1JMZB

Crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida with inhibitor
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
346
structure length
339
Chain Sequence
GPALKAGHEYMIVTNYPNNLHVVDVASDTVYKSCVMPDKFGPGTAMMAPDNRTAYVLNNHYGDIYGIDLDTCKNTFHANLSSVPGEVGRSMYSFAISPDGKEVYATVNPTQRLNDHYVVKPPRLEVFSTADGLEAKPVRTFPMPRQVYLMRAADDGSLYVAGPDIYKMDVKTGKYTVALPLRNWNRKGYSAPDVLYFWPHQSPRHEFSMLYTIARFATADLLYGYLSVDLKTGKTHTQEFADLTELYFTGLRSPKDPNQIYGVLNRLAKYDLKQRKLIKAANLDHTYYCVAFDKKGDKLYLGGTFNDLAVFNPDTLEKVKNIKLPGGDMSTTTPQVFIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amine Dehydrogenase
publication title Crystal structure of quinohemoprotein amine dehydrogenase from Pseudomonas putida. Identification of a novel quinone cofactor encaged by multiple thioether cross-bridges.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 86
structure length 339
sequence length 346
ec nomenclature
pdb deposition date 2001-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1jmzB00
3EU7A 3W15A 4GM9A 2YBAA 4J84A 2HYEA 2B4EA 2HESX 1JOFA 4JD2C 4CI1A 2IAAA 5EAMA 4A0BA 1JMZB 3RFGA 3RMZD 2OVQB 4BL0A 5FXYA 5TDHB 5EM2B 3V9FA 5C9ZB 3SBRA 3MZKA 3MMYA 5I5JA 4FAND 3OKYA 2QXVA 3BG0A 2H13A 4J87A 4H5IA 5CYKA 4A0BB 1YFQA 4FB1D 1FWXA 4PXWA 2OK6A 1PGUA 4NSXA 3EI2B 1XHMA 2H14A 2YNNA 3BG1A 3IIWA 5EMJB 3VGZA 4E54A 1GOTB 3FRXA 3JZNA 1A0RB 4ZOVA 3OKYB 3PVUB 2H9NA 4FHLA 2OVRB 4L3GD 3PXSD 2XL2A 4G56B 5CYKB 4D0KA 3C75H 4OZUA 4ZOXA 4A11A 1SHYB 3NVQA 3I8EA 5TEEA 3OKWA 4E54B 3SJLD 3SBPA 5K1CC 3F3PA 4GMBA 1N6DA 4JSNC 5FKSA 2XU7A 3V5WB 5H17A 4CY2A 4K3JB 5A2Qg 4J0WA 3BWSA 5C2WB 4A11B 5GMKn 2H6QA 2B5MA 4QQEA 3V7DB 2I0SA 4ZOYA 1S4UX 5AJAA 4A09A 5I5MA 4J0XA 4J73A 2H68A 3PXWD 3AFCA 3EG6A 4BH6A 5EMKB 1JMXB 4GQ2P 3RLMD 2AH0A 4CI3A 1TBGA 2XL3A 4CZXA 1RI6A 4JSPC 4ERYA 4J8BA 2OJYA 4A09B 4L1QD 4KFMB 3RN1D 4L3HD 4FA1D 2J55H 5KDOB 3RFHA 2I3TA 4MK0B 1OMWB 2H47A 2GC7A 5JWZA 3J81g 4OWRA 2B5NA 3SXTD 5HQGA 3AL8B 3SWSD 3SCYA 3I7OA 4JT6C 2O9KA 3DSMA 4J77A 5IGOA 5HE0B 4CY5A 2W18A 3JRPA 4AEZA 3SN6B 3I7LA 4D6VA 5EMMB 4GM3A 3U4YA 1K32A 5HYNB 3EI2A 2AGLA 5GSAA 5IGQA 1OLZA 2PM9B 4PNKB 3J80g 4CC9A 3SBQA 2P9LC 4J81A 5FLXg 1MDAH 4FAVD 4CZVA 2YMUA 3JB9L 4PC0A 4Y5RD 1GG2B 2YNOA 5FQDA 4PBZA 2Z2NA 2CE9A 4X60B 3N0EA 4GGAA 5IJ8E 4FWWA 1NEXB 3KRXB 3RRMC 1U2VC 2IWKA 3AL9A 3RN0D 3P4FA 2OIZA 3PE7A 3E0CA 4PSWB 4TZ4A 4J82A 1QNIA 4ES0A 5I5IA 4J86A 4ERQA 3NVNA 3OL2A 4A2LA 4UI9R 3SFZA 3K26A 5IT9g 4A0AB 2P9UC 2PM6B 4L9OA 3DM0A 4LG9A 3RSEC 3I7KA 3UVKA 3I7HA 2HXCA 4Z8LA 5HE1B 2AGWA 3L4MD 4CI8A 2CO0A 4GQBB 1MG3A 2G99A 4FA4D 3OTTA 4E5ZA 4XYIA 5EAPA 3OL2B 4R7AB 4EWRA 4PSXB 3L4OD 3UVOA 3C5MA 3IJCA 2H3XA 4J79A 1N6FA 5GXHA 4CY1A 2HJ4A 3F3GA 4X3EA 3JPXA 2TRCB 4U7AA 4E5ZB 4O1QD 3SMRA 4GGCA 3AL8A 4ZOZA 4GZ8A 2P9NC 4YVDA 3UVNA 2HJBA 3IKOA 4QT8A 2Q7QA 3I8CA 3ZWLB 3KRWB 2I3SA 2HKRA 4CZYA 2PM7B 2PBIB 2UZYB 5EALA 2CO0C 3VA6A 1U4CA 1SQJA 2PM9A 1B9XA 3ODTA 4LG8A 2CNXA 5FKQA 1TYQC 4JT5C 1PBYB 3I7NA 3UVMA 4A7JA 5C2VB 4GQ1A 5IC7A 3DWLC 3EWEA 3N0DA 3I7PA 2AGYA 4O3UB 5FKRA 4I79A 4HDJA 4XEIC 3EMHA 4O9DA 1P22A 2P9IC 2BBKH 3PSLA 2P9SC 3JROA 3AH8B 2H9LA 3EI3A 5K19A 4A08B 3CIKB 2IUVA 3JAMg 2H6NA 4GM8A 3FM0A 2Z2PA 2GNQA 4ZN4A 3MXXA 4Y7RA 1K8KC 3SHFA 4A0AA 3MKSB 5EMLB 2Z2OA 2J57G 3EI3B 4JXMA 5IJ7E 2GC4A 3NVXA 1MG2A 4IA9A 5H14A 3OW8A 4PBYA 4BUJC 3PXTD 3UR4A 2EBSA 3IJ0A 1VYHC 3DXMC 1XIPA 5SXMA 4CI2A 2XYIA 4O3TB 3CFSB 3UKRC 5GXIA 1GP2B 4GGDA 1PI6A 2G9AA 