1JMZB

Crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
346
structure length
339
Chain Sequence
b'GPALKAGHEYMIVTNYPNNLHVVDVASDTVYKSCVMPDKFGPGTAMMAPDNRTAYVLNNHYGDIYGIDLDTCKNTFHANLSSVPGEVGRSMYSFAISPDGKEVYATVNPTQRLNDHYVVKPPRLEVFSTADGLEAKPVRTFPMPRQVYLMRAADDGSLYVAGPDIYKMDVKTGKYTVALPLRNWNRKGYSAPDVLYFWPHQSPRHEFSMLYTIARFATADLLYGYLSVDLKTGKTHTQEFADLTELYFTGLRSPKDPNQIYGVLNRLAKYDLKQRKLIKAANLDHTYYCVAFDKKGDKLYLGGTFNDLAVFNPDTLEKVKNIKLPGGDMSTTTPQVFIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amine Dehydrogenase
publication title Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 86
structure length 339
sequence length 346
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1jmzB00
1NR0A 4J0WA 2QXVA 4JT6C 2UZYB 5FKQA 4ERQA 1YFQA 3JB9L 4A09B 2PBIB 2CN3A 3DXKC 3I8EA 4FA9D 4TZ4A 1SQ9A 4JSXC 5FA5B 2H6NA 1FWXA 4CI2A 3EI4A 1TBGA 4H5IA 3EI1A 4J8GA 4CZVA 3OTTA 3L4MD 5EMKB 3BWSA 4BUJC 2H9PA 3V9FA 4A0BB 4JXMA 4D6VA 3EI2A 3N0EA 4MK0B 4OWRA 1MG2A 3I7OA 4GM8A 4K3JB 1N6EA 3PXTD 4FA4D 5EMJB 3KRXB 4J84A 2B5LA 3PSLA 5TEFA 4A11A 5B4WA 4XEIC 3SCYA 2OVRB 5FKRA 5AJAA 4JSVC 4EWRA 1NEXB 3J81g 2AH0A 2H47A 2P9NC 3PE7A 4O45A 3DXMC 3RSEC 3SMRA 2XL2A 4CI3A 4CZXA 1TYQC 1PI6A 4X61B 3EMHA 1OLZA 5FQDA 1L0QA 1OMWB 3RFGA 3VH0A 5GMKn 1A0RB 4L9OA 3IJ1A 2B5NA 3VA6A 4CY5A 2Q7QA 2CE9A 5FLXg 3HFQA 5IJ7E 1P22A 2B4EA 4GGDA 3SBPA 2AGLA 4J73A 2G9AA 4CY3A 4FWWA 4ZOXA 4FA5D 3V7DB 2YNPA 5HE3B 3EI2B 2OK6A 4PSXB 4ZN4A 4PBZA 3JROA 1N6FA 4UI9R 3ORVD 2GC4A 2AGWA 3OL2A 3SFZA 4A11B 4Y5RD 3SVWD 3JZGA 3CIKB 3FRXA 1JMZB 3N0DA 3EI3A 5GXIA 1XHMA 3AL8A 4PNKB 3I89A 4GGCA 3UR4A 2CE8A 2HESX 1MG3A 4AOWA 2P9IC 4QL1A 5H14A 3K27A 2HJ4A 4HDJA 4A08A 5FXYA 5AMSA 3SHFA 2YBAA 4GGAA 2PM9A 1B9XA 2H68A 4J79A 4PSWB 2IWKA 5CXCA 4PC0A 5KDOB 5TDHB 4FAND 2CO0C 4J8BA 2H6KA 5TEEA 4JT5C 3OKYA 5HYNB 2CN2A 3F3GA 3C75H 1GG2B 1Q47A 1QNIA 3I8CA 3RN0D 2AH1A 5EMMB 5EM2A 4KFMB 4QRJA 3EI3B 2Z2NA 4GM3A 4ESGA 2O9KA 1PEVA 5CXBA 4J81A 3ZWLB 4CZYA 5EAMA 3PXSD 4FA1D 1RI6A 4LGNA 3J80g 1XKSA 3CFVA 2HJBA 1U2VC 3AL9A 4PBYA 4J78A 3PVUB 5H1MA 4CC9A 3NVNA 5GSAA 4FB1D 3E0CA 4ERYA 3PVWB 5AFU3 4A0AB 1GOTB 5CXCB 5I5MA 3DWLC 5THAA 1XIPA 3FGBA 5EALA 4U7AA 3UVKA 3EWEA 3BG1A 5GXHA 4GQBB 3JAMg 3JRPA 3OKYB 4JSPC 2GNQA 2H9MA 2I0SA 3EU7A 2I0TA 2IWFA 2AGXA 4E54A 2IAAA 3A0FA 3EG6A 3SLED 3ULEC 3B7FA 2MTAH 2PM7B 2W18A 5EARA 4E5ZA 3EI4B 5IGOA 1K8KC 3EI1B 2H6QA 3SJLD 1SQJA 4D0KA 1GXRA 5HE0B 3UKUC 3IIWA 4J82A 4K3ID 2B5MA 2P9SC 4X60B 3CFSB 1MDAH 4A7JA 2G99A 2YMUA 2Z2PA 4FHLA 1PBYB 4IA9A 5C9ZB 3SBRA 4Y7RA 2OVQB 5JWZA 2HKMA 2I0RA 2J57G 2P9PC 5SXMA 4CY2A 5A2Qg 1GP2B 2QC5A 2I3TA 3UKRC 4QT8A 3SN6B 3IKOA 2UZXB 2J56H 5H17A 3IJ0A 2HKRA 5HE2B 4BL0A 4JD2C 4ZOVA 2P9KC 3I7LA 3JZNA 3PXWD 1JMXB 3MXXA 4GM9A 2IUPA 2H3XA 3RFHA 2H13A 4CI1A 3MKSB 2EBSA 5EMLB 1K32A 3OL2B 3I7HA 2HYEA 4L3GD 4ZOYA 2J55H 2XU7A 3GFCA 4O1QD 2YNNA 3I7NA 4NSXA 3AL8B 3RMZD 5TF2A 5K19A 5I5JA 2TRCB 3IIYA 2P9LC 3BG0A 4A08B 3C9CA 4R7AB 4LG9A 2XYIA 4ERZA 3AH8B 3OKWA 2PM6B 3RN1D 3DSMA 2XL3A 2PM9B 5HQGA 2OIZA 5CYKA 2BCJB 1ERJA 4L3HD 4L1QD 3I7KA 4A2MA 4J77A 1N6DA 3OW8A 2P9UC 3NVQA 3FM0A 4IMMA 3MKQA 3P4FA 4XYHA 2HXCA 5IJ8E 4U1EI 2OJYA 4JSNC 5IT9g 4Z8LA 4G56B 1VYHC 5EM2B 3UVOA 1SHYB 3I2NA 3L4OD 2IURA 3NVXA 4QQEA 3UVMA 4J0XA 2H9NA 5CXBB 5IC7A 4A2LA 5EAPA 1JOFA 1R5MA 3KRWB 2I3SA 3SBQA 2IUQA 5HE1B 3GREA 2H9LA 4GQ1A 4O9DA 4GMBA 4XYIA 4J86A 1U4CA 2H14A 5CYKB 3ODTA 4X3EA 4N14A 3JZHA 5C2WB 2AGZA 4FAVD 2IUVA 4GQ2P 3RRMC 2CO0A 2OVPB 2CNXA 2AGYA 3I7PA 3PSCB 5C2VB 3SXTD 3UVLA 4O3TB 2YNOA 4AEZA 3K26A 4YVDA 4ES0A 4PXWA 4E54B 4X63B 2GC7A 4ZOZA 5I5IA 4O3UB 3UVNA 3IJCA 4A09A 3MZLA 2YB8B 1B9YA 4J87A 3JPXA 3VGZA 4E5ZB 3SWSD 2OK4A 3F3PA 2AQ5A 3V5WB 4I79A 3U4YA 1S4UX 4CY1A 3C5MA 3MMYA 3W15A 4A0BA 4CI8A 1JJUB 2Z2OA 2BBKH 4BH6A 4GZ8A 3OKTA 5FKTA 3F3FA 4A0AA 5K1CC 4H5JA 5FKSA 3RLMD 3DM0A 5IGQA 3MZKA 4OZUA 4LG8A 1PGUA 3AFCA 3C99A
