1JMXA

Crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
493
structure length
493
Chain Sequence
b'EQGPSLLQNKCMGCHIPEGNDTYSRISHQRKTPEGWLMSIARMQVMHGLQISDDDRRTLVKYLADKQGLAPSETDGVRYAMERRLNTVEQFDTQLSETCGRCHSGARVALQRRPAKEWEHLVNFHLGQWPSLEYQAQARDRDWLPIALQQVVPDLAKRYPLESAAWAEWQKARPKADALPGQWAFSGHMLAKGDVRGVMSVTPDQGDTFKVEVKGAYADGTPFNGSGSAILYNGYEWRGNVKVGDANLRQVFAALDGEMKGRMFEAEHDERGLDFTAVKEGKARLLAVQPAFIKAGGESEITLVGSGLAGKPDLGAGVEVTEVLEQTPTLVRLKARAAADAKPGQREVAVGTLKGVNLAVYDKVEEVKVVPAFSIARIGENGASVPKVQGRFEAEAWGKDANGQPLRIGYLPASWKVEPFNERAVEDEDVKFAGKMQADGVFVPGGAGPNPERKMMTNNAGNLKVIATLADGGQTGEGHMIVTVQRWNNPPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amine Dehydrogenase
publication title Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 137
structure length 493
sequence length 493
ec nomenclature
pdb deposition date 2001-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09098 Dehyd-heme_bind Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding
A PF09099 Qn_am_d_aIII Quinohemoprotein amine dehydrogenase, alpha subunit domain III
A PF09100 Qn_am_d_aIV Quinohemoprotein amine dehydrogenase, alpha subunit domain IV
A PF14930 Qn_am_d_aII Quinohemoprotein amine dehydrogenase, alpha subunit domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.120 Mainly Beta Beta Barrel Lipocalin Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 1jmxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jmxA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jmxA03
5ACMA 2GCYB 2B1AH 5IVXF 2MKLC 3BP6B 1HINL 5J3HC 1HHGB 5M7QA 1OARH 2AQ1A 1XCQA 4V1DE 5BCAA 5D7KD 4G3YL 3L9RB 4IM8A 5DJZB 5I1IL 4NHCL 4F7TB 5KW9H 3PHQA 1AY1H 1V3MA 3PHSA 3WFEH 3V0WL 1OCWH 2AK1L 3VCLA 3Q5TA 5A40E 2QEJA 4QWWD 4H0IA 1OAKH 4NP4H 3SQOL 5DJYA 4U3XA 3T1FA 4FFYH 4NQED 1RFDL 1TPXB 5JIIA 1U3HC 4XBEH 2VLRB 2J6EH 1QSFE 1FGVH 1BQUA 4ZO9A 2ADGB 2VKXA 3MBXH 2XPGB 4Y8AA 5EZOH 2DN7A 4HJ0C 3D39A 4MJ5B 4KRNA 4LMQE 1CDJA 4LAJH 5JQ6L 4EN3C 2KDGA 4YUEH 3TVMB 2ZCKH 3ZSSA 1CE1H 2PYFA 1XH3A 1YJDC 3VGEA 4W4OC 5ITFA 3L3IB 4PRPA 5E2VH 2Q8BL 4B0MM 1UKSA 4G80A 1NQBA 5HYJD 4X4YA 2BVUA 2VZ3A 4PJCE 4BFBD 3NABL 4R9HA 4OAWB 1MWAB 1IM9D 3GSXB 1I1AC 1JMXA 4OLXH 3DYMA 2HP4A 4M1GH 3GSWA 2Z4QA 4GQ9H 4KTDL 5CJOH 3HC0B 1L0XA 1PLGL 3HUJF 5I17B 1BZQK 3QO0B 5SV4A 3LV3B 2GEEA 3PV7A 3ELAT 4XAKD 3VXQB 1YN6B 2YXFA 4WW1A 2O5XL 4Y4HC 3LH2L 4OGXH 3STBA 1QP1A 4AIOA 3JVGC 4R4BB 3T0EE 4ZFOA 5IMLA 4FZ8H 1EJOH 2JIXB 5EIVA 1Q94A 2J88H 4FS0A 3D0VB 4MAYA 4X5WA 3IYLW 4YZFF 1CLYL 3SDCC 3W2DH 5INCB 5FGBC 2V2WB 3CX5J 1UYWL 1FZJB 4RZCA 3U2SB 4LMQI 1CN4A 1KIQA 2H32A 3IJSA 3RUGE 5C0AB 4LRIC 4QGTA 2HTKC 4PJFB 3MLUL 3ARDD 3SY0B 1FORL 1I1CA 2QSCH 2H26B 1A0QH 5KSBB 4TNVF 1IAIL 1MHCB 1TFHA 4Z7VB 4K3JL 4LL9A 2XKSA 4ZNEE 3DMMA 5JOEA 5AZEL 1G84A 3L3GA 2PW2A 4ZXBB 2A6JB 4P9MH 4XP6H 5I74B 4GAGH 4AL8L 2PXYA 3DVFA 4ZFFA 4K3HA 1E6JL 5C0JA 3BYYA 3OAZK 2ZOLA 2B5IB 4IEFB 3KS0H 2E7HA 4DJMA 5DQDH 1JHTB 4OZIE 4WU7A 4GLRH 3LQAC 1NCAL 2DM7A 4MAUH 4RWHA 1YEDA 4Y8DC 3IJHA 4ZOCA 1AO7D 1TDQA 2CLRB 1Q9WB 2FL5B 2YC1A 4PYHA 5FUCC 5EC2B 3W11D 4YHMH 4PJGE 3RHWK 4GRLD 5ADPL 5JPMA 2OL3B 1PJ9A 3BE1H 1S7XB 2JLLA 3QWRD 5IB1A 1JZ8A 4NRZB 2B0SL 3EJZD 12E8L 1D6EA 1BBJA 3BMWA 1X44A 1LP9B 1ZHBB 1NCUA 1KTRL 3C2AH 4XC3L 5ISZB 4Y5XB 5DHVB 3VRLF 4U2YA 1N5YL 3SJVE 2DKUA 4PYGA 2MPAL 2WM0A 3O2WH 2ESVA 3REWB 2IANA 3BVNB 5ILTH 4HS6A 4MDJB 3VU2A 1O7VA 4NKMA 1B9ZA 4M7JL 4QRQA 2VH5H 1XF5A 3WFZA 4XMLL 2WV3A 3A6CL 3ZKNC 4ELMB 1HIMH 4WI8A 2VWEC 1RZ8B 2DWEB 4CVXB 4U3HA 4M6NH 4XP5L 2GTWB 3WJJC 1EFXB 2XWBA 2CKBL 3RDTD 4YGVB 5J11C 4UILL 1EGJH 2YD5A 4ZQKA 5BV7H 2M1KA 1IGJB 1NMAH 1ZXQA 2EDDA 3TIEA 5T33H 1JZ4A 4HPOL 2D4DA 2EDLA 1KJ2B 1MCDA 1DL7H 5GS0L 4OLEA 1KUMA 2X6MA 3MCLH 3T0WA 4D9QD 3OR7B 3UX9B 1PZ5B 3LY6A 4M61A 2HMID 1WZMA 1JGLH 2VDRL 2M26A 3U79A 1JF5A 3MA7B 5I71B 4U1JB 3PL6A 3O6FD 2VXTL 3SDXA 1Y6MR 5KANG 4LSUH 3QHZH 1LEIA 5JXAL 4LQFH 4MJID 3P30H 4XPTH 4G9FA 4XNQA 5INDA 1G7MA 3SE9H 1J0KA 1N6UA 5C9KA 3O3BA 3LS4H 1T4KA 2NX5B 1LDPH 3RKDD 1II4E 1HXMB 5F9WC 4FQHB 1IL1A 5C09D 3KGRA 2NY5L 3BPOC 2X44D 4AENB 2YWYA 5ALCL 5I16B 3CDGB 5TDOA 1E27B 2FX9L 3UJIH 1S8DA 4HLZH 4P57B 4WI3A 4LCUB 2NZ9C 3O45B 3GMQB 3QJHA 3VMOA 5JW5B 1IMHC 4U1HB 1UENA 1B0RA 2HT4D 3QQ3B 3QNXB 2V2TB 3QUKB 4TSCH 3JXAA 1Q9OB 5FO7B 3GMNA 1W8NA 2OR9L 4BZ1H 5BMFL 4JO4L 2VXVH 1VFAB 3MLPA 2ZPKH 3QEQB 1IC7H 4ODWB 5IVXA 1UJ3A 4L5FH 4M7KH 3S35X 4WO4D 2VO5A 5FF6A 3UPRA 1MJUL 2CKNA 3OPZL 2NXYD 3OKDB 3W5MA 3A6BH 1I7RA 3NH7L 3MJ8A 4X7TA 3SE3A 3SOBL 2WBWB 2K7PA 1X7QB 2QQLL 3Q3GA 3U9UB 2VLKD 1YYLL 3VH8B 4ZTOL 4HIJA 3TA3A 3WFCH 4X5XA 5EZLA 1KCLA 1JF6A 5AEAA 1FV1B 2DRUA 2F5BH 3JV4A 1QUNA 3W9DB 1B90A 2EDRA 3TESA 5J89A 2ZSVB 2CMRH 4HGWA 2X4OB 4UMGA 4UV7H 3IDXL 1A02N 4EDXB 3VMPA 5BVPH 5F96L 1I8KB 1F3DJ 2CKBA 4PS4H 3FQRA 1AXTL 4ZPVA 3VA6A 5JOPE 1CBVH 1A5FH 1IILE 4KZEH 4QTHA 4JFHD 3TBWB 3TJHD 5T1LD 1YEEH 4IRSA 4LKCB 3SGEI 1KPVA 1MFDL 3VFRA 1YEGL 1CU4H 2ESVE 1N8ZB 4JFZH 1FIEA 4WEMB 1QEWB 2IANE 2XYCA 3ROLB 4PJDF 4UT6H 2W9DL 4CDHA 4YEEA 1T21B 3T3ME 1HEZB 3HUJA 4EUPA 5GXBB 2I9LB 1N59B 3P2TA 2IGFL 2I9TA 5EBWA 3OKEA 4YXKH 2IG2H 1BX2A 3QIBC 1HE7A 2JK5B 4M4RA 2YEZA 3WS3A 