4XYHA 4FA5D 2H9MA 1Q47A 1N6EA 2YB8B 3SLED 1PEVA 4FA9D 2AGXA 5TEFA 3A0FA 1GXRA 1XKSA 2HKMA 2IWFA 4IMMA 3C99A 4QRJA 2UZXB 1ERJA 2AH1A 2IUPA 4U1EI 2AGZA 3EI4A 1NR0A 3IJ1A 3OKTA 3HFQA 3JZHA 4X61B 3I2NA 2OK4A 5CXBA 5TF2A 2I0TA 5AMSA 4ERZA 2P9PC 2I0RA 4CY3A 3C9CA 2P9KC 2IURA 3I89A 3JZGA 4J8GA 5H1MA 4H5JA 4ESGA 2CN2A 3ULEC 1R5MA 2AQ5A 2YNPA 3GFCA 2CE8A 5FA5B 3SVWD 2B5LA 2CN3A 3EI4B 4QL1A 5B4WA 1B9YA 4X63B 3FGBA 5CXBB 2IUQA 3UVLA 1SQ9A 5AFU3 3ORVD 4J78A 3VH0A 1JJUB 5CXCA 3K27A 2OVPB 5HE2B 4N14A 3UKUC 3PVWB 3PSCB 2QC5A 3EI1A 5HE3B 5THAA 5FKTA 2J56H 3DXKC 4JSXC 4JSVC 2H9PA 3CFVA 4A2MA 4A08A 4K3ID 1L0QA 4O45A 3IIYA 2BCJB 2H6KA 5CXCB 4LGNA 5EARA 4AOWA 3EI1B 3F3FA 2MTAH 5EM2A 3GREA 3MZLA 3MKQA 3B7FA
chains in the Genus database with same CATH superfamily
3EU7A 3W15A 4GM9A 2YBAA 2QZPA 4J84A 2HYEA 2B4EA 3IUMA 2HESX 1JOFA 4JD2C 1M1XA 2VDLA 4CI1A 2IAAA 5EAMA 1I2MB 4A0BA 1JMZB 3RFGA 3RMZD 2OVQB 4DNWA 4BL0A 3QHYB 4WK4A 5FXYA 5TDHB 5EM2B 4JHPC 3ZDYA 3V9FA 5C9ZB 3SBRA 3MZKA 3MMYA 5I5JA 4FAND 3OKYA 2QXVA 4G1EA 2VDMA 3BG0A 5M5RA 3IJEA 2H13A 4J87A 4H5IA 5CYKA 4A0BB 1YFQA 3K72A 4FB1D 1E8NA 1FWXA 4PXWA 3T3MA 3MVDK 2OK6A 1PGUA 4NSXA 3EI2B 4O2WA 1XHMA 2H14A 2YNNA 3BG1A 3IIWA 5EMJB 2EIEA 3VGZA 4E54A 1GOTB 3FRXA 3JZNA 1A0RB 4ZOVA 3OKYB 3V4VA 3PVUB 2H9NA 4FHLA 4RE6A 2OVRB 1VZ3A 4L3GD 3PXSD 2XL2A 4G56B 5CYKB 4D0KA 3C75H 4OZUA 4ZOXA 4A11A 1SHYB 3NVQA 3I8EA 3GC3B 5TEEA 3OKWA 4E54B 3SJLD 3SBPA 3GD1I 3F3PA 5K1CC 4GMBA 3NIGA 1N6DA 4JSNC 5FKSA 2XU7A 3V5WB 1H2YA 5H17A 4CY2A 1UOPA 1UTCA 4K3JB 5A2Qg 4J0WA 3BWSA 5C2WB 4A11B 5GMKn 2H6QA 2B5MA 4QQEA 1VZ2A 3V7DB 2I0SA 5E6RA 4ZOYA 1S4UX 5AJAA 4A09A 5I5MA 4J0XA 1C9LA 1YR2A 4J73A 2H68A 2EIDA 3PXWD 3AFCA 3EG6A 4BH6A 4AMZA 5EMKB 1JMXB 4GQ2P 3RLMD 2AH0A 4CI3A 1TBGA 4NAAA 2XL3A 4CZXA 1RI6A 4JSPC 4ERYA 4J8BA 2OJYA 3NIFA 4A09B 4L1QD 4KFMB 5HDBA 3RN1D 4L3HD 4FA1D 2J55H 5KDOB 3IURA 3RFHA 2I3TA 4MK0B 1OMWB 1VE6A 2H47A 1GOFA 3O4IA 2GC7A 5M5VA 3VI3A 5JWZA 3J81g 3ZE1A 4OWRA 2B5NA 3SXTD 5HQGA 1JTDB 3AL8B 3SWSD 3SCYA 3I7OA 4JT6C 3FCUA 4BCDA 1TYEA 2O9KA 2BKLA 4AN1A 3DSMA 2XZGA 4BP9A 4J77A 5IGOA 5HE0B 3V4PA 3EQ8A 4CY5A 2EICA 2W18A 4DNVA 3JRPA 3IUJA 4AEZA 5M5UA 3SN6B 3I7LA 4D6VA 5EMMB 4GM3A 3U4YA 1K32A 5HYNB 3EI2A 1K3IA 2AGLA 5GSAA 5IGQA 1OLZA 2PM9B 4PNKB 3J80g 1BPOA 4CC9A 3SBQA 2P9LC 1O6GA 4J81A 5FLXg 5E6UA 1MDAH 4FAVD 4CZVA 2YMUA 4MMXA 4UM9A 3JB9L 4PC0A 4Y5RD 1GG2B 2HU8A 3O4JA 1H2WA 2WQ8A 4MMYA 2YNOA 5FQDA 2VZ1A 4PBZA 2VDKA 2Z2NA 4NC4A 5M5TA 2CE9A 4X60B 3N0EA 4GGAA 5IJ8E 4FWWA 1NEXB 3KRXB 3RRMC 1U2VC 2IWKA 3AL9A 3RN0D 3DDUA 2EIBA 1H2XA 3P4FA 2OIZA 3EQ9A 5C86A 3PE7A 3E0CA 4PSWB 5M61A 4TZ4A 4J82A 1UOQA 4AX4A 1QNIA 4ES0A 5I5IA 3EQ7A 1C9IA 4J86A 4ERQA 3NVNA 1UOOA 3OL2A 4A2LA 4UI9R 3SFZA 3K26A 5IT9g 4A0AB 3T3PA 2P9UC 2PM6B 4L9OA 4RE5A 3DM0A 4LG9A 2VDOA 1E8MA 3RSEC 2VZ3A 3I7KA 3UVKA 3I7HA 2HXCA 4Z8LA 5HE1B 2AGWA 3L4MD 4CI8A 2CO0A 4GQBB 1MG3A 2G99A 4FA4D 3OTTA 4E5ZA 4L1MA 4XYIA 5EAPA 3OL2B 4R7AB 4EWRA 4PSXB 2HU5A 3L4OD 3UVOA 3C5MA 3IJCA 2H3XA 3MUOA 4J79A 1N6FA 5GXHA 2JKXA 5C92A 4CY1A 2HJ4A 3F3GA 4X3EA 3JPXA 1JV2A 2TRCB 4U7AA 3ZDZA 4E5ZB 4O1QD 3SMRA 1GOHA 3FCSA 4GGCA 3AL8A 4ZOZA 4GZ8A 3O4GA 4QAMA 2P9NC 5E6SA 4YVDA 3UVNA 2HJBA 3IKOA 4QT8A 2Q7QA 3I8CA 3ZWLB 3KRWB 2I3SA 2HKRA 2VDRA 4CZYA 2PM7B 2PBIB 2UZYB 5EALA 2CO0C 3VA6A 1U4CA 1SQJA 2PM9A 1B9XA 3ODTA 4LG8A 2CNXA 5FKQA 1TYQC 4JT5C 4IRZA 3IVMA 3O4HA 1PBYB 3I7NA 3UVMA 4A7JA 5C2VB 4GQ1A 5IC7A 1GOGA 