2WT7 B;  5KLV E;  4YXW H;  1D7M A;  2FYN C;  1OVR A;  2N1T B;  4JYB A;  5APW A;  3AE6 C;  3EWK A;  2QM8 A;  3H1J D;  2YXQ B;  3PJS K;  3SFD C;  3G9R A;  4DZO A;  2GM4 A;  1KIL D;  3WU2 E;  3P8C E;  2GUS A;  1SLQ A;  2RKL A;  4C7N B;  1JTH B;  3AEF C;  5BVZ A;  3H32 B;  4RKU J;  1YHQ P;  1DH3 A;  1LP1 A;  3RK3 E;  4RO0 A;  5EFW B;  4DOJ A;  2O3J A;  5CBO A;  3H32 A;  2JO1 A;  2H8P D;  3PTZ A;  1BE3 G;  1LP1 B;  4WY4 A;  3LW5 H;  1IJD B;  1BE3 D;  2O01 N;  4NPF X;  2KZJ A;  1L0N E;  3TGU J;  3RBX A;  1VQK P;  1OVV A;  1KB9 H;  1WRG A;  3IFM A;  1GTW A;  1FOS E;  1L0L J;  1X79 B;  2JJL A;  3V4W A;  2QIW A;  2XV5 A;  3HUS C;  4IOI H;  2OYH C;  3BCC E;  1PP9 D;  3Q5R A;  3C1L A;  2FFD C;  1RQU A;  4PV1 D;  3A0H E;  1EDJ A;  1K9M Q;  1SQB E;  3L70 G;  3L72 G;  1SQX E;  2A45 I;  1URQ C;  2KI7 B;  3G3Z A;  3H1L G;  5GTH H;  4EYY Q;  2FYU D;  5AVT B;  2WVR A;  5AW5 B;  1GD2 E;  1IZN B;  1S2E A;  5DJT B;  3RGU A;  1VQ7 P;  1JO5 A;  2MJZ A;  1FZB A;  1EXI A;  2N1T D;  1NTM K;  1L0L D;  2QRX A;  4H0L C;  1KOR A;  2ZJS E;  1XTC C;  1BSN A;  1LWU B;  1FC2 C;  1U57 A;  4UB6 E;  4W7Z A;  3AE9 C;  2HG5 D;  5TJH A;  4EI2 A;  3M0D A;  1H88 A;  1H89 A;  1AQ5 A;  1GL2 D;  1IFI A;  3KZI E;  4IFF A;  4H44 B;  2KK7 A;  1LWU A;  3GF3 A;  2RH0 A;  4PV1 B;  2KB7 P;  1FE6 A;  1S5L H;  1T2K C;  3D6Z A;  2QE7 H;  2H7H A;  2J5U A;  1NAY A;  2NPS C;  1SQX G;  1HVV A;  3EFF K;  3D70 A;  2WIT A;  1NJI Q;  5APU A;  3RL0 g;  2FYU E;  2G8Y A;  1NTM G;  2KIK A;  2W83 C;  3HD7 D;  2KLU A;  4I7Z C;  3E1I A;  4JF7 A;  5AW1 B;  3HE5 A;  5GTI H;  3HD7 A;  1VF5 D;  3P7K A;  1NTZ E;  1DEB A;  3S9O A;  1L0N K;  1YJW P;  2IX7 C;  2QJY C;  5APT A;  1VQM P;  1BSH A;  3HE5 B;  3G4S P;  5KKZ B;  1EZV D;  3CD6 P;  1YBK A;  1JCC A;  2IYO A;  1CSB A;  2P58 A;  3WUU A;  1LT9 A;  4IL6 H;  1E79 H;  1PGP A;  3F5H A;  2P2U A;  3H1H G;  5AW3 B;  5H2F E;  5APX A;  2OYH B;  1ZRT E;  3AE4 C;  2R3S A;  3M9Q A;  1YQ4 C;  2WMM A;  2NZ2 A;  2WPS A;  2XNX A;  3AEC C;  1IC2 A;  4JYC A;  2Z4E A;  2JDI H;  2WZ7 A;  4LLH A;  2AXC A;  2OYH A;  1M1K Q;  4TT3 H;  2Q3I A;  1SP4 A;  1SQV K;  1QGK B;  1NTZ D;  3CCV P;  4EOT A;  1XTG B;  2J58 A;  4M3L A;  3TF5 A;  1Z56 A;  2AXT H;  2H88 C;  5TIS E;  1X22 A;  4ZKU A;  1EDK A;  2HOD A;  1EZV E;  1SQV G;  2IBZ D;  3B5N A;  3V5B A;  3AEB C;  2IBZ G;  4U3F G;  3TSI A;  1SQP J; 
#chains in the Genus database with same CATH homology