3MR9A 2PTVA 4Z95H 4HUUB 3EYQD 4B7IA 1H0DA 3VXMB 4HD9A 2W65B 4U0QB 1HSBB 2FBOJ 2VDML 5DVNA 5HHNA 4V1DD 4HJGB 1UC6A 1FZOA 1REIA 4XMPH 3AU1B 3ARVA 3KJ6H 2BVQA 4TULH 2DIJA 4YDIL 1I8MB 1NJ9A 1EEYB 4Y16B 5DJ0B 3TN0A 4CVZB 1FRGL 1HWHB 2AK4D 4XNMB 4ALAH 5EOCL 4QRUA 4YDKH 1XGRB 1QSFD 4JGUA 4MDIA 4P48A 1HQRA 5ICXB 3SDXE 3QXVA 4HLJA 2NY4D 5DZOA 3PWJB 1X6LA 1FFNA 1RMFH 2X9YA 1DLFL 2LVEA 1KCUL 1HXYB 4HDIA 3GO1H 4Z0XA 5AZ2H 2EE6A 4Y5VB 2R4SL 1W0VA 4G9FE 4WJ5B 4GKOA 1LE9B 5E8NA 4D0BA 4KJPD 4GW1B 2OLDA 2NY6B 2BERA 3ZDZF 1CFSB 4NQDD 1J0HA 3V4PH 5DC0A 1RUKH 4K8RL 5F9JB 3TIDA 1PQZA 1D5IH 2ZG3A 2V7NA 5DJ8B 2D7TL 3IXAA 3W81A 1AP2B 3G6JA 4WI9A 2XN9B 2IADB 2VDQL 5EU6E 5L88L 2KBGA 3UO1L 3UBXG 3EO1B 4OF7A 5DI8A 3QULB 2ZOKA 5EH1A 3MLZH 5D1XD 1F2XK 3RZCD 4GG6F 4KKCD 2HJKB 4NHUA 2G9HA 3BGMA 4OZHF 4MZ2A 5IVXE 3MODL 5FV2A 1TENA 4XXCA 2LU3A 1S9XB 1JFQL 1C16B 3N1MC 3BXNA 4UOW1 3VXRA 1KELH 3T0ED 5KZCD 1A9BA 2CUIA 3H3PH 2IQAB 1ORSB 1KTDA 3PP3K 2FLBT 3FN0H 1HZHL 3DIFA 3OAZH 4QO1A 4QRSA 4X5LA 4FQ1L 4JKPH 1IAII 3HE7B 4OD3H 4FQ2L 2Q20A 4H8WH 5IMKA 3BWAB 3C6LD 4J3XA 5KAQF 1P4LB 2GJJA 3O4LB 3N9GL 4OUUB 4LVNB 1OGAB 2DB8A 1CZ8L 3GMOA 1K6QL 3IDIA 4O2FA 1SJHA 2YD7A 3P9WB 2XY1A 1BVKB 1WZLA 3KR3L 3ARFB 5E6IA 2DICA 5D6CA 1UZ6F 4N5EC 5GISH 2ZJSH 3Q2CA 4WENB 2MNUA 5HYEA 5MERB 4K7FB 3G04A 2VLME 1IQDB 2WBJB 5IGXH 3EJYC 4IHOA 5DK2B 3U36B 4YHYC 4DN3L 3C5JB 1TJHH 5I9QB 1IVLA 1HILB 1BD2D 2A6IA 3BQUB 4ZYKB 4JFFE 1QFWI 1UJTA 1JZ5A 1JI2A 3HUJE 2HJLB 3O2DL 2C3VB 4PG2C 1I7UB 1YEHL 2R2CA 5B8CA 1CGSL 4PTTB 5DHXB 5EC1B 3BT2L 3ALWA 3GKZA 1QPPA 3RBGA 4KQ3H 3PABA 1KYOK 3ILPB 4UUJB 4X6BA 5E7FA 5F1OB 4HH8A 3KNBA 3ECBB 4HKZA 1YEIH 5DQ9A 4WI5A 2DYPB 4XAWL 4P5MA 3GMLA 5GRZA 4YZFE 1T3FB 1VFBA 2W92A 5EA0H 5DD3H 5DURB 5FYKD 3PV6B 4QXGH 3BPCB 1BEYL 1NMCC 5JLZA 3RZWA 4RFEA 4GSDH 1X5AA 3GBLA 4KROB 3PGFL 4DZ8A 5F3BA 1I3RB 1FL3B 2X4SA 3GB7B 1OAXH 3Q0HA 2M8XA 1WTGT 3U4BH 1B4RA 1WFOA 1SJVA 4GBXD 4XB7A 1U36A 4QT5B 3T4YA 5BJTB 3KPLB 43CAB 2VRAA 3D39D 4KJWC 3ZHDA 1RUQL 4WFHD 4DEPC 4KUZL 5I73B 1YDPB 5DJXA 2DBLH 1HI6B 4K94C 5F9OL 1ZTXL 3V52H 3G5XA 4DK3A 1VGEL 4P46A 2CO6B 4MQSB 2V17L 4GAYA 1UCTA 4U33A 3DXAB 1MF2H 4MNHB 1R3KB 2VC2L 3D3VB 5I0ZA 1DDHA 4HHAB 4PRPD 5CBAB 3PWVB 2FECL 3BZDA 2DQFA 4M93B 4X9IA 3QPQD 3QYCA 2X1XR 3FQTB 4JDZA 5FA3A 4APQA 4MX7B 3PWPB 3VD7A 1A4JB 3DO7B 5J1AB 3M17B 4YPGB 4F37F 3FT3B 3LD8C 2R69L 1JK8A 5D70H 1RULL 3S3JA 1CICA 4FQIH 4R6UA 2DLEA 1UZ8A 2IF7A 3LSOB 5L2JB 1EAPA 3ZTJG 1NGXA 4HWBL 4HIEA 3MYJA 4EI6A 3TBYB 4LK4A 4OLUL 3S35L 4OKVA 2FYYB 1D5BA 3PIQB 5DT1L 3VXRE 4IRJC 3QHTC 3VRLE 3DVGB 1RK0B 1LWRA 4OZ4B 1YNLH 3KPNA 1DVFA 3OJ2C 5IW6A 5DD6B 2L4OA 4OB5L 5A16A 1UFUA 4PJDA 4MAYD 3UBXA 5IW1A 4P5KA 3O2DA 2HAZA 5CLWA 2D9CA 5J6GB 2OTUA 3DSFL 3T0BA 1HHIA 4I3SH 1MCRA 1YYMH 4FNLL 1KENL 3RWCB 3R06B 5DMJB 3N85H 3TNNA 4D9RE 4JM2C 3W0WA 3TH4T 1GPOL 1G7JB 3MJ7B 2VDPH 5ERWA 3WSQH 4LLYB 2ORBH 3O0RL 4W81A 1P84J 3DMMD 1BZ9A 5IOPB 1QBLH 4HH9A 2CXGA 3LN4B 4NNPL 3ZL4H 5GS1B 4U1NB 4LSRH 3NBNA 1JUFB 4YBHA 5ESQB 5H35A 1NGPH 2J8UB 1N2RB 4XWOC 4I18C 3OSKA 2PXYD 4G6FB 4JE4B 3IVKA 2IAMC 3C8DA 3PG2A 4WGVB 2A6KA 1OTTC 3GIZL 3GI9L 5C0CB 3MLTB 1FZMB 1FVDB 2PW1A 5IQ7H 2MCPH 4M02A 4Y4KA 3ULVF 4M1DL 1LMKA 3RX5A 1H5BA 4Q9RH 4O5LL 3VWJA 5LVEA 2ZSWA 2YBRB 3MRNB 3OKOB 4X80H 1NFDB 3EYVA 2R9HC 3T4AA 3QNZA 2WBKA 3MO1A 3RBSA 3K1DA 3U0TB 1SEQL 5JOPD 5JDSA 4MQ7A 3BD5A 2CDFB 3QFDB 5MEPB 3TM6A 1U8MA 5IBTL 5JW4M 4G6JH 4ISVB 1ZT4B 3OKYA 4N0YH 5CZXC 3B2VL 3AS0A 2BCKB 4HCRH 2AKRB 1UB5B 1PSKL 3K3QA 3VD3A 1R3LB 1RY7B 5BV7B 2H8PA 4O2CA 4XCFH 1T7ZA 2ESVD 3EDKA 1A22B 2IAND 3JZ7A 4CDGC 4HBCH 4I9WE 5KN5A 2FGWH 4YC2B 4FXGA 3MOBL 5F8QC 4E5XB 5I66A 4EJ1C 1QBML 4JHAH 1R3IH 1AHWC 4HWBA 4E41B 3D69B 4GG6A 1FVCB 1N5AA 5C07E 3GSUB 1KGCE 4H25B 4OD1H 4OZHA 5B3JF 1I8IB 4LPXA 4QHKI 4XVJH 3ZT6A 4HKBA 3V95A 2Y4SA 1KCKA 5GS3A 1YNKH 4O4YH 4QY8B 4J3WA 4MA8L 3AMLA 1UWXK 3QUXA 2EYTB 5E8DL 4HXAH 4TUJB 4HIXH 3IDGB 2YRPA 1OM3H 4FHBD 5J1SC 1E4KA 1RZJL 1QFHA 2R29L 4QRTA 1AD0A 3WHXA 4WWID 4NM4H 4XB8A 3OGCB 1TZGH 3DROB 2DWDA 4PJ5B 5JA8B 1M6OA 1N3NA 3S98A 3IDUA 3PL6D 4ZO8A 5F3HA 4LPUA 3FT2A 3B3IA 4P4KA 3O2VH 4NJ9H 4K9EH 2VDKH 2RFXA 5D4QA 4NZRL 4YXHL 4Q6IB 1H8OA 2VZVA 4LLWA 4QXUH 4MA3A 2YMXH 3FB6B 1T1XA 4MD0A 5D7IB 4GAFB 5TDPA 4HUXB 4G9FD 4DVBA 1U92A 5C0GA 1XR8B 2I60H 4UT9L 3JTTB 4GKZA 1MUJA 5F7YC 4KPHH 4K3EL 4DKFH 1HHKA 1YECH 1JTPA 5KSAB 3BSZL 1Q0YH 3HG1B 3PP3H 5CSZA 3L3JB 4LRNL 4PJDE 5HHPB 3RVTC 5JW3H 1HH6A 1CIUA 3D9AL 5IKCB 4K23H 4NKDA 1QKZL 2DTMH 3QBTB 3X3GH 3TO2B 4LU5H 1UWGL 3W0WE 5I8OL 5EZJB 3ESUF 3WNPA 1URLA 3PWLB 3ISWA 1MLBA 2AV1B 1QYGL 5DJCA 1JPTH 1MFBL 4G9DB 1A6UH 3P0GB 4DCQA 1G1YA 5IWLC 3VXNB 1DSFL 1RZ7H 2AAVA 3OZ9L 4QHLA 4FXKB 2HH0L 3U4EB 1X5XA 5AWNH 4XPBH 4M48L 1KTKE 4F58H 4X8XA 1P7QA 1I7TA 2AJUH 2UVEA 4OCYL 5IB5B 3CZFA 1ZEAL 3QQ9D 1FDLL 4M00A 4PP2B 6FABH 3RWJA 5HI5C 2VQUA 3HR5B 3E1F1 1NUDA 4PJIF 3F7VA 3TA3D 5D6DC 5GRJH 3HC3L 3FQUA 4TPRL 4ZXBC 4NCC2 5F7WC 1E6OH 5CZVH 2HFEA 5JUEH 2Y5TA 4L4TB 1M7DA 3KLDA 3QDGB 4BM7A 4JM4H 3QUZA 3ZKMC 4FOMA 3QRGL 3JWDH 4TUKH 5EUKA 4CMMB 3O3AA 2XKUA 3WFDL 4Z7NF 1Z5LA 5CINH 3ULVL 4UQ2A 5FO8B 1QR1B 3T0AA 1BVLB 2BNRA 3G5YB 2XG5A 2UYLB 2EO1A 2VXQH 4JDVB 