chains in the Genus database with same CATH superfamily
1NR0A 4O02A 4J0WA 2QXVA 4JT6C 2UZYB 5FKQA 4ERQA 1YFQA 3JB9L 4A09B 3IUMA 2PBIB 1GOGA 2CN3A 3EQ8A 3DXKC 3I8EA 4FA9D 1K3IA 4TZ4A 1SQ9A 4JSXC 5FA5B 2H6NA 1FWXA 4CI2A 3EI4A 1TBGA 4H5IA 3EI1A 4J8GA 4CZVA 3OTTA 3L4MD 5EMKB 3BWSA 4BUJC 2H9PA 3V9FA 4A0BB 4JXMA 4D6VA 5C86A 5HDBA 3N0EA 4MK0B 3EI2A 4OWRA 1MG2A 3I7OA 4GM8A 4K3JB 1N6EA 3PXTD 4FA4D 5EMJB 4BP9A 3KRXB 4J84A 2B5LA 3PSLA 5TEFA 4A11A 5B4WA 4XEIC 3SCYA 2OVRB 5FKRA 5AJAA 4JSVC 4EWRA 1NEXB 3J81g 1H2ZA 2AH0A 2H47A 2P9NC 3PE7A 4O45A 3DXMC 3RSEC 3SMRA 2HU8A 4DNWA 2XL2A 2EIBA 3O4JA 4CI3A 4AN0A 4CZXA 1TYQC 1PI6A 1E8NA 4X61B 3EMHA 1OLZA 5FQDA 1TYEA 4IRZA 1E5TA 1L0QA 3IJEA 1OMWB 3RFGA 3VH0A 5GMKn 1H2WA 1A0RB 4L9OA 3IJ1A 2B5NA 3ZDXA 2VDLA 3VA6A 4CY5A 2Q7QA 4WJKA 3O4IA 2CE9A 5FLXg 3HFQA 5IJ7E 1P22A 2B4EA 4GGDA 3SBPA 1O6GA 1QFMA 2AGLA 4J73A 2G9AA 4CY3A 4FWWA 1YR2A 4ZOXA 4NBMA 4WK2A 4FA5D 1VE7A 3V7DB 3GD1I 2YNPA 1C9IA 5HE3B 3EI2B 2OK6A 4PSXB 4ZN4A 4PBZA 3JROA 1N6FA 4UI9R 3ORVD 2GC4A 2AGWA 3FCSA 3OL2A 3SFZA 4A11B 4Y5RD 2HU7A 3SVWD 3JZGA 3CIKB 3FRXA 1JMZB 3N0DA 1VZ2A 5FFOA 3EI3A 5GXIA 3QI0A 2XDWA 1XHMA 3AL8A 4PNKB 3I89A 4GGCA 1UTCA 3UR4A 5FFGA 2CE8A 2HESX 1MG3A 4AOWA 2P9IC 4QL1A 5H14A 3K27A 2HJ4A 4HDJA 4WK0A 5FXYA 5AMSA 4A08A 3SHFA 2YBAA 4AN1A 4GGAA 1UOQA 2JKXA 2PM9A 1B9XA 3GC3B 4QAMA 3T3MA 2H68A 4J79A 4PSWB 2IWKA 5CXCA 1O6FA 4PC0A 5KDOB 5TDHB 4FAND 2CO0C 4J8BA 2H6KA 5TEEA 4JT5C 3OKYA 5HYNB 2CN2A 3F3GA 3C75H 1GG2B 1Q47A 1QNIA 3I8CA 3O4HA 1QFSA 3RN0D 2AH1A 1GOHA 5EMMB 1GOFA 5EM2A 4KFMB 4QRJA 3EI3B 2Z2NA 4GM3A 5E6RA 4ESGA 2O9KA 1PEVA 5CXBA 4J81A 3ZWLB 4CZYA 1JTDB 5EAMA 3PXSD 4FA1D 1RI6A 4LGNA 3J80g 1XKSA 3CFVA 3NIFA 2HJBA 1U2VC 1VE6A 3AL9A 4PBYA 4DNVA 4J78A 3KCIA 3PVUB 5H1MA 4CC9A 3NVNA 5GSAA 4FB1D 3E0CA 4O2WA 4ERYA 3PVWB 5AFU3 5M5SA 4A0AB 1GOTB 5CXCB 5I5MA 3DWLC 3EQ7A 5THAA 1U8CA 1XIPA 3FGBA 5EALA 4U7AA 3UVKA 3EWEA 4MMYA 3BG1A 5GXHA 4GQBB 3JAMg 3JRPA 3OKYB 4JSPC 1I2MB 2GNQA 2H9MA 2I0SA 3EU7A 2I0TA 2IWFA 2AGXA 4E54A 3ZE2A 4UM9A 2VZ3A 2IAAA 2HU5A 3A0FA 3EG6A 3SLED 4G1MA 3ULEC 4MMZA 2VC2A 3B7FA 2MTAH 4AX4A 2PM7B 2W18A 3V4VA 5EARA 3ZDYA 4WK4A 4E5ZA 3EI4B 5IGOA 1K8KC 3EI1B 2H6QA 3SJLD 1SQJA 4D0KA 1GXRA 5HE0B 3UKUC 3IIWA 4J82A 4K3ID 2B5MA 2P9SC 4X60B 4D9SA 3CFSB 1MDAH 4A7JA 2G99A 1M1XA 3K71A 2YMUA 1JV2A 2VDOA 2Z2PA 4FHLA 2XE4A 1PBYB 4IA9A 2VDQA 3NIDA 5C9ZB 3SBRA 4Y7RA 2OVQB 5JWZA 2VZ1A 3MVDK 5M61A 2HKMA 2I0RA 2J57G 2P9PC 5SXMA 4CY2A 5A2Qg 1GP2B 2QC5A 2I3TA 3UKRC 4QT8A 4MMXA 5M5TA 3SN6B 3IKOA 3OF7A 3ZE1A 2UZXB 2J56H 5H17A 3IJ0A 1E8MA 2HKRA 5HE2B 5M5UA 4BL0A 4JD2C 4ZOVA 2P9KC 3I7LA 3JZNA 3PXWD 4RE6A 1JMXB 5M5VA 3MXXA 3VI4A 4GM9A 4BCBA 2IUPA 2VDPA 2H3XA 3RFHA 2H13A 4CI1A 3MKSB 2EBSA 5EMLB 1K32A 3OL2B 3I7HA 2HYEA 4L3GD 4ZOYA 2J55H 2XU7A 3GFCA 4O1QD 2YNNA 3I7NA 4NSXA 3AL8B 3RMZD 5TF2A 5K19A 5I5JA 2TRCB 2VDMA 1BPOA 2QR5A 3IIYA 2P9LC 2VDNA 3BG0A 4AMZA 4A08B 2EICA 3C9CA 4R7AB 2XYIA 