 1MZ9 A;  4WBA A;  2HOD B;  3B5N B;  2P67 A;  5AVV B;  1S9K D;  1GU4 A;  3A2A A;  2OYI A;  1RF1 A;  3SWF A;  3T97 A;  1H8A A;  5AW2 B;  3C9I A;  2OAR A;  3SWY A;  4N78 D;  5CMZ A;  3CLQ A;  3KDP B;  2H43 A;  2WTY A;  1HJB A;  1URQ A;  3M9H A;  3M0D C;  2O1K A;  1T3U A;  5APS A;  1NHL A;  1URQ B;  3NTN A;  4I6M C;  2Q9I A;  1MFZ A;  5APY A;  1FZC B;  4C7N A;  3NXS A;  3TYY A;  1FZE A;  2N9B A;  4N6J A;  4N78 E;  1FZC A;  2CPS A;  3IR9 A;  3VMZ A;  4AYC A;  1FOS F;  3KYQ A;  1RE3 A;  1WT6 A;  2YKQ A;  1GZL A;  1JCD A;  1LTJ A;  1NO4 A;  2KSJ A;  3N7N A;  4N3Y B;  5BU8 B;  1HH0 A;  5AVZ B;  4WB4 A;  3RL0 D;  2Q5U A;  1KIL C;  2YNY A;  2XZR A;  3L37 A;  1LGH B;  1T8Z A;  2A45 H;  5AVX B;  3RK2 D;  1GW4 A;  3MUD A;  1DX7 A;  1FJP A;  1FZA A;  3RK3 B;  3R2P A;  2KLV A;  1ZR4 A;  1LTB C;  3MTU E;  4ZKP A;  3B5N D;  3BRV B;  2WSC H;  4O9B A;  1RF1 C;  1G2C A;  2NPS A;  2KYV A;  3V2P A;  2OYI C;  1FZF A;  2QM7 A;  1CI6 A;  1N7S D;  3OJA B;  1HBW A;  3U59 A;  2YO3 A;  5AW8 B;  2HPC B;  3RK3 D;  2FXM A;  5KJ7 A;  1KQL A;  3MD0 A;  1YTZ I;  3OAK A;  1FDM A;  3HE4 B;  1CZQ A;  4XA4 A;  2BAS A;  1OXZ A;  1FBM A;  2PAJ A;  3HE4 A;  3VTP C;  3PP5 A;  1QL1 A;  3KQG A;  1LTI C;  2W6A A;  1HWT C;  5KJ7 C;  5AVU B;  2R5B A;  2O01 H;  1MV8 A;  1FAV A;  1YYC A;  1JMM A;  4GT1 A;  3CL3 D;  2XKM A;  4I2L C;  5CCH A;  1N7S A;  1GL2 A;  1GK4 A;  3A7O A;  2HFE D;  5AVW B;  1N7S B;  1GL2 B;  1KZU B;  2HLO A;  3RL0 C;  4AQR D;  1FZC C;  1J1D B;  1N2D C;  1LWU C;  2YKO A;  3V2N A;  2W27 A;  2M8R A;  2HYN A;  1NU1 K;  2IPP A;  2C9N Y;  1JY2 N;  1GL2 C;  2YKP A;  3M0A A;  5CCG A;  2VRS A;  2IFM A;  1W2E A;  5APQ A;  2FYZ A;  2I1K A;  4WY4 D;  3NFQ A;  5KLV K;  1A02 F;  3RL0 B;  1M7L A;  2Z5H A;  2CPB A;  1E5W A;  2E42 A;  2P1J A;  5CCH D;  3RK2 B;  1EQ7 A;  1IK9 A;  3WMM 0;  4GKG A;  1LTJ B;  2IFN A;  2WPR A;  3P8C D;  1CW5 A;  1RE4 C;  3M06 A;  5CCG C;  3BVH A;  2Z5I A;  2XU6 A;  2N1T C;  2J59 M;  1X9V A;  1M1J B;  3A5T A;  3N4X A;  1JNM A;  4Y99 C;  1OWA A;  1X8Y A;  1SVF A;  2W6B A;  4GIF A;  1SQP K;  1LTA C;  2WWW A;  5CJ0 A;  5AW4 B;  3VOP A;  1AFO A;  3M9B A;  2WPQ A;  3M91 A;  2P7J A;  1A02 J;  1G2C B;  2NPS D;  2NPS B;  3TNU A;  3VYI A;  3HTK A;  1NAF A;  1N73 A;  1CI6 B;  4HYT B;  1L4A A;  3TNU B;  4Y99 B;  3HTK B;  1N73 B;  1L4A B;  2HPC A;  5AW6 B;  1GK6 A;  2R3C A;  1JOC A;  2Q7C A;  5AW9 B;  2OYH C;  2KP8 A;  1LTJ C;  1NTZ K;  1LTT C;  1J2J B;  2I1J A;  1IFD A;  3MIW A;  4IFM A;  3MGN A;  4EIJ A;  1N7L A;  3LIE A;  3VN0 A;  1L4A D;  4OH8 B;  1T2K D;  1ZR2 A;  5BU5 A;  1T3J A;  1JY2 O;  1N7S C;  3L35 A;  1SQB K;  1GDT A;  1RF0 A;  2YMY A;  2ZFC A;  3HRN