3TC9A 2B5IC 4D0CB 1I9JL 4RIRB 5CEXB 3UBXI 4DN4L 3B4NA 4LPWA 3BH9B 3L6FA 4LGPB 3FRPG 3ZDZE 4ZSOB 2VLMD 4IRSD 1KB5H 1Y18A 5GS0D 5HDQL 4HF5H 3IJYA 3GSQB 3KHQA 1NLDL 2W9EH 2LE9A 5J13B 1ZHLB 2E6QA 4UIKH 3CX5K 4RAUA 2A9NL 2EZ0C 2N7AA 3QPXH 5ABDE 1VFMA 5C3LD 2BVYA 4Y5XC 3HNTL 5SWZB 4GG6E 5IVZA 4RBPK 2EC9U 5DLML 4OZHE 5FDYA 3L3HA 4M6AA 4P2QB 1P4IL 1VERA 3K4AA 3DRTB 5K9OA 1LEGB 2YPKA 1YUHA 5CD3A 3GMPA 3OXSB 4PY8I 2A9MH 3D85B 4PJ7B 5MI0B 3W9EB 5IG7A 1QSEB 2COQA 2HRPL 1MLCB 3VFNB 3KPPA 5LWYL 4P4RB 1JTTA 3DOSA 3IKCA 5CEZE 4P3WA 1AQDB 3ZO0A 3PQYB 1WIPA 4NGHL 3MROA 1XZ0B 1U6AL 5IV2B 2F8OA 3V4VH 5FUZL 2X42A 3X11B 3WFBL 2PYEB 3BP5A 2J8OA 4ZUUB 2VN4A 3JV6B 1JPFA 3NCMA 2FECI 4R0LA 2DQIH 2H1PH 3FKUS 1UZ6E 3RY5A 3CH1A 4OF5A 2BK8A 1IC5L 3CSPA 3ULUC 2GT9A 2IPKB 4MQXD 1ORQA 2DQUL 5C3TA 1J1XH 1I3GH 4PG9B 1JPSL 3ARUA 1HNFA 4LCIH 2HKHL 3BUTA 1JNHA 2C1OB 1DBBH 4LNVA 1IRAY 2BRRL 3UP1A 1NFIB 2F53E 3DV4A 4PRNA 5D7SH 3JWOC 3OX8A 3H9HA 1F4HA 2VB5A 4GXUM 2W0KA 3IU4H 4OCWL 4U6HB 1J0IA 4JPWL 3SN6N 2ZNXA 5TQ2H 4R90L 5DDHA 4BUHA 1N26A 2FEEL 4OQTH 1RZKH 4PRBA 2X9XA 2HKFL 1WAAF 1DLHA 4JFPB 1XGPB 4I5BA 1SYSA 4NQEB 1NGQH 1A6AA 1ZLVK 2O5ZL 3MV9E 1IAIM 1MAML 4ZOBA 1CK0L 2Z92B 1OAZH 3NFNA 4X7SH 4YHLH 5D2NA 1LE5B 1V7MH 4RGOL 4BSJA 1C08A 5E03A 5GGQL 1RV6X 5GGVY 3VXRD 1I9RL 1BIIB 2QQKH 2F8XC 1H15B 5T1DL 1A2YB 3SE8H 2FWOB 4FA8A 4X6FA 5JORB 2HN7A 5E2UL 2JB6A 2GITB 1F6FB 2J5LC 4NDMA 2PTTA 4R3SB 4I0CC 3WLWD 3UTQB 3CJJA 4ONGL 3VJ6B 3VW3H 2JB5H 4KXZI 1AD9A 2FR4B 4KUCF 5HYJB 1CFQA 1MCOH 5EU4A 4Z6AT 5HHQB 2BNRE 2A2QT 4WHYH 2NY2D 5E6ID 1IM9B 5L0QC 3BUYA 5CIPA 3IU3B 1BREA 5DFVD 4LP4A 5JOFB 4JHZA 4LLQB 1QFWM 5I8CB 5JTWA 5CBEB 1JIBA 3FFCE 1R5WB 1XIWC 5FYLE 1U3HA 5E8PB 4H88H 4MS8D 1F3JB 1NCBH 1U42A 2BDNH 1OWWA 3LQAL 3VFGH 1FFPA 4ZFGH 3CZJA 4GMTL 4OM0L 1PD6A 4KVNL 5IIEA 5ESAB 2W91A 4MWFA 4MZ3A 3C60C 2Q8AH 1GZPB 5I0DA 1IEHA 4YX2L 5IFJB 3F5WB 4I3GA 3STZB 1YPZB 1FNHA 4W4OA 1PKQA 1ETZB 3FRPA 2OBGA 4NBXB 3EOTL 3I75B 4WNQB 4Y1AA 3VXUA 4Y5YB 3BDBA 4DAGH 5DFTA 5HYSG 4BH8A 4KQ4H 4R7DA 4IOIB 1HQ4B 1CDUA 5FYJL 3RWGA 3LZFH 3FZUD 1KEGL 1I1AA 2OJEA 2Q7YB 1MH5B 1IAOA 2OR7A 3ARDB 3VFPA 3IDNB 1ZLUK 3NA9H 5IR1A 4K8RD 1UWXH 4U6VL 1ADQL 4F33B 2AS5M 5B22A 2ICEA 2QBWA 2GSGA 4J3UA 3MRQA 5DTFA 1MQKH 3O41B 4Y4HA 1YA5A 3NPSC 3GBNH 2JCCE 5I1HL 4PPTA 1T7YA 2BC4A 5D93C 4I9WD 1B0WA 2EYRA 3GZKA 3JVGA 4E0RA 4KJQC 4U1KB 1IEBA 1ZGLM 3OJDA 5GSVA 5MEOB 3O6LH 3OB8A 2BNQA 4M5ZL 3STLB 1YQVL 3KXFA 5BO1L 3LKNB 2CRZA 2H32H 1P7KB 2A0LC 2B39A 4HXBH 1IKFL 1MRDL 1JZ3A 4JO2L 2HYMA 3QR2A 4NFDA 4Y16C 4AM0B 2XY2A 4MXVF 1DQDH 3GMMB 1LO5B 1LO4H 4P46D 3I2CH 4M5YH 4X4ZA 1SBSH 1AO7B 1NH6A 5JIHA 1ZAGA 5HI4D 2IWGA 3VG0L 4LRIA 3LN5A 1OTSD 4YHPA 1MCQA 3B83A 1HINH 1KC5L 1ED3B 4GRLB 5I15L 3S88L 4G3YH 4NCDA 5C6PB 1JNNL 4JN2A 3L5WA 3AMKA 5DJ2A 5I1IH 4NHCH 5IBUB 4PJIA 4Y5VC 3TPUB 4APQD 4FN0A 5TDNA 3NGBB 5J7CC 4M62L 3V0WH 5KS9F 2AK1H 2IMMA 3B9KC 3LB6D 3MNVB 5FIEA 3ME0A 3IFNL 4Z9KB 5KSUA 3SQOH 3L7EA 3ULVE 2NY6C 1EEZB 3KPMA 3VE0B 5IHZB 2O61B 3CK0L 3UTTA 3MCG1 2DQCL 2VLLA 4AEEA 1CICD 3CFCL 5F9AC 1TVBA 2WIIB 2X9WA 5T1KA 4RRPG 4Y19A 3GSRA 2AVGA 3MRHB 1INQA 1MFCL 5E95B 2EKSB 1KCSL 5F7EL 1IGIL 3OAYK 5D2NE 2WINB 5F6HJ 3MRFA 5JQ6H 3FB7B 5BZWA 4UDTA 5SWQB 2NR6C 5IUSA 3SQBA 5ID0B 4KK6C 1QLEL 4JRYD 4AH2A 3EYFA 1DVFD 1HWGB 4OUOA 1F58L 5SX5K 4F57L 2J8HA 2Q8BH 5ACZA 1K3ZA 4JREC 1KT2B 5DJ6A 1MCLA 5DEFB 1VADA 5K9JL 5HHME 3NABH 4OV6F 2QTEA 2DQDH 3RDTB 4POZC 4V2CB 3LKRA 5CGMA 5HXMA 3WE6B 3UXFA 4NQXB 4KTDH 5CILL 3HMWL 3QXDA 3W0WD 5B3JE 2GUOA 4LDOB 4G8GE 1BJ8A 2GJ6A 2PF6A 2HA1A 3HE7C 3WCYA 2H3NB 1X4XA 5HVFB 3LH2H 4KH2A 1FNAA 2B2XL 4PRAB 3WL9A 5B38G 3C09C 2DBJA 3QXAB 1ADQA 3O6FB 4R26L 1WF5A 3PHOB 4LVNC 4JKKA 2IH1A 4R2GD 4JRXA 1FNGB 4XVUD 1G7IB 3ARFC 4MJIB 2A77L 4YR6A 1CLYH 4B41A 5L7XL 2C3HA 3FO9B 3WFEL 4R7NB 3IFOB 4H20L 1UYWH 2WBJC 4R4NC 3FN9A 3BO8A 4AZ8A 1PKQE 1KPUB 2H6PB 4KMLB 4N1EA 4RBPH 3S3PA 1NCWL 5C09B 2ID5A 1NC4A 1MHEB 3OB0K 4QF1A 4Y1AE 5CEYA 3VWJD 1G7LB 4D3CL 1JGVH 2BOCA 3MLUH 5C8JA 3BQUC 2XA8L 4WUUA 3HNSL 5AD0A 2APTA 1NFKA 3O6ML 1IAIH 2A73A 4K3JH 2DIBA 1OSZB 5AAWA 5DUBA 5AZEH 4F7MA 2JJSC 3UYRL 4NSKB 4U1LA 4EI5A 4FQQA 4MCZA 3BZEA 4FQLL 3V9FA 4LF3B 5J56B 3REVA 1EEQA 4AL8H 3ZZ1A 4LLUB 1KPRA 1UT9A 1W0YT 1TTUA 3GI8L 1E6JH 3FFDB 3JUYA 4NQVB 4WO4B 4J3SA 3GM0A 4HS8L 4QXWA 1SY6L 2NXYB 4ONFL 3V6FB 5HYSA 3LRSB 4GKSA 2UY6A 2BNQE 1C8PA 1XGUA 2O5YL 3O8XA 1WAAA 2NY0D 1NGWA 2ITCB 3CC5A 1NCAH 3I6GA 2VLKB 1U8JA 4PBXA 3HFML 4GKNB 5E94B 3RWEA 1VGKA 2ADIB 4E42B 3FCTA 5FDWA 4KROC 4NQUA 2C7UA 2VSDA 1K5NB 5ICZA 5ADPH 3QJFB 2OTPA 2V6HA 1MCJA 4LOUD 3EO0B 4TTDD 4MYWB 2B0SH 4YLQT 3CFEB 2YPLA 4XGZA 12E8H 3TNMB 4MXQC 3QUXD 3U4AA 1XF2A 4XC3H 3O4OC 4PJIE 4FZEL 4R96B 1N5YH 2MPAH 3U7WL 4XCYB 1NCDL 2MSPA 4PB9L 2AXGA 1YEFL 5T1MA 4FTVA 3E6FA 4N9GA 5T1LB 1U93B 4ZUSA 1YY8B 1JYVA 4Z7NE 4WI6A 4F9LC 3VDAA 4XTRD 1NCTA 3PDOB 1LO0H 3HAEB 4M7JH 3BGFB 4P4KD 2GJZA 4XMLH 1ZLVH 4Y19E 5A2LH 3A6CH 3C5ZC 5EU5B 5TFSL 1OF2A 3S96B 4CGTA 4FQXA 2Z35B 3GSOB 5K93A 4RNRB 2CKBH 1KNOB 2QR0B 1VEOA 2YUZA 3OF6A 3TCLB 4X6CF 4LLAA 4K2UL 5FUCE 5HYQB 2HWZL 3KPSD 5A2JH 1FFOB 4L9LA 4HC1L 3SKNA 1I8LC 1VENA 4HPOH 2R2EA 1CT8B 2HT2D 3FT4B 3GEWB 