1UOOA 4LG9A 4ERZA 3DDUA 3AH8B 3OKWA 2PM6B 5E6SA 3RN1D 3DSMA 2XL3A 2PM9B 5HQGA 2OIZA 1UOPA 5CYKA 2BCJB 1ERJA 4L1QD 4L3HD 3I7KA 4A2MA 4J77A 1N6DA 3OW8A 2P9UC 3MUOA 3NVQA 3FM0A 4IMMA 3MKQA 3IUNA 3P4FA 1L5GA 4XYHA 2VDRA 3VI3A 2HXCA 5IJ8E 4U1EI 3MUNA 4Z7QA 2OJYA 4JSNC 5IT9g 4NC4A 4Z8LA 1H2XA 4G56B 1VYHC 5EM2B 3UVOA 1SHYB 3I2NA 3L4OD 2IURA 3NVXA 4QQEA 3UVMA 4J0XA 2H9NA 5CXBB 5IC7A 4A2LA 5EAPA 1JOFA 1R5MA 3KRWB 2I3SA 3SBQA 4G55A 2VDKA 2IUQA 5HE1B 2QZPA 3GREA 3IULA 2H9LA 4GQ1A 3IUJA 4O9DA 4GMBA 4XYIA 4J86A 1U4CA 2H14A 5CYKB 3ODTA 4X3EA 4N14A 3JZHA 5C2WB 2AGZA 4FAVD 2IUVA 4GQ2P 4JHNA 3RRMC 3QHYB 2CO0A 2OVPB 4BP8A 2CNXA 2AGYA 3I7PA 3PSCB 4Z7NA 4BCCA 5C2VB 4NAAA 3SXTD 5E6UA 3UVLA 4O3TB 2EIEA 2YNOA 3V4PA 4BCDA 4L1MA 4AEZA 3O4GA 1T2XA 4Z7OA 3IURA 1A12A 3ZE0A 3K26A 4AMYA 4DNUA 4YVDA 4ES0A 4PXWA 4E54B 3IUQA 4X63B 5C92A 2GC7A 4UM8A 4ZOZA 5I5IA 4O3UB 3UVNA 3IJCA 4A09A 3MZLA 3ZDZA 2YB8B 1B9YA 3K6SA 4J87A 3JPXA 4G1EA 2BKLA 3VGZA 4E5ZB 3SWSD 2OK4A 3EQ9A 3F3PA 2AQ5A 3V5WB 4I79A 3U4YA 1VZ3A 1S4UX 4CY1A 3C5MA 3MMYA 3FCUA 4JHPC 3W15A 2XZGA 4A0BA 4CI8A 1H2YA 1JJUB 2Z2OA 2BBKH 3T3PA 4BH6A 1C9LA 4GZ8A 3OKTA 5FKTA 3F3FA 4A0AA 4NENA 5K1CC 4H5JA 5FKSA 3K72A 3RLMD 3NIGA 3DM0A 5IGQA 3IVMA 3MZKA 2WQ8A 2EIDA 4OZUA 4RE5A 5M5RA 4LG8A 1PGUA 3AFCA 3C99A
chains in the Genus database with same CATH topology
1NR0A 4J0WA 2QXVA 4JT6C 2UZYB 5FKQA 4ERQA 1YFQA 3JB9L 4A09B 2PBIB 2CN3A 3DXKC 3I8EA 4FA9D 4TZ4A 1SQ9A 4JSXC 5FA5B 2H6NA 1FWXA 4CI2A 3EI4A 1TBGA 4H5IA 3EI1A 4J8GA 4CZVA 3OTTA 3L4MD 5EMKB 3BWSA 4BUJC 2H9PA 3V9FA 4A0BB 4JXMA 4D6VA 3EI2A 3N0EA 4MK0B 4OWRA 1MG2A 3I7OA 4GM8A 4K3JB 1N6EA 3PXTD 4FA4D 5EMJB 3KRXB 4J84A 2B5LA 3PSLA 5TEFA 4A11A 5B4WA 4XEIC 3SCYA 2OVRB 5FKRA 5AJAA 4JSVC 4EWRA 1NEXB 3J81g 2AH0A 2H47A 2P9NC 3PE7A 4O45A 3DXMC 3RSEC 3SMRA 2XL2A 4CI3A 4CZXA 1TYQC 1PI6A 4X61B 3EMHA 1OLZA 5FQDA 1L0QA 1OMWB 3RFGA 3VH0A 5GMKn 1A0RB 4L9OA 3IJ1A 2B5NA 3VA6A 4CY5A 2Q7QA 2CE9A 5FLXg 3HFQA 5IJ7E 1P22A 2B4EA 4GGDA 3SBPA 2AGLA 4J73A 2G9AA 4CY3A 4FWWA 4ZOXA 4FA5D 3V7DB 2YNPA 5HE3B 3EI2B 2OK6A 4PSXB 4ZN4A 4PBZA 3JROA 1N6FA 4UI9R 3ORVD 2GC4A 2AGWA 3OL2A 3SFZA 4A11B 4Y5RD 3SVWD 3JZGA 3CIKB 3FRXA 1JMZB 3N0DA 3EI3A 5GXIA 1XHMA 3AL8A 4PNKB 3I89A 4GGCA 3UR4A 2CE8A 2HESX 1MG3A 4AOWA 2P9IC 4QL1A 5H14A 3K27A 2HJ4A 4HDJA 4A08A 5FXYA 5AMSA 3SHFA 2YBAA 4GGAA 2PM9A 1B9XA 2H68A 4J79A 4PSWB 2IWKA 5CXCA 4PC0A 5KDOB 5TDHB 4FAND 2CO0C 4J8BA 2H6KA 5TEEA 4JT5C 3OKYA 5HYNB 2CN2A 3F3GA 3C75H 1GG2B 1Q47A 1QNIA 3I8CA 3RN0D 2AH1A 5EMMB 5EM2A 4KFMB 4QRJA 3EI3B 2Z2NA 4GM3A 4ESGA 2O9KA 1PEVA 5CXBA 4J81A 3ZWLB 4CZYA 5EAMA 3PXSD 4FA1D 1RI6A 4LGNA 3J80g 1XKSA 3CFVA 2HJBA 1U2VC 3AL9A 4PBYA 4J78A 3PVUB 5H1MA 4CC9A 3NVNA 5GSAA 4FB1D 3E0CA 4ERYA 3PVWB 5AFU3 4A0AB 1GOTB 5CXCB 5I5MA 3DWLC 5THAA 1XIPA 3FGBA 5EALA 4U7AA 3UVKA 3EWEA 3BG1A 5GXHA 4GQBB 3JAMg 3JRPA 3OKYB 4JSPC 2GNQA 2H9MA 2I0SA 3EU7A 2I0TA 2IWFA 2AGXA 4E54A 2IAAA 3A0FA 3EG6A 3SLED 3ULEC 3B7FA 2MTAH 2PM7B 2W18A 5EARA 4E5ZA 3EI4B 5IGOA 1K8KC 3EI1B 2H6QA 3SJLD 1SQJA 4D0KA 1GXRA 5HE0B 3UKUC 3IIWA 4J82A 4K3ID 2B5MA 2P9SC 4X60B 3CFSB 1MDAH 4A7JA 2G99A 2YMUA 2Z2PA 4FHLA 1PBYB 4IA9A 5C9ZB 3SBRA 4Y7RA 2OVQB 5JWZA 2HKMA 2I0RA 2J57G 2P9PC 5SXMA 4CY2A 5A2Qg 1GP2B 2QC5A 2I3TA 3UKRC 4QT8A 3SN6B 3IKOA 2UZXB 2J56H 5H17A 3IJ0A 2HKRA 5HE2B 4BL0A 4JD2C 4ZOVA 2P9KC 3I7LA 3JZNA 3PXWD 1JMXB 3MXXA 4GM9A 2IUPA 2H3XA 3RFHA 2H13A 4CI1A 3MKSB 