1JMZA

Crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
493
structure length
493
Chain Sequence
b'EQGPSLLQNKCMGCHIPEGNDTYSRISHQRKTPEGWLMSIARMQVMHGLQISDDDRRTLVKYLADKQGLAPSETDGVRYAMERRLNTVEQFDTQLSETCGRCHSGARVALQRRPAKEWEHLVNFHLGQWPSLEYQAQARDRDWLPIALQQVVPDLAKRYPLESAAWAEWQKARPKADALPGQWAFSGHMLAKGDVRGVMSVTPDQGDTFKVEVKGAYADGTPFNGSGSAILYNGYEWRGNVKVGDANLRQVFAALDGEMKGRMFEAEHDERGLDFTAVKEGKARLLAVQPAFIKAGGESEITLVGSGLAGKPDLGAGVEVTEVLEQTPTLVRLKARAAADAKPGQREVAVGTLKGVNLAVYDKVEEVKVVPAFSIARIGENGASVPKVQGRFEAEAWGKDANGQPLRIGYLPASWKVEPFNERAVEDEDVKFAGKMQADGVFVPGGAGPNPERKMMTNNAGNLKVIATLADGGQTGEGHMIVTVQRWNNPPLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amine Dehydrogenase
publication title Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 135
structure length 493
sequence length 493
ec nomenclature
pdb deposition date 2001-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09098 Dehyd-heme_bind Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding
A PF09099 Qn_am_d_aIII Quinohemoprotein amine dehydrogenase, alpha subunit domain III
A PF09100 Qn_am_d_aIV Quinohemoprotein amine dehydrogenase, alpha subunit domain IV
A PF14930 Qn_am_d_aII Quinohemoprotein amine dehydrogenase, alpha subunit domain II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.120 Mainly Beta Beta Barrel Lipocalin Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 1jmzA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jmzA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jmzA03
3A67H 3OB0H 2DDQH 4R26H 4F7PB 5ANMA 5K33A 4FQIH 4P5TC 4JQXC 3B6SB 4U2ZA 1FAIH 2I5YL 5F72S 5DQ9A 1GH7A 5IVOA 1AKJA 5BRZE 4ODTL 4U49A 3UZVB 1JYWA 2NZ9C 4L4TA 1IT9L 1IQDB 5C7XH 2E3VA 4L3EE 1JBJA 2O5YH 3C60A 5IG7A 1A22B 3ARDD 3EFFA 2D0GA 5KSBF 5GGQL 5I74C 2JJVA 5F3HA 1MVUB 3PQYB 4GW1B 4LCCC 4HW6A 3LSOB 5FGBC 3U4BL 3KPMA 4RZCB 4UNVA 2OK0L 1WISA 1AQKH 3KPPA 3QDMA 2DOCA 5CEZE 3ARVA 5H94B 3QEQE 4YHPB 4PGDB 3PHQA 4NKDA 1JHTA 3I50L 4PTUB 1CLZL 4Q97A 2Y5TA 4NYLB 2K9UA 1ZE3C 1AO7A 1UKTA 2EICA 3OF6D 1MLBA 5GGTH 2NY1C 1UJ3B 2NW3B 1KC5L 3OGCB 3NTCL 1UENA 1WFOA 1BM3H 5E24E 3U1SL 3F58H 3L3DA 4MQ7A 5F7FA 1FBIH 2IAMB 3T2QA 4FQ2L 1MWAA 4NRYB 4F7CB 1QSZA 3ULSB 1IL1B 4AIZB 5L2KD 2Q6WA 5DEGA 3TPKA 2JK5B 1JNNH 1FJ1A 5ADPH 4OZHF 3BIBX 4MQSB 2YXFA 2ARJB 4OIIH 4R7DB 1NKOA 5IB4A 5F7KC 2V7HA 3EO0A 2EDOA 5EZIL 4JO2L 2UUDK 5E03A 3JWDH 1Z5LA 3MLXL 1P4BH 4P4KC 3HE7D 3LS5L 1EXUA 3SDXA 3H9ZA 4NZRH 1FL3A 4NQXB 4XVUD 1GHFH 1WICA 4L3CB 3HZKA 4WV1B 2XTJC 5E95B 5F1SA 4A6YA 2AAVA 2CLZA 4X6DE 4QWWC 4M03A 3UJIL 4YHIA 5FHAH 1X5GA 3TIEB 2DQIH 1EX0A 5KG9B 2PXYA 2EEBA 4X5LA 5F6HJ 3CSPA 2QV2A 3KPQB 4WO4D 1ZLWK 5JPNA 1CGVA 1IGCL 3JSSA 3PDGA 4ZFOB 4BYHA 4G6KH 3O8XA 1J1XL 3VXNA 1G6VK 3QIBD 3GMMB 4F7MA 1YMHA 3R06A 4HS8L 1HHKB 3UROR 3WLBB 5GRWA 5T1LB 3LZFL 5IFJB 1RZ8A 3G6JB 1JI2A 5DXWA 1PAMA 1GXEA 5I1AA 5B3NA 5ADOH 1H0DA 3K4DA 5JHDB 3TBTA 1NAMB 3RL1A 1WFTA 1CDJA 4C4KO 5FDYA 2WWMC 5TH2B 2EE9A 5I1GH 4L9LC 3DO7B 3O4LD 4XPGL 3UTZA 1WTGT 3T65B 4AM0A 5JQ6H 3MV7D 4MA8L 4XNZB 3MRLA 3QJHA 1MPAH 4NQEE 3MNWA 4X9GA 5BVJA 4XNUH 1QEWB 4HF5L 3P40A 4Z7NE 3TVMD 1A1OA 5FO8B 4TVPD 2FCBA 1RU9L 5E00B 4L8DA 4Z7UF 2DKSA 3P3YA 1MCPL 5D6DC 4HLZG 5GHWH 3RGVC 3P73B 4CGTA 1IAII 3VGEA 3RL2A 3WIFB 5JHLH 4HK3N 1RIUL 4Y4HA 3BO8B 4NC0B 2X5PA 4G6FD 3RWEA 3MMEA 1T1WB 4GKZB 2YWZA 4ZFFB 2FEEL 4XMPH 1Q1JH 1TZGH 3MODL 3H7BB 4C58B 1QO3B 4Y88A 4HJJL 4OGYH 3G9VA 3V6BR 1WV7T 3PG2A 1LP9B 2V5MA 5L8JB 1OAZL 4N68A 4WUKL 2DLEA 2P7TB 5DJZA 5C9JA 2A9NL 4WFHE 2O5XH 1EPFA 1T21B 1AQDB 3SDXF 4KK6C 3UPRB 3TWCL 4JM2C 2W9DH 3QHFL 4V1DD 2IGFL 3SE3C 4G80B 1HHHA 3PDDA 4JKPH 1DBBL 5LCVL 2CIIA 1HDMA 4XVTL 4CMHC 1A3RH 4Q6IA 5T3XH 1FV1B 3RVVC 3IAQA 1LE5B 4L1DA 3MZTA 4K94H 4YIQB 3RZCB 3WL9B 5D2NA 1N5YH 1S7TB 1G7LA 3QEHA 2YD6A 3F7YB 1FL5B 3ARED 1B2WH 5DEFB 2ADFH 2ITDB 2ORBL 4ZYKA 4WU7B 4O58H 1IQWH 5DQJB 1BFOA 3SY0A 1BQSA 1JPSL 4UDUA 3UTTB 4P5TA 1J8HD 2VXVH 1F4WH 1ZGLA 3AGVA 4MB4A 3HC0B 1RUML 4PGBA 1IGML 3ULUC 3QWOA 5ID1A 2ZUSA 4MXVF 1I3UA 3SGEH 4ZS7L 4I3SL 3GKZA 4C55A 5L9DH 1XCTB 2XZAL 4PV8B 5TE6H 4XPAH 1MFBL 1J0KA 1K3ZA 4QXUL 4YC2B 2X70B 2R0LL 3UZQA 4H1LH 4YHZH 2XNAA 3BD5A 4KRNA 4BFIB 4J2XA 4TVSa 5FKPA 3UYRL 1ZT1A 1F00I 1R3HA 1OHQA 1KCSH 2GT9B 2YZ8A 1E4WH 4LCCA 1RZKL 3CCHB 3C8DA 1XCQB 5FGBA 4ZXBD 1RJLB 4NNXA 2ATPA 4HUWA 5D2LE 4OTXH 3SKNA 1KB5B 4BJLA 2NZIA 1SM3H 5L2JB 1GAFL 4OCXL 4R90H 3CFBA 2P24A 1NFDA 2BRRH 3UC0L 2NW2A 4HX1B 2EXWC 3FQWB 5DVOA 1ED3B 3VFSA 5HDQL 3AS3A 4MCYB 4Z95H 1QSEB 2OL3H 5C2BH 3TVMB 1X5JA 4P3WA 3FONA 1TJHH 2NXZB 5EU7C 1J1PL 3RIFK 3QXAB 4URTB 5F6IC 1H3GA 5T3ZD 4JDVA 1YNTB 4JHZA 2Q7YA 2ENSA 1N0XL 3DVGB 4RRPA 4EI5A 4M3KB 4P2OC 1OPGL 2HFFB 5EU6B 3MA9H 4ODSH 1FO0L 4RFOH 1PG7H 3B2UD 1YPZA 1JNHB 2BMKB 4PJ9D 5HI4C 4O00A 4XBPB 1LDPH 3HNSL 4FFWC 3GKWL 2ZG1A 3PXHA 3KPRA 1N6QL 3FAXA 4LKCA 3GBML 5E2UL 3V5KA 5IOPB 2X9YA 2VC2L 3OKEA 1T7YA 4P4KA 1A7QL 5FYJD 1IC5H 4OGZA 3NABL 5E2JA 2IADB 2NY3D 3QNZB 3JV4A 3RWGA 3IDMA 5JW4N 5LGJB 3INUH 2YRLA 1HKLH 3L5XH 3WFBH 4PBWD 3VH8A 1JZ7A 5FF6A 4PREA 3GBLA 1EBAA 2OZ4A 4O2FB 3FO9B 4IIQB 1C5DB 3LKOB 4Q9QL 1VKXA 4L5FH 4MXQD 4YEFA 1KIRA 2HKHL 4LSPH 4LVEA 5IKCB 3VXTB 