3DWLC 3EWEA 3N0DA 3I7PA 2AGYA 4G1MA 4MMZA 4O3UB 5FKRA 4G55A 4I79A 4HDJA 4XEIC 3EMHA 4O9DA 1P22A 2P9IC 2BBKH 4NBMA 3IUQA 3PSLA 2P9SC 3JROA 3AH8B 2H9LA 4Z7QA 3EI3A 5K19A 4A08B 3CIKB 2IUVA 3JAMg 2H6NA 4GM8A 3FM0A 2Z2PA 2GNQA 4Z7NA 4ZN4A 3MXXA 4Z7OA 4Y7RA 4JHNA 4D9SA 1L5GA 1K8KC 4NENA 3SHFA 4A0AA 3MKSB 5EMLB 5FFGA 1E5TA 2Z2OA 2J57G 2VDNA 3EI3B 4JXMA 5IJ7E 2GC4A 3NVXA 4O02A 1MG2A 4IA9A 2XDWA 5H14A 3OW8A 4PBYA 4BUJC 3PXTD 3UR4A 2EBSA 3KCIA 3IJ0A 1VYHC 3DXMC 1XIPA 1H2ZA 5SXMA 4CI2A 2XYIA 4O3TB 4WK2A 1U8CA 3CFSB 3UKRC 1A12A 5GXIA 2XE4A 1GP2B 4GGDA 1PI6A 3ZDXA 2QR5A 2G9AA 3QI0A 4XYHA 4FA5D 2H9MA 1Q47A 1N6EA 2YB8B 3SLED 1PEVA 4UM8A 4FA9D 2AGXA 5TEFA 3IULA 3A0FA 2VDQA 4AN0A 1GXRA 1XKSA 2HKMA 2IWFA 3NIDA 3C99A 4IMMA 4QRJA 2UZXB 1ERJA 2AH1A 2IUPA 4U1EI 2HU7A 2AGZA 3EI4A 5FFOA 3MUNA 1NR0A 3IJ1A 3OKTA 3HFQA 3JZHA 4X61B 3I2NA 2VDPA 2OK4A 5CXBA 4BCCA 5TF2A 2I0TA 5AMSA 4ERZA 2P9PC 2I0RA 4CY3A 3C9CA 2P9KC 2IURA 3I89A 1QFSA 3JZGA 3IUNA 4J8GA 5H1MA 1QFMA 4H5JA 3ZE0A 4ESGA 2CN2A 3OF7A 1O6FA 3ULEC 1R5MA 2AQ5A 2YNPA 3GFCA 2CE8A 5FA5B 4WK0A 3SVWD 2B5LA 2CN3A 3EI4B 4QL1A 5B4WA 1B9YA 4X63B 3K71A 3FGBA 5CXBB 2IUQA 3UVLA 4BP8A 1SQ9A 5AFU3 3ORVD 4J78A 3VH0A 1JJUB 5CXCA 3K27A 2OVPB 5HE2B 4N14A 3UKUC 3PVWB 3ZE2A 3PSCB 2QC5A 3EI1A 5M5SA 5HE3B 1VE7A 5THAA 5FKTA 2J56H 3DXKC 4JSXC 4JSVC 2H9PA 2VC2A 3CFVA 4A2MA 4A08A 4K3ID 1L0QA 4DNUA 4O45A 3IIYA 3VI4A 2BCJB 2H6KA 5CXCB 4LGNA 5EARA 1T2XA 4AOWA 3K6SA 3EI1B 4AMYA 3F3FA 4WJKA 2MTAH 5EM2A 4BCBA 3GREA 3MZLA 3MKQA 3B7FA
chains in the Genus database with same CATH topology
3EU7A 3W15A 4GM9A 2YBAA 4J84A 2HYEA 2B4EA 2HESX 1JOFA 4JD2C 4CI1A 2IAAA 5EAMA 4A0BA 1JMZB 3RFGA 3RMZD 2OVQB 4BL0A 5FXYA 5TDHB 5EM2B 3V9FA 5C9ZB 3SBRA 3MZKA 3MMYA 5I5JA 4FAND 3OKYA 2QXVA 3BG0A 2H13A 4J87A 4H5IA 5CYKA 4A0BB 1YFQA 4FB1D 1FWXA 4PXWA 2OK6A 1PGUA 4NSXA 3EI2B 1XHMA 2H14A 2YNNA 3BG1A 3IIWA 5EMJB 3VGZA 4E54A 1GOTB 3FRXA 3JZNA 1A0RB 4ZOVA 3OKYB 3PVUB 2H9NA 4FHLA 2OVRB 4L3GD 3PXSD 2XL2A 4G56B 5CYKB 4D0KA 3C75H 4OZUA 4ZOXA 4A11A 1SHYB 3NVQA 3I8EA 5TEEA 3OKWA 4E54B 3SJLD 3SBPA 5K1CC 3F3PA 4GMBA 1N6DA 4JSNC 5FKSA 2XU7A 3V5WB 5H17A 4CY2A 4K3JB 5A2Qg 4J0WA 3BWSA 5C2WB 4A11B 5GMKn 2H6QA 2B5MA 4QQEA 3V7DB 2I0SA 4ZOYA 1S4UX 5AJAA 4A09A 5I5MA 4J0XA 4J73A 2H68A 3PXWD 3AFCA 3EG6A 4BH6A 5EMKB 1JMXB 4GQ2P 3RLMD 2AH0A 4CI3A 1TBGA 2XL3A 4CZXA 1RI6A 4JSPC 4ERYA 4J8BA 2OJYA 4A09B 4L1QD 4KFMB 3RN1D 4L3HD 4FA1D 2J55H 5KDOB 3RFHA 2I3TA 4MK0B 1OMWB 2H47A 2GC7A 5JWZA 3J81g 4OWRA 2B5NA 3SXTD 5HQGA 3AL8B 3SWSD 3SCYA 3I7OA 4JT6C 2O9KA 3DSMA 4J77A 5IGOA 5HE0B 4CY5A 2W18A 3JRPA 4AEZA 3SN6B 3I7LA 4D6VA 5EMMB 4GM3A 3U4YA 1K32A 5HYNB 3EI2A 2AGLA 5GSAA 5IGQA 1OLZA 2PM9B 4PNKB 3J80g 4CC9A 3SBQA 2P9LC 4J81A 5FLXg 1MDAH 4FAVD 4CZVA 2YMUA 3JB9L 4PC0A 4Y5RD 1GG2B 2YNOA 5FQDA 4PBZA 2Z2NA 2CE9A 4X60B 3N0EA 4GGAA 5IJ8E 4FWWA 1NEXB 3KRXB 3RRMC 1U2VC 2IWKA 3AL9A 3RN0D 3P4FA 2OIZA 3PE7A 3E0CA 4PSWB 4TZ4A 4J82A 1QNIA 4ES0A 5I5IA 4J86A 4ERQA 3NVNA 3OL2A 4A2LA 4UI9R 3SFZA 3K26A 5IT9g 4A0AB 2P9UC 2PM6B 4L9OA 3DM0A 4LG9A 3RSEC 3I7KA 3UVKA 3I7HA 2HXCA 4Z8LA 5HE1B 2AGWA 3L4MD 4CI8A 2CO0A 4GQBB 1MG3A 2G99A 4FA4D 3OTTA 4E5ZA 4XYIA 5EAPA 3OL2B 4R7AB 4EWRA 4PSXB 3L4OD 3UVOA 3C5MA 3IJCA 2H3XA 4J79A 1N6FA 5GXHA 4CY1A 2HJ4A 3F3GA 4X3EA 3JPXA 2TRCB 4U7AA 4E5ZB 4O1QD 3SMRA 4GGCA 3AL8A 4ZOZA 4GZ8A 2P9NC 4YVDA 3UVNA 2HJBA 3IKOA 4QT8A 2Q7QA 3I8CA 3ZWLB 3KRWB 2I3SA 2HKRA 4CZYA 2PM7B 2PBIB 2UZYB 5EALA 2CO0C 