2EBSA 5EMLB 1K32A 3OL2B 3I7HA 2HYEA 4L3GD 4ZOYA 2J55H 2XU7A 3GFCA 4O1QD 2YNNA 3I7NA 4NSXA 3AL8B 3RMZD 5TF2A 5K19A 5I5JA 2TRCB 3IIYA 2P9LC 3BG0A 4A08B 3C9CA 4R7AB 4LG9A 2XYIA 4ERZA 3AH8B 3OKWA 2PM6B 3RN1D 3DSMA 2XL3A 2PM9B 5HQGA 2OIZA 5CYKA 2BCJB 1ERJA 4L3HD 4L1QD 3I7KA 4A2MA 4J77A 1N6DA 3OW8A 2P9UC 3NVQA 3FM0A 4IMMA 3MKQA 3P4FA 4XYHA 2HXCA 5IJ8E 4U1EI 2OJYA 4JSNC 5IT9g 4Z8LA 4G56B 1VYHC 5EM2B 3UVOA 1SHYB 3I2NA 3L4OD 2IURA 3NVXA 4QQEA 3UVMA 4J0XA 2H9NA 5CXBB 5IC7A 4A2LA 5EAPA 1JOFA 1R5MA 3KRWB 2I3SA 3SBQA 2IUQA 5HE1B 3GREA 2H9LA 4GQ1A 4O9DA 4GMBA 4XYIA 4J86A 1U4CA 2H14A 5CYKB 3ODTA 4X3EA 4N14A 3JZHA 5C2WB 2AGZA 4FAVD 2IUVA 4GQ2P 3RRMC 2CO0A 2OVPB 2CNXA 2AGYA 3I7PA 3PSCB 5C2VB 3SXTD 3UVLA 4O3TB 2YNOA 4AEZA 3K26A 4YVDA 4ES0A 4PXWA 4E54B 4X63B 2GC7A 4ZOZA 5I5IA 4O3UB 3UVNA 3IJCA 4A09A 3MZLA 2YB8B 1B9YA 4J87A 3JPXA 3VGZA 4E5ZB 3SWSD 2OK4A 3F3PA 2AQ5A 3V5WB 4I79A 3U4YA 1S4UX 4CY1A 3C5MA 3MMYA 3W15A 4A0BA 4CI8A 1JJUB 2Z2OA 2BBKH 4BH6A 4GZ8A 3OKTA 5FKTA 3F3FA 4A0AA 5K1CC 4H5JA 5FKSA 3RLMD 3DM0A 5IGQA 3MZKA 4OZUA 4LG8A 1PGUA 3AFCA 3C99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR0 A;  4J0W A;  2QXV A;  4JT6 C;  2UZY B;  5FKQ A;  4ERQ A;  1YFQ A;  3JB9 L;  4A09 B;  2PBI B;  2CN3 A;  3DXK C;  3I8E A;  4FA9 D;  4TZ4 A;  1SQ9 A;  4JSX C;  5FA5 B;  2H6N A;  1FWX A;  4CI2 A;  3EI4 A;  1TBG A;  4H5I A;  3EI1 A;  4J8G A;  4CZV A;  3OTT A;  3L4M D;  5EMK B;  3BWS A;  4BUJ C;  2H9P A;  3V9F A;  4A0B B;  4JXM A;  4D6V A;  3EI2 A;  3N0E A;  4MK0 B;  4OWR A;  1MG2 A;  3I7O A;  4GM8 A;  4K3J B;  1N6E A;  3PXT D;  4FA4 D;  5EMJ B;  3KRX B;  4J84 A;  2B5L A;  3PSL A;  5TEF A;  4A11 A;  5B4W A;  4XEI C;  3SCY A;  2OVR B;  5FKR A;  5AJA A;  4JSV C;  4EWR A;  1NEX B;  3J81 g;  2AH0 A;  2H47 A;  2P9N C;  3PE7 A;  4O45 A;  3DXM C;  3RSE C;  3SMR A;  2XL2 A;  4CI3 A;  4CZX A;  1TYQ C;  1PI6 A;  4X61 B;  3EMH A;  1OLZ A;  5FQD A;  1L0Q A;  1OMW B;  3RFG A;  3VH0 A;  5GMK n;  1A0R B;  4L9O A;  3IJ1 A;  2B5N A;  3VA6 A;  4CY5 A;  2Q7Q A;  2CE9 A;  5FLX g;  3HFQ A;  5IJ7 E;  1P22 A;  2B4E A;  4GGD A;  3SBP A;  2AGL A;  4J73 A;  2G9A A;  4CY3 A;  4FWW A;  4ZOX A;  4FA5 D;  3V7D B;  2YNP A;  5HE3 B;  3EI2 B;  2OK6 A;  4PSX B;  4ZN4 A;  4PBZ A;  3JRO A;  1N6F A;  4UI9 R;  3ORV D;  2GC4 A;  2AGW A;  3OL2 A;  3SFZ A;  4A11 B;  4Y5R D;  3SVW D;  3JZG A;  3CIK B;  3FRX A;  1JMZ B;  3N0D A;  3EI3 A;  5GXI A;  1XHM A;  3AL8 A;  4PNK B;  3I89 A;  4GGC A;  3UR4 A;  2CE8 A;  2HES X;  1MG3 A;  4AOW A;  2P9I C;  4QL1 A;  5H14 A;  3K27 A;  2HJ4 A;  4HDJ A;  4A08 A;  5FXY A;  5AMS A;  3SHF A;  2YBA A;  4GGA A;  2PM9 A;  1B9X A;  2H68 A;  4J79 A;  4PSW B;  2IWK A;  5CXC A;  4PC0 A;  5KDO B;  5TDH B;  4FAN D;  2CO0 C;  4J8B A;  2H6K A;  5TEE A;  4JT5 C;  3OKY A;  5HYN B;  2CN2 A;  3F3G A;  3C75 H;  1GG2 B;  1Q47 A;  1QNI A;  3I8C A;  3RN0 D;  2AH1 A;  5EMM B;  5EM2 A;  4KFM B;  4QRJ A;  3EI3 B;  2Z2N A;  4GM3 A;  4ESG A;  2O9K A;  1PEV A;  5CXB A;  4J81 A;  3ZWL B;  4CZY A;  5EAM A;  3PXS D;  4FA1 D;  1RI6 A;  4LGN A;  3J80 g;  1XKS A;  3CFV A;  2HJB A;  1U2V C;  3AL9 A;  4PBY A;  4J78 A;  3PVU B;  5H1M A;  4CC9 A;  3NVN A;  5GSA A;  4FB1 D;  3E0C A;  4ERY A;  3PVW B;  5AFU 3;  4A0A B;  1GOT B;  5CXC B;  5I5M A;  3DWL C;  5THA A;  1XIP A;  3FGB A;  5EAL A;  4U7A A;  3UVK A;  3EWE A;  3BG1 A;  5GXH A;  4GQB B;  3JAM g;  3JRP A;  3OKY