1X3DA 4LCWA 4OZGF 4W6WB 1M71A 4KVNL 3VGGA 4UV4H 1PEWA 1YZZA 2FEDD 3HUJA 3ARGB 4P4RB 4ORGB 5J3HC 1GZPB 4LOUC 5BV7B 1N8ZA 4NN7B 4M93B 1FLRH 1RULL 4L9LA 4YXHL 4KRPD 1KPRA 4LARL 3UPAA 4PRHD 3VXRB 1CL7I 1JGEB 3GHBH 1YEEH 1BAFH 1T2XA 1XGTA 1E6OH 1J8HB 1DANT 3S96B 1C5CH 1I7UB 3B8YA 4IRJC 5KJRL 1SHMA 1MLCB 1DL7L 4RDQG 5KVGH 3UO1L 1FIGL 1EAPA 5L2KE 1CLYH 1NFDF 5GGSY 2GJZB 5D6DA 2F19L 3D69A 1B6DA 4Z77A 1HWHB 4LIQE 1CXFA 1LK2B 2BY3A 4I2XA 3OB0K 4J7RA 3H3BC 3ZYOA 4OLYL 4RGOH 5FA3B 1BF8A 5EIQA 4LAJH 4R6UA 1TNNA 4S0TD 2YBRA 4JZJC 3VE0A 3HZYB 3O4OC 2R9HC 4OGXH 1JF5A 2W0FA 3EZJB 5E5RB 5B3JF 2VZ3A 3TN0A 4WWKA 4ZTPL 1Q72L 5CBEB 1NGWA 1YPZF 3JTTB 2X4PB 5IWLC 3ZE0E 3ETBF 2PCPB 1BZ9B 2EIZA 1LO4L 2KPNA 3FOMB 3HR5B 1GIGH 1NBZB 5TJWK 4TRPH 2CIKB 4LQ1A 2EZ0D 2UY6A 5FB8B 5C3TA 4EI6B 2AJZB 1W72A 2APWA 2HFGL 1XF3B 2X7LB 1G7IA 3EBAA 1KCLA 3G9AB 2F15A 2FL5A 4J4PC 3MYJB 1CBVH 1JI1A 1P7QA 4JFZH 3SE3A 4FRWA 3MRIB 4UILL 3TT3L 5T1DH 4BSJA 1Y18B 3WLWC 2PW1A 4QY8A 4K2UH 4OKDA 3P4LA 1A6VH 3QIWD 2DLTA 1TZHA 4G8EB 2CRZA 4DFHA 3QPQD 1U3JA 3O4LE 1UM6H 5AAWA 4D3CH 5DUBB 5CJ8A 4G7YL 4LSTH 1L7TL 3MV7E 1EUTA 1F3RB 2FO4A 3MFFB 5HI3C 2BZDA 4FXLA 3MUY1 1IKNA 5D7IB 5I1CH 1I9RH 1NC2D 1AXIB 4TVPE 1OD7A 2VLJA 4M62H 2ZOKB 1T1YA 4OLZH 5HD8D 3HUJF 2K1MA 3OR7B 5DVLA 5ALBH 3I85A 2AP2A 1MY5A 2A83A 3S98A 3X12B 1IBGL 2R2HB 2FO1A 4E5XA 1KV3A 4IMKC 1IARB 5ECJE 3MROB 4DGIL 4JRYA 1HSAA 3VD7A 4FFZL 4D0CB 3WHXB 4WWID 1NUNB 3W39A 1FFNB 2CR6A 3MBED 5HBBA 2R4SL 1RZFH 2R23B 1EVTC 4OCSL 1P1ZB 3UAJC 2VZVA 4M9PA 2P4AB 4R0LC 2DWDA 4DAGH 3L9RB 4LLDA 4P2YA 2VZTA 4GLRI 5C71A 2D7PA 2QEJA 4WEMB 3D3VE 3ULUL 3B3IA 1K4CB 1QRNB 3KPSD 3EOBB 4MCZA 3PWNB 4JHAH 1CGXA 1AC0A 1S5IL 1A6UL 1NCAH 1TITA 3H9SD 1CICD 2NTFA 1IGIL 4V1DE 3HZVA 5K9OA 2QADD 2W60A 1WZLA 2D31B 1NAKL 2F8VA 3DRTB 3IU4H 1FFRA 4NFBA 3I6KA 4TULL 3FKUS 5FYLE 5DQDH 3MJ7B 4CW1A 1UXSA 5DVNA 1ZWIB 4HUNB 3TPUA 3Q6GH 5FO7A 3PIQB 1ONQA 4PRDB 3VXMB 1SMAA 4GKNB 4P2OA 5HHMD 3H3PL 4Z8FL 4RMQA 1EEQA 4C59B 5T3XD 3KLAA 2GUOA 3E1F1 5F8QC 3WUWB 3C6LD 2BSRB 3JZ7A 3RGHA 4F33B 4Z7WB 5AYUL 4TTDC 3U4BH 2EC8A 3UJTL 4YHOH 1S7WA 5I17A 4U6HA 1K9TA 3JBG7 4WW2B 5SV4A 5CILL 4JFHD 4P23B 3O6KL 1A3LH 1TCMA 2IPUK 5DC4B 4FQHB 1U8OA 3G08B 5AG8A 1CD1B 1G1YA 4RFNB 5C09A 2J8UB 4UOJA 3BAEL 4RGNB 3BSZL 1VFUA 1ZLUH 2UWEA 3WNOA 1Z3GL 2WNGA 2F54A 4EUPB 1Q9KA 1I7RB 4DFIA 3GI9L 3U1SH 4JFDA 1OTSD 5CZVH 4JG0L 4KJPD 4FQ2H 1GOHA 1NUDA 4N9GA 4YDVB 3WIHL 4H26B 4KKNA 2BDNH 4DW2H 3GM8A 3CZFB 3IGAA 1Q9OA 4KAQL 5HHOD 2Z35A 4LSSH 5IMOB 4PRPB 1KT2A 4YXKL 3IJHB 3FQTB 1H3WM 2NMSA 2EDFA 5C0BD 1ZLVH 3MLXH 3FHAA 5I75B 3LS5H 3QUZC 5JHDA 1UM5L 3TESA 1BJ8A 5A3IC 1J5OL 5T3ZE 4X99A 5EDXA 5DJDA 5BZWB 4L4VD 4YHKL 1YY8A 4AZ8A 2EXYC 1I9IH 3D2UB 4IRJA 3VWKC 1HHJB 1LO0L 4Z5RA 2AJXL 4HKXA 2WUCH 1P7KA 5DO2C 3PL6C 1OAUL 5BZDA 1FFOA 4HV8B 2HLAB 4HS8H 4M8VA 1IFHH 3QUMA 1G9MH 2XIDA 3LZFH 2DQEL 4P59L 3RP1A 1ORQB 1KACB 5FYJE 4U1GB 4N1HB 4JZJA 3I2CH 2AJ3B 3IS1X 4QTIL 4CN1A 5F8RC 1UWGH 4D0DA 4XXDA 4PLKD 4P57A 3KPSB 4HWBA 4Z0BL 3ALXA 3HRZA 3IXTB 2NCMA 2Z8RA 4N8CL 4M48L 5IW1A 5IW3A 4XMKH 5IWLA 4XRCB 3H9SB 3L3JB 1PYWA 1N6VA 4P9HL 2AEWA 3NFPA 3U0PA 4WTWA 4U0RC 2DRUA 4HF5H 1Y0LB 4JPIB 2D4DA 4Q2ZA 4XCEA 1HXMB 1MNUL 2AXFB 1RU9H 3RKDD 3QIUB 4Y19B 1WC7A 4UTBL 3FOLB 3S88H 1V7ML 4J4PA 1AQDA 5D7JD 1NCUA 3P9MA 3ZE2F 5C0JA 2KL6A 4TSBL 1RIUH 3N1FC 3D9AH 3S3PA 5IM7B 4CMMB 4NZJA 3V0WH 2P5ED 3QFJA 1YECL 4PRID 2FJHB 5EOTB 3MR9B 4Y1AE 2C4FU 4ZDHA 4R97C 3WD5L 4J23A 4PRHE 5HYJA 5JOPD 3HRPA 3VMOA 4JB9L 1TCRB 3O6FC 3WEXB 3CXDL 1DQLH 1G9EA 5TE4L 1DQML 4QT5B 3MODH 3BOVA 4U1JB 4DTGH 4KY1L 1KLGA 4Y5VC 3UDWC 1XH3B 3O2WH 4FQXC 1FORL 5H2BB 1H8NA 1X4XA 3HG1E 3GSNB 3NZHH 5BO1H 2HT3D 3IXAB 3BN9C 1VCAA 1OGTA 3ELAT 5TE7L 4IMKA 1HK6A 1FN4B 3PWLA 4ELMB 3MXWH 2JF1A 3LVEA 4U7SA 3QHFH 1YEGL 3ARFD 5SWZB 5I76A 5EIIA 1N26A 3GFUA 1DBBH 2V9QA 5LCVH 3UTSA 3VCLA 2OJEB 3BGAA 1FL6B 4H1LB 5DDHA 1CZ8H 4MHHI 2G9HA 3KPLB 4GMTH 1N5AA 3SE4C 5HHOB 3V52L 3RNQA 3WFDL 2VLRD 2YSSA 1EGJH 5KBNC 4OLXL 2H3NB 4Z18A 5HGHA 2YKLL 3NPSC 4YPGB 2OTWB 5ICXB 2Y06L 2ORBH 2IH1B 4ZAKA 1U8HB 4M4PA 3DV6A 5E6YA 3RVUD 2JKXA 1AGEA 1R5VA 1WITA 2PO6D 4U3CA 4WENB 3MNVB 3MCLL 5SWSD 4AG4H 5IBTL 4JN1L 4DGYL 3N50A 5J1SC 1UYWL 1IC1A 3S36L 2VQ1A 1IGMH 4BSVB 4MCYA 1VADB 1H3XA 2ADGB 4ZS7H 5IB3B 2J88H 4NO5A 1HXYA 1TQBC 3Q48A 2XZAH 4X4XA 1MFBH 2EYTB 4GRMB 1KJ2A 5FIEA 1LP9F 5ILTL 1A21A 3DLQR 1JMXA 1E4JA 1NEZB 3MUGA 1AFVL 4DKDC 4DN4L 3S4SA 1SJHB 1CR9L 5GGUB 2Q8BL 5B8CC 2HN7A 2NR6C 3CPLB 3QEUB 3V4PL 1ZS8A 5CD5D 2PW2B 4X98A 4F15B 3D25A 3FB7B 1B88A 4OCXH 4Z0XB 1YC7A 5KSVA 3VXUA 4GS7C 1WT5C 5I1LA 3UC0H 1REIA 4P9ML 3IDNB 5D1ZB 4G6AD 5IQ7L 5HDQH 5FGCB 1YMMD 2IWGA 3EGSB 2IBBA 3JV6A 5KANG 3VDAA 1J1PH 1URLA 3VD5A 4X7FC 1IZKA 3U4EA 3TGXA 2GJ6B 1KPVB 3SDCD 3D0VB 5ETUA 3FRPA 2VITB 4X80H 4PJFA 3OKKA 3SDDC 4F7EA 4AEFA 1UADC 4OZIE 3LH2L 3MLVL 2HKFL 1R3JA 1DDHA 4KROB 5C0CA 1FO0H 2NYYD 1BLNA 3U9UA 2IPKB 5ENWB 2QHRH 1I8IB 1E4KC 3WNMA 1DVFC 1T6VN 3CH1A 1V3LA 3HNSH 4OCNC 3SCMD 4ZO8A 3WMSA 1N6QH 2M26A 3KAAA 3GBMH 3TC9A 4AEHH 5E2UH 1R0AL 5DMKA 1MCLA 3E6FB 5I19L 4G9FD 2VC2H 3PWVB 3ZTJG 3QUZA 2C4FT 3D39A 2F5AL 4KKBC 1K85A 4LFHG 3RU8L 2B5IB 5E8DH 4HJGA 1BF2A 1XGYH 