3VA6A 1U4CA 1SQJA 2PM9A 1B9XA 3ODTA 4LG8A 2CNXA 5FKQA 1TYQC 4JT5C 1PBYB 3I7NA 3UVMA 4A7JA 5C2VB 4GQ1A 5IC7A 3DWLC 3EWEA 3N0DA 3I7PA 2AGYA 4O3UB 5FKRA 4I79A 4HDJA 4XEIC 3EMHA 4O9DA 1P22A 2P9IC 2BBKH 3PSLA 2P9SC 3JROA 3AH8B 2H9LA 3EI3A 5K19A 4A08B 3CIKB 2IUVA 3JAMg 2H6NA 4GM8A 3FM0A 2Z2PA 2GNQA 4ZN4A 3MXXA 4Y7RA 1K8KC 3SHFA 4A0AA 3MKSB 5EMLB 2Z2OA 2J57G 3EI3B 4JXMA 5IJ7E 2GC4A 3NVXA 1MG2A 4IA9A 5H14A 3OW8A 4PBYA 4BUJC 3PXTD 3UR4A 2EBSA 3IJ0A 1VYHC 3DXMC 1XIPA 5SXMA 4CI2A 2XYIA 4O3TB 3CFSB 3UKRC 5GXIA 1GP2B 4GGDA 1PI6A 2G9AA 4XYHA 4FA5D 2H9MA 1Q47A 1N6EA 2YB8B 3SLED 1PEVA 4FA9D 2AGXA 5TEFA 3A0FA 1GXRA 1XKSA 2HKMA 2IWFA 4IMMA 3C99A 4QRJA 2UZXB 1ERJA 2AH1A 2IUPA 4U1EI 2AGZA 3EI4A 1NR0A 3IJ1A 3OKTA 3HFQA 3JZHA 4X61B 3I2NA 2OK4A 5CXBA 5TF2A 2I0TA 5AMSA 4ERZA 2P9PC 2I0RA 4CY3A 3C9CA 2P9KC 2IURA 3I89A 3JZGA 4J8GA 5H1MA 4H5JA 4ESGA 2CN2A 3ULEC 1R5MA 2AQ5A 2YNPA 3GFCA 2CE8A 5FA5B 3SVWD 2B5LA 2CN3A 3EI4B 4QL1A 5B4WA 1B9YA 4X63B 3FGBA 5CXBB 2IUQA 3UVLA 1SQ9A 5AFU3 3ORVD 4J78A 3VH0A 1JJUB 5CXCA 3K27A 2OVPB 5HE2B 4N14A 3UKUC 3PVWB 3PSCB 2QC5A 3EI1A 5HE3B 5THAA 5FKTA 2J56H 3DXKC 4JSXC 4JSVC 2H9PA 3CFVA 4A2MA 4A08A 4K3ID 1L0QA 4O45A 3IIYA 2BCJB 2H6KA 5CXCB 4LGNA 5EARA 4AOWA 3EI1B 3F3FA 2MTAH 5EM2A 3GREA 3MZLA 3MKQA 3B7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU7 A;  3W15 A;  4GM9 A;  2YBA A;  4J84 A;  2HYE A;  2B4E A;  2HES X;  1JOF A;  4JD2 C;  4CI1 A;  2IAA A;  5EAM A;  4A0B A;  1JMZ B;  3RFG A;  3RMZ D;  2OVQ B;  4BL0 A;  5FXY A;  5TDH B;  5EM2 B;  3V9F A;  5C9Z B;  3SBR A;  3MZK A;  3MMY A;  5I5J A;  4FAN D;  3OKY A;  2QXV A;  3BG0 A;  2H13 A;  4J87 A;  4H5I A;  5CYK A;  4A0B B;  1YFQ A;  4FB1 D;  1FWX A;  4PXW A;  2OK6 A;  1PGU A;  4NSX A;  3EI2 B;  1XHM A;  2H14 A;  2YNN A;  3BG1 A;  3IIW A;  5EMJ B;  3VGZ A;  4E54 A;  1GOT B;  3FRX A;  3JZN A;  1A0R B;  4ZOV A;  3OKY B;  3PVU B;  2H9N A;  4FHL A;  2OVR B;  4L3G D;  3PXS D;  2XL2 A;  4G56 B;  5CYK B;  4D0K A;  3C75 H;  4OZU A;  4ZOX A;  4A11 A;  1SHY B;  3NVQ A;  3I8E A;  5TEE A;  3OKW A;  4E54 B;  3SJL D;  3SBP A;  5K1C C;  3F3P A;  4GMB A;  1N6D A;  4JSN C;  5FKS A;  2XU7 A;  3V5W B;  5H17 A;  4CY2 A;  4K3J B;  5A2Q g;  4J0W A;  3BWS A;  5C2W B;  4A11 B;  5GMK n;  2H6Q A;  2B5M A;  4QQE A;  3V7D B;  2I0S A;  4ZOY A;  1S4U X;  5AJA A;  4A09 A;  5I5M A;  4J0X A;  4J73 A;  2H68 A;  3PXW D;  3AFC A;  3EG6 A;  4BH6 A;  5EMK B;  1JMX B;  4GQ2 P;  3RLM D;  2AH0 A;  4CI3 A;  1TBG A;  2XL3 A;  4CZX A;  1RI6 A;  4JSP C;  4ERY A;  4J8B A;  2OJY A;  4A09 B;  4L1Q D;  4KFM B;  3RN1 D;  4L3H D;  4FA1 D;  2J55 H;  5KDO B;  3RFH A;  2I3T A;  4MK0 B;  1OMW B;  2H47 A;  2GC7 A;  5JWZ A;  3J81 g;  4OWR A;  2B5N A;  3SXT D;  5HQG A;  3AL8 B;  3SWS D;  3SCY A;  3I7O A;  4JT6 C;  2O9K A;  3DSM A;  4J77 A;  5IGO A;  5HE0 B;  4CY5 A;  2W18 A;  3JRP A;  4AEZ A;  3SN6 B;  3I7L A;  4D6V A;  5EMM B;  4GM3 A;  3U4Y A;  1K32 A;  5HYN B;  3EI2 A;  2AGL A;  5GSA A;  5IGQ A;  1OLZ A;  2PM9 B;  4PNK B;  3J80 g;  4CC9 A;  3SBQ A;  2P9L C;  4J81 A;  5FLX g;  1MDA H;  4FAV D;  4CZV A;  2YMU A;  3JB9 L;  4PC0 A;  4Y5R D;  1GG2 B;  2YNO A;  5FQD A;  4PBZ A;  2Z2N A;  2CE9 A;  4X60 B;  3N0E A;  4GGA A;  5IJ8 E;  4FWW A;  1NEX B;  3KRX B;  3RRM C;  1U2V C;  2IWK A;  3AL9 A;  3RN0 D;  3P4F A;  2OIZ A;  3PE7 A;  3E0C A;  4PSW B;  4TZ4 A;  4J82 A;  1QNI A;  4ES0 A;  5I5I A;  4J86 A;  4ERQ A;  3NVN A;  3OL2 A;  4A2L