B;  4JSP C;  2GNQ A;  2H9M A;  2I0S A;  3EU7 A;  2I0T A;  2IWF A;  2AGX A;  4E54 A;  2IAA A;  3A0F A;  3EG6 A;  3SLE D;  3ULE C;  3B7F A;  2MTA H;  2PM7 B;  2W18 A;  5EAR A;  4E5Z A;  3EI4 B;  5IGO A;  1K8K C;  3EI1 B;  2H6Q A;  3SJL D;  1SQJ A;  4D0K A;  1GXR A;  5HE0 B;  3UKU C;  3IIW A;  4J82 A;  4K3I D;  2B5M A;  2P9S C;  4X60 B;  3CFS B;  1MDA H;  4A7J A;  2G99 A;  2YMU A;  2Z2P A;  4FHL A;  1PBY B;  4IA9 A;  5C9Z B;  3SBR A;  4Y7R A;  2OVQ B;  5JWZ A;  2HKM A;  2I0R A;  2J57 G;  2P9P C;  5SXM A;  4CY2 A;  5A2Q g;  1GP2 B;  2QC5 A;  2I3T A;  3UKR C;  4QT8 A;  3SN6 B;  3IKO A;  2UZX B;  2J56 H;  5H17 A;  3IJ0 A;  2HKR A;  5HE2 B;  4BL0 A;  4JD2 C;  4ZOV A;  2P9K C;  3I7L A;  3JZN A;  3PXW D;  1JMX B;  3MXX A;  4GM9 A;  2IUP A;  2H3X A;  3RFH A;  2H13 A;  4CI1 A;  3MKS B;  2EBS A;  5EML B;  1K32 A;  3OL2 B;  3I7H A;  2HYE A;  4L3G D;  4ZOY A;  2J55 H;  2XU7 A;  3GFC A;  4O1Q D;  2YNN A;  3I7N A;  4NSX A;  3AL8 B;  3RMZ D;  5TF2 A;  5K19 A;  5I5J A;  2TRC B;  3IIY A;  2P9L C;  3BG0 A;  4A08 B;  3C9C A;  4R7A B;  4LG9 A;  2XYI A;  4ERZ A;  3AH8 B;  3OKW A;  2PM6 B;  3RN1 D;  3DSM A;  2XL3 A;  2PM9 B;  5HQG A;  2OIZ A;  5CYK A;  2BCJ B;  1ERJ A;  4L3H D;  4L1Q D;  3I7K A;  4A2M A;  4J77 A;  1N6D A;  3OW8 A;  2P9U C;  3NVQ A;  3FM0 A;  4IMM A;  3MKQ A;  3P4F A;  4XYH A;  2HXC A;  5IJ8 E;  4U1E I;  2OJY A;  4JSN C;  5IT9 g;  4Z8L A;  4G56 B;  1VYH C;  5EM2 B;  3UVO A;  1SHY B;  3I2N A;  3L4O D;  2IUR A;  3NVX A;  4QQE A;  3UVM A;  4J0X A;  2H9N A;  5CXB B;  5IC7 A;  4A2L A;  5EAP A;  1JOF A;  1R5M A;  3KRW B;  2I3S A;  3SBQ A;  2IUQ A;  5HE1 B;  3GRE A;  2H9L A;  4GQ1 A;  4O9D A;  4GMB A;  4XYI A;  4J86 A;  1U4C A;  2H14 A;  5CYK B;  3ODT A;  4X3E A;  4N14 A;  3JZH A;  5C2W B;  2AGZ A;  4FAV D;  2IUV A;  4GQ2 P;  3RRM C;  2CO0 A;  2OVP B;  2CNX A;  2AGY A;  3I7P A;  3PSC B;  5C2V B;  3SXT D;  3UVL A;  4O3T B;  2YNO A;  4AEZ A;  3K26 A;  4YVD A;  4ES0 A;  4PXW A;  4E54 B;  4X63 B;  2GC7 A;  4ZOZ A;  5I5I A;  4O3U B;  3UVN A;  3IJC A;  4A09 A;  3MZL A;  2YB8 B;  1B9Y A;  4J87 A;  3JPX A;  3VGZ A;  4E5Z B;  3SWS D;  2OK4 A;  3F3P A;  2AQ5 A;  3V5W B;  4I79 A;  3U4Y A;  1S4U X;  4CY1 A;  3C5M A;  3MMY A;  3W15 A;  4A0B A;  4CI8 A;  1JJU B;  2Z2O A;  2BBK H;  4BH6 A;  4GZ8 A;  3OKT A;  5FKT A;  3F3F A;  4A0A A;  5K1C C;  4H5J A;  5FKS A;  3RLM D;  3DM0 A;  5IGQ A;  3MZK A;  4OZU A;  4LG8 A;  1PGU A;  3AFC A;  3C99 A; 
#chains in the Genus database with same CATH topology
 1NR0 A;  4O02 A;  4J0W A;  2QXV A;  4JT6 C;  2UZY B;  5FKQ A;  4ERQ A;  1YFQ A;  3JB9 L;  4A09 B;  3IUM A;  2PBI B;  1GOG A;  2CN3 A;  3EQ8 A;  3DXK C;  3I8E A;  4FA9 D;  1K3I A;  4TZ4 A;  1SQ9 A;  4JSX C;  5FA5 B;  2H6N A;  1FWX A;  4CI2 A;  3EI4 A;  1TBG A;  4H5I A;  3EI1 A;  4J8G A;  4CZV A;  3OTT A;  3L4M D;  5EMK B;  3BWS A;  4BUJ C;  2H9P A;  3V9F A;  4A0B B;  4JXM A;  4D6V A;  5C86 A;  5HDB A;  3N0E A;  4MK0 B;  3EI2 A;  4OWR A;  1MG2 A;  3I7O A;  4GM8 A;  4K3J B;  1N6E A;  3PXT D;  4FA4 D;  5EMJ B;  4BP9 A;  3KRX B;  4J84 A;  2B5L A;  3PSL A;  5TEF A;  4A11 A;  5B4W A;  4XEI C;  3SCY A;  2OVR B;  5FKR A;  5AJA A;  4JSV C;  4EWR A;  1NEX B;  3J81 g;  1H2Z A;  2AH0 A;  2H47 A;  2P9N C;  3PE7 A;  4O45 A;  3DXM C;  3RSE C;  3SMR A;  2HU8 A;  4DNW A;  2XL2 A;  2EIB A;  3O4J A;  4CI3 A;  4AN0 A;  4CZX A;  1TYQ C;  1PI6 A;  1E8N