4DQOL 2D3VA 1A6TB 1UCBL 3BPCA 1T1ZB 3NFSL 1LO2L 2APBA 5HHME 3REWA 1MCDA 3VWKA 1B0GA 1S5HA 4XC1L 1FGVL 1INDH 4LCIL 3Q3GA 5GRXG 4QYOB 1FNGB 2EEDA 3OHXB 4I48A 1MCIA 4JFFD 5EZLB 3UZEA 4MJIA 1PKQB 2DN7A 1MLCA 4MD0B 1A64A 1RZIA 3QUXC 1JRHL 2ZUQC 2HKHH 3HMXA 5DD6B 3TBYB 2W9EL 3P4MB 4NKIL 4MZ2A 4CUCA 2BJML 1UC6A 3RVTC 4OT1L 3OKMB 1CFBA 3F7RA 1ZLSL 2V5RA 1BZ7A 1YN6A 2RR3A 3ULVF 5KVEH 2IQ9L 4I4WB 4LSRL 1GGYA 4GRWB 5K9JL 3SJVA 2ICCA 1KJMA 3ARYA 6CGTA 2CDGA 5E56A 3NMEA 2F9BT 4YXHH 1A6ZB 5F97E 2XY1A 2D7OA 3L7EB 3W0WD 3BVNA 3Q1SH 1FZOA 1FCCA 2OP4L 5SWSB 5GS1C 2V2XB 3T77B 5JXAL 3IFLL 5KJRH 1WCBA 1G9NC 2VL5A 3J8F7 5EUKA 4DGVL 4POZC 1FQ9C 1PLGH 2F58L 3F5WB 2DL9A 3EYOB 3MLPA 3BE1H 2F74B 3VGAB 2FZ3B 3IDIB 2A0LD 2D9CA 3MRIA 1WGOA 2X4NA 5EN2B 5FHBL 4OLYH 5C0BE 1MHEB 4FQPA 4GSDL 2M1KA 3T0EC 4JR9H 1J0HA 4MSWA 3O6FA 1CTNA 5IB1A 1ZT4B 1T5WB 3VFVB 4CN6A 1BBDH 4Y5XA 4JRXD 3CFCH 4PJHB 4ERSH 5CUSH 1JHKL 3UDWA 5TGBA 4FQXA 3ZDYF 5JIIA 3G5XA 2J8HA 3HZMB 3DHMA 1NMCC 3O3BB 1BEYH 5LBSL 1A2YA 1D5BA 4X4YB 3RNKB 35C8L 1UVQB 2HFGH 4ZUSA 1UCTA 3EDEA 3GIVB 2HLFD 4OAWA 3QUKB 4I13B 4MDJA 5D71H 3VD4A 5SV3A 2OR9H 2NY6D 4UU9A 2Q86A 5DRWA 4E41A 3O3DB 1ZVSB 2VAAB 4RNRA 3SCMB 4N8VB 3ZYZA 2BVOB 1L7TH 2C3WA 4HHAA 4NUGL 1XGUA 2PYEB 4UIKH 3KVQA 5FO9A 1H3UA 3DURA 1MHHA 2P45B 2VLKB 1CQYA 5FUCE 5DHVH 1LEKB 2JIXB 1VEMA 3MACH 3PE9A 5IW6A 5BJTA 1YDPA 5E0QA 5GJSL 3CMOL 1ULVA 1CG9A 2EDJA 2J5LC 1Z9MA 2FX8H 3NCFB 5EC1A 4HXAL 5BS0A 3EHBD 2O61A 1LD9B 2Y7QA 3O3EB 4PJAB 4L8CB 3P0YL 4MLIA 1CE1L 3V4UH 4Z78A 4DVBA 5DYOB 1PW3A 4JQIL 1AGCA 2P5EE 4PRIE 1TMCB 2BCKA 1I1AC 1TVHA 2H8PA 1P2CA 3I6LD 1RZJC 4LK4A 2WZPD 4JFED 1Q0YL 5C0ND 5JOPE 4OKVA 3GSRB 5IB5A 2VUOA 2V2TA 4LBEB 4YWGH 4ZSOE 2I60L 4HULB 5CWSB 1KCVL 4OCSH 2HT4D 5I18L 4EDXA 1FSKB 5F9JA 5B8CA 1ODAA 2XOTA 4YDKL 1KIQA 1WSST 1DSFL 3ZTNH 3JTSA 1WFNA 1WWWX 1AD0B 2FATH 3QDGA 3NN8B 3NAAL 3KJ6L 2HTKD 3VFUB 5I73C 4MDIA 3LKQA 4PJ8B 4GG6A 3R8QA 1WT5A 2VH5L 4RMWA 1A6UH 3MRDB 1E6JL 4JANB 2IH3A 1Z6JT 3SKJH 3QULA 4XMLH 1RHFA 3LN4A 5FGRA 1JTPA 3WFEL 2NPLX 5DSCA 4NBYB 1W0WB 2P1YA 3QHZH 3EJZC 4HUVA 2MPAL 4RA0C 3PGCB 2LE9A 4MMXC 4PRAB 5I1IL 5I8OL 4K3HA 3ZHLA 3OWEA 4ZNEE 1IAKA 4S10A 3SDDA 3QH3A 4XPFH 3FO1A 5TDPA 2VLRE 4U0QB 5CZXC 3H3PH 3WJLC 4MS8D 1LQSR 3FFDA 1NFKA 4LLVA 5HYEA 3RFZC 3HNVL 5IJVB 3OKLB 2VWEE 1PBYA 1MIEL 5HY9A 5CCKL 5I1HH 1N2RB 3QI9D 1E4KA 1HQRA 1DVFA 4LVHB 5DGQA 3TJHD 4RQQA 1WAAA 1OAYH 2BC4B 3CDGB 3O2DH 4D9LL 4P2QA 2RCSH 4D9RD 1QSFA 4OZ4A 1A9EB 5ITFB 1FZKB 3K8KA 3BT2L 2NY0B 1BOGA 5CILH 5J7CC 1U95B 3IU3A 1P6AB 1LGVA 4IOIB 3QUYD 1JJUA 1U3HC 1S7XB 5LKNA 2DF3A 3LKNA 4FQ1L 2ENYA 1U2CA 2BNQD 1P4LA 1Z3GH 2B39A 3ZMRA 2ADIB 4ZQKB 3QPXL 3L3OA 4KKAC 4JG0H 3QUXA 3MLRL 3MRPA 4P3DB 3QWRA 3LHPL 5C07D 4U1SA 3QDHA 3GSXB 4GAYA 3P9LB 4KK5D 4PTTA 4HCRH 4E9LA 1YJDC 1N0LA 4O51A 3TH4T 4F3FB 3UBXB 4QNPE 5IVXB 1HILA 2YRPA 3MLYL 2VR9A 1MI5B 4LLWB 2PETA 4EXKA 1YMME 1TETL 2YS4A 4UBDD 1UM5H 1K8DB 3BXNA 4K7FB 3IFOB 4LLUB 3D85A 1ETZB 3KXFD 3C8HA 3N1GC 1D9KD 4BKLA 4CU6A 4N0FB 3VWJC 5D1QD 4YHKH 5GS1A 5J9PA 1FG2A 4GW5B 1RUKL 1QNZL 1LO0H 2AJXH 2A2QT 4ALAH 2R1WA 4GG6F 5DMGC 1D5MB 1MSPA 2X4UB 4C56B 1L9MA 3LAFA 3BP4A 1OAUH 4LSUL 1Q9WA 1A14L 2IBZY 4H0IA 4EDWL 2X4SB 3RWJB 3MNZA 4XVJH 3O9WB 5JLZA 3RHWK 4G9FE 5DD3L 4OF8A 4XAWL 2J8UF 2DQHL 1NC4A 2CUIA 3BGMA 1RUAL 4EN3B 1EHNA 2NXYC 1AE6L 1CDCA 1U8PA 3MX0A 3VXSA 5I2IB 2V5SA 3WFHB 2DMKA 4Z0BH 4RSVA 3CU1A 3B9KC 3BYTA 3Q6FA 1WAAF 3C5ZB 4JFFE 2QKIB 2BVPB 3JV5A 4P9HH 5IVZA 4FA8A 1J05A 3LN9A 4HIEA 4UIMA 5K9QG 2VABA 5E2WH 3CD4A 1UKQA 4EJ1C 4ONFH 4P2RB 3FQNB 3L95B 3X11A 3QAZC 3WN5B 5D6CA 3MLZL 3QT2A 2X41A 4BZYA 2R0KL 4PJGA 4NQDA 1KG0B 2AXHA 2RIKA 2CRYA 3ILPA 3RDTC 5B4MC 5INCA 1T03L 1B4JH 4YR6B 4F57L 1TVBA 5CIPB 1FPTL 1YECH 2GW5A 2H2PD 2OYPA 3WD5H 1A4KB 4U1NA 5CP7A 4MX7A 2NY4C 4HBCL 4IRSC 3W0WE 3CXDH 3ARBB 1XF4B 2V5TA 1NBQA 4XNMA 1NGQL 5EUOE 4MAYA 4NM8L 4M1GL 6FABL 3DXAD 4FQJL 2F53A 4M7KL 2HJFA 2OTWA 4N8PA 1MVFA 1PKOA 1ZHKB 4U1KA 1FORH 3W9DB 1OARL 4DVRL 4UI2A 1A02N 4TUJA 3EIFA 3I02A 4P46D 4JFPA 5MI0B 5EBWB 1UH2A 3GSOA 4GG8A 3LD8B 3C2AL 3D6GA 1GOFA 4X5XA 5TPWH 2F8XC 3PABB 4LNVA 3BWUC 4XCYA 2ZKHL 3OQ3B 3S35X 2BXYA 3BWAB 4GBXC 1IM9A 1T2QH 3DUHA 4PJXA 1C5BL 3R1GH 3DGGB 1HZHH 5JNYA 1JTOA 1NMAL 4XP1L 1CFSB 4NCC2 4BQ9A 3TBSB 1NBVL 3MA7B 1F4YH 1RV6X 4JRXE 4HWUA 1OGAB 3V52H 2O5ZL 4KKLD 2V17L 1NFIB 2ILLA 3TCXA 5FA4A 5A16B 1M05B 2J6EH 4OLXH 3F7VA 2YWYA 4OCYL 4YJZL 3AY4A 4HWZB 2B2XL 3LKRA 4QRPD 2VOTA 5D9SB 1MUJB 5DWUL 5TFSL 4WTZA 5E8OA 2Y06H 1DUYB 3WKNA 2HTLD 5E6IB 3RWCA 4R3SA 4N0RA 2IANA 5E4EC 3ES6A 4Y4KB 2XZQL 1DQDL 5D1QB 3AAZA 3BQUC 4MD5A 1CFNB 2AK4D 2CJUL 2DL2A 3DVFA 4JZNA 3MCLH 4NQVB 4U6VH 4N5EC 3RWDA 3V8OA 1YEHL 3X14A 3TO4B 2GAZA 2I24N 2BSTB 1KXQE 4WFED 3QA3B 4M4RA 5BRZA 4G6ML 5IEHA 5F7LB 4L3EA 1X5LA 2VXTH 3ARZA 1UZ8B 4PB9L 1UXWB 4NQCD 3WJLA 4U6YB 3WO4C 5E99L 3T0WA 1JF1B 3QO0A 1AFVH 3FQXB 4DN4H 1LILA 5ESVB 3S36X 1XIWB 3MJ9H 1W8NA 4HG4K 1KUMA 3D3VB 2Q8BH 5DD5L 5KAQG 4PJGF 1MCOH 2YUWA 3RTQB 4K7PL 2Z31D 3LB6C 1QFWL 5CGMA 3STBA 3QYCA 4UV7H 2D7NA 3U7WL 3B9EA 1QQDA 2VMFA 1QLRB 4JM2D 3QXUA 2FJFB 1WBYB 2ADJB 3QEQA 4LPUA 4Y4FC 1EH9A 3KLDA 1T89C 3WJJA 3TO2A 2IALB 1G7JB 5J12B 