3GUTB 4HFUL 5GS0H 3P4MB 4V1DB 3X12A 4ZS7L 1D9KA 3KYOA 4NKIL 3ILQC 2VDRH 4AJ0A 5IMMB 3D0LA 1JN6A 3U82B 1WC7A 3HPLA 1OWRM 2GJ6E 4EUPH 3HPJB 2R4RL 1KJVB 2VXTH 1FHGA 1SEBA 3WJLA 4LLMB 2AK4B 3K2UL 1S7VB 2DMCA 4JY6B 1N0LA 4D0DB 5JXAH 2D7MA 1QSFB 1FLRL 3CDCA 4G8EA 3L3OB 4PJHE 1DBKL 4JGMA 4XCEB 4LLDB 5KG9A 1G9ML 2Q86A 2NY4B 5JHLL 4LVOC 3BZFB 2IFFL 3TYFA 3KYMB 3MCKA 1KB5B 1X5KA 2NW3B 2F58L 4JM2F 3NZHL 1D6VL 1SY6A 5ITBL 2V7HA 2NY5H 3QEUA 4Z7UA 1MCEA 1N0XL 5GS1C 5ALCH 1RVFL 3OAUL 4NQDB 2FX9H 2CJUL 3OHXA 3QUZD 2Q6WB 2X7LA 1AXSB 5E70A 3WIFA 3NFPA 2P8PA 15C8L 1U8QB 5GSRA 5B38A 1N64L 4G6AD 3NVQA 4AIZB 3DURB 5C0BA 4NCC1 2BNRD 4XBGB 3T2PA 4WUUE 2XWTB 5DO2D 4HLZG 3TWCL 1BOGA 3Q6GL 3VFMB 4XH2A 3SPVB 5BMFH 3TFKC 4JO4H 3X13B 1ZLUH 4YHOH 2G5BB 3QP3A 1QO3A 1NDGB 3QCVL 5D1XB 4GH7B 3RZCB 1MJUH 3FO2B 1UH2A 2C4FU 3OPZH 4PGCA 5I30L 4HUWA 1MIEL 5D7JA 5CMAB 3PWNA 3CX2A 4JAMA 3NH7H 3SOBH 4IBLT 4YBQD 3QAZB 4OCXL 4P2OC 5DQJA 2QQLH 1YYLH 4U6YA 4ZTOH 1CL7I 5I76A 1GGCL 1DL7L 3T0EB 1KCRL 4CL7A 5KZCB 3G6DL 1AGBB 1KN4L 1WAAE 1H3PL 4UZGA 1UXSB 3LDBC 4QOKA 5BV7C 2XT1B 3FQNB 3BN9C 5HTSA 4B5EA 1LHZA 1SJEB 1YMHB 3LKSB 3IDXH 3JV5A 4U1SA 2EICA 1A3QA 4GRMA 3C6LB 3JTSA 3SKOA 1P2CB 4YC2C 4CW1B 3FTGA 5IEKA 1WBYA 3LKPA 1TQBB 1D3CA 4HC1A 4W68A 3MX0A 3BGAA 3KPTA 2WWMD 2HFGL 2JKXA 1MFDH 1BQHG 1YEGH 4QKXB 3PDDA 3BDYL 5EFIA 4PJXB 4FTVE 5SV3A 3D2UA 2VOTA 3HLAB 4S1DD 3RVUC 4KDVA 2W9DH 1S9WB 5F7DA 3SE4A 1IT9L 2QSTA 5MEQA 2ZUQC 4E9LA 2ZUVA 3BKYL 3VGFA 2VABB 3P9MB 2EDFA 2IGFH 3VFUB 5F1KC 3RWHB 3X3FL 3Q1SL 3OAYH 1DJSA 3CVHL 2RJMA 4NQCA 3U1SL 4OLYL 4OZIB 3GMRA 4QHUA 3MGOB 4JN1L 5C7XL 4I4WB 1CCZA 4JFXA 2AXHA 3WHE1 1G9NL 2VL5A 2FZ3A 4YHNB 2GAZB 5SX5H 4NC1C 1E4XL 5HPMA 2VDMH 1ITBB 4PJGB 3V5HB 1U0QA 4KVCL 4MD5A 4FFVD 3VXPA 1UWEL 5EBLA 1U3YA 5D5MA 4ONHA 4YDIH 4M9PA 1XCQB 5FKAA 1MEXL 3BJLA 4KHXL 1FRGH 1FN4A 3ULVD 5T5FL 3P77A 3WUWG 3F7PC 3WFCL 5KSAC 3PHQB 5EOCH 2KUTA 3VCLB 1OPGL 5DJYB 1GC1C 3HZVA 3T1FB 3F7QA 1DLFH 1KCUH 2YRZA 4LVEA 2R4SH 2NYYD 4GBXB 4ZTPL 4PG2A 1BLNA 5JW4R 3D39B 3EGSA 3CFIC 3AAZA 5BQ7A 1RUPL 1H3WM 5I1LA 4P2YA 3ARBA 4NQSA 1U8PA 4K8RH 2PYFB 1XH3B 5HHMD 1XGQA 5ITFB 1OAUH 4XNZB 4JCMA 5DRNA 4PRPB 4FMFA 1CDGA 4XNUL 2EDYA 4IIQA 3AY4C 4U1MA 4G80B 1PYWA 5FA4A 2VDQH 2FB4L 3OB0H 4X4YB 5L88H 1OQOA 3ZDXF 3UO1H 3PXHA 4MXVE 4PJFF 3IGAA 5FOBA 4XPFL 3FONA 4NPYA 3N06B 3GSWB 2Z4QB 2R1WA 4XVTL 4NO5B 3NIFF 3GKWL 2P5WA 3MODH 4Z7VF 2FJFA 2V9QA 1LK3L 4N8CL 3ZKQD 4WW1B 1JFQH 1U3HD 4WWKC 1Q72L 3AC0A 4LSSL 1JNLL 4WCYL 3DX7A 5KS9E 8FABA 5AUMA 4XMPL 1HZHH 1MJJA 2ZUUA 4FQ1H 3GBML 4Y0GA 1GYAA 4FQ2H 4ZFOB 5AAMA 5IMLB 1AGFA 5T3ZL 3UYPA 1P4BL 1Q94B 4QOKE 4MAYB 3N9GH 4X5WB 3CVHA 4L29A 5EDXA 3O6KL 1EH9A 1CZ8H 1K6QH 4Y1AD 3VXUD 5J13C 1AR1C 3O11A 4RZCB 1CD1A 3KR3H 1KIQB 2H32B 1NC2A 4H5SA 4MXWL 5E5MA 3IJSB 3QEGL 2APWA 4KI5C 3LIZL 4OSUL 4LVHC 1I1AD 5JIPA 5E5UB 5KOVC 1RZIB 4WGWB 4X6CA 5E6ZA 1GOFA 3LS5L 3V5DA 4Z8FL 4DN3H 2AABL 4PFEA 3VGHA 3HZKA 4Y4HD 3DMMB 3L3GB 1QNZL 2I24N 1U8IA 2ZG2A 1I7ZA 2PXYB 3O2DH 4ZFFB 4HV8A 2BNQD 4IRJA 1E4JA 4PJ9A 3KXFD 5C0JB 1YEHH 3QRFM 1CGSH 2E7BA 2ZOLB 3BT2H 3MRKA 4ELMF 3CXHJ 4NQCE 4I2XE 2NXZC 3D25A 2J12B 4WU7B 1BQHA 4EDWL 4YDJA 3N1GC 4MLIA 5L8JB 1YEDB 4RGNE 3IT8D 5DF0A 3IJHB 1OT2A 1VEMA 4MVBD 3TLRA 5KJRL 1ZA3A 2YC1B 3DRQA 4CVUA 4PGDA 1ND0A 1UADC 2HTKD 3BI9X 4XAWH 4X7CC 5JPMB 3BP7B 4JG1L 4JZNA 2YPVL 1SYVA 2DJSA 1H3XA 3H3PL 5IB1B 2ADFL 1F4XH 5DK3A 3ULUF 1BEYH 3FAXA 1QSVA 3FN0L 1M05A 2GY7B 1BBJB 3NFSL 1T04A 2P45B 4GXUN 3I6LD 3UTTD 3ZYOA 4M1CC 1L7IL 4ERSL 3UTOA 3H7BA 2YA1A 4TNWF 2ESVB 1VEPA 3E0GA 3GJEA 2IANB 3MREA 4I18A 4TSBL 1T80A 3EO9L 5T1KD 4QXTA 3MV8A 4W6YB 4Y19D 3S8WA 4HS6B 4NKMB 4KUZH 3UTZA 1Z0MA 4QRQB 5F9OH 5C08A 1ZTXH 4H8WC 1XF5B 2L7JA 4WTWA 5GISL 5E8OA 4L3CA 1VGEH 4XXDA 4N8PA 4ODTL 1S7TA 2V17H 3SCMA 3F58L 5F44A 2A6DA 2BY2A 4L8BA 4QWWC 1X5ZA 3WUWA 3B5GA 4M7ZB 3RNQA 1CD9B 5IT2L 2P8MA 1VB9A 2DLHA 2KQMA 2BSED 1ZT7A 3FB8A 4CNIA 4GOSA 1X5HA 4O02L 4ZQKB 3RIAK 1YZZA 4LLVA 4Q9CA 4BUGA 2QADC 5C71A 3TIEB 4GMSL 3WS6C 1NAMB 5DJAB 4ZO6A 1RULH 3RI5K 5FYJD 2GJ6D 4M61B 2YD1A 4K7PL 4BZ2L 5IJVA 1FNEA 4HWBH 3MFFA 3X14A 1U8NA 2VISA 2P5WE 2VZ1A 3S5LG 3PL6B 4FFWD 2IQ9L 4NC2B 4OLUH 4ODXA 3SDXB 5T3XL 3S35H 5DT1H 2F15A 2BOBA 3L5IA 4JRXD 3RX7A 4PY7A 1LEIB 1TJIL 3L9RA 1AHWA 4P3CL 5CSGA 5GJSL 2DQJH 5F89A 4G9FB 1B0GA 4OB5H 4XNQB 5INDB 1G7MB 1CVRA 5BS0A 4KMTL 4MMXC 4S1QL 4A6YL 1T4KB 4RQQA 5GRXG 1IL1B 1Q0XL 4FNLH 1KENH 1NC4D 2XPGA 3OKNA 5E1HB 4PJEA 5TDOB 1GPOH 2DJUA 3LVEA 4WUUD 1J18A 2CXKA 5CP7A 1KJMA 5CGYC 3O0RH 3AGVA 3QJHB 4KFZC 3QI9A 3OKMA 2B20A 3RWDA 1B0RB 4M8VA 1KIRA 4X6CE 4EI5D 4NNPH 3L5HA 4P5TD 5C0IA 4HX1A 3GMNB 4KXZH 4Y5YC 1BJ1H 3CLEL 5IVXB 4X98A 1UJ3B 3FMGL 4ZUTA 5DEGA 5FF6B 4M4PA 1AGCA 1FBIL 3ARDC 3GIZH 2D2OA 3GI9H 2E6PA 2ATKA 2VE6A 1I7RB 1AR2A 3MJ8B 3HC0A 3IRPX 1DANU 4X7TB 1MRFL 3O8XD 5ESVA 5IHUL 3Q3GB 1OY3B 1I4FA 3ZTJH 4M1DH 2OYPA 4LAQL 3V6OC 3WKNA 1GAFL 3TA3B 4O5LH 4X5XB 5EZLB 3BWUC 5T5NF 5HHOA 3JV4B 4J4PA 4EOWL 4HGWB 3LPFA 3DVIA 4X9BA 5DD5L 2YPLD 2NZ9D 5IBTH 1OSPL 3ZYIA 2VXSL 3B2VH 3T0DA 3RPKA 4OZFG 1MCKA 1U58A 4R8WL 5E08L 2CKBB 1PSKH 1X3DA 3H8NA 5FK9A 3FQRB 4ZPVB 2UZYB 1EZVX 4QTHB 2AQ3A 4FTVD 1FNFA 4IRSB 2K9UA 3N50A 