A;  4X61 B;  3EMH A;  1OLZ A;  5FQD A;  1TYE A;  4IRZ A;  1E5T A;  1L0Q A;  3IJE A;  1OMW B;  3RFG A;  3VH0 A;  5GMK n;  1H2W A;  1A0R B;  4L9O A;  3IJ1 A;  2B5N A;  3ZDX A;  2VDL A;  3VA6 A;  4CY5 A;  2Q7Q A;  4WJK A;  3O4I A;  2CE9 A;  5FLX g;  3HFQ A;  5IJ7 E;  1P22 A;  2B4E A;  4GGD A;  3SBP A;  1O6G A;  1QFM A;  2AGL A;  4J73 A;  2G9A A;  4CY3 A;  4FWW A;  1YR2 A;  4ZOX A;  4NBM A;  4WK2 A;  4FA5 D;  1VE7 A;  3V7D B;  3GD1 I;  2YNP A;  1C9I A;  5HE3 B;  3EI2 B;  2OK6 A;  4PSX B;  4ZN4 A;  4PBZ A;  3JRO A;  1N6F A;  4UI9 R;  3ORV D;  2GC4 A;  2AGW A;  3FCS A;  3OL2 A;  3SFZ A;  4A11 B;  4Y5R D;  2HU7 A;  3SVW D;  3JZG A;  3CIK B;  3FRX A;  1JMZ B;  3N0D A;  1VZ2 A;  5FFO A;  3EI3 A;  5GXI A;  3QI0 A;  2XDW A;  1XHM A;  3AL8 A;  4PNK B;  3I89 A;  4GGC A;  1UTC A;  3UR4 A;  5FFG A;  2CE8 A;  2HES X;  1MG3 A;  4AOW A;  2P9I C;  4QL1 A;  5H14 A;  3K27 A;  2HJ4 A;  4HDJ A;  4WK0 A;  5FXY A;  5AMS A;  4A08 A;  3SHF A;  2YBA A;  4AN1 A;  4GGA A;  1UOQ A;  2JKX A;  2PM9 A;  1B9X A;  3GC3 B;  4QAM A;  3T3M A;  2H68 A;  4J79 A;  4PSW B;  2IWK A;  5CXC A;  1O6F A;  4PC0 A;  5KDO B;  5TDH B;  4FAN D;  2CO0 C;  4J8B A;  2H6K A;  5TEE A;  4JT5 C;  3OKY A;  5HYN B;  2CN2 A;  3F3G A;  3C75 H;  1GG2 B;  1Q47 A;  1QNI A;  3I8C A;  3O4H A;  1QFS A;  3RN0 D;  2AH1 A;  1GOH A;  5EMM B;  1GOF A;  5EM2 A;  4KFM B;  4QRJ A;  3EI3 B;  2Z2N A;  4GM3 A;  5E6R A;  4ESG A;  2O9K A;  1PEV A;  5CXB A;  4J81 A;  3ZWL B;  4CZY A;  1JTD B;  5EAM A;  3PXS D;  4FA1 D;  1RI6 A;  4LGN A;  3J80 g;  1XKS A;  3CFV A;  3NIF A;  2HJB A;  1U2V C;  1VE6 A;  3AL9 A;  4PBY A;  4DNV A;  4J78 A;  3KCI A;  3PVU B;  5H1M A;  4CC9 A;  3NVN A;  5GSA A;  4FB1 D;  3E0C A;  4O2W A;  4ERY A;  3PVW B;  5AFU 3;  5M5S A;  4A0A B;  1GOT B;  5CXC B;  5I5M A;  3DWL C;  3EQ7 A;  5THA A;  1U8C A;  1XIP A;  3FGB A;  5EAL A;  4U7A A;  3UVK A;  3EWE A;  4MMY A;  3BG1 A;  5GXH A;  4GQB B;  3JAM g;  3JRP A;  3OKY B;  4JSP C;  1I2M B;  2GNQ A;  2H9M A;  2I0S A;  3EU7 A;  2I0T A;  2IWF A;  2AGX A;  4E54 A;  3ZE2 A;  4UM9 A;  2VZ3 A;  2IAA A;  2HU5 A;  3A0F A;  3EG6 A;  3SLE D;  4G1M A;  3ULE C;  4MMZ A;  2VC2 A;  3B7F A;  2MTA H;  4AX4 A;  2PM7 B;  2W18 A;  3V4V A;  5EAR A;  3ZDY A;  4WK4 A;  4E5Z A;  3EI4 B;  5IGO A;  1K8K C;  3EI1 B;  2H6Q A;  3SJL D;  1SQJ A;  4D0K A;  1GXR A;  5HE0 B;  3UKU C;  3IIW A;  4J82 A;  4K3I D;  2B5M A;  2P9S C;  4X60 B;  4D9S A;  3CFS B;  1MDA H;  4A7J A;  2G99 A;  1M1X A;  3K71 A;  2YMU A;  1JV2 A;  2VDO A;  2Z2P A;  4FHL A;  2XE4 A;  1PBY B;  4IA9 A;  2VDQ A;  3NID A;  5C9Z B;  3SBR A;  4Y7R A;  2OVQ B;  5JWZ A;  2VZ1 A;  3MVD K;  5M61 A;  2HKM A;  2I0R A;  2J57 G;  2P9P C;  5SXM A;  4CY2 A;  5A2Q g;  1GP2 B;  2QC5 A;  2I3T A;  3UKR C;  4QT8 A;  4MMX A;  5M5T A;  3SN6 B;  3IKO A;  3OF7 A;  3ZE1 A;  2UZX B;  2J56 H;  5H17 A;  3IJ0 A;  1E8M A;  2HKR A;  5HE2 B;  5M5U A;  4BL0 A;  4JD2 C;  4ZOV A;  2P9K C;  3I7L A;  3JZN A;  3PXW D;  4RE6 A;  1JMX B;  5M5V A;  3MXX A;  3VI4 A;  4GM9 A;  4BCB A;  2IUP A;  2VDP A;  2H3X A;  3RFH A;  2H13 A;  4CI1 A;  3MKS B;  2EBS A;  5EML B;  1K32 A;  3OL2 B;  3I7H A;  2HYE A;  4L3G D;  4ZOY A;  2J55 H;  2XU7 A;  3GFC A;  4O1Q D;  2YNN A;  3I7N A;  4NSX A;  3AL8 B;  3RMZ D;  5TF2 A;  5K19 A;  5I5J A;  2TRC B;  2VDM A;  1BPO A;  2QR5 A;  3IIY A;  2P9L C;  2VDN A;  3BG0 A;  4AMZ A;  4A08 B;  2EIC