4LCYA 4NZTL 1SJVA 1U3HA 2OX5A 4JFEE 43C9A 3T0AA 5CP3H 4S1QL 5EO9B 5J11C 2A6JB 2I9LB 4IDJH 5LAXA 1YC8A 2A6IA 2DI7A 3LIZH 3CFDB 1CDBA 5B21A 3QDJD 1Y6KR 5FKAB 4S2SB 2ICWB 3MLVH 2HKFH 5KS9B 3EYFB 3MCKA 4Q9BA 3M1BA 1RMFL 5FYKU 1YEKL 4WRLA 5DJCB 2HA1A 1EZVX 3LEYL 1CFQA 4PJXF 3AVEA 2E6JA 1IILE 2MNUA 3O6MH 2R39A 3CIQA 4JY6B 4QTHB 5JOFA 4LL9A 4ZUTB 1M4KA 1MOEA 3RU8H 2HAZA 2NY5C 3AC0A 4X6DA 3FT3B 4I18A 1UCBH 4FFYH 3C08L 4WI2A 3VXQB 5C2UB 1LO2H 4QXGL 4XC1H 1AXTL 1FGVH 2A6DB 5DJYA 4LCIH 3ARDC 2HVKB 4M7LT 5DI8B 2HFEB 2K3TA 3NGBB 2BNRD 2A9MH 3V7AE 1F4HA 5FDWA 1JRHH 4NRXA 4D9RE 4GXVL 3PP4L 4KI1A 4K71B 1EO8L 4ZOEA 2ICES 1ZLSH 1WQVT 1ZA3A 5IMMB 5LQBL 2AJVL 1WF5A 4G9DB 2G2RB 4WEUD 4Z7OE 1HOCB 2FIKA 4APQD 4M8QA 5K9JH 3O41A 5L6YL 4E42A 2FECI 5KSAD 4V2BA 4XB8A 3FFCB 5MEQA 4C83A 2BNQE 4PJDB 1OVZA 1I1YB 2QQQA 4LRIC 2R2EA 2AK4B 5DJ8A 3EO1B 4NQEA 3EO9L 3VFMB 3IFLH 3VW3L 4PJIE 5GSVB 1S7QA 2JJSA 2BHYA 1XEDA 5C07E 4ODUA 3VFPB 4DGVH 1JGVL 5IB2A 5IQ9B 1M7IB 1KFAH 2F58H 2V6HA 1CDHA 1XR8B 1ZV5A 1YEIL 5I0DA 4JDTL 3RDTA 2FJGA 2IPUG 4OD3H 2HVJB 4F2MA 1N64L 3QCVH 3KNBB 1A7RL 3HE7C 1JWSB 3WS6C 5GSRA 3V6FA 5I71B 1NANH 4HQQL 4XVUC 1TENA 3QNXB 3KXFE 4S11A 1G6RH 5JDSA 2W91A 5MENB 1BQLH 1R6VA 4WJ5B 3RI5F 5JW4Q 4IRSA 1TDQA 4WGWB 2HH0L 3OV6A 2VE6A 5DHVB 5ITBL 3O2VL 3HB3D 5DLML 4OI8A 1OW0C 4WO4C 4JLRA 4NDMB 1KCRL 4RAVA 1JHKH 1L7IL 3C6SB 1FVCB 1GVIA 5LBSH 1DQJB 1E27B 1ACYH 4GRWF 1FDLL 1CFTA 3OAZH 5MERB 3BEWA 2MWCA 4GBXA 3P4NB 2BP3A 4XP5H 1S78D 2FR4A 5DJ2B 1XF5B 4HAGA 4NJAH 4YHMH 1X9QA 2YK1L 4Y8DC 1G7HB 1VFAB 2X4TB 5F7DB 2FHBA 3P4OA 2NY7H 5IEKB 4OLWH 1WBZA 2YOCA 2OQJA 2X2YA 1N59B 5C0EB 1L9NA 4UNUA 3TVMC 1VPOL 1MCWW 1A7NL 2AK1L 1KN4H 3X3GL 4FZEL 4U3HA 2D9QB 3KWWA 3O45B 4U1LA 4CVZB 3UTQA 5D93C 1HEZA 4RAUA 4L8BA 4LGSB 3BQUA 3UPCA 3V6ZB 4HXAH 5C0AB 4MNHB 5BMFH 4JO1L 3VJ6B 1S7VB 1CE1H 1FZMA 1DN0B 1R3LB 3HS0A 4FNLL 4GW4A 4JQIH 8FABA 1T3FA 5D72H 1AI1H 3U48A 1JZ2A 2CKBA 3NIDE 4PJHF 5CHNB 3PGCA 5GJTL 2O93L 4H1LG 4M6ML 4Z7NF 3FCTA 1U93A 3LQZB 3PP3H 2I60H 2IQAB 3ZT7A 1XGRB 3GMQB 5DRNA 1KCVH 1OAQH 4BH8B 5I18H 1I8MB 2NY2D 3DXAE 4UT6L 5BW7C 5DZLA 3DVNB 4MNQD 4X8JB 3QXWA 4XB7A 4Y2DB 1YN7A 4G42A 3QBTB 4OFDA 5T1MB 4YDKH 3EZ8A 4ZMAT 5L88L 4NZUL 5D2LA 3T2NH 3VI3F 1TXKA 4TTGA 3KJ6H 2H26B 1LWRA 4JM4L 4Y4FA 1A9EA 2BOCA 2LAGB 1NSNH 1T89A 1E6JH 3BDYL 3BP6B 3OR6B 1CDYA 4NO0A 4X9FA 1WBXA 4MA7L 5I1EH 3DX9A 1RK1A 4M7LH 5CKAA 3ZDXE 2MPAH 1ZKAA 5IBUB 3M17B 2KZ1B 4F80A 4KQ4L 1AIFB 4KH2A 4OZFB 5CSZB 3CFJA 4J3OC 4KV5F 1U8QB 5DRZB 3HNVH 1MIEH 1NEZG 4QRPE 1MWAH 3AREC 4NN7C 3PJSB 3VFRA 3CFIC 3DX8A 2CXGA 4ZFOL 4QCIB 4GRLD 4A2MA 4AT6B 4D9LH 4QHLB 5HYQA 1D5IL 1ZTXH 2OR8A 5EC2A 5ERWB 5HGDB 3FRUA 1DE4B 4WHCA 4CBPA 3I75A 1EO5A 3TCLA 2UZXB 4N1EA 5I8KL 1DBJH 1C12A 1S9KC 1OCWL 4CVXB 4WFEE 1NAML 3OJDB 3ROOB 5A2FA 3SKUD 5F1IB 1ETZA 2N1KA 2AEPL 3F65A 4NQCE 4A6YH 4MA1B 3OXRB 4FXKA 3ARDA 1MCSA 3C9NA 4ODBD 1CS6A 2VDKL 2JTDA 3OPZL 3PXJA 3B2VH 4J3SA 1WEJL 1HHIB 4FFVD 1OP5H 4S1RL 4LSQH 4N0UB 3D18B 2EIDA 4HKBB 3HAEB 4ZXBC 3DSNA 2LFGA 5C0GB 3LHPH 3MRKB 4NC1C 2UYLB 1NLDH 2NY5L 3VD3A 4PS4H 5J8OA 1II4E 2AW2A 4HIJB 5DGRA 4G8GD 2C4XA 5HYSG 3U4AA 1E4XH 4BZ1L 1TETH 4UMGA 2J7LA 5D1XD 3CNKA 3FO0H 5F9WC 2DIJA 1AC6A 4LRIA 5HGAB 3SDYL 2VDOL 1MJJA 5D2LF 3QDJE 3G04A 3EOAB 3KYMA 5C1MB 1OAKL 3GJEB 2GK0A 5L2KA 2WINB 3B2UC 3MRNA 2DLGA 4PJ9C 4KI5D 2VZUA 4DZBA 4LU5L 3FT4A 2ZSVA 2FGWH 1DTUA 5INDB 4HJ0D 2R8SH 4QRSA 4S1DD 1A9BB 2ZUVA 1S8DA 3HE7A 4XAWH 5F1NB 3WS6A 1FCGA 3E6HB 3L5WA 3CVHA 4YE4H 1RUAH 2NY3C 4DCQA 1AE6H 2ICEB 4G5ZL 2GCYB 1PVHA 4ZFZB 3TZVB 2EDRA 2DMBA 1S7RA 2CO7B 2YC1A 1OW0A 4WO4A 4O5LH 4MWFB 4F7TB 1R3KA 5B39B 1RI8A 1EIBA 2GY7B 3D0LA 2V2WA 3X13B 3PGDA 2BNRE 2YUZA 3GSWB 4MXQC 2DD8L 3V4VL 3QIBA 4AMKH 4OQTL 1S7UA 3MOAH 2XWBA 5DTFA 4N1CA 5FOBB 2C7UB 1PGRB 1ZEAL 2P8PA 2GITB 4LNRB 3OG4B 3MLZH 1EMTL 2BY1A 2H32H 2FEDC 4X6CE 5F96L 4K3EL 4X7TA 4ELKB 3QP3A 5EU7E 1UWXH 2Y23A 5E1AA 5JW5A 4GQ9H 3O4LA 3NCMA 4KRPC 3LPWA 2VSDA 3MV7A 4Q9RL 3MGTA 4HH9A 2G60L 4HBCH 1PSKL 3BKJL 5GISH 4GKSB 4JVPA 3U0TA 1NGQH 4KK8D 5AD0B 4X7SH 4M1GH 6FABH 4B0MM 3PL6D 4I0PD 4M7KH 1ND0B 3BDXA 5EBLB 5IMKB 3O6LL 5JR1H 1MFDH 2GTWB 3MRRB 4DVRH 1JK8B 4HMDA 5E6IA 3EYSL 3J7HA 4RMSA 4ZG1A 1KB5L 4PB0L 2GFBA 4Y4KA 3QRGL 3C2AH 4OLVL 4MAUL 3RPIA 4YBLB 2LQRA 2X1WL 5L7XL 1L0XA 3FT2A 5C6PB 4AQ1B 1F2QA 4H8WL 5GIRA 2FB4H 2ZNWA 1C16B 3WUZA 4XP1H 3JWDC 3H0TA 3ROLB 1NBVH 2GSIB 2W65B 1S9XA 4CNIB 3QJFA 1EERB 4WW2C 2NLJA 4OJFH 2AKRA 2O5ZH 4G8GB 4P23C 4M00A 4N8VG 5DK0B 1B90A 4P5MB 5DVKA 3D3VA 3HE6B 1MELA 2B2XH 4HUXA 4RFNC 3RA7L 2EZ0C 1XR9A 1SEBB 2DYPD 5J6HB 4OBSA 1AGFB 1KJVA 5DC9B 5A2IH 1DQDH 4NHCL 3H9YA 4V1DA 1Y6MR 5E9DB 2APFA 5DURB 1F6AA 4F8TA 3KJ4B 1U58A 1YEHH 4I3RL 2EKJA 5ICYB 3VFTA 5IHUL 3ZE0F 3QPQC 1JGDA 1CF8L 3U36B 2JJWA 4RWYL 2GY5A 1BIIB 3HC4H 1I7TA 4PB9H 1XMWA 5E99H 1FH5H 5CEXB 2HG5A 2GHWB 5IIEA 2ZOLB 5ESQB 5JW3L 5HD8C 3NA4A 1RJZA 4K7PH 4BH7A 3BJLA 3BN9D 1KXVC 1DBKL 5D70L 1B3JA 3U7WH 1H5BC 1A6AA 1KN2L 3SKMB 1OWRM 4QOKD 3BPLB 2I9TA 3KPNA 4LLMA 1D5ZB 4LRNH 4ODXB 4XNQA 4PGCA 3TA3D 4TPRH 4QXTA 3BP5A 4NZTH 5AYQA 5BV7L 1IM3A 4W4NA 2FRGP 4YHYB 3MBEC 1KJ3L 5IESL 1CGYA 4LSVL 4KMTL 5M95B 1L0QA 5C0RL 4ZOCA 2XPGA 1RY7B 