A;  4UI9 R;  3SFZ A;  3K26 A;  5IT9 g;  4A0A B;  2P9U C;  2PM6 B;  4L9O A;  3DM0 A;  4LG9 A;  3RSE C;  3I7K A;  3UVK A;  3I7H A;  2HXC A;  4Z8L A;  5HE1 B;  2AGW A;  3L4M D;  4CI8 A;  2CO0 A;  4GQB B;  1MG3 A;  2G99 A;  4FA4 D;  3OTT A;  4E5Z A;  4XYI A;  5EAP A;  3OL2 B;  4R7A B;  4EWR A;  4PSX B;  3L4O D;  3UVO A;  3C5M A;  3IJC A;  2H3X A;  4J79 A;  1N6F A;  5GXH A;  4CY1 A;  2HJ4 A;  3F3G A;  4X3E A;  3JPX A;  2TRC B;  4U7A A;  4E5Z B;  4O1Q D;  3SMR A;  4GGC A;  3AL8 A;  4ZOZ A;  4GZ8 A;  2P9N C;  4YVD A;  3UVN A;  2HJB A;  3IKO A;  4QT8 A;  2Q7Q A;  3I8C A;  3ZWL B;  3KRW B;  2I3S A;  2HKR A;  4CZY A;  2PM7 B;  2PBI B;  2UZY B;  5EAL A;  2CO0 C;  3VA6 A;  1U4C A;  1SQJ A;  2PM9 A;  1B9X A;  3ODT A;  4LG8 A;  2CNX A;  5FKQ A;  1TYQ C;  4JT5 C;  1PBY B;  3I7N A;  3UVM A;  4A7J A;  5C2V B;  4GQ1 A;  5IC7 A;  3DWL C;  3EWE A;  3N0D A;  3I7P A;  2AGY A;  4O3U B;  5FKR A;  4I79 A;  4HDJ A;  4XEI C;  3EMH A;  4O9D A;  1P22 A;  2P9I C;  2BBK H;  3PSL A;  2P9S C;  3JRO A;  3AH8 B;  2H9L A;  3EI3 A;  5K19 A;  4A08 B;  3CIK B;  2IUV A;  3JAM g;  2H6N A;  4GM8 A;  3FM0 A;  2Z2P A;  2GNQ A;  4ZN4 A;  3MXX A;  4Y7R A;  1K8K C;  3SHF A;  4A0A A;  3MKS B;  5EML B;  2Z2O A;  2J57 G;  3EI3 B;  4JXM A;  5IJ7 E;  2GC4 A;  3NVX A;  1MG2 A;  4IA9 A;  5H14 A;  3OW8 A;  4PBY A;  4BUJ C;  3PXT D;  3UR4 A;  2EBS A;  3IJ0 A;  1VYH C;  3DXM C;  1XIP A;  5SXM A;  4CI2 A;  2XYI A;  4O3T B;  3CFS B;  3UKR C;  5GXI A;  1GP2 B;  4GGD A;  1PI6 A;  2G9A A;  4XYH A;  4FA5 D;  2H9M A;  1Q47 A;  1N6E A;  2YB8 B;  3SLE D;  1PEV A;  4FA9 D;  2AGX A;  5TEF A;  3A0F A;  1GXR A;  1XKS A;  2HKM A;  2IWF A;  4IMM A;  3C99 A;  4QRJ A;  2UZX B;  1ERJ A;  2AH1 A;  2IUP A;  4U1E I;  2AGZ A;  3EI4 A;  1NR0 A;  3IJ1 A;  3OKT A;  3HFQ A;  3JZH A;  4X61 B;  3I2N A;  2OK4 A;  5CXB A;  5TF2 A;  2I0T A;  5AMS A;  4ERZ A;  2P9P C;  2I0R A;  4CY3 A;  3C9C A;  2P9K C;  2IUR A;  3I89 A;  3JZG A;  4J8G A;  5H1M A;  4H5J A;  4ESG A;  2CN2 A;  3ULE C;  1R5M A;  2AQ5 A;  2YNP A;  3GFC A;  2CE8 A;  5FA5 B;  3SVW D;  2B5L A;  2CN3 A;  3EI4 B;  4QL1 A;  5B4W A;  1B9Y A;  4X63 B;  3FGB A;  5CXB B;  2IUQ A;  3UVL A;  1SQ9 A;  5AFU 3;  3ORV D;  4J78 A;  3VH0 A;  1JJU B;  5CXC A;  3K27 A;  2OVP B;  5HE2 B;  4N14 A;  3UKU C;  3PVW B;  3PSC B;  2QC5 A;  3EI1 A;  5HE3 B;  5THA A;  5FKT A;  2J56 H;  3DXK C;  4JSX C;  4JSV C;  2H9P A;  3CFV A;  4A2M A;  4A08 A;  4K3I D;  1L0Q A;  4O45 A;  3IIY A;  2BCJ B;  2H6K A;  5CXC B;  4LGN A;  5EAR A;  4AOW A;  3EI1 B;  3F3F A;  2MTA H;  5EM2 A;  3GRE A;  3MZL A;  3MKQ A;  3B7F A; 
#chains in the Genus database with same CATH topology
 3EU7 A;  3W15 A;  4GM9 A;  2YBA A;  2QZP A;  4J84 A;  2HYE A;  2B4E A;  3IUM A;  2HES X;  1JOF A;  4JD2 C;  1M1X A;  2VDL A;  4CI1 A;  2IAA A;  5EAM A;  1I2M B;  4A0B A;  1JMZ B;  3RFG A;  3RMZ D;  2OVQ B;  4DNW A;  4BL0 A;  3QHY B;  4WK4 A;  5FXY A;  5TDH B;  5EM2 B;  4JHP C;  3ZDY A;  3V9F A;  5C9Z B;  3SBR A;  3MZK A;  3MMY A;  5I5J A;  4FAN D;  3OKY A;  2QXV A;  4G1E A;  2VDM A;  3BG0 A;  5M5R A;  3IJE A;  2H13 A;  4J87 A;  4H5I A;  5CYK A;  4A0B B;  1YFQ A;  3K72 A;  4FB1 D;  1E8N A;  1FWX A;  4PXW A;  3T3M A;  3MVD K;  2OK6 A;  1PGU A;  4NSX A;  3EI2 B;  4O2W A;  1XHM A;  2H14 A;  2YNN A;  3BG1 A;  3IIW A;  5EMJ B;  2EIE A;  3VGZ A;  4E54 A;  1GOT B;  3FRX A;  3JZN A;  1A0R B;  4ZOV A;  3OKY B;  3V4V A;  3PVU B;  2H9N