1KPVB 3RX8A 2O26U 1S78D 3VFRB 1EFQA 3W11C 4HUVA 1E4XI 5C6TL 3AS1A 3MOBH 4I3SL 4GRLC 1QBMH 1YYML 1HKLL 1AQKL 2N7BA 3MV8E 4FABL 4GG8A 3NGBC 1BF2A 4PJ8A 4NOFA 3EJZC 4Z7WA 3UROR 5JZ7C 3HUJB 3ZKSD 4FQXD 4RFOL 5C08E 4Z7VA 4JQVA 1T7VA 3JWOL 2I9TB 4NN5C 5EBWB 3OKEB 2EE2A 1BX2B 4KK5D 4F7PA 2C5DC 3OF6D 1H3TA 3MUJA 4LSRL 3WS3B 5CKGA 4MA8H 1IQWL 5E8DH 4A6YA 2YD2A 4HUNB 5JHDA 1H0DB 2DF3A 4EKXA 3WNNA 1RZJH 2R29H 1JHTA 1MCCA 2Z9TA 5HHNB 4LHUA 1D9KD 5FUOL 1FZOB 2Z8VC 2OS7A 3BPLB 1WCBA 2BVQB 4KRPC 4MHHG 1MI5A 1NJ9B 2CUMA 1WWCA 4F7EA 2X70A 4NNXA 3RDTC 4NZRH 4YXHH 4RDQF 1S7XA 4QRUB 4QTIL 4TQEL 1LK2B 4L3EA 1O7SA 1HQRB 3B2UC 3QNYA 3CSYA 5I1DA 1FFNB 3A67L 3CCHA 4HDIB 3TT3L 2VR5A 3BH8A 1QR4A 4K3EH 4JHBA 3BDXA 4DVRL 3BSZH 1W0VB 3QT2A 1HHJA 4LRNH 2QQNL 4PREA 3DX6A 3FN3A 5E8NB 4D0BB 2YKLL 2D7PA 3D9AH 5D71L 5E1AB 2OXGA 1FCGA 3MMEA 3QCUL 2XZAL 2VLRE 1DN0A 1QKZH 4WHTA 2XZQL 2HVKA 3EIFA 3SKMA 1T6VN 2DQHL 5DA4A 4ZS6C 4NO3A 4PJCF 2IPUG 2JJTC 3S5LA 1UWGH 2MMXA 3EYOA 3TIDB 5I8OH 4Q58C 5C0BD 1PQZB 1R3IL 3F8UB 2V7NB 3E2HB 1QYGH 1ZWIB 4AK1A 3IXAB 1AKJA 4ZUVB 1MFBH 2XNAA 3G6JB 3WXWL 4GW5A 4JLRA 1CQKA 3EYUL 2BSRA 2XWJA 1RU9L 3KJ4C 1DSFH 2XXCB 1OLZA 3OZ9H 1DBJL 2ZOKB 2Y06L 3KLHD 1KXTB 2HH0H 1GZQA 5GGRA 1VSCA 4M48H 4NHUB 1O5DT 2G9HB 2OI9B 4XP9L 1KB9K 5D7JD 5HHVL 1SQ2N 5IF0A 4OCYH 5CLTA 2AEQL 1ZEAH 5FECA 1FDLH 3QDJA 2PTUA 1P1ZA 3RP1A 3BXNB 4JVUA 3VXRB 2EDXA 1A9BB 1IGYA 2HT4C 3HC3H 1EZVY 4TPRH 3ESVF 3MJ6A 4QHNA 1GXEA 3TGXA 1I3VA 1KTDB 4QRSB 3DIFB 5FGRA 5K9QG 4QOKD 3QRGH 2NY3D 4ETQA 3WFDH 3ULVH 1XF4A 5IMKB 1EPFA 1JZ2A 3H9SA 1K2DA 1OP5H 3VD9A 5IMOA 3GSVA 5IB2A 5L8LB 2F8VA 4NJAL 4XWGL 3U7YL 1I9JH 2NXYC 2VUOA 4DN4H 3KPQA 4F3FA 4O2FB 3KYNA 3QQ4B 3GMOB 2QL1A 1SJHB 1S7QA 1TQCB 2NY2B 5E6IB 4RDQG 5D6CB 1R3JB 1HXMA 1HDMA 3UJTL 3P4OA 5HDQH 1I1RA 1NLDH 1F2QA 1Q0YL 1A3RL 2UZXB 1C1EL 5IB3A 3G04B 3D2UD 1I85A 2BVOA 1WLHA 2P7TA 3GSNL 3OG4B 2DM4A 2A9NH 2MOVA 4IHOB 3EZ8A 3ZDXE 4LPYA 3CUPA 4PJFE 1KBGH 3FOMA 3ABZA 2A6IB 3HNTH 3H0TA 3QQ3A 4OGYL 1MCHA 5DLMH 3FQXB 3TJHC 3NIFE 1MVFA 4NQCD 5T3XE 4OZFA 4Z7VE 5E2TH 1P4IH 1ZT1A 1J0JA 5B8CB 1EHAA 4RGND 5CIPH 4HBQA 1WK0A 2HRPH 1HSAA 1J8HA 3UEZA 2X4UA 3PABB 3TYGL 5LWYH 2XQBL 3U46A 4OV5A 4X6BB 2FDBP 4YFDB 5JHDE 3KNBB 4HKZB 2XRAL 3Q5YA 4PV8A 1TLKA 5D1QA 3QG7L 1AE6L 4N5ED 3DI2B 4NGHH 1U6AH 5DQ9B 4P5MB 5FUZH 2UZIL 3KPOA 2XTJD 3WFBH 1F00I 1U95A 1ZVSA 1VFBB 1XIWA 1E6OL 4G8IA 1MI5E 1OT1A 1UACL 5JLZB 4F15C 5JIKA 4RFEB 3DYPA 2HG5A 4DZ8B 5F3BB 1NAKL 3IFPA 3QFJA 1IC5H 2W9LA 1YJDH 2IJ0C 2KZ1B 3CFJA 5IHLB 4L3EE 2BVEA 2XA3A 4RMQA 4X6DA 2DQUH 3C60A 3W82A 5D72L 3T4YB 2DQTL 1JPSH 5ISZE 1PX3A 5TQ0L 2HKHH 3JWDC 1WZ1L 5DJXB 1GCFA 3LMJH 1QHOA 2BRRH 4YXLL 3G5XB 3T2NL 3ARBD 4JFQA 3GHBL 5D1ZC 4P46B 3K7UA 3O81A 3F65A 4RAHA 2P49B 2VDLL 3L3KA 2R56L 4GAYB 1KLUA 2X09A 4L1DA 2YZ1A 4OCWH 4PJBA 4JPWH 1DDHB 1HEZA 1J1PL 4R90H 2DQFB 4ODUA 1A47A 4LARL 3QDAA 2VR4A 5D8JL 4X8JA 4JDZB 5FA3B 4APQB 5DK0A 4ELME 2BRQA 5L8KB 3BESR 1WCQA 4LSTL 3LKOA 2HKFH 3B5HA 4KJPC 3HMXL 5EWIL 3MLRL 2VXUL 1R5IA 2O5ZH 4ONOA 2EIZA 5EULV 1MAMH 1JK8B 3VGAB 4UINL 2P5WD 3N1QC 1CICB 1CK0H 3SGKC 1UZ8B 4LCCA 3P0YL 3P3YA 2JJVA 2BJML 4RGOH 2R0LL 1EAPB 3BAEL 1NGXB 1I9RH 3EOAA 4HIEB 1E28A 3MYJB 4DFIA 4EI6B 2DLTA 3ULUE 4UV4L 5T1DH 1MY7A 3EHBD 2P4AB 3GSNA 3QDJE 1IKNC 4ZFZA 2Y72A 5E56A 3TJEL 5DS8A 5B39G 1WT5C 5E2UH 1N4XL 2AJ3A 1TVHA 1J10A 4I0PA 1A7NL 5E7BA 1EO8L 3KPNB 1DVFB 5IW6B 3RZCC 5A16B 4KKCC 4ONGH 3MLVL 4OCLC 4PJDB 3K8KA 3UBXB 1IC1A 5IW1B 4P5KB 3IAPA 35C8L 4PLJD 1R3HA 2AJXL 5F70A 5HDLA 2OTUB 1HOCA 3H9SE 1Z9MA 3OJMB 3IDYB 1HHIB 1NC2D 5CCKL 5F1SA 3MRMA 5C0RL 3MRBA 4OF8A 3B9KA 4Z7OF 3TNNB 5EOQL 3W0WB 4M7LH 1ZHNB 2DDQL 3MUGA 2NX5E 5ERWB 4JFYA 1F02I 1GGTA 4HJJL 4LCIL 3VD4A 3RPIA 2NW2A 1BZ9B 5DMIL 4HH9B 3LQAH 4ENEC 1P9MA 4GMTH 4NN7C 2RAMA 4OM0H 1RZFH 4KVNH 5H35B 4BH7A 2YWZA 4J6RL 5H37G 4G42A 4R2GB 3IVKB 3ARGC 4IRJD 4MJ6A 4YX2H 4PJ9D 3WLBA 5JNYA 2A6KB 2X1PA 4D9LL 3EOTH 1AI1L 2XFXA 3QEQE 5HGGS 4Y4KB 1I9IL 5FYJH 1EBAA 4KRMB 1H5BB 4WFGE 4YH6A 1Y6NR 1RIHL 4MB5A 1KEGH 3VWJB 4G43A 5K9KA 2ZSWB 1A1MA 1FNSL 1J8HE 3EUUA 3T4AB 3EYVB 3QNZB 1F8TL 4U6VH 4PJAF 1ADQH 3MO1B 2LTQB 4P2CG 1CLCA 3VXOA 5JDSB 5EIQA 3PDGA 3UMTA 4F7CA 2VQ1A 1U8MB 5I6XB 2X89A 5KTEL 2P47B 5I1HH 2BZDA 1IGML 3NCJL 1RAMA 4QNPF 4XZUA 5EU3A 4PJCA 4S1RL 2H8PB 4O2CB 4OUUA 2Z93A 3HMXA 4XWOD 1T7WA 3ARZA 4M5ZH 1T03L 3QFJE 1FQ9C 1YQVH 4LSDA 5EN2A 5BO1H 1QZ1A 5KN5B 1IM3A 3MBEC 2W38A 1DQQA 5BVJA 1IKFH 1CXIA 1MRDH 4OF3A 4JO2H 3ZE2E 2VMFA 4FXGB 5I66B 1OTTD 4OZGF 5C08D 3H9ZA 1P69B 2NY0B 4OI9A 2EIBA 1V05A 3QZWG 4GG6B 1YMMA 1N5AB 3VGGA 3SCMD 4O00A 4OQ1A 3VG0H 4JJHA 4MA7L 1KC5H 3SBWC 4KKBD 1PG7L 5I15H 3S88H 1T0NA 1JNNH 5T3ZD 1FSKB 1HILA 3UJJL 4HKBB 3NZ8A 3DETD 1NPUA 3BW9A 4PGBA 5EG6C 4GBXC 4NT6A 4M62H 1KFAH 4G6ML 5BRZA 4M8QA 3G6AA 3IFNH 4ODVL 3QUXB 3L3DA 3MQIA 2JJSA 1TJGL 3CK0H 3UC0L 5EIIA 5LGHL 4DGIL 3CFCH 4QRTB 1AD0B 3QO1A 3WHXB 3ARPA 3RUGA 2ZKHL 4Z5RA 5GZOC 1ZANL 4NUJA 3SDDC 4AEIL 2DWDB 1PBYA 4XNZC 1M6OB 1ONQA 1N3NB 4ZO7A 4LSQL 1MFCH 5F7EH 1KCSH 1VFUA 1IGIH 3QIUA 5KVMC 3UZQA 1MAKA 3FOLA 1PY9A 1WTLA 5F3HB 3QPQC 3FT2B 3B3IB 4P4KB 2EDJA 1G0DA 2EECA 4JGJA 3PQYD 4MCYA 4LLWB 4KK8C 1QLEH 4MA3B 4MD0B 