3FZUD 2YPLB 4MMZC 3SO5A 2MSPA 1T0NA 4ZXBA 4FABL 3FB6B 4PGEB 2ZG2A 1RMFH 1SYSB 4MNGB 1YEKH 2ZUXA 3FAWA 4WHDA 5D5MB 1QA9A 1ADQA 4M5YL 3LEYH 3GI8H 4JY4B 4OV5A 1CICC 2EKSB 3MYZA 3DO3A 1HOCA 5GRUH 1G7QB 2QADC 3MV9B 5T1KB 3K8MA 4Y16D 3T0XA 3WO3B 1J7VR 1KEGL 3DUSA 4I0PB 1A4JA 3L3HA 3U46B 3B9VA 2A74B 2J1KA 4JFYA 3HLAA 2AV1A 5FECB 3C08H 3OKDA 4IOSD 1BGXH 4QXGH 1GGUA 3BKCL 3OX8B 1AXTH 1UB6A 3FN9A 4IJ3C 4H0GA 4RWHA 5A43C 3EOTL 2QSTA 2C1OB 4K94C 1JPFA 3QFDA 2D03L 4PJ9A 3LPGA 1SBSH 3C6LC 5KSBB 1FNSL 2QSQA 1FLTX 3MXVL 1QPXA 3GMLA 4F9LC 4GXVH 3T4AB 1CD9B 1C7TA 3GRWL 3PP4H 3TV3H 3BHBA 1Q9LB 2OXHA 3PWPD 4MJ5B 4W4OC 3QEGH 5LQBH 4B50A 3GMNB 2AJVH 1T1XB 1R5WB 4R4BA 3LKSB 5D8JL 2ZCLL 1G6RB 4HC1L 4PRBA 4WUUD 1ZA6B 4DKFH 3UBXG 5KN5A 4NC2B 1GOGA 3RIFF 4NZDA 5L6YH 2PTTA 1IGTB 2QSCH 1U8IA 2QR0B 4HUKB 2J4WL 3VG0L 1TNMA 4X6BB 4A2LA 2Z8SA 5I9QB 2VUYA 3PP3K 1OTSC 2Q8AL 1KBGL 4KJPC 1LDSA 2M2DA 4FMKA 3T1FA 1F8TL 3VW3H 4AEEA 3V2AR 2GSGB 4NOBA 3MV8D 4YGVB 4NPYB 3GJFA 5B38B 3A67L 1S9YB 2XV6B 2PXYD 4PJ7E 2GQHA 1NCWL 4UT7L 1FC2D 2W0KA 4OZHB 4U1IB 4JDTH 4P0DA 1N64H 4M43H 4EQ2A 2L7JA 1XT5A 4Y1AA 2DWEB 4HGKC 4PRHA 5C7XL 2O5YL 4ETQA 1DLFL 2XI9A 1QFPA 2VN4A 5HDLA 1HI6B 3AM8C 4X8XA 2HH0H 2XACC 5ITBH 5GGTA 1I3RB 2CPCA 2R2CA 1VACA 3ESVF 3T0DA 1KCRH 5EH1A 4H25B 1P9MA 3WS3A 5C0EA 2C1PB 4R96A 4KI5E 2OLDA 1LK3L 2N56A 2WBKA 3HG1A 2VQUA 1JZ8A 2NX5D 2YPKA 2IG2L 3H9HB 2PTVA 5ANMB 4YDJA 1MCKA 2CMRH 2IF7A 5DQ9B 5D7LD 1S7VA 1AKJB 3MRBA 4PJDF 2LU4A 3QG6A 5MEPA 5J56B 4L4TB 4PLKC 2CDFA 4K55A 2EDTA 3KS0J 4G8IA 5KZCB 4OCWH 4U6XA 3WSQH 2YK1H 3F7QA 3TBVA 4PJ5D 1TQCB 1WZMA 3C60B 4PYGA 4YHNA 5IG7B 1M7DA 1FBIL 3V7AG 1VFBA 3VI4E 3H42L 3EFFB 4PIRF 1FHGA 1YEFH 3HN3A 4PJEE 3RVXD 4HDIA 5F3HB 1JNJA 4LKXA 2Z91A 5FUCC 3KPMB 3SBWC 1S9WA 4LSDA 1VPOH 5ADPL 4YK4B 4Z7VE 4OFIA 3VU2A 3KPPB 3QDMB 4OIIL 1OSZA 4PD4J 1BECA 4DOHE 5D7JC 2I07A 3PHQB 4NKDB 3JWDL 2XQYK 1MJUH 1P4BL 2BSSA 2Y5TB 2X4OA 4NZRL 3ECBA 1AO7B 3QIWA 4JVUA 3OR6A 1KTRL 4FNLH 1MLBB 1QR4A 4QHUA 2AQ1A 5LWYH 2Y72A 5EU3A 5FHAL 3KPOA 1UT9A 2DQIL 3L3DB 4MQ7B 1A1MA 4UTAH 5C08D 2WLZA 3Q5OA 1MWAB 1Z0NA 3ZKXB 5AUMA 3DV4A 4XGZA 1NC2A 1JPTH 4YUEH 1TJIH 4G6KL 2EC9T 5DEGB 2Q6WB 4NFDA 1FVDA 3BH8A 5L0QB 4X4ZA 1FJ1B 5L88H 4NZUH 3RBSA 2P42B 5DD1H 1J86A 5IB4B 1H5BA 4ZO7A 2HT3C 2V7HB 2EDKA 3EO0B 5ADOL 1Z5LB 2DQDL 1EEYA 4JCLA 1EXUB 1MREH 3SDXB 5E8NA 1FL3B 4J3WA 2A1WL 3ARFC 3MJ8A 3HZKB 3NH7L 4A6YB 5I1GL 2CLZB 5MP6L 3CLFL 3MBEA 4MA7H 2JELL 4HKJA 4YHIB 4HD9A 2PXYB 2DKMA 1KPUA 1JN6A 1MPAL 3KYOA 5JPNB 3BGFB 3VGBA 4HGWA 4OZIA 4XNUL 5F7UA 3DMMD 5I8EA 2VWEC 1FVEA 3O8XB 2B0SH 3VXNB 4F7MB 1YMHB 3R06B 1T5XA 1OQOA 2LVEA 43CAA 1RZ8B 2C9AA 4KDWA 2FIRT 2XN9D 4RGMB 3TNMB 3PNWA 5I1AB 1CICA 3O3AA 3RVUC 1H0DB 2ZP0T 4GUPA 2PO6C 2XFXA 1R24A 3TBTB 4Y5YA 3RL1B 2QQNH 5HPMA 3CH8A 1I1AD 5I8KH 5E5MA 1P5UA 3REVA 1UWXK 2WBJD 4YLQT 3PWJA 3UTZB 4AM0B 4OGYL 3GO1H 4KDVA 3MRLB 3QJHB 3MNWB 4JDZA 5BVJB 1T04A 3CVIH 4XT1C 3PDOB 3OPZH 1A1OB 4NWUL 3C6LA 2W92A 4L8DB 1AH1A 2MQ0A 1BD2E 4QRRD 2FEEI 3IYLW 5CD5C 4KXZI 4KHTL 4EI5D 5HVGB 3RL2B 4W4OA 1IAIH 1VEOA 2XZZA 3QUMH 4JHWH 4QOKE 3SDAD 5JXEC 2H9GA 4Y4HB 4UQ2A 4JKPL 4JKWA 4G6AC 3RWEB 4OSUL 3MMEB 5T3XL 1NH6A 3ZT6A 4X4ME 4K94L 4LCUA 2VIRA 4ZOBA 5AWNH 2DAVA 1TPXC 4FTVD 1P53A 4HWBH 3SDCC 2VDOH 5TF0A 4O2CA 3WE6A 4LAQH 3BPOC 3QISA 1B2WL 1E28A 5KOVC 2EO1A 2EDEA 5KTEH 1ZHNA 2ADFL 1OAKH 5DJZB 5C9JB 3QXDA 2NYYC 4O58L 2ED9A 4XWOD 1Q0XH 1IQWL 1J0JA 1CXKA 2VXVL 3SCMC 3GSNL 1T20A 1HHHB 2VYRE 3CAFA 3G6DH 5C0BA 2CIIB 5DFWH 1AGDA 3G6AA 4Q6IB 5L9DL 1QKZH 1QHPA 3PHOB 4XPAL 1NQBA 4ODVL 1NGXA 1DR9A 4NQSA 4XP9L 4YHZL 5D2NB 3AM8A 2OL3A 4Z7UE 2CKNA 1RFDH 1ZGLP 5E1HB 1G7LB 1E4WL 3QEHB 4KHXH 4J3TA 3S5LG 4B41A 4ETYA 3W9EA 2OI9B 4KKCD 1VA9A 4NBZB 3S37H 4ZYKB 1QLFA 1XGQA 1RHHA 2DD8H 5F7NC 2DJ4A 1BFOB 4R90L 4LEXH 3FHQA 5IMKA 4UDUB 3SY0B 5HYIA 4P5TB 3FQUA 2CUHA 3PWPE 3IDXH 1CE6A 1EMTH 4PGBB 3N1PC 2BOBA 3KR3L 3IDYB 5ACLA 4WUUE 3QWOB 5C2BL 1CIUA 5ID1B 4KJYA 1J1OH 5T33L 1TJHL 2XZCL 5I6XC 4NWTH 2EE6A 4R4FH 1KNOA 5TQ0L 2XNAB 4ZUWA 4PJ8C 5FKPB 2QJDA 1ZT1B 1R3HB 2GSIA 1RUPH 3QR2A 2ESVD 3N1MC 3VMNA 1IC7L 3MA9L 4LCCB 4ODSL 1YNLL 4RFOL 2EDQA 5EG6C 4I0CC 4KTEH 2ATPB 4HUWB 4NNXB 3SKNB 5EZJA 4O2EA 3WDIA 3MV8E 4IOFD 1OM3H 5CJBA 1OTTD 5GRZA 5HTSA 3TN0D 4WWKD 4IHOA 3CFBB 2P24B 1SJEA 5D7JA 2JB5L 1NFDB 5EO0B 3ABZA 2NW2B 1KB5H 5C86A 3UJJL 4NN5C 4FOMA 2A0LC 2VO5A 3QRGH 3VFSB 1U8MA 4HWEH 3T8XA 1IC5L 4RIRA 3FONB 2P5EA 4MAUH 2NY1B 4PRIA 4YBQD 3INUL 3O3UN 4H8WH 2Q7YB 3WFBL 3ULVH 5HYSA 2QBWA 1EFXD 4EI5B 4ZSOA 3U36A 3B9KD 1A5FH 3MRCA 4UQ3A 2BERA 3RVWD 1BJMA 4LHUD 4OD2A 1YPZB 1J0ZA 5ISZD 2DJSA 1W8OA 5HGGS 3QZWG 2NX5E 3IKCA 1MAMH 2BHZA 3KPRB 4LKCB 2G5BA 4UV4L 3V5KB 1MQ8A 3PV6A 3OKEB 4P4KB 1EDQA 4QRQA 1SY6A 5D7LE 3ARFA 5CZKA 3LS4L 2P5WB 2VLJD 4PG9A 1CK0L 1FLRL 1MRDH 2XTJB 3BH9A 1G9MC 3JV4B 3RWGB 2NY6C 3IDMB 4I3RH 2J8OA 5SX4H 2E5EA 4J3UA 3GHBL 4M7ZC 2R29L 3VH8B 4PJ5E 4KTYA 1T80A 4J1UA 3FB8A 3M8OH 4ZNEA 4RWYH 4PREB 1C5CL 1U8KA 2VLRA 4LMQE 2VKWA 3LKPA 3H7LA 3DYMA 5KVGL 1VKXB 2VZSA 1P4IL 1DZBA 5FAAA 1KIRB 2XA8H 5TQ2L 1F2XK 1Z9LA 3VRIA 4LCWB 1BFVH 1M71B 4JEGB 3EFDL 1CGWA 4PJCE 3HUJB 2HJKA 2PO6A 1DBKH 2EYSA 5LG1A 4RGOL 3ZKQD 1N8ZB 4KRMB 