A;  3HD7 C;  3U1A A;  3BAT A;  1IO4 A;  1JUN A;  3L4F A;  1N86 A;  2C0X A;  1SQQ K;  3TK1 A;  3H6P A;  2WSF H;  1FJK A;  4W7Y A;  2E43 A;  2YO2 A;  4I1L A;  2FFD A;  3HUS A;  5KTB A;  1ZV8 A;  1MUU A;  4W80 A;  3I5C A;  1G1I A;  1HUC A;  1RY3 A;  1HGZ A;  3B5N C;  1RE3 C;  4LC1 A;  2ZXE B;  2PP6 A;  4HH2 A;  2C0W A;  5AVR B;  1KFN A;  1NKN A;  1SFC D;  3RK3 C;  2WT7 A;  3EFG A;  1IFN A;  2N1T A;  2POH A;  5AVS B;  3EQ2 A;  3GHG B;  2KOG A;  3V2R A;  3V2Q A;  1KIL A;  4KHX A;  5AVQ B;  1JTH A;  3GHG A;  1M1J A;  5CJ4 A;  1JY3 O;  2JEE A;  1KIL B;  2WSE H;  4WY4 B;  4AUW A;  3U1C A;  1JY3 N;  1HGV A;  3RK2 C;  2L5G B;  1VDF A;  3P32 A;  2LKM A;  3VP8 A;  4B86 A;  5AW7 B;  1JY3 P;  5APV A;  3OA7 A;  5CCG D;  1NOH A;  1VPC A;  1HTL C;  2R32 A;  3VMY A;  3V4Q A;  3VP9 A;  1J1E C;  1PFI A;  1NTK K;  3B8E B;  3LID A;  1IFJ A;  2FKW B;  3GHG C;  3UIA A;  1S9K E;  1NKZ B;  1RE4 A;  1J1E B;  5AW0 B;  1LT9 C;  3CI9 A;  1LTS C;  5KJ7 D;  1J1D C;  1FU1 A;  1L0L K;  1FZG A;  3BRT B;  5CCH C;  1SQX K;  4RES B;  4IFD K;  3HD7 B;  2R5D A;  3A3Y B;  2A45 G;  4C46 A;  1NH4 A;  2C9L Y;  1GU5 A;  1LT9 B;  1IFM A;  4C7R A;  1YTZ T;  2M3B A;  3II6 A;  3NMD A;  2GUV A;  1M1J C;  5CHX A;  1URQ D;  1QL2 A;  1L4A C;  2FFD B;  1N73 C;  1SFC A;  3L36 A;  3HUS B;  2XDJ A;  1JY2 P;  1ZLL A;  1SFC B;  1NWQ A;  1LTG C;  1KFM A;  5AVY B;  1GW3 A;  3P8M C;  2OYI B;  1RF1 B;  3BAS A;  1G1J A;  4WY4 C;  4XE5 B;  1RF0 C;  3VMX A;  3O8Z A;  4LGD E;  2FYU K;  1ZN5 A;  1SFC C;  2O1J A;  3KPE A;  2WT7 B;  2N1T B;  4JYB A;  5APW A;  2QM8 A;  4DZO A;  2GM4 A;  1KIL D;  3P8C E;  2GUS A;  1SLQ A;  4C7N B;  5BVZ A;  1JTH B;  3H32 B;  1DH3 A;  4DOJ A;  3H32 A;  2H8P D;  4WY4 A;  3LW5 H;  1IJD B;  1WRG A;  3IFM A;  1GTW A;  1FOS E;  1X79 B;  2JJL A;  3V4W A;  2XV5 A;  3HUS C;  2FFD C;  2A45 I;  1URQ C;  3G3Z A;  5AVT B;  1GD2 E;  5AW5 B;  1JO5 A;  2MJZ A;  1FZB A;  2N1T D;  1NTM K;  1XTC C;  1LWU B;  4W7Z A;  2HG5 D;  1H89 A;  1H88 A;  3M0D A;  1AQ5 A;  1GL2 D;  1IFI A;  4IFF A;  1LWU A;  2KB7 P;  1T2K C;  2H7H A;  2NPS C;  1HVV A;  2WIT A;  5APU A;  5AW1 B;  3HD7 D;  3E1I A;  4JF7 A;  3HE5 A;  3HD7 A;  3P7K A;  1DEB A;  1L0N K;  2IX7 C;  5APT A;  3HE5 B;  1JCC A;  1CSB A;  1LT9 A;  5AW3 B;  2P2U A;  5APX A;  2OYH B;  3M9Q A;  2WPS A;  2XNX A;  1IC2 A;  4JYC A;  2Z4E A;  2WZ7 A;  4LLH A;  2OYH A;  2Q3I A;  1SP4 A;  1SQV K;  4EOT A;  1XTG B;  2J58 A;  4M3L A;  1Z56 A;  4ZKU A;  2HOD A;  3B5N A;  3V5B A;  3TSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...