A;  3C9C A;  4R7A B;  2XYI A;  1UOO A;  4LG9 A;  4ERZ A;  3DDU A;  3AH8 B;  3OKW A;  2PM6 B;  5E6S A;  3RN1 D;  3DSM A;  2XL3 A;  2PM9 B;  5HQG A;  2OIZ A;  1UOP A;  5CYK A;  2BCJ B;  1ERJ A;  4L1Q D;  4L3H D;  3I7K A;  4A2M A;  4J77 A;  1N6D A;  3OW8 A;  2P9U C;  3MUO A;  3NVQ A;  3FM0 A;  4IMM A;  3MKQ A;  3IUN A;  3P4F A;  1L5G A;  4XYH A;  2VDR A;  3VI3 A;  2HXC A;  5IJ8 E;  4U1E I;  3MUN A;  4Z7Q A;  2OJY A;  4JSN C;  5IT9 g;  4NC4 A;  4Z8L A;  1H2X A;  4G56 B;  1VYH C;  5EM2 B;  3UVO A;  1SHY B;  3I2N A;  3L4O D;  2IUR A;  3NVX A;  4QQE A;  3UVM A;  4J0X A;  2H9N A;  5CXB B;  5IC7 A;  4A2L A;  5EAP A;  1JOF A;  1R5M A;  3KRW B;  2I3S A;  3SBQ A;  4G55 A;  2VDK A;  2IUQ A;  5HE1 B;  2QZP A;  3GRE A;  3IUL A;  2H9L A;  4GQ1 A;  3IUJ A;  4O9D A;  4GMB A;  4XYI A;  4J86 A;  1U4C A;  2H14 A;  5CYK B;  3ODT A;  4X3E A;  4N14 A;  3JZH A;  5C2W B;  2AGZ A;  4FAV D;  2IUV A;  4GQ2 P;  4JHN A;  3RRM C;  3QHY B;  2CO0 A;  2OVP B;  4BP8 A;  2CNX A;  2AGY A;  3I7P A;  3PSC B;  4Z7N A;  4BCC A;  5C2V B;  4NAA A;  3SXT D;  5E6U A;  3UVL A;  4O3T B;  2EIE A;  2YNO A;  3V4P A;  4BCD A;  4L1M A;  4AEZ A;  3O4G A;  1T2X A;  4Z7O A;  3IUR A;  1A12 A;  3ZE0 A;  3K26 A;  4AMY A;  4DNU A;  4YVD A;  4ES0 A;  4PXW A;  4E54 B;  3IUQ A;  4X63 B;  5C92 A;  2GC7 A;  4UM8 A;  4ZOZ A;  5I5I A;  4O3U B;  3UVN A;  3IJC A;  4A09 A;  3MZL A;  3ZDZ A;  2YB8 B;  1B9Y A;  3K6S A;  4J87 A;  3JPX A;  4G1E A;  2BKL A;  3VGZ A;  4E5Z B;  3SWS D;  2OK4 A;  3EQ9 A;  3F3P A;  2AQ5 A;  3V5W B;  4I79 A;  3U4Y A;  1VZ3 A;  1S4U X;  4CY1 A;  3C5M A;  3MMY A;  3FCU A;  4JHP C;  3W15 A;  2XZG A;  4A0B A;  4CI8 A;  1H2Y A;  1JJU B;  2Z2O A;  2BBK H;  3T3P A;  4BH6 A;  1C9L A;  4GZ8 A;  3OKT A;  5FKT A;  3F3F A;  4A0A A;  4NEN A;  5K1C C;  4H5J A;  5FKS A;  3K72 A;  3RLM D;  3NIG A;  3DM0 A;  5IGQ A;  3IVM A;  3MZK A;  2WQ8 A;  2EID A;  4OZU A;  4RE5 A;  5M5R A;  4LG8 A;  1PGU A;  3AFC A;  3C99 A; 
#chains in the Genus database with same CATH homology
 1NR0 A;  4J0W A;  2QXV A;  4JT6 C;  2UZY B;  5FKQ A;  4ERQ A;  1YFQ A;  3JB9 L;  4A09 B;  2PBI B;  2CN3 A;  3DXK C;  3I8E A;  4FA9 D;  4TZ4 A;  1SQ9 A;  4JSX C;  5FA5 B;  2H6N A;  1FWX A;  4CI2 A;  3EI4 A;  1TBG A;  4H5I A;  3EI1 A;  4J8G A;  4CZV A;  3OTT A;  3L4M D;  5EMK B;  3BWS A;  4BUJ C;  2H9P A;  3V9F A;  4A0B B;  4JXM A;  4D6V A;  3EI2 A;  3N0E A;  4MK0 B;  4OWR A;  1MG2 A;  3I7O A;  4GM8 A;  4K3J B;  1N6E A;  3PXT D;  4FA4 D;  5EMJ B;  3KRX B;  4J84 A;  2B5L A;  3PSL A;  5TEF A;  4A11 A;  5B4W A;  4XEI C;  3SCY A;  2OVR B;  5FKR A;  5AJA A;  4JSV C;  4EWR A;  1NEX B;  3J81 g;  2AH0 A;  2H47 A;  2P9N C;  3PE7 A;  4O45 A;  3DXM C;  3RSE C;  3SMR A;  2XL2 A;  4CI3 A;  4CZX A;  1TYQ C;  1PI6 A;  4X61 B;  3EMH A;  1OLZ A;  5FQD A;  1L0Q A;  1OMW B;  3RFG A;  3VH0 A;  5GMK n;  1A0R B;  4L9O A;  3IJ1 A;  2B5N A;  3VA6 A;  4CY5 A;  2Q7Q A;  2CE9 A;  5FLX g;  3HFQ A;  5IJ7 E;  1P22 A;  2B4E A;  4GGD A;  3SBP A;  2AGL A;  4J73 A;  2G9A A;  4CY3 A;  4FWW A;  4ZOX A;  4FA5 D;  3V7D B;  2YNP A;  5HE3 B;  3EI2 B;  2OK6 A;  4PSX B;  4ZN4 A;  4PBZ A;  3JRO A;  1N6F A;  4UI9 R;  3ORV D;  2GC4 A;  2AGW A;  3OL2 A;  3SFZ A;  4A11 B;  4Y5R D;  3SVW D;  3JZG A;  3CIK B;  3FRX A;  1JMZ B;  3N0D A;  3EI3 A;  5GXI A;  1XHM A;  3AL8 A;  4PNK B;  3I89 A;  4GGC A;  3UR4 A;  2CE8 A;  2HES X;  1MG3 A;  4AOW