3PQYD 1NGYA 1MQKL 3T0EE 1YUHA 4L9LB 3RKPA 3PUCA 2DMCA 1KPRB 4U1HA 1GGBH 5C0NC 1X6NA 5CSBA 1CL7H 1XGTB 3NCYP 5C08E 4EVNA 4KMTH 5ALCL 4LFHD 3R0MA 1CU4H 2HT4C 1CTOA 2E8YA 4RFEA 5IBUG 1PD6A 1GIGL 1ITBB 2ITCA 1UEMA 1EAPB 2VRAA 4ZUUA 4TRPL 3A6BL 4OF6A 3EYVA 3D69B 4Z77B 3MREA 2HTKC 4RMVA 1AJ7L 1CBVL 2L0DA 4TNWF 4I2XB 1I8KA 1KXTB 4PY8I 5T1DL 2IAMD 3VXPA 4J3XA 3WHE1 4K2UL 3L6FA 1A6VL 1YMMA 4LDOB 2VKXA 3VE0B 3HR6A 4JAMA 2UVEA 2YA1A 4D3CL 2W0FB 2ICWJ 4LSTL 4YFLI 4WWKB 4S1SL 3SDCA 4FZ8H 1NGWB 4XP6L 1ZGLM 4OZGE 1WFUA 3EAKA 2YMXL 2EIZB 5I1CL 1I9RL 4MS8C 3HA0A 4GXUN 3NCBB 3V7MA 4OLZL 2JCCE 3RWHA 3I6GA 4QGTA 3QI9C 1MIML 5ALBL 2WUBL 3TJHC 1FNSH 2ARWA 1W72B 2XN9E 1G7IB 2WANA 4OLUL 2IMNA 1JMZA 2FL5B 5B38A 3NA9H 1P7QB 4H20H 2X1OA 4G9FA 2PW1B 4CMHB 4QY8B 3K1DA 1AP2A 2VDMH 1TZHB 3NFNA 4JKKA 2XKNA 4KJQD 4MVBC 3HPLA 3H3KA 4K3DH 1RZFL 5T1LD 2FO4B 4PJBE 1ZOXA 2A38A 4DAGL 4XC3L 4LDEB 5EO1A 5JHDD 4JFFA 1BMGA 1I3RA 1KBGH 2VLJB 2D0FA 1T1YB 5D5MF 5GZOD 3WFCL 4QRRE 2I26N 4TSCL 3RWIA 1RUQL 2A83B 1HH9A 3JWOH 2VJXA 3TYFA 4ZFGH 1NCAL 2SEBA 4E5XB 1NCWH 1RZKC 4UT7H 4YAQA 4DN3L 4JRYB 1HSAB 3TBWA 3IU4L 2LV4A 3W39B 4UBDC 1QFWM 5DQDL 3ZHKA 1TLKA 3BKML 3Q6GL 5F6HI 4FTVE 4DUXA 1D9KC 1DLFH 4PGZA 3HPJA 4YBHA 5D1QC 3W0WA 3KDMA 2DWDB 3CFKA 4KQ3L 4BFBD 4LLDB 5I1DA 5EUOA 2Y36H 3TO4C 5IR1A 4GLRH 1RQ5A 3B3IB 4JE4B 1F97A 4K8RL 1P69B 4MCZB 4YHOL 1LK3H 4G43A 4XZUA 1AGBA 2IG2H 1OB1A 5JW4R 2NTFB 1RK0A 3HZVB 1A3LL 5K9OB 2YD5A 4LPYA 2W60B 4K3JL 3ZYIA 1K6QH 4N9OB 3QSKB 2Q87A 2JJTC 5KVDL 5F6IB 2AEQH 3WHE0 3I6KB 1EEZB 1HHGA 5BQ7A 4XH2A 4CW1B 1UXSB 3TPUB 1UB5B 5FO7B 1ONQB 4P2OB 3GMRA 4JRXA 1A6WH 1BQHA 3FMGH 5C6WH 5CZVL 1KCUL 3H42H 1B0WA 4JJ5A 3KLAB 2GUOB 4M02A 4LHJB 2BDNL 1SYVA 4DW2L 1MCFA 3WNKA 1S7WB 4WI3A 5I17B 4U6HB 4LSSL 3RZCD 2NNAA 5EWIH 4G7VH 2EYRA 3MO1A 5EORL 4QHNA 1XF2A 2APXA 2HWZH 1U8OB 2CRMA 1MHCA 4LP5A 5C09B 3EUUA 1MRCH 5E2VH 2Y07L 2UWEB 3K3QA 2H2PC 1YEDA 2F54B 1Q9KB 4OCRL 3UTTD 3BIKA 1I9IL 4JFDB 4ZTOH 2ESVE 4TNVF 2WUCL 4NNYA 4EUPH 4N9GB 3OMZA 4N90D 2VSCA 2IBZX 2EE2A 1B9ZA 3PWUA 3IGAB 1Q9OB 1IFHL 1G9ML 1O7SA 4JY5L 2FSEA 1ZANH 2Z35B 4P46C 1I8LA 2ZG3A 3ZKSD 5E8EA 1H8OA 1KT2B 2P43B 3TNMA 4CN4A 4HH8A 3OTTA 2DQDH 3I2CL 1UWGL 3LRSA 3ZKMD 2A1WH 2Z8VC 2UVFA 4X99B 2AGJH 3NH7H 4XXCA 1HNFA 4JFEA 4ZAKD 3WCYA 5DJDB 3IB4A 1FYTE 5MP6H 1RJCA 3CLFH 2R0ZL 4LLYA 1YY8B 5M94B 2JELH 2H1PH 5FCSH 4XMKL 1MHPL 5JO5A 1GYAA 4IRJB 2YN3A 4Z5RB 2CO6B 4KKLC 4HKXB 1P7KB 1JYVA 1QSED 3PDOA 5C0IA 3N9GL 5ISZE 4WIQA 5KOMC 1K4DA 3MLTA 3LEXA 2NXZD 3AMKA 5BZDB 1FFOB 5IF0A 4ONGL 3QUMB 4RMUA 3S88L 3WYRA 2HTLC 1FFPA 4XNXH 3SKOA 4PLJD 3V0VA 1J11A 4XCNA 1K2DA 1XZ0A 3D9AL 4JZJB 5SWQA 5EU6D 3V0WL 4WI6A 4D0DB 4XXDB 5I8CA 4P57B 2WIMA 1JP5A 3C5SA 5BXFA 3HRZB 3CMGA 1IRAY 5IW1B 1DQLL 4NUJA 1PYWB 4DTGL 4B7LA 3NFPB 5F1OB 3U0PB 3BUYA 1KENH 3T1WA 1BFTA 3O2WL 3OSKA 4K9EL 2WWKT 4XBGA 4Q2ZB 3QI9A 4NWUH 4XCEB 5I71C 3CDFA 1WC7B 2Z31C 3NZHL 5BO1L 5F7EL 3FN0L 4KHTH 3GUTA 3P9MB 5HGBA 5C0JB 4UOW1 2DQGL 3MXWL 4Y2OA 2WV3A 2RJMA 3PQYE 4JFQA 3QUYA 3QFJB 1JHLH 3CUPA 4XP4H 1CZ8L 2KZWA 4ZDHB 4OSUH 5HYJB 3PHOA 2J2ZA 4GMTL 2A73A 2BNQA 5F9OH 5HDBF 2B4CL 1EGJL 3ARGD 2ZSWA 3IDJA 5C6TL 1NGZA 1KLGB 1BVZA 3NIFF 2CXKA 2X1XR 4PJIA 1EJ6A 1EV2E 3OJVC 5C07A 5ESAA 5HHPA 2EDLA 1EHLL 3VXRD 3SN6N 2HP4A 1OGTB 3X3FL 4JQXA 4AG4L 3PWLB 3GSNH 3IETB 3HI6L 5I76B 5EIIB 1MH5A 1GJIA 4WEBH 3UTSB 3VCLB 2BVQA 5DDHB 5K59E 3K81A 2J88L 4MLSA 4ESKA 2G9HB 1I1CA 3KXFA 1QACA 1D9KA 1N5AB 4ODVH 4NM4H 4XP9H 3RNQB 1UWEL 3TLRA 2YSSB 1KYOJ 2DLFL 1WIOA 1O0VA 2CDEA 5IT2L 1PZ5A 4AH2A 1CT8A 2Q3ZA 5HGHB 4EEEA 5HHXL 2WBWB 3IF1B 4IMLA 1T22A 4ODHL 3I9GL 3AXLA 4ZAKB 3GNMH 4R4ND 1QOKA 3DV6B 3CXHJ 3HMWH 3NVQA 4HPOL 2Q7NA 1AGEB 1R5VB 2R2BA 5F3BA 5EO0A 1FO0A 1IVLA 1PQZA 2VQ1B 4WNQA 5F9AC 2JJTA 3KR3H 1EAJA 4APQC 4IRZH 5CD3A 1UH4A 3G5ZB 4Y2DC 3MRJA 5T33H 4NO5B 2XZCH 1HXYB 4X4XB 3G6JE 4J8RA 1QFHA 1BVLA 5KSAC 1KJ2B 5TQ0H 4X80L 1F3JA 3MUGB 3S4SB 4OCLC 4POUB 4XTRD 1IC7H 1NDGA 2HN7B 4Q0XL 2AABL 1YNLH 2Q3AA 2Z4QA 2QHRL 1ZS8B 4X98B 4Z7OF 3KLSA 4ZD3H 3D25B 4GFTB 4ZUVA 5KSVB 4AEHL 3VXUB 2D4FA 4NQUA 2JB5H 5I1LB 3B5GA 4YNYA 4F58L 5HHQA 3UJJH 2MCG1 4UOW0 1PG7X 3MLWL 2P5WA 5E8DL 4XI5D 3JV6B 1XGYL 4JFOA 3MUZ1 7FABH 3U4EB 4JREC 1S3KH 1IAIM 4C57C 5ETUB 4L1HA 4PJFB 1INDL 5F93C 1YYLH 2XWJA 3OKKB 4PJIF 4F7EB 4O9HL 3HB3C 3W5MA 1R3JB 2X44D 4L29A 5F44A 1DDHB 1JF6A 2C3VA 1J12A 3IVKA 3DXAA 5C0CB 2Z9TA 1BLNB 4NJ9L 3U9UB 1EHAA 3FO2A 1CFVL 3CH1B 4P46A 4CU8A 5DFTA 3E2HC 4WW1A 5C9KA 4HFWA 4OF0A 2ZPKH 5KVEL 4BQBA 5DMKB 3I84A 4TN9A 3QUZB 1LP9E 5CEZH 3D39B 3UTOA 2QSVA 3LS4H 1S78C 2NTSP 4N0YL 1CK0H 2FWOA 4HJGB 4NSKA 4AL8L 1U3YA 1QRND 1JTTA 1DFBH 2A77L 3BPCB 3REWB 2R29H 1JUFA 3VWKB 1B0GB 1S5HB 1JV5A 3Q1SL 4KK9D 3Q3GB 1BVKA 4I48B 5IUSA 3EW3B 1EBPA 2GTZB 4MJIB 1LMKA 4UINL 1RZIB 4YX2H 1P4IH 4POYA 3DBXA 1PLGL 4QRPA 5I1JL 1JNLH 5TQ2H 5IROC 3RGVA 3S34L 3S5LA 2J3SA 2PYFB 3BE1L 1BZ7B 1YN6B 3VXMD 5F7YC 3L7FA 3KGRA 5I66A 3C8KA 3EFDH 4P9HC 3VRJA 3T2PA 4NO3A 3SJVB 1BOYA 1KJMB 3RPKA 2CDGB 5I16A 5HVHC 1CDIA 1MQKH 4JR9L 2FECL 3K74B 4GRWH 3UTTE 3B8SA 4NO2A 3W2DL 1BBDL 2W1NA 2ZNXA 4NQCA 1AD9A 3BVNB 1DP0A 1FZOB 3ZSSA 3CFCL 4K7PY 3RWFA 4ERSL 2VR5A 5J13C 3NZ8A 5CUSL 