1CVSC 1T1XB 4N0RA 4ZNEA 4JZJA 5TDPB 1F58H 4DVBB 4F57H 1U92B 5C0GB 2JJWA 2OTWB 1NL0L 5BS0D 1BBDH 1MUJB 1A7RL 3KDMA 5K9JH 1HHKB 3W5NA 3JSSA 5CSZB 4FMKA 4XNYL 3BHBA 1HH6B 3KPSB 2CGRL 5D9SA 1J05B 5CILH 3HMWH 5MENA 1M7IA 2QJDA 4NKDB 3H3BC 3MFGB 4MNQA 1XR9A 1V3KA 4AY0A 4MHHI 1A64A 3QI9D 1NCCL 4HWEL 4HG4J 5B39A 1DUZA 1MLBB 4QLRA 2B2XH 1OTUD 3U48A 4OGZA 4MAYC 4F9LA 1R3KA 4HS3A 4R26H 2CR3A 5FYKU 3PWVA 3S4SG 2DL9A 4DCQB 4XP4L 4Y88A 1ES0A 4XVSL 4QHLB 2A77H 3C5ZA 3RVWD 4RMUA 3V5KA 1EAJA 3DO7A 2EXWD 43C9A 3DBXA 5L7XH 2XN9E 4XHJC 4GXVL 3SJVA 5E00A 1I7TB 3FO1A 4H20H 4C58B 3CZFB 4NNYA 2N4IA 1NCWH 3OKKA 3RWJB 3V6ZA 4OF0A 3F7VB 3UZVB 3FQUB 4D3CH 1Q9LA 1T66D 5HHOD 2HFEB 4XT1C 1I8LA 1B3JA 1CLZL 2Y5TB 4U0RB 1M7DB 2XA8H 1CTNA 4J4PD 3HNSH 3QUZB 2NLJA 1TCMA 1QFUL 3O3AB 1X5FA 2BY0A 1Z5LB 3O6MH 3NAAL 4UQ2B 2BNRB 4MSWA 3UYRH 1I1FA 2HRLA 1IARB 4FQLH 1MNUL 2VIRA 2AJSL 3L6FB 1PY4A 1CDHA 1MJ8L 3EDFA 3VFSA 3C9NA 2YD8A 3GI8H 3MRIA 4P2RA 4RISH 3O4LE 1Y18B 4HS8H 1SY6H 2DQDL 3IJYB 4ONFH 4X7DC 2V9TA 5E9DA 1FZKA 1OGAE 2EDWA 2O5YH 4RAUB 2FX8L 3RA7H 4PJ8D 3HFMH 4YBLC 4JKMA 5KSVA 5K9QI 2VYRE 5T3XD 3HR6A 3DWTA 1L9MA 1HKFA 5IVZB 1YMME 4U1NA 5D96C 3K4DA 2IH3A 4OBRA 3DVNA 2OR8A 3L3HB 4HWUA 4TSAL 1IJ9A 1JRHL 5K9OB 2IEPA 2YPKB 1YUHB 3GMPB 3QISA 4JVWA 3V0VB 3MA9L 4FZEH 5IG7B 4XC1L 3U7WH 3MXVL 5BRZE 1NCDH 3CH8A 3KPPB 3U30B 5BW7A 5J12B 4PB9H 1GC1L 1YEFH 2P43B 4LHUD 1CTOA 2EDEA 1MOEA 3IKCB 1UEMA 5DRWA 4M7ZC 2IPTL 3CMGA 3MROB 3B9EA 3DX8A 3QZWA 3QDMA 3CXHK 2YBRA 4PLKC 3BP5B 3WXVL 1CGUA 5IB4A 1VPOL 5TFSH 1JGVL 4P2OA 1JPFB 4L3ED 2RR3A 4MB3A 4WU5A 1UQSA 2CDFA 2EZ0D 3CH1B 4ELKA 5JPNA 1Y6KR 1I1YA 2GT9B 1BMGA 3H7LA 5MHSE 1EA9C 1X4ZA 3TCXA 1ORQB 4K2UH 1QFOA 2EEAA 2HWZH 4LQ1A 4HC1H 1Q8MA 1B6UA 4Z77A 4HFUH 3PL6C 1JNHB 3MGAA 1XGTA 1IAKA 3DV4B 3LPWA 4KDTC 4ZS7H 3OX8B 4NKIH 4OLWH 3H9HB 4BQ9A 2FATL 3B5TA 3HTLX 5MENE 1U8KA 1FVCA 1Z9LA 3LQZA 4N0CC 4R4FL 1AGDA 1AKJD 4JFEA 2R4RH 4HK3J 4MNQE 5DDHB 4BQ6A 4X0KA 3K2UH 3TBTB 1FE8L 4LBEA 4YE4L 4PRBB 4EUPG 1FLRH 1T20A 3D3VE 1DBKH 4QY8A 1F5WA 4O2EA 1J86A 1DLHB 1G9MH 4I5BB 1SYSB 5JHLH 4PJAA 1A6AB 1QFWL 4G8FA 2DKMA 4DFHA 1MELA 2NTSP 2CR6A 4TUJA 2IFFH 3HZMA 3VXSA 2EDNA 3NFNB 3PWPE 4YIQA 5D2NB 3ZE1F 1PFCA 3QDJD 3R4DA 1XEDA 2F58H 3NZHH 1D6VH 4L8SA 4XCNA 5ITBH 5JXEC 1C08B 3I3DA 1DBML 5EOTA 1S7UA 4YO0A 1N0XH 1RVFH 3OAUH 4C83A 1A1OA 2CJUH 4X6FB 2HN7B 4EQ2A 15C8H 2JB6B 1N64H 2D03L 3B9AA 1Z9SA 4PBVC 1UJ3C 5HHMB 1LO0L 3H9SD 4NDMB 1N6QL 2PTTB 4GRWF 3S4SA 4OZGA 4RCAA 4X99A 3WNOA 5JR1L 1AD9B 3TWCH 3Q6GH 3GJFA 1HYSD 1CFQB 2GQHA 5EU4B 3I50L 3OXRA 3QQ9C 1XMWA 4IOFD 3LN9A 1RI8A 3QCVH 5KSAA 3UDWC 3BUYB 5CIPB 4L3AA 3TA3C 4XNXL 4P9HC 4NRXA 5F1IA 1YY9D 4MNGA 5I30H 2ARJA 3WKML 1MIEH 1RPQA 3I3BA 4X4MA 3Q6FA 1X5GA 4P2RE 4OCXH 5LBSH 4KC3B 1U3HB 1K8IA 4G7VL 4NIKB 2WSKA 4WV1C 1GGCH 1KCRH 2R2HA 5E9DE 3G6DH 3RL1B 5I1GL 1KN4H 1FFPB 3P0VL 1H3PH 3AB0B 1DR9A 1LNUB 4WVRA 5IIEB 3T04D 4MWFB 2J3SA 2EXYD 3QWOA 5GS0C 1ZA6A 1PKQB 1H3UA 5HSFA 2J8UE 1F6AA 4Y1AB 3VXUB 1EERB 1J8HD 4H1LG 4BH8B 4R7DB 5TPWL 3WD5H 3RWGB 2HFGH 3R1GL 4PP2A 4N0FA 1A14L 3BPNB 1I1AB 2OJEB 5D1QD 5TE7L 4KGLA 1IAOB 5C0CE 3BDYH 3GHEH 2IC2A 4JKLA 3VFPB 5IR1B 5FAAA 2FH6A 2ENYA 3WDIA 2OZ4L 1ZOXA 1BWMA 2ICEB 1IT9H 2GSGB 1NEZG 3MRQB 1XIWD 5DTFB 4Y4HB 2NY1C 3CMOL 4WWKA 3QDME 3BKYH 5ENWA 2BC4B 3QFJD 4LDLB 4AQOA 2EYRB 5EU6A 5FGCB 2F74A 4Z7OE 1U9KA 3P73A 4E0RB 5CEXA 1IEBB 1M7XA 3X3FH 3Q1SH 4NZDA 3CVHH 3OJDB 5GSVB 4AMKL 3U1SH 2BNQB 4OLYH 2Q1EA 3KXFB 3C60D 3BPLC 3MJ9L 4JN1H 4D94A 5C7XH 5F7LB 4YHOL 1G9NH 1VACA 1E4XH 1G7QA 2MQ3A 4GLRI 5C92A 5EBMB 1X5YA 4KVCH 1UWEH 1GGBL 4OFKA 1BZ7A 1FL6A 4KU1A 5CWSA 4YHPB 4MD4A 4P23A 1S7RA 3VD5A 2E3VA 1MEXH 2EH8L 3KVQA 4KHXH 4JN2B 2R0WL 1MRCL 3L5WB 5T5FH 5DJ2B 4PJIB 5LAXA 2BVPA 4M6OH 4XCCL 5TDNB 3PWUA 3V7MA 4JFEE 1OPGH 3FQWA 5LKNA 3L7EB 5I18L 9CGTA 3KPMB 5GGSY 3G5VA 1P53A 3VRIA 3UTTB 2VLLB 5K59F 1JGEA 3TO4C 1TVBB 1OGTB 4H26A 5HDOA 1EHXA 3RQ3A 5GS2H 2Z0BA 2Q7NA 4ZTPH 5T1KB 4PJAE 5J9PA 2WUCL 4YHIA 3HC4L 1BFSA 4Y19B 1INQB 3E2HC 1A6ZA 5H8DA 1UKQA 3VXSE 2NZIA 2G75A 2G5RA 1RUPH 3MRFB 4XPAL 5ID1A 1IZKA 2MHAA 2R2BA 5BZWB 1C5DA 5EUOF 1OP3H 2RCSL 4QNPE 2YD3A 5CHNA 4I0PD 3CGTA 4Q2ZA 1JI1A 4PJ5E 4AH2B 3EYFB 5FM8A 3QIWA 5DJDB 5ACZB 4XNUH 5DJ6B 1ZGLA 4JFFA 4NC1E 3VDCA 1PZUB 2FB4H 1VADB 2GFBA 2YHGA 4HSQA 4LCYA 5DGQA 2ZCHL 3PGDA 4OZGE 3LKRB 2VZTA 1XGYL 2AEPL 1UH3A 4XPFH 5L6YL 3B9KD 5LGKA 4XVTH 3QXDB 4PG9A 3IKKA 5F7HA 4NN6C 2GUOB 3GKWH 3PGCA 1LK3H 4N8CH 2GJ6B 3HG1E 4KHTL 1Q72H 4LSSH 4MNGE 5J6HA 1JNLH 4WCYH 3O9WA 1JL8A 4JO3L 4X4ME 1BFOA 2NY7L 3WLWC 3WL9B 5FB8A 1MHHA 2MQCA 1R24A 4NZUL 2OZ4A 1T89C 2NQCA 4GT7A 1IC4L 2PO6D 4NUGL 3GBMH 2IH1B 4JRXB 1PW3A 1NUNB 1RZGA 2HLAA 4N90E 5T3ZH 2NR6D 2NY2C 5E6IC 3IAGC 1NGZA 1P4BH 5IVNA 5DFVC 3U0PA 1CI5A 3K0WA 1NBYA 4BSVA 1G1CA 1WBZA 3NOIA 3P11L 3O6KH 4EIGB 4J23A 3C8HA 3MJ9A 3BO8B 4JY4A 4LGRB 4MXWH 1RUAL 3SO3C 3QEGH 4QHKJ 1A6WL 5EOCJ 3LIZH 4MS8C 2R15A 1NC4B 4OSUH 1QLFA 4OFYA 1M4KA 4QF1B 5CEYB 1P7HL 2E9JA 2BOCB 3WS6A 1BIIA 2XKNA 4HPYL 5C8JB 4WUUB 5AD0B 3LS5H 4AYFA 5KVEL 3RFZC 5C1MB 4Z8FH 3JWNC 2AABH 2VAJA 2A73B 4EQ3A 4C55A 5DUBB 2X89D 5ANMA 4F7MB 2OMNA 4D2NA 4U1LB 4EI5B 3KLAA 4FQQB 4P5TB 3HI6L 3BZEB 1A6TA 