A;  4FHL A;  4RE6 A;  2OVR B;  1VZ3 A;  4L3G D;  3PXS D;  2XL2 A;  4G56 B;  5CYK B;  4D0K A;  3C75 H;  4OZU A;  4ZOX A;  4A11 A;  1SHY B;  3NVQ A;  3I8E A;  3GC3 B;  5TEE A;  3OKW A;  4E54 B;  3SJL D;  3SBP A;  3GD1 I;  3F3P A;  5K1C C;  4GMB A;  3NIG A;  1N6D A;  4JSN C;  5FKS A;  2XU7 A;  3V5W B;  1H2Y A;  5H17 A;  4CY2 A;  1UOP A;  1UTC A;  4K3J B;  5A2Q g;  4J0W A;  3BWS A;  5C2W B;  4A11 B;  5GMK n;  2H6Q A;  2B5M A;  4QQE A;  1VZ2 A;  3V7D B;  2I0S A;  5E6R A;  4ZOY A;  1S4U X;  5AJA A;  4A09 A;  5I5M A;  4J0X A;  1C9L A;  1YR2 A;  4J73 A;  2H68 A;  2EID A;  3PXW D;  3AFC A;  3EG6 A;  4BH6 A;  4AMZ A;  5EMK B;  1JMX B;  4GQ2 P;  3RLM D;  2AH0 A;  4CI3 A;  1TBG A;  4NAA A;  2XL3 A;  4CZX A;  1RI6 A;  4JSP C;  4ERY A;  4J8B A;  2OJY A;  3NIF A;  4A09 B;  4L1Q D;  4KFM B;  5HDB A;  3RN1 D;  4L3H D;  4FA1 D;  2J55 H;  5KDO B;  3IUR A;  3RFH A;  2I3T A;  4MK0 B;  1OMW B;  1VE6 A;  2H47 A;  1GOF A;  3O4I A;  2GC7 A;  5M5V A;  3VI3 A;  5JWZ A;  3J81 g;  3ZE1 A;  4OWR A;  2B5N A;  3SXT D;  5HQG A;  1JTD B;  3AL8 B;  3SWS D;  3SCY A;  3I7O A;  4JT6 C;  3FCU A;  4BCD A;  1TYE A;  2O9K A;  2BKL A;  4AN1 A;  3DSM A;  2XZG A;  4BP9 A;  4J77 A;  5IGO A;  5HE0 B;  3V4P A;  3EQ8 A;  4CY5 A;  2EIC A;  2W18 A;  4DNV A;  3JRP A;  3IUJ A;  4AEZ A;  5M5U A;  3SN6 B;  3I7L A;  4D6V A;  5EMM B;  4GM3 A;  3U4Y A;  1K32 A;  5HYN B;  3EI2 A;  1K3I A;  2AGL A;  5GSA A;  5IGQ A;  1OLZ A;  2PM9 B;  4PNK B;  3J80 g;  1BPO A;  4CC9 A;  3SBQ A;  2P9L C;  1O6G A;  4J81 A;  5FLX g;  5E6U A;  1MDA H;  4FAV D;  4CZV A;  2YMU A;  4MMX A;  4UM9 A;  3JB9 L;  4PC0 A;  4Y5R D;  1GG2 B;  2HU8 A;  3O4J A;  1H2W A;  2WQ8 A;  4MMY A;  2YNO A;  5FQD A;  2VZ1 A;  4PBZ A;  2VDK A;  2Z2N A;  4NC4 A;  5M5T A;  2CE9 A;  4X60 B;  3N0E A;  4GGA A;  5IJ8 E;  4FWW A;  1NEX B;  3KRX B;  3RRM C;  1U2V C;  2IWK A;  3AL9 A;  3RN0 D;  3DDU A;  2EIB A;  1H2X A;  3P4F A;  2OIZ A;  3EQ9 A;  5C86 A;  3PE7 A;  3E0C A;  4PSW B;  5M61 A;  4TZ4 A;  4J82 A;  1UOQ A;  4AX4 A;  1QNI A;  4ES0 A;  5I5I A;  3EQ7 A;  1C9I A;  4J86 A;  4ERQ A;  3NVN A;  1UOO A;  3OL2 A;  4A2L A;  4UI9 R;  3SFZ A;  3K26 A;  5IT9 g;  4A0A B;  3T3P A;  2P9U C;  2PM6 B;  4L9O A;  4RE5 A;  3DM0 A;  4LG9 A;  2VDO A;  1E8M A;  3RSE C;  2VZ3 A;  3I7K A;  3UVK A;  3I7H A;  2HXC A;  4Z8L A;  5HE1 B;  2AGW A;  3L4M D;  4CI8 A;  2CO0 A;  4GQB B;  1MG3 A;  2G99 A;  4FA4 D;  3OTT A;  4E5Z A;  4L1M A;  4XYI A;  5EAP A;  3OL2 B;  4R7A B;  4EWR A;  4PSX B;  2HU5 A;  3L4O D;  3UVO A;  3C5M A;  3IJC A;  2H3X A;  3MUO A;  4J79 A;  1N6F A;  5GXH A;  2JKX A;  5C92 A;  4CY1 A;  2HJ4 A;  3F3G A;  4X3E A;  3JPX A;  1JV2 A;  2TRC B;  4U7A A;  3ZDZ A;  4E5Z B;  4O1Q D;  3SMR A;  1GOH A;  3FCS A;  4GGC A;  3AL8 A;  4ZOZ A;  4GZ8 A;  3O4G A;  4QAM A;  2P9N C;  5E6S A;  4YVD A;  3UVN A;  2HJB A;  3IKO A;  4QT8 A;  2Q7Q A;  3I8C A;  3ZWL B;  3KRW B;  2I3S A;  2HKR A;  2VDR A;  4CZY A;  2PM7 B;  2PBI B;  2UZY B;  5EAL A;  2CO0 C;  3VA6 A;  1U4C A;  1SQJ A;  2PM9 A;  1B9X A;  3ODT A;  4LG8 A;  2CNX A;  5FKQ A;  1TYQ C;  4JT5 C;  4IRZ A;  3IVM A;  3O4H A;  1PBY B;  3I7N A;  3UVM A;  4A7J A;  5C2V B;  4GQ1 A;  5IC7 A;  1GOG A;  3DWL C;  3EWE A;  3N0D A;  3I7P A;  2AGY A;  4G1M A;  4MMZ A;  4O3U B;  5FKR A;  4G55 A;  4I79 A;  4HDJ A;  4XEI C;  3EMH A;  4O9D A;  1P22 A;  2P9I C;  2BBK H;  4NBM A;  3IUQ A;  3PSL A;  2P9S C;  3JRO A;  3AH8 B;  2H9L