4P23D 5ALCH 4JPVH 4U0RB 1WCBB 2NY2C 3B4NA 2B1HH 4ONHA 5CBAA 2VL5B 3E3QE 5EUKB 1ORSA 1BEYL 2R69H 2Z31A 5ACZA 3A6BH 4RGND 3GSQA 3L5HA 3MC0A 4LF3A 4JM2A 2XQYG 2RAMA 1AJ7H 3QQ3A 4GQPH 2UZYB 2WSKA 2X4NB 2XWTA 5D71L 1YEJH 4WY7H 1TZIA 5T5NF 2OR9L 4LHQB 1FE8H 3NIDF 1RD6A 4F9PC 4R97B 5EU5A 1MCCA 2DQFA 1CWVA 1NGPL 3O6FB 4MSWB 4U1MA 3T3PF 2W07A 5IB1B 5E08H 2E9BA 4W70A 4Y5XB 4S1SH 1IC4H 4PRPD 4PV9A 4UIKL 4GAFB 4XP6H 3HC3L 4U7MA 3QDJA 2YMXH 5EBMA 1BBJA 1QSEE 5TGBB 4FQXB 3KLHD 3G5XB 3MACL 4XX1E 5DHYB 2B8OT 3MUJA 1BD2B 1A2YB 2XQBH 3KS0H 3WDJA 1D5BB 2FX8L 1MIMH 4M6AA 4HKZA 2WUBH 3OAUL 2VDQH 4GRLC 5DRXA 4ZUSB 4M61A 4LASH 4OLUH 1IKFL 1EUUA 3L5IA 3V4UL 4OAWB 3D2UD 4NGHL 3TIDA 4Z76A 1QG3A 3SE8L 3QZWA 4MDJB 5EU6E 3L3GA 5DR5L 5HJ3A 4UU9B 5DRWB 2Q86B 4E41B 1UJTA 3THMH 1AXSA 4RNRB 4YWGL 4UT9L 4K3GA 4HHAB 4OIBA 3IDGA 3CLEL 1XGUB 4RAHA 5FO9B 3DURB 1MHHB 3NPSB 1VGEL 3F8UB 4UZGA 4XC3H 2VXUH 4KRLB 3BRDA 3P11H 4ZPVA 5IW6B 3ZTNL 1YDPB 5BJTB 1HN1A 2BNRA 4FFVC 1OWWA 2FATL 1CG9B 3D85D 4YBLC 2OJZH 3WFCH 2FLBT 4E0RA 4JO3H 1D3CA 4TSCH 5EC1B 2K7QA 5F7HA 1RUQH 5BS0B 2O61B 2Y7QB 5J4MA 4Z78B 4DVBB 2AJYH 4X6CA 4YFLF 1X7QA 3EKCA 4JKLA 5J1AA 3RQ3A 1XGPA 3SKJL 4APQA 4XMLL 1AGCB 1D5XA 2YPVH 4DN3H 3CFEA 2BCKB 1MCHA 1TVHB 2EIEA 2H8PB 3MRMA 1P2CB 4WFGD 3QHZL 1EEZA 4KGLA 3HE6C 5KSAA 3QIUD 4OKVB 5IB5B 4Y19D 2V2TB 2CLVB 3V79C 2AXJA 4UDTA 5D1XC 3BKMH 1QBBA 1UB5A 5F88A 4XPFL 4CKVX 4EDXB 5DJAA 1U91A 5F9JB 3K0WA 5B8CB 2EO9A 1KIQB 4KQ3H 4HS3A 5I1HL 3JTSB 4JM2F 4YDIH 3LOWA 3QDGB 5E2TL 1OAYL 2LAAA 3VXRE 3NACL 3O2DL 4MDIB 4KI5C 3LKQB 2RCSL 4K8RH 3V5HA 1AHWC 4GG6B 5DMIL 1J8HE 1VFMA 3N85L 4HJ0C 2ED8A 5IK3A 4S1DC 2IH3B 2A6KA 3WIHA 4JHBA 4KTDH 3QULB 3VD9A 3LN4B 4K3JH 4W6XB 4X6FA 1SMOA 5EPMA 2CD0A 5DSCB 5KVDH 4HUVB 2BNUA 2YHGA 4MJ2A 5LVEA 1MFAL 1Q94A 1IAKB 3SDDB 3QH3B 5BOZG 3FO1B 5TDPB 3AROA 2HJLA 4NHUA 3FFDB 1HYSD 5GRYA 4LLVB 1KCUH 3BPLC 5SWZD 5HY9B 1L6ZA 3PGFH 3BD3A 1IE5A 3GMPA 1HQRB 1DVFB 3LDBB 4RQQB 1FNLA 4HK0A 4NC1E 4UUJA 1H15A 1JZ6A 3K1KC 4D2NA 4P2QB 5EFIA 4LEOA 4HCRL 3ULUF 4EBQH 4P99A 1QSFB 4OZ4B 4GXUM 5J06A 3AFLA 1BPVA 1BOGB 2XXCB 3IU3B 4MAYD 1MF2H 5EORH 4J3VA 2GYSA 3ZE1F 1G7PA 2Q76A 5FUZH 3LKNB 1C08A 2Y07H 1AR1D 4ZPTA 4XAKD 1P4LB 4JJHA 4OCRH 2X4QA 5D7SL 2E27H 4ALAL 3L1OH 3L3OB 3F12A 5FYJU 1HSBB 3QUXB 2ZUQB 3MRPB 3SPVA 4KK8C 4U1SB 2C3GA 4I0PC 4GAYB 4PTTB 4JY5H 1Q38A 4O51B 1HH6A 4XVJL 2DQUH 1MEXH 3AUVA 1HILB 5D7IE 3ME0A 2YD1A 5D96C 4PGJA 3OG6B 4JCMA 2FX9L 2X40A 1N4XL 3F62A 4QXWA 1JWUA 3BXNB 2D7TL 5BCAA 3D85B 3DROA 4JN2A 3BD4A 2X10A 4WTXA 2KUTA 5A2JH 4BKLB 2Y25A 1JPGA 3BW9A 2UUDH 2R0ZH 4WU5A 3GSVA 5GS1B 5J9PB 1MHPH 1LO3L 4KZDL 1FG2B 5J6GA 3VH8G 5D1ZD 3C5JA 4LMQI 2R1WB 5HSFA 5E2WL 3N9GH 4NKMA 4KFZC 5DA0B 3HHRB 4ONFL 1CLOH 2COQA 3BP4B 1Q9WB 3QDAA 4Q9CA 1NDMA 4ONGH 2GJ6D 4XWGL 3MNZB 1ZLWH 3EYUH 4QHKJ 4PRNA 5JLZB 4NBXB 1C8PA 1F6FB 3DYPA 3STZA 1B4JL 5AG9A 1NC4B 2UWEF 3BGMB 4W6YB 4KROD 4OUUA 4BELD 1U8PB 1QRNE 1YYMH 2ZUTA 4DWHA 2MCPH 3VXSB 3ZDZF 3BX7C 1GC1L 1J0IA 3Q6FB 4D94A 3ORJA 1HIML 2XG4A 3EDJA 5IVZB 1NMCB 4FQQA 1MFNA 5ICZA 1J05B 3LQAH 4HIEB 4UIMB 5DUML 1ZMYA 4HZLA 2VABB 4K9EH 2VDRH 2GI7A 2CLRA 1BX2A 1D6VL 1U92A 3X11B 4MQXD 2F8OA 4GRLA 2CSPA 2PF6A 5D6CB 3VXME 2MQ3A 4PJGB 5F7EH 4FXGA 5TPWL 4NQDB 3FN0H 4CJ0A 2VDNH 3ILPB 2DQGH 4TQEL 3IETA 2DQTL 5INCB 3MJGX 1T2QL 1TFHA 1TVBB 3R1GL 4Z7WE 1HZHL 3TA3C 4YDLC 2O26U 3QG7L 1I85C 1UZ6F 3CVHH 3KYKL 4U1NB 1F4YL 1FIEA 5CP7B 1S9VA 5E94A 4RISL 4MX7B 1QR1A 3ALPA 5CIPH 3MRGA 1JGUH 4R0LA 2B4CH 4NCDA 4CVWA 2VN7A 4XNMB 3FZUC 2J6EL 5C6TH 4MAYB 2XRAH 4D8PB 1RIVH 2F53B 5C0FA 2J8UE 2HJFB 2J5LB 3H2WA 4U1KB 3IF1A 4RGNE 4JKMA 3RX8A 4TUJB 5HYFA 4EZMA 1SEQL 3I02B 5HI5D 4JFPB 5E8PB 1EHLH 3GSOB 3NCEB 3OKOA 4GG8B 1TQCC 3C60C 4X5XB 4PJ7A 4XCYB 2IPTH 4HXBL 1SBBA 3X3FH 4AY0A 3GB7A 5F89A 2DBLH 4U6VL 3HI6H 1OL0A 1MCEA 1IM9B 5KSUA 4PJXB 3GBNH 1KIPA 2DM3A 3G5ZA 1IEAA 4Y16C 5JNYB 3VDCA 4DZ8A 5JORA 4G8FA 5FV2A 1MCNA 3BEVA 4LHUG 2VXTL 5CAYB 4PRPE 1UWEH 1XFPA 5FA4B 3GGWA 4HEPG 3F7VB 2DLFH 4QHMA 3MJ9L 4OF5A 5IT2H 3V9FA 5HHXH 3LKRB 1MCOL 5E8OB 4P5KA 5I73B 2VXQL 3RI5K 3MBXL 5F70A 4ODHH 3RWCB 1AHWA 4UV7L 3I9GH 4R3SB 3HCVA 1IAMA 2IANB 4QF1B 3ES6B 5D4QA 3AAZB 4HPOH 4MD5B 4OM1L 5JXED 1JZ3A 1IEBA 2YD3A 4JZNB 5GGRA 3RWDB 3X14B 3ZKXC 2GAZB 4ODWA 1QFWI 3EDKA 5BRZB 5IEHB 3GK8H 3R8BB 4L3EB 4IDJL 3HFMH 4UAOC 4JG1L 5K9KA 3DUUA 3LIZL 3LY6A 1QBMH 3QO0B 3FQRB 4PJEA 4YO0A 1CCZA 3E8UH 5JTWA 4Q0XH 2AV7A 2AABH 2WMPA 3KPSE 4Z7VA 3ARRA 3S97C 5EB9A 1QQDB 1A0QH 3T09A 3BYYA 3H9SE 5IHZA 3QEQB 1A7PH 2PXYC 3O6ML 2PYED 1F3DH 3TO2B 1MCQA 2VLKD 4F58H 5IHBA 4X0KA 2JIXD 2OTUA 4HUUA 4LCYB 4WFGE 1NCNA 1U3HB 32C2A 1GZQA 43C9B 3MLWH 5CMAA 4Y19E 3ZKND 3TH3T 3T4YA 4FFYL 2LTQB 4M1CD 5LAXB 2A6IB 5FYLH 1AY1L 2XICA 1ZHLA 5T3XE 1A1NA 1EK3A 1VGKA 4O9HH 1I3GH 2FD6L 3MCKB 2GTZA 4JZOA 1F13A 3M1BB 2A9ML 3PL6A 3DRQA 1BZQK 1Z9SA 1GGCH 4NJ9H 1CFVH 4H5SA 1CFQB 1T7ZA 2PYFA 1TTUA 3QCUL 4JFHE 2OXGA 2DKUA 2FBJH 5JOFB 2DLIA 2VLLA 4GMSL 4K8RD 5F1KC 4N0YH 2YD8A 4AL8H 4X6DB 3VWJB 4NFCA 4I18B 2A77H 4PJ8D 4PD4K 5GS2H 4QRUA 4OD1H 4TUOA 4ELME 1L4IA 1EZVY 5DJYB 15C8H 4QRTA 5SWZE 5MEOA 3RVXC 2YZ1A 1MCJA 4I5BA 4UINH 4KDTC 4M6OH 4P48A 5FDWB 1M6OA 1KFAL 4NRXB 5I1JH 