1QNZH 3QDGE 4DZBA 3L95A 4RWYL 5HBBA 3REVB 1EJ6A 1EO5A 1OAUL 4I48A 1JRHI 1KPRB 4YQXL 3MLXL 3MRDA 2J2ZA 4PR5A 1OLLA 1RQ5A 3FZUC 1SMAA 2IALA 4H1LA 5HYSB 1KJ3L 4GKSB 4K8RC 3UPAA 4LLQA 4U1IA 1XGUB 3ZKXB 4EDWH 3O8XB 2R1XA 1NGWB 4ZSOE 3CC5B 1JP5A 3I6GB 2HFFA 1CE6B 1TMCB 4WUKL 1U8JB 1YMMD 4M9OA 3RWEB 4R4ND 5E8PA 5KJRH 1VGKB 5F9WB 2ILLA 3H3KA 3J7HA 4O9HL 5FDWB 2C7UB 2Y5EA 5ICZB 3BPOB 1NEZA 3QUYC 4JG1H 2D9QB 2YPVH 3T0XA 4M3JA 5HGHA 1J8KA 2DM3A 2ADFH 4P59L 4QCIA 2YPLB 5BRZD 4ZOAA 4XGZB 2DLGA 3BEWA 2C4XA 1CFVL 3NFSH 3UPCA 4FQCL 3RWFB 1XF2B 4KAQL 5SWZE 3OMZA 2IPUK 3MNZA 4ERSH 1L7IH 2LU4A 4OFIA 2J7LA 4M3KB 5DUML 3EBAA 4P2QE 5T1MB 2NTFA 4FTVB 3E6FB 4N9GB 1QLRA 4TSBH 3EO9H 4ZUSB 1OQXA 5HI4C 3EFFA 4S2SA 2QKIA 1OTSC 4U49A 1JPGA 1UCBL 3QIUD 1QSEE 3MRGA 4HFWA 2GJZB 3QEHA 4J2XA 3A6OA 4ODTH 3INUL 1OF2B 3C5SA 3F58H 1UKTA 3LB6C 3EYSL 5MHSD 2V2XA 4FQXB 3BD3A 5ACLA 5J8OA 1T83A 2Z31A 3W39A 5IT2H 4HWZA 4JVPA 2WLZA 3VGAC 1CICC 1JNJA 2YSSA 2DLIA 1AC6A 1NGYA 4O02H 3CPLA 3QCTL 4L9LB 3SKNB 4GMSH 5DYOA 5I75B 2R2EB 4JKWA 5F7KC 2CIKA 5MEND 1FIGL 3DUHA 1MSPA 2R23A 3LCYA 4XHQA 4K7PH 3X12B 1JMZA 4MNQD 3K8MA 1D9KB 4UNTA 4X6EA 3WIIL 3KYOB 2Q76A 3CNKA 3KWWA 4Y89A 4BZ2H 2Y23A 5IQ9A 3B43A 3D0LB 1JN6B 1WC7B 4WFFE 3HPLB 3HCVA 2SEBA 1U2HA 2IQ9H 5T3XH 1SEBB 3ZE0F 3LOWA 1TJIH 8CGTA 4P3CH 1PAMA 5GJSH 2I5YL 2ED9A 3QWRA 5C0FA 3C5ZD 4G8EB 5KG9B 1K4DA 3F62A 2Q86B 1RUML 4KMTH 1JHLL 3SJVD 1DQTA 4S1QH 1F4XL 4XPHL 1RIUL 4A6YH 3TYFB 4TVSa 3MCKB 3M1BA 4MB4A 3TZVA 1CFNA 5JA9A 1Q0XH 2X4PA 1M1SA 1OVZA 3WFHA 2EE9A 2V7HB 3QEUB 4Z7UB 3VWKC 3FJTA 4LHQB 1WISA 1MVUA 3OHXB 5FCSH 5IW3A 2X7LB 3WIFB 3ES6A 3NFPB 4PY8J 4R2GC 5KAQG 2P8PB 4XVUC 5GSRB 5C07A 3P9LA 5B38B 1FAKT 2JELL 1CG9A 4AEHH 5C0BB 3S37L 1Q38A 1WBXA 3UZEA 4GQPH 1BOGB 4CJ1A 5DWUH 1U8LA 4XH2B 5ANME 1QHPA 3CLEH 3FMGH 3SKUD 1Z0NA 1BGXL 4PJXF 4P2RD 4S0TD 1H5BC 4CKVX 5ALBL 4KZDL 4XBPA 5L9DH 4U6XA 5B3NA 4PGCB 1FBIH 5I1AA 4Q9QL 4HUWB 3ZT7A 5E9DD 3AREC 2MCG1 5D7JB 5TH2A 3PWNB 2CDGA 1MRFH 3LHPL 3S7GA 5IHUH 2LTQC 4U2ZA 4KJYA 5CJXC 4U6YB 4LAQH 5I76B 5I6XC 1GAFH 2FO4B 1U91A 2I27N 4HEME 3LAFA 4UB0L 4EOWH 4QOKB 2NY3B 3ARSA 3H42L 3S34L 4U1SB 4UU9A 5DD5H 4K3DL 3ZE1E 4GRMB 4IJ3B 1OSPH 2JJTA 3JTSB 2VXSH 5BXFA 5EUOA 4R8WH 5E08H 2GW5A 2P42B 5IEKB 1WBYB 5IFHL 1K85A 2DQJL 3LKPB 1QTYT 3IXTA 3FO9A 4UTAL 5IBLD 5GGSA 2LAAA 4Y7MA 2H41A 3B9VA 5C6TH 5CEZL 4GRWE 2JCCF 5EFIB 1K4CA 2A38A 3QDMD 1HKLH 1FSKC 3D2UB 1AQKH 4ORZC 4FABH 2W0FA 1RK1A 4TTDC 5F7DB 3WN5A 4DOHE 4P2OD 2WIMA 5MEQB 4NOBA 4RFOH 3Q48A 3JWOH 1NANI 1A9EA 1NLBL 4JY5L 5CS7A 1TETL 5IROA 4F9PC 4OCRL 1T5WA 4NQCB 3QWQB 3V6OE 3VXTA 3GMRB 4QHUB 5JO5A 1JHKL 1IQWH 3HE6A 4RMRA 4N5UA 3MTRA 4RGNB 4JFXB 2HJFA 1KULA 1EUTA 2VL5B 2FZ3B 1FH5L 3SDAA 1VKXA 2X2YA 5HPMB 5JQHC 4NZJA 3QHFL 3QXUA 2YUXA 2P24A 1BJ1J 2IBGA 3LRHA 4MD5B 5FUOH 3VXPB 2FLRT 5EBLB 4C57C 3C8KA 2VITA 3H9YA 4NWTL 5D5MB 4J7RA 5HJ3A 4ONHB 4PP1D 4JFED 5FKAB 4NYLA 4S11A 1FN4B 3HS0A 1RJZA 3I6KA 4PB0L 2XTJB 3WV0A 3P77B 1QA9A 5JMRA 1ZSDA 4DQOL 3EOYG 4QTIH 4TQEH 4PUBL 1EUUA 1J5OL 4OZFH 3HZVB 2UWEB 3RNKA 2HT2C 3D1MC 3A67H 5KOMC 2GHWB 4WTXA 2ITDA 3D5OF 4HGKC 3TT3H 2R0KL 1TZHA 4K71B 5F9DC 3VXSD 4DVRH 4NRYA 2YD4A 5IM7A 2QQNH 1KACB 2B1HL 3IF1A 1F4WL 2YKLH 3R0NA 1IGCL 1BLNB 32C2A 5D71H 3OR6A 1MFEL 4Z76A 3EGSB 3QCUH 3AAZB 2XZAH 5BQ7B 5I1LB 4AT6A 2XZQH 2C1PA 3ARBB 4NQSB 3HAEA 1U8PB 2DQHH 2MFNA 4PLOB 2YK1L 4PIRF 4QRPA 4X7FC 4IMKC 2A83A 4IIQB 4U1MB 4C56A 3GSOA 3WXWH 1PYWB 5FA4B 2W0LA 3EYUH 5EBGA 1RU9H 2HLFD 4JR9L 4IMLA 4J8RA 3IGAB 3QG6A 3DUUA 1DBJH 1TPXC 2Y06H 1WFTA 4QRRA 3MRLA 3FONB 4NPYB 3HI1A 2R1WB 5HYQA 1NMCB 4OLVL 1WWWX 4JQIL 4XP9H 4JPKL 4U0RC 4PV9B 1DTUA 1CT8A 3QUZC 2P5WB 5HHVH 3GUTA 2B4CC 2AEQH 5ADOL 5FYLL 4G6KL 3DX7B 3DJ9A 3TVMC 3SGDH 1UG9A 8FABB 5AUMB 1U2CA 2H2PC 1C12B 1MJJB 4MQTB 3WNKA 4ZAKA 3WEXA 1AGFB 4YWGL 5I2IA 1SJXA 2AK4A 5K59E 4JANB 5D1ZA 4PRHA 3D6GA 4YNYA 4HG4K 3RIFF 4NJAH 4XWGH 3U7YH 2FHBA 1RZJC 4GW4A 3CVHB 4L29B 4PRIA 3O11B 4YBQC 1D5ZA 1CD1B 4MJIE 5KVFL 4H5SB 1NC2B 5E5MB 5EUOE 5F1NB 1V3LA 4PGEA 3UJTH 2Y7QA 1Q1JL 5HHXL 1A3RH 4Q9BA 1C1EH 4RAVA 2BY1A 2F53A 3LD8B 4X6CB 1F6LL 3GNML 3GSNH 4YJZL 4WTZG 3V5DB 1A4KA 2V9RA 1FVEA 3SGKA 4F8QA 3HZKB 4UNVA 2VZSA 4TRPL 4WWKD 1JYWA 2LVCA 2ZNWA 1LD9B 1U8IB 2HT3D 5EU6D 2XWTA 5FYKL 4OGYH 1I7ZB 5J12C 3U30C 1FJ1A 4NM8L 5FCUL 3BRFA 5GGTL 1WT5A 5GHWL 3F6IA 5CJ5A 1CFTA 4IRJB 2Y36L 2WWMC 4Y2DA 4PJ9B 4UAOB 1WICA 2R8SL 1U3JA 3MV9A 2ARWA 4J1UA 3MRKB 3D25B 4OI7A 1C7SA 1F42A 3NIDF 1G6VK 1P5VA 4S1DC 4LHJB 3LEXA 1BQHB 4KY1H 4YDJB 3TYGH 2XQBH 1LVEA 1K3IA 1PGRB 4I3RL 3UAJD 2XRAH 1ZA3B 3DRQB 5GGUA 3VDBA 4PGDB 3RTQA 1ND0B 3QG7H 4P23D 1EMTL 1AE6H 4EEEA 3V4UL 1INEL 2UZIH 4JZNB 5GIRA 5I1JL 1SYVB 1A7QL 5DMKA 2P46B 1JGDA 2OJZH 4ZPTA 2XV6B 5KVDL 1UACH 5I74C 3AXLA 5FV1L 3V8OA 1M05B 2CDEA 4I1NB 2QHLA 1NAKH 1UM4H 2CRMA 2EIDA 3HB3D 1T04B 4NFCA 1CD8A 3ALPA 2AXFA 2CH8A 3FRUA 4N0UA 4XPGL 1NCNA 3CFKA 2L7UA 4HIIA 3K4ZA 4LPVA 5E6YA 5IJKC 3GJEB 4F80A 2CLVA 3MC0A 4FFVC 3MREB 4I18B 4QYOA 3ARYA 1UA6L 1H3GA 1V3JA 4QXTB 1GRWA 5D72H 1QRNA 2DQTH 2K1MA 3ARGA 5TQ0H 1WZ1H 3UTZB 3GJFK 5C08B 3FFCA 4YXLH 5EPMA 3T2NH 1YQ2A 3N1FC 3CU7A 5E8OB 4X83A 2F54A 2NXZD 3GHBH 4H0HB 4L3CB 4XXDB 