A;  4Z7Q A;  3EI3 A;  5K19 A;  4A08 B;  3CIK B;  2IUV A;  3JAM g;  2H6N A;  4GM8 A;  3FM0 A;  2Z2P A;  2GNQ A;  4Z7N A;  4ZN4 A;  3MXX A;  4Z7O A;  4Y7R A;  4JHN A;  4D9S A;  1L5G A;  1K8K C;  4NEN A;  3SHF A;  4A0A A;  3MKS B;  5EML B;  5FFG A;  1E5T A;  2Z2O A;  2J57 G;  2VDN A;  3EI3 B;  4JXM A;  5IJ7 E;  2GC4 A;  3NVX A;  4O02 A;  1MG2 A;  4IA9 A;  2XDW A;  5H14 A;  3OW8 A;  4PBY A;  4BUJ C;  3PXT D;  3UR4 A;  2EBS A;  3KCI A;  3IJ0 A;  1VYH C;  3DXM C;  1XIP A;  1H2Z A;  5SXM A;  4CI2 A;  2XYI A;  4O3T B;  4WK2 A;  1U8C A;  3CFS B;  3UKR C;  1A12 A;  5GXI A;  2XE4 A;  1GP2 B;  4GGD A;  1PI6 A;  3ZDX A;  2QR5 A;  2G9A A;  3QI0 A;  4XYH A;  4FA5 D;  2H9M A;  1Q47 A;  1N6E A;  2YB8 B;  3SLE D;  1PEV A;  4UM8 A;  4FA9 D;  2AGX A;  5TEF A;  3IUL A;  3A0F A;  2VDQ A;  4AN0 A;  1GXR A;  1XKS A;  2HKM A;  2IWF A;  3NID A;  3C99 A;  4IMM A;  4QRJ A;  2UZX B;  1ERJ A;  2AH1 A;  2IUP A;  4U1E I;  2HU7 A;  2AGZ A;  3EI4 A;  5FFO A;  3MUN A;  1NR0 A;  3IJ1 A;  3OKT A;  3HFQ A;  3JZH A;  4X61 B;  3I2N A;  2VDP A;  2OK4 A;  5CXB A;  4BCC A;  5TF2 A;  2I0T A;  5AMS A;  4ERZ A;  2P9P C;  2I0R A;  4CY3 A;  3C9C A;  2P9K C;  2IUR A;  3I89 A;  1QFS A;  3JZG A;  3IUN A;  4J8G A;  5H1M A;  1QFM A;  4H5J A;  3ZE0 A;  4ESG A;  2CN2 A;  3OF7 A;  1O6F A;  3ULE C;  1R5M A;  2AQ5 A;  2YNP A;  3GFC A;  2CE8 A;  5FA5 B;  4WK0 A;  3SVW D;  2B5L A;  2CN3 A;  3EI4 B;  4QL1 A;  5B4W A;  1B9Y A;  4X63 B;  3K71 A;  3FGB A;  5CXB B;  2IUQ A;  3UVL A;  4BP8 A;  1SQ9 A;  5AFU 3;  3ORV D;  4J78 A;  3VH0 A;  1JJU B;  5CXC A;  3K27 A;  2OVP B;  5HE2 B;  4N14 A;  3UKU C;  3PVW B;  3ZE2 A;  3PSC B;  2QC5 A;  3EI1 A;  5M5S A;  5HE3 B;  1VE7 A;  5THA A;  5FKT A;  2J56 H;  3DXK C;  4JSX C;  4JSV C;  2H9P A;  2VC2 A;  3CFV A;  4A2M A;  4A08 A;  4K3I D;  1L0Q A;  4DNU A;  4O45 A;  3IIY A;  3VI4 A;  2BCJ B;  2H6K A;  5CXC B;  4LGN A;  5EAR A;  1T2X A;  4AOW A;  3K6S A;  3EI1 B;  4AMY A;  3F3F A;  4WJK A;  2MTA H;  5EM2 A;  4BCB A;  3GRE A;  3MZL A;  3MKQ A;  3B7F A; 
#chains in the Genus database with same CATH homology
 3EU7 A;  3W15 A;  4GM9 A;  2YBA A;  4J84 A;  2HYE A;  2B4E A;  2HES X;  1JOF A;  4JD2 C;  4CI1 A;  2IAA A;  5EAM A;  4A0B A;  1JMZ B;  3RFG A;  3RMZ D;  2OVQ B;  4BL0 A;  5FXY A;  5TDH B;  5EM2 B;  3V9F A;  5C9Z B;  3SBR A;  3MZK A;  3MMY A;  5I5J A;  4FAN D;  3OKY A;  2QXV A;  3BG0 A;  2H13 A;  4J87 A;  4H5I A;  5CYK A;  4A0B B;  1YFQ A;  4FB1 D;  1FWX A;  4PXW A;  2OK6 A;  1PGU A;  4NSX A;  3EI2 B;  1XHM A;  2H14 A;  2YNN A;  3BG1 A;  3IIW A;  5EMJ B;  3VGZ A;  4E54 A;  1GOT B;  3FRX A;  3JZN A;  1A0R B;  4ZOV A;  3OKY B;  3PVU B;  2H9N A;  4FHL A;  2OVR B;  4L3G D;  3PXS D;  2XL2 A;  4G56 B;  5CYK B;  4D0K A;  3C75 H;  4OZU A;  4ZOX A;  4A11 A;  1SHY B;  3NVQ A;  3I8E A;  5TEE A;  3OKW A;  4E54 B;  3SJL D;  3SBP A;  5K1C C;  3F3P A;  4GMB A;  1N6D A;  4JSN C;  5FKS A;  2XU7 A;  3V5W B;  5H17 A;  4CY2 A;  4K3J B;  5A2Q g;  4J0W A;  3BWS A;  5C2W B;  4A11 B;  5GMK n;  2H6Q A;  2B5M A;  4QQE A;  3V7D B;  2I0S A;  4ZOY A;  1S4U X;  5AJA A;  4A09 A;  5I5M A;  4J0X A;  4J73 A;  2H68 A;  3PXW D;  3AFC A;  3EG6 A;  4BH6 A;  5EMK B;  1JMX B;  4GQ2 P;  3RLM D;  2AH0 A;  4CI3 A;  1TBG A;  2XL3 A;  4CZX A;  1RI6 A;  4JSP C;  4ERY A;  4J8B A;  2OJY A;  4A09 B;  4L1Q D;  4KFM B;  3RN1 D;  4L3H D;  4FA1 D;  2J55 H;  5KDO B;  3RFH A;  2I3T A;  4MK0 B;  1OMW B;  2H47 