A;  2P9I C;  4QL1 A;  5H14 A;  3K27 A;  2HJ4 A;  4HDJ A;  4A08 A;  5FXY A;  5AMS A;  3SHF A;  2YBA A;  4GGA A;  2PM9 A;  1B9X A;  2H68 A;  4J79 A;  4PSW B;  2IWK A;  5CXC A;  4PC0 A;  5KDO B;  5TDH B;  4FAN D;  2CO0 C;  4J8B A;  2H6K A;  5TEE A;  4JT5 C;  3OKY A;  5HYN B;  2CN2 A;  3F3G A;  3C75 H;  1GG2 B;  1Q47 A;  1QNI A;  3I8C A;  3RN0 D;  2AH1 A;  5EMM B;  5EM2 A;  4KFM B;  4QRJ A;  3EI3 B;  2Z2N A;  4GM3 A;  4ESG A;  2O9K A;  1PEV A;  5CXB A;  4J81 A;  3ZWL B;  4CZY A;  5EAM A;  3PXS D;  4FA1 D;  1RI6 A;  4LGN A;  3J80 g;  1XKS A;  3CFV A;  2HJB A;  1U2V C;  3AL9 A;  4PBY A;  4J78 A;  3PVU B;  5H1M A;  4CC9 A;  3NVN A;  5GSA A;  4FB1 D;  3E0C A;  4ERY A;  3PVW B;  5AFU 3;  4A0A B;  1GOT B;  5CXC B;  5I5M A;  3DWL C;  5THA A;  1XIP A;  3FGB A;  5EAL A;  4U7A A;  3UVK A;  3EWE A;  3BG1 A;  5GXH A;  4GQB B;  3JAM g;  3JRP A;  3OKY B;  4JSP C;  2GNQ A;  2H9M A;  2I0S A;  3EU7 A;  2I0T A;  2IWF A;  2AGX A;  4E54 A;  2IAA A;  3A0F A;  3EG6 A;  3SLE D;  3ULE C;  3B7F A;  2MTA H;  2PM7 B;  2W18 A;  5EAR A;  4E5Z A;  3EI4 B;  5IGO A;  1K8K C;  3EI1 B;  2H6Q A;  3SJL D;  1SQJ A;  4D0K A;  1GXR A;  5HE0 B;  3UKU C;  3IIW A;  4J82 A;  4K3I D;  2B5M A;  2P9S C;  4X60 B;  3CFS B;  1MDA H;  4A7J A;  2G99 A;  2YMU A;  2Z2P A;  4FHL A;  1PBY B;  4IA9 A;  5C9Z B;  3SBR A;  4Y7R A;  2OVQ B;  5JWZ A;  2HKM A;  2I0R A;  2J57 G;  2P9P C;  5SXM A;  4CY2 A;  5A2Q g;  1GP2 B;  2QC5 A;  2I3T A;  3UKR C;  4QT8 A;  3SN6 B;  3IKO A;  2UZX B;  2J56 H;  5H17 A;  3IJ0 A;  2HKR A;  5HE2 B;  4BL0 A;  4JD2 C;  4ZOV A;  2P9K C;  3I7L A;  3JZN A;  3PXW D;  1JMX B;  3MXX A;  4GM9 A;  2IUP A;  2H3X A;  3RFH A;  2H13 A;  4CI1 A;  3MKS B;  2EBS A;  5EML B;  1K32 A;  3OL2 B;  3I7H A;  2HYE A;  4L3G D;  4ZOY A;  2J55 H;  2XU7 A;  3GFC A;  4O1Q D;  2YNN A;  3I7N A;  4NSX A;  3AL8 B;  3RMZ D;  5TF2 A;  5K19 A;  5I5J A;  2TRC B;  3IIY A;  2P9L C;  3BG0 A;  4A08 B;  3C9C A;  4R7A B;  4LG9 A;  2XYI A;  4ERZ A;  3AH8 B;  3OKW A;  2PM6 B;  3RN1 D;  3DSM A;  2XL3 A;  2PM9 B;  5HQG A;  2OIZ A;  5CYK A;  2BCJ B;  1ERJ A;  4L3H D;  4L1Q D;  3I7K A;  4A2M A;  4J77 A;  1N6D A;  3OW8 A;  2P9U C;  3NVQ A;  3FM0 A;  4IMM A;  3MKQ A;  3P4F A;  4XYH A;  2HXC A;  5IJ8 E;  4U1E I;  2OJY A;  4JSN C;  5IT9 g;  4Z8L A;  4G56 B;  1VYH C;  5EM2 B;  3UVO A;  1SHY B;  3I2N A;  3L4O D;  2IUR A;  3NVX A;  4QQE A;  3UVM A;  4J0X A;  2H9N A;  5CXB B;  5IC7 A;  4A2L A;  5EAP A;  1JOF A;  1R5M A;  3KRW B;  2I3S A;  3SBQ A;  2IUQ A;  5HE1 B;  3GRE A;  2H9L A;  4GQ1 A;  4O9D A;  4GMB A;  4XYI A;  4J86 A;  1U4C A;  2H14 A;  5CYK B;  3ODT A;  4X3E A;  4N14 A;  3JZH A;  5C2W B;  2AGZ A;  4FAV D;  2IUV A;  4GQ2 P;  3RRM C;  2CO0 A;  2OVP B;  2CNX A;  2AGY A;  3I7P A;  3PSC B;  5C2V B;  3SXT D;  3UVL A;  4O3T B;  2YNO A;  4AEZ A;  3K26 A;  4YVD A;  4ES0 A;  4PXW A;  4E54 B;  4X63 B;  2GC7 A;  4ZOZ A;  5I5I A;  4O3U B;  3UVN A;  3IJC A;  4A09 A;  3MZL A;  2YB8 B;  1B9Y A;  4J87 A;  3JPX A;  3VGZ A;  4E5Z B;  3SWS D;  2OK4 A;  3F3P A;  2AQ5 A;  3V5W B;  4I79 A;  3U4Y A;  1S4U X;  4CY1 A;  3C5M A;  3MMY A;  3W15 A;  4A0B A;  4CI8 A;  1JJU B;  2Z2O A;  2BBK H;  4BH6 A;  4GZ8 A;  3OKT A;  5FKT A;  3F3F A;  4A0A A;  5K1C C;  4H5J A;  5FKS A;  3RLM D;  3DM0 A;  5IGQ A;  3MZK A;  4OZU A;  4LG8 A;  1PGU A;  3AFC A;  3C99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...