3LEYL 2OK0L 1S7WA 1ULVA 2VDLH 1S7TB 2R56H 3SCMB 2A6DB 2X4QA 4L8BB 2E8YA 3CDFA 3QIWD 4YDVA 2Y6SD 2JE8A 1T0MA 3WUWB 3VRJA 3RNQB 1J1PH 5IEHA 2P8MB 4JFFD 5A1AA 4LARH 2DOCA 1OHQA 5D8JH 1BD2A 3VFUA 1BIHA 1ZT7B 5D2NC 3L5XL 3FB8B 2NYYC 4I13B 1KBGL 4CNIB 4QRPE 4LSTH 1P6AB 2G2RA 4LLVB 4C56E 3HMXH 1CGWA 5GRUL 5EWIH 3MLRH 2VXUH 1MJ7L 3MV11 4R97B 5E2TL 4UINH 3HRZA 3T65A 5FM4A 3NMEA 3PP4L 4QRRE 3P0YH 2BJMH 5H2BA 1PVHA 2R0LH 7FABL 3BAEH 5IJVB 1FNEB 3MFFB 3X14B 1U8NB 3O9WD 1JV5B 2N1KA 4PBWD 2VISB 4UV4H 3MBEA 4PJHF 5TF0A 1JPST 2M2DA 3TJEH 4ODXB 3AS2A 3X17A 1N4XH 2BOBB 1F45A 4PY7B 1A7NH 4ODSL 1YEKL 1AHWB 2CK0L 4N8VG 3EDJA 1EO8H 5EZIL 2JCCA 5F89B 3TBSA 3TN0D 5DD1L 1B0GB 1OAYL 2HTLD 2GSIA 3MLVH 5BS0B 2R1YA 2ADJA 1TIUA 1VCAA 35C8H 3NIGF 2AJXH 5GGTA 3K2MC 2AK4E 3SBWA 2EO9A 1NBZA 2LQRA 4PRHE 4RQQB 5C0DA 4YAQA 5FHBL 4WRLA 1OW0C 5CCKH 2AP2A 1YJDL 3DLQR 4GBXA 3T09A 3RVVC 5C0RH 2R39A 3OKNB 5BOPA 4OFYD 4PRIE 4N9OB 1EX0A 4EXKA 5EOQH 2QADD 4PJEB 3AB0C 2DDQH 1FO0L 1GSMA 5D2LF 5CP7B 1KJMB 2GTZA 5TE4L 3TBVA 5E24E 1INDL 1M71A 4HJJH 5I71C 2WZPD 4KI1A 3QI9B 5A3IC 2Q3ZA 3OKMB 1JWUA 3LMJL 2ZG1A 3RWDB 3SDDA 5DMIH 1KIRB 5DUPL 3OKLA 4NQDE 5C0IB 3M8OL 2AEIT 4HX1B 4UBDC 4Q6YA 1G7PA 3NCBB 4J6RH 5D7LA 1W0WA 4WW2B 4Z78A 4Q7DA 1FP5A 4X98B 4ZUTB 3NTCL 4LEOA 3TEUA 3RY6C 1BFTA 2KL6A 5J1TC 1ODAA 5DEGB 3TH3T 3WUZA 1MIML 1AGCB 3BPNC 3I85A 4JJ5A 4N1CA 2F5AL 4D9LH 1AI1H 3OL2A 1UB6A 2ATKB 2VE6B 5SX4I 1W8OA 5IK3A 4NO5A 2BSSA 5ESVB 5FM5M 5SWSA 3MZGB 1I4FB 1I9IH 3ZE0E 2F19L 3CVIL 4Y4FA 1RIHH 3HZYA 2PR4L 4G5ZL 3GGWA 1FNSH 5HHOB 3DSNA 4WTZA 1F8TH 4M7LT 4UT7L 3FB5A 4NZTL 1W72L 5TJWK 3MV01 5CGYD 2DQGL 5KTEH 1KLFA 4OJFL 5DMGC 4FFZL 3THML 3PJSB 4G7YL 1IGMH 1LILA 1U58B 2AGJL 3NCJH 3RGVA 3VFWA 5FK9B 2Z91A 4S1RH 4LGSB 1E4WL 3WBDA 1AJ7L 2D7QA 1NAML 2GY5A 5F7MC 1T03H 4MVBC 4U05A 4D9RD 3BD4A 4N0UE 4HUVB 4JPIB 4G8GA 3EDEA 4RFNB 4ZUWB 3EZJB 4QEGA 5HD8C 1QRNE 4GG8B 1RZIA 1JE6A 4PJ8B 2FJGA 4Z7WB 4M7LL 3RY4A 2FSEB 4HW6A 4MA7H 4PJXE 2Z31D 1PG7H 2F54E 2YOCA 1U8OA 5H37H 3UJJH 3EFDL 4AEFA 1T1WA 4F7PB 4G6MH 4CN6A 1RZFL 4ODVH 3MLSL 1AIFA 2BNUA 3K1KC 4BKLB 4A6YB 2CLZA 1BD2E 1HH9A 1Q9KA 2BX5A 4PD4J 5JHDB 1TJGH 4EN3A 3UC0H 5LGHH 4DGIH 4LHUB 2ZKHH 3BIAX 3IDJA 1ZANH 2H9GA 3P40A 4AEIH 1V7NL 3G6JF 1XCTA 2BVTA 4LSQH 2XOTA 1FO0A 1WCBB 4PTUA 2X4NA 1BJMA 1UXWA 1MI5B 1EVTC 5EORL 4F7EB 2X70B 2FD6L 1UGNA 4NNXB 2FIKA 3BP7A 1CL7L 4FXLA 3ORJA 1QPXA 4L3EB 1TCRA 4TNVK 1NL0H 2BSTA 3QNYB 5JZ7D 3CSYB 5I1DB 5C70A 4LEXL 3R8QA 1A7RH 3CCHB 5DVOA 3BH8B 1L6ZA 4V2BA 5FYKE 5I8KL 1QOKA 1HHJB 1ZHKA 3TZVD 3CU1A 4XNYH 3L1OL 4PREB 3DX6B 2CGRH 5HY9A 2RHEA 4U7MA 4EVNA 1AGEA 2ZP0T 2VQTA 2XQYG 3MMEB 2ZUYA 1EV2E 4FFWC 1DN0B 2XZCL 4WHTB 5DVLA 2HVKB 3SKMB 1KEML 2I07A 4P9HL 4NO3B 3SGEH 5C07D 3S5LB 1KGCD 3EYOB 4HKXA 1NCCH 2PCPB 5HVHB 4HWEH 3D39E 1UVQA 1DQJA 3RAJL 4WFHE 3SDCA 2NNAA 2X05A 5FGBA 1W72A 1AKJB 1HYRC 3V7AG 2XNAB 1L6XA 4KRPD 4JB9L 4N8VA 4GW5B 4JLRB 4NQTA 2BSRB 2XWJB 4XP4H 4CADA 1JWMA 3GIVA 4XVSH 5GRVL 2A1WL 4HZLA 3IAQA 4PRPE 4NFBA 4KMQA 1GZQB 1NDMA 5GGRB 5D7LE 4BFGA 4DKEL 4GXVH 1KIUA 1NAMA 3B2UD 4JQXC 5HGDA 1KFAL 3BOVA 2YR3A 2BP3A 1A3LL 4YHKL 5IF0B 1FYHB 5DJAA 4RX4A 5FECB 3QDJB 1P1ZB 2P5EA 4UOJA 1GGIL 3C08L 4BYHA 1IGYB 4QHMA 4EI5C 5AG8A 4P5TC 1T0PB 1CLZH 2E7MA 4QHNB 5SWSE 1KSRA 4ETQB 1QFUH 3NAAH 1ZMYA 1XF4B 4HIHA 4KDTA 3H9SB 1RHFA 4ZS6D 1K2DB 3T77A 5IMOB 3T2OA 3GSVB 5IB2B 1BAFH 1MCNA 3FO0L 1U8HA 2A74A 1RJYA 1MNUH 5FGSA 2ZCLL 3KPQB 4F3FB 3KYNB 2AJSH 1RJLA 1MJ8H 3ZKXC 4ORGA 1S7QB 3O8XC 1GOHA 1R0AL 1KB9J 1QVOB 1BBDL 1HDMB 3HNVL 5FYJU 3P4OB 3JBG7 1WV7T 3GFUA 5IB3B 1ZS8A 5DRXA 4JCLA 4LCWA 2E7CA 1KG0A 3IRZA 3PF2A 4TN9A 1GJIA 2BVOB 3BKCL 2P7TB 2FX8H 2YN5A 2I25N 4YFLF 3T8XA 3CUPB 5JXEA 4LKXA 1FG2A 2Y9RT 3LKQA 3ZTNH 3FOMB 3FL7A 3ARQA 3H0TB 4Q74A 3ULSA 3GJFH 4OF6A 4TSAH 4OZFB 4PJHA 1J88A 5FOJA 1ZT1B 1JRHH 5F88A 4JO1L 5LXGL 3HE6D 2J5LB 1S78C 3MXWL 4DUWA 3O3DA 1LDSA 3MA9H 5L2KA 2Q3AA 4XRCB 4XC1H 4DTGL 1F11A 1J11A 3MXVH 3SDAD 3BMVA 1HSAB 2DQEL 1J8HB 4ZMAT 2X4UB 3ROOA 1GC1H 1T7XA 3U46B 4OV5B 4KTEL 1FGNL 2FRGP 5L0QB 3QUML 4PV8B 4FQXC 4NWUL 3UDWA 5D1QB 3WJJA 2IPTH 2ZZUT 5I8EA 3HN3A 4Y4KD 2X5PA 1EDQA 3KPOB 2ICES 3WXVH 1U95B 1ZVSB 2W60A 1VPOH 4KK5C 3CFDA 5I9QC 1XIWB 4G8IB 1IEAA 4WV1A 5B4MD 3F12A 4L9LC 4OLZL 4O51A 2HG5B 3IFPB 5D2LA 5I75C 3QFJB 2BHYA 4LPCA 3D48R 2OQJA 2J1KA 5EU7C 1WZKA 1JBJA 2WK2A 3CFJB 4X4XA 1BWWA 4IDJL 5DRZA 4X6DB 1D9KC 3UTSA 5AYUL 1Y0LA 3C60B 3TPKA 5TF1L 2VKWA 3NA4A 2GK0A 3L7FA 1D5MA 5DD0L 3MNWA 4RISL 3WJLC 4JFQB 1EXUA 3L3KB 2FATH 1KLUB 1DFBL 1MAJA 3MV7A 1S9YA 4R4FH 4PJBB 1SM3L 4QRPD 3UYOD 3MGTA 2AV7A 4C56D 1JJUA 4ODUB 3RA7L 3GM8A 4LFHG 4X8JB 3PXJA 3BX7C 5DK0B 1G7HA 1FE8H 2X4TA 3NIDE 4YE4H 1TNNA 1FFRA 1K8DA 3LKOB 2APFA 2EDTA 4QRRD 2AJZA 2DI7A 1JF1A 3NPSB 3E3QC 1R5IB 1QFWH 3MACL 3OBAA 4HGMA 2EIZB 1JWSA 1XF1A 1LEKA 5GZND 5D93B 3P4NA 4LCCB 1B6DA 5DSCB 1ZLSH 5I73C 3P4LA 4BFIA 2RIKA 5CEZD 2P48B 2D31A 3EOAB 1DBMH 3V79C 1E28B 3MRCA 4OT1L 1ZV5A 1RJCA 3GSNB 4MGXA 4ZFZB 4UTBL 2MQ0A 5DS8B 2P5EE 3B9DA 4HK0A 4PRDA 2AJ3B 1SBBA 1TVHB 4ZAKD 2D03H 4I0PB 4CMHB 4YPJA 1IAMA 1N6QH 5D1ZD 4PRHD 4H0GA 3KLHC 4M93C 5CP3A 1LK2A 3BZ4B 5JR1H 2FH8A 5D7JC 2XI9A 1R3HB 1QRKA 4PRID 1HOCB