A;  2GC7 A;  5JWZ A;  3J81 g;  4OWR A;  2B5N A;  3SXT D;  5HQG A;  3AL8 B;  3SWS D;  3SCY A;  3I7O A;  4JT6 C;  2O9K A;  3DSM A;  4J77 A;  5IGO A;  5HE0 B;  4CY5 A;  2W18 A;  3JRP A;  4AEZ A;  3SN6 B;  3I7L A;  4D6V A;  5EMM B;  4GM3 A;  3U4Y A;  1K32 A;  5HYN B;  3EI2 A;  2AGL A;  5GSA A;  5IGQ A;  1OLZ A;  2PM9 B;  4PNK B;  3J80 g;  4CC9 A;  3SBQ A;  2P9L C;  4J81 A;  5FLX g;  1MDA H;  4FAV D;  4CZV A;  2YMU A;  3JB9 L;  4PC0 A;  4Y5R D;  1GG2 B;  2YNO A;  5FQD A;  4PBZ A;  2Z2N A;  2CE9 A;  4X60 B;  3N0E A;  4GGA A;  5IJ8 E;  4FWW A;  1NEX B;  3KRX B;  3RRM C;  1U2V C;  2IWK A;  3AL9 A;  3RN0 D;  3P4F A;  2OIZ A;  3PE7 A;  3E0C A;  4PSW B;  4TZ4 A;  4J82 A;  1QNI A;  4ES0 A;  5I5I A;  4J86 A;  4ERQ A;  3NVN A;  3OL2 A;  4A2L A;  4UI9 R;  3SFZ A;  3K26 A;  5IT9 g;  4A0A B;  2P9U C;  2PM6 B;  4L9O A;  3DM0 A;  4LG9 A;  3RSE C;  3I7K A;  3UVK A;  3I7H A;  2HXC A;  4Z8L A;  5HE1 B;  2AGW A;  3L4M D;  4CI8 A;  2CO0 A;  4GQB B;  1MG3 A;  2G99 A;  4FA4 D;  3OTT A;  4E5Z A;  4XYI A;  5EAP A;  3OL2 B;  4R7A B;  4EWR A;  4PSX B;  3L4O D;  3UVO A;  3C5M A;  3IJC A;  2H3X A;  4J79 A;  1N6F A;  5GXH A;  4CY1 A;  2HJ4 A;  3F3G A;  4X3E A;  3JPX A;  2TRC B;  4U7A A;  4E5Z B;  4O1Q D;  3SMR A;  4GGC A;  3AL8 A;  4ZOZ A;  4GZ8 A;  2P9N C;  4YVD A;  3UVN A;  2HJB A;  3IKO A;  4QT8 A;  2Q7Q A;  3I8C A;  3ZWL B;  3KRW B;  2I3S A;  2HKR A;  4CZY A;  2PM7 B;  2PBI B;  2UZY B;  5EAL A;  2CO0 C;  3VA6 A;  1U4C A;  1SQJ A;  2PM9 A;  1B9X A;  3ODT A;  4LG8 A;  2CNX A;  5FKQ A;  1TYQ C;  4JT5 C;  1PBY B;  3I7N A;  3UVM A;  4A7J A;  5C2V B;  4GQ1 A;  5IC7 A;  3DWL C;  3EWE A;  3N0D A;  3I7P A;  2AGY A;  4O3U B;  5FKR A;  4I79 A;  4HDJ A;  4XEI C;  3EMH A;  4O9D A;  1P22 A;  2P9I C;  2BBK H;  3PSL A;  2P9S C;  3JRO A;  3AH8 B;  2H9L A;  3EI3 A;  5K19 A;  4A08 B;  3CIK B;  2IUV A;  3JAM g;  2H6N A;  4GM8 A;  3FM0 A;  2Z2P A;  2GNQ A;  4ZN4 A;  3MXX A;  4Y7R A;  1K8K C;  3SHF A;  4A0A A;  3MKS B;  5EML B;  2Z2O A;  2J57 G;  3EI3 B;  4JXM A;  5IJ7 E;  2GC4 A;  3NVX A;  1MG2 A;  4IA9 A;  5H14 A;  3OW8 A;  4PBY A;  4BUJ C;  3PXT D;  3UR4 A;  2EBS A;  3IJ0 A;  1VYH C;  3DXM C;  1XIP A;  5SXM A;  4CI2 A;  2XYI A;  4O3T B;  3CFS B;  3UKR C;  5GXI A;  1GP2 B;  4GGD A;  1PI6 A;  2G9A A;  4XYH A;  4FA5 D;  2H9M A;  1Q47 A;  1N6E A;  2YB8 B;  3SLE D;  1PEV A;  4FA9 D;  2AGX A;  5TEF A;  3A0F A;  1GXR A;  1XKS A;  2HKM A;  2IWF A;  4IMM A;  3C99 A;  4QRJ A;  2UZX B;  1ERJ A;  2AH1 A;  2IUP A;  4U1E I;  2AGZ A;  3EI4 A;  1NR0 A;  3IJ1 A;  3OKT A;  3HFQ A;  3JZH A;  4X61 B;  3I2N A;  2OK4 A;  5CXB A;  5TF2 A;  2I0T A;  5AMS A;  4ERZ A;  2P9P C;  2I0R A;  4CY3 A;  3C9C A;  2P9K C;  2IUR A;  3I89 A;  3JZG A;  4J8G A;  5H1M A;  4H5J A;  4ESG A;  2CN2 A;  3ULE C;  1R5M A;  2AQ5 A;  2YNP A;  3GFC A;  2CE8 A;  5FA5 B;  3SVW D;  2B5L A;  2CN3 A;  3EI4 B;  4QL1 A;  5B4W A;  1B9Y A;  4X63 B;  3FGB A;  5CXB B;  2IUQ A;  3UVL A;  1SQ9 A;  5AFU 3;  3ORV D;  4J78 A;  3VH0 A;  1JJU B;  5CXC A;  3K27 A;  2OVP B;  5HE2 B;  4N14 A;  3UKU C;  3PVW B;  3PSC B;  2QC5 A;  3EI1 A;  5HE3 B;  5THA A;  5FKT A;  2J56 H;  3DXK C;  4JSX C;  4JSV C;  2H9P A;  3CFV A;  4A2M A;  4A08 A;  4K3I D;  1L0Q A;  4O45 A;  3IIY A;  2BCJ B;  2H6K A;  5CXC B;  4LGN A;  5EAR A;  4AOW A;  3EI1 B;  3F3F A;  2MTA H;  5EM2 A;  3GRE A;  3MZL A;  3MKQ A;  3B7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...