2DYPA 5HHOE 2Z93A 3S34H 4O02H 1ZA3B 4LLAA 5GS0H 4BQ6A 3W11D 3MRHA 4OD3L 3QCVL 1VDGA 2FIKB 1ADQH 4M8QB 1OLLA 2NXYB 1KSRA 3O41B 4E42B 2QL1A 3CX5J 1G6RL 3HI5L 4PJFF 1BQLL 5MEQB 4C83B 3C09C 1IGYA 4L4VE 4XAKE 1M1SA 5T3ZH 3W2DH 2R2EB 5DJ8B 2NY0D 2X42A 4NQEB 4Z7VF 4Y5VA 3U2SA 1S7QB 5DHYA 5F7MC 4WHTA 4JRWA 1IAOA 4ODUB 3QAZB 1WZ1H 5IB2B 1BD2A 4CADA 5I15L 3MRFA 1ACYL 4U7KA 2VERN 1KB9J 2VZOA 1K8IA 1X6LA 3RDTB 2FJGB 4F2MB 4QOKA 1W0VA 1RURH 1IGJA 4XP5L 4M5ZL 5GSRB 3V6FB 1RZ7H 4P3CH 3CSYA 3TA3A 4NJAL 4B7IA 3L3KA 5FYJH 2HMID 1PDKA 2AXGA 1I85A 2D2OA 4YHML 5JDSB 4X4MA 5H35A 2NY4B 3SE4A 4IRSB 1ES0A 1NGPH 2VB5A 3CC5A 1ZLUK 4PUBH 2VE6B 1GCFA 2NY7L 4H88H 1V8HA 4OLWL 3OKNA 3BPNB 1MI5D 3HC3H 4JLRB 4PY8J 5JW4M 4RAVB 3IDYC 3K46A 3NIGE 5FGCE 5KANI 1SQ2N 5DHXB 3DMMC 1KN4L 1JL8A 3QWQB 4EIGB 2P47B 3VXOA 2AJUH 4NP4H 1T0MA 2GJ6E 1G0YR 4M6NL 1T66D 1OP9A 2YEZA 3OAUH 1CFTB 3K8LA 5BMFL 3GJFH 1IKFH 3BEWB 4GBXB 4NGHH 1QVOA 2WIIA 1T7WA 3SE8H 2FR4B 5DR5H 2D7MA 4Y16A 1ZLVK 5D72L 1AI1L 5E70A 1V3MA 3N1QC 4C56D 4MB5A 5LGHL 2WBJC 5CINL 1C1EH 5H37H 2LU3A 2CLVA 4UT9H 1XAUA 5AEAA 3P4OB 4OB5H 3O9WD 4Z7UA 1OAQL 1WBZB 3CLEH 2FHCA 2OQJB 5C70A 4R2GD 1RJYA 1VGEH 5LXGL 4B53A 3T0BA 4EN3D 3T2NL 3BZFA 5E5UB 3KWWB 4U1LB 5E4EB 3UTQB 1HEZB 4RAUB 4L8BB 4BSWA 3BQUB 2PN5A 4EI5C 5FK9A 3PWPA 1NSNL 5C0DA 4C4KT 4HIHA 1FZMB 3C5ZD 2DLHA 3KHOA 4HUMB 4NT6A 3SDAC 1I1FA 4LLQA 3HS0B 1PKQE 3IRZA 4IS6A 4WUUA 4GW4B 1JGLH 3MTRA 4YQXL 2MHAA 8FABB 5DJ0A 1X4ZA 1KTLA 1T3FB 2P8LA 1U8JA 4OI7A 1B0RA 1ZVHA 5TDOA 3B5HA 5I1EL 3EJJX 2CKBB 4M7LL 4P2RD 1U8NB 5DD0H 3U30B 3FTGA 3FCTB 3WO4B 3OXSA 1U93B 4PFEA 5IVNA 5DRNB 4GRWE 3AU1A 5E6ZA 3MGOA 1YN7B 3RUGE 4G42B 1MWAL 2JE8A 5D2LB 4JFXA 4JPKH 3MV8A 5DK2A 5E2TH 4XWOC 1CXLA 3NACH 3DX6A 1X5KA 2QQKH 4Y4FB 5DMIH 1ZTXL 2BOCB 3N85H 4HIIA 2DTML 2LABA 5SWSE 3ARBD 4J12A 1OP3H 3SQOL 4HIXL 4CL7A 3BP7A 1MCRA 1DBJL 1KLUA 4NO0B 2X89A 1WBXB 4KWUA 2OSLA 2VZ1A 4MVBD 5J11B 3DX9B 1RK1B 5MHSD 2X1PA 3SGDI 4R7NA 4XX1G 4A6YL 4ORZC 4G3YH 1MFAH 1T4KA 5ID0A 3GSUA 4WCYH 3CFJB 1JWMA 5DFVD 3PF2A 4LVOB 3B2VL 3HI1A 4L8SC 2OM5A 4LSQL 4KKCC 4OZFH 1HSBA 3DX7A 2VTFA 3S4SG 3VFRB 3DX8B 4PYHA 2G75A 2XTLA 5CEYA 1NLDL 2NX5A 4AENA 5HYQB 1Z0MA 4PS4L 1OGAD 5EC2B 5LGKA 3FRUB 4PJHE 3QQ4A 1IZJA 3I75B 5D7LA 3TCLB 2XKSA 5DMYA 1E4XL 1C12B 2QQLL 1D6EA 4HLJA 5GGVH 3FO0L 5E6ID 1LE9A 4L3AA 1JE6A 3ZHDA 2CRIA 4PJ5A 4Y4KD 3VI3E 4FXKB 3ARDB 3C9NB 2CGRL 1N3NA 3Q5TA 5D7SH 1OT1A 3FRPG 5FCUH 4JPWH 4KDTA 4MJ6A 3TO4D 1BIHA 4RDQF 4CDHA 2FGWL 4IOFC 1HCVA 3QCTH 1OTTC 3LV3A 5FOJA 1NBYA 4BUHA 2R8SL 3TN0C 4WWKC 3VFOA 3HAEH 4CU7A 5KVFH 4NRZA 4PJCA 2PYEE 4MGXA 2R0WH 1FAKT 3KYNA 2VLKE 5EBGA 3UCRA 1FYHB 4IEFB 4R2GB 1U41A 1XIWD 2ERJC 3D3VD 4YE4L 2FX9H 4IM8A 3T0EA 1N4XH 4KV5E 3RTQD 2H32A 2D7TH 2RFXA 4YBQC 5D7KD 4G6JH 5FYKL 2EDXA 4ISVA 4AYFA 3BZEA 9CGTA 4PJAE 4PR5A 2V9RA 1MJJB 5C08A 4O5LL 3G04B 4YHLH 1LO3H 2FYYA 3KYMB 4KZDH 4TSAH 2ATKB 2E7MA 3P77A 3RVWC 3O11A 2GK0B 5L2KB 4DKEH 3MRNB 4AMKL 3MOAL 3U7YH 5FYLD 4KMLB 4DZBB 1X5IA 3FT4B 2ZSVB 2F5BH 3VFNA 4EOWH 4X9HA 5EA0H 3TF7C 1CVSC 4QRSB 1R5IA 4XWGH 1HQ4A 3VFWA 1S7SA 2BK8A 5IMLA 1S8DB 1IKNC 3HE7B 1DANU 3QQ9C 3L5WB 3CVHB 2X4RA 4DCQB 1U8LB 1ZHBA 4GQ9L 4PBXA 1LO5A 5HHVL 4XPBH 4JGJA 4I3GA 1GC1H 1S7RB 2YC1B 4AJ0A 4WO4B 4OZGA 3DECA 5GISL 1R3KB 3WBDA 3D0LB 2V2WB 4TUKH 2BVEA 1HIMH 3B9AA 3PGDB 3DMMA 4X7SL 1K5NA 2QTEA 4D8PA 5DUMH 3QIBB 5GS2D 2JCCA 4OV6F 1S7UB 2XWBB 5JR1L 3P30H 5DTFB 1MFDL 1D6VH 2P8PB 4P49A 2XN9A 1DLHA 5E8PA 4FG6D 3G5YB 2BX5A 4X7TB 3L3IA 4WDIA 4TQEH 2DQTH 2IBGA 2N7AA 3MQIA 1I1AA 3LN5A 5JUEH 4X5WA 5E1AB 5JW5B 4UNTA 5GS0D 2FB4L 2WBJA 1FZJA 3O4LB 3EOYG 3FB5A 3OBAA 5GGSA 3QG7H 3KYKH 3MV7B 3MGTB 4HH9B 4RISH 3CGTA 1YQVL 4OJFL 4PJBA 4WI4A 1IMHC 3RY6C 3U0TB 5DT1H 4D0BB 2EDDA 1KELH 4PJCF 2RB8A 4QRRA 3OJ2C 5D93B 3FFCD 1UJ3C 1G7MA 1SEQH 1ZXQA 4QF1A 2GFBB 3ARXA 2EE3A 3BKYL 3SDAA 3DOSA 5IV2A 4HXBH 3IFNL 2IAMC 4OFYD 3RPIB 4JVWA 5TDNA 4G6FB 3TM6A 5HHNA 3FT2B 1LNUA 5GIRB 2DQJL 3B43A 3H0TB 4FTVA 1S9XB 3HC4L 3QJFB 5IVXE 2NLJB 1MI5E 1DUZA 2AKRB 3DIFA 1FH5L 3T2OA 3FQRA 5SX4I 1INEH 1P6FA 3U6RA 3T0VA 4F37F 1EHXA 3AB0B 4HUXB 3HNTH 1XR9B 3IFPA 4WV1C 5MEND 2VXQH 3MBXH 1KJVB 1VEPA 1ZT7A 3VFGH 1QTYT 4V1DB 4TOYL 4OM1H 4J6RH 1EEUA 4LRNL 1F6AB 1U58B 4YGAB 1LEIA 2AJSH 4TPRL 2EEAA 1DEEA 3I6LE 3VFTB 5I1KH 4C56E 2JB6A 2VDPL 5C8JA 4KJQC 1JGDB 1DBML 1WLHA 1I7TB 4JG1H 4I77L 3RAJH 2JCCF 4KVCH 1QYGL 4L8SA 2HG5B 3AREB 4X6EA 2KQMA 2OZ4L 5IIEB 3OZ9L 1MFCL 2AQ2A 4Y1AD 1RZGA 5GZOC 3ZL4L 4PP2A 5AZEL 1RJZB 3D1MC 4BH7B 5L8LB 3TNNA 2H6PA 3WUWG 4MA3A 1A6AB 4GOSA 1F11A 3GI8L 5KW9H 2I9TB 4XNZC 3RX7A 3KPNB 4LLMB 5K9QI 5GRUL 1KTDA 3S7GA 4XNQB 4PGCB 1SY6H 2VR4A 1R3IL 1YY9D 2VISA 4QXTB 2EDNA 3BP5B 2VDLH 3MLUL 5FUOH 1UQSA 4U31A 4ZS6D 3GMOA 4P2RE 4PJBF 3HG1D 2WP3T 4HEME 5I30H 1IM3B 1CD0A 3RBGA 5A1AA 3VWJA 3WXVH 1N7MH 3STLA 3BZ4A 2XPGB 5C0AD 1BGXL 5JA8B 2ESVA 1AY1H 3QNYA 4XCCL 2E7LC 1OF2A 4R8WL 1T0NB 4EUPG 1I1RA 4PY7B 1ZSDA 3CSGA 4ZXBB 2FD6H 4BM7A 5DJXA 3EYQD 1SBSL 4JQVC 1NL0L 2YD4A 1MFEL 3IJSA 1QA9B 2IC2A 3TV3L 1QFUH 2Y6SD 4OV5B 3MRQA 3QEGL 2R1XA 4I1NB 3QCUH 3GJFK 3TFKD 3WXWH 4DKFL 5CJXC 4Y2DD 4GMSH 3DUSB 4PBVC 5F9WB 1A4JB 5MHSE 3V8CA 1NPUA 2QSCL 3L3HB 4KUCF 2QHLA