1JNDA

Crystal structure of imaginal disc growth factor-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
400
Chain Sequence
b'SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Imaginal disc growth factor-2
molecule tags Hormone/growth factor
publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
total genus 143
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jndA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jndA01
3MMDA 4PMVA 2NSXA 9CGTA 5DF0A 1G0CA 2ZXQA 1V0MA 1XD1A 4QLLA 2VCAA 1CTNA 1Q6EA 3PN8A 3BSGA 1JIBA 2J7DA 3OLDA 2FHBA 3WBAA 3ZJKA 1H09A 1NM9A 1MVYA 1LL7A 3PZOA 2WCGA 2CKSA 1PAMA 1JZ6A 3WNPA 4HOXA 4CVWA 3NJ3A 3OIHA 4AZCB 2YKKA 4W85A 3LPOA 1KCKA 4CUCA 1QI5A 3L4WA 2EPLX 4B9YA 3BCDA 1CWYA 2NT0A 3WH8A 4UNIA 3BAXA 3VILA 4AD1A 4U5IA 1GNXA 4J3WA 3AROA 4B3LA 1UR4A 2ZICA 1IT0A 2WAGA 4NSBA 2OSYA 4LX4A 4U33A 2YL6A 5BXRA 1WDPA 4KRTA 1FA2A 4PCSA 3WH5A 4AEEA 1W9UA 5CSUA 2VZOA 1PZ3A 2BHZA 2ZUVA 1W1TA 2D3LA 4ATWA 4HMDA 2QMJA 1KXVA 4ACZB 2Y8KA 3SUTA 4V2XA 4BZYA 3FAWA 3OLGA 1E3ZA 3F5LA 4XV0A 1IZKA 2W91A 4PUEA 1NOFA 4X9YA 4AW7A 2VJXA 3W26A 1MXDA 1B3VA 2XWDA 3MS8A 1VRXA 4D1IA 4PMYA 3ZT6A 4GQRA 3VVGA 5F7UA 4CD6A 4FK9A 1K9DA 1E40A 1K9EA 1R86A 3PZ9A 3I3EA 1GOIA 1LG2A 1TVNA 2G3IA 4GI8A 2XJ7A 3VIFA 3ARZA 1WKYA 1XYZA 1SR0A 3PTKA 4F66A 3WDHA 5A6SA 3HN3A 1FP9A 2V5DA 2WBGA 2V3EA 1K6AA 1JF6A 1G01A 3MSGA 5JIWA 4WKFA 4TOQA 1JZ4A 1QHPA 2J7FA 1J01A 4B16A 2WMKA 3NYDA 3VIGA 4S3JA 1RD6A 3WD3A 5TD4A 3VD5A 4C7GA 4D6CA 4KWUA 2WLZA 1LF1A 3GH7A 1MXGA 3HMCA 4IPLA 1CECA 2CERA 2XSAA 4W8AA 3VDBA 1C90A 2EJ1A 1FOBA 3EYPA 2EQDA 5EB8A 2WC4A 1UD8A 5HPCA 1V3KA 4QDMA 3SCVA 1E4IA 2XSBA 1XCWA 3II1A 1I1WA 3EMQA 1UR8A 4CD8A 1CXIA 1GOWA 2BS9A 2OWWA 3BAJA 4V27A 2IXUA 3POHA 2V5CA 5A2AA 5GNZA 1HF6A 2WC7A 4YHGA 2WSPA 5DT7A 1SMDA 1C7SA 4OOUA 2F2HA 1JGIA 1JZ8A 1QNSA 4CU8A 2EPOA 2J74A 1Q4NX 3AMDA 3T0AA 5LA1A 3AXIA 3RMEA 3WF2A 1BYCA 1TA3B 1UD5A 2WBKA 4RE3A 1VBUA 1XCXA 1J11A 5HNNA 5DEZA 4B15A 2WVTA 4KGJA 1RP9A 2CKRA 2XUCA 2WKLA 1SFSA 1L0PA 1E9LA 1LWJA 1LG1A 1BQCA 3DECA 1JYXA 2VX5A 1R7AA 2WMFA 2XIIA 2DDXA 2V3DA 2W4XA 1TE1A 4ATDA 2VVNA 1WCGA 5M5DA 2D0FA 3SCSA 2DSWA 1HNYA 2W5FA 4AIEA 1CXHA 1M04A 1VJSA 1OCQA 1LL6A 4LYPA 3HJEA 4F9DA 3VDHA 3UG3A 3PTMA 4QFUA 1PX4A 4UFHA 3VOCA 1JFHA 4BQ4A 1PX3A 2WHKA 4CD5A 1M7XA 1UR9A 2YLAA 1Q6DA 5FIPA 5A6MA 4E8DA 4AY1A 1GHSA 3IANA 1KWKA 3WUEA 3VM5A 2CBVA 2CEQA 1OGGA 2E40A 2WCAA 1UHVA 3PZTA 3UESA 2Y5EA 3APGA 3U5YA 5A6KA 2E0PA 2O9PA 4HPHA 2VURA 3K1DA 3T2QA 3GBDA 2G3NA 4DWSC 4OKDA 7CGTA 3ARUA 1JD7A 1V3LA 2X8RA 3GDBA 4W87A 1EXPA 4HA4A 3ZR6A 3CUIA 3EDJA 4D6GA 4JAWA 1E56A 4ZXOA 2ZOXA 2DEPA 4PCTA 3NDZA 2VR4A 1OGSA 3AIWA 5DMYA 1E4MM 1QNPA 4F8XA 1EDTA 1J0ZA 5AYIA 3W53A 3CZKA 3L2MA 2GK1A 3PZNA 6TAAA 2CBIA 1US2A 3AZTA 4UFKA 4AD0A 5ABFB 1X6LA 4GZJA 5EBAA 2Y8VA 4QAWA 1EHNA 3LPFA 3SCWA 5AY7A 1U30A 4Z2KA 3WL0A 3RIKA 3CHCA 2VZTA 3VMNA 1GZJA 5ABHA 2ZX5A 2D20A 1HJXA 1ZL1A 3W25A 5IHSA 1WZMA 3ARWA 2VMFA 3WEOA 2WWCA 3FAXA 1XHGA 1OM0A 1CEOA 1EDGA 4MNMA 2XHYA 2PWEA 3A6OA 2XGIA 1AQ0A 5D9PA 2XVKA 3S2CA 2PC8A 2E9LA 3O2LA 4ZEPA 5GQBA 3VIPA 2VQUA 1GQJA 3SCPA 4A4AA 2W61A 4D6DA 5ABEA 2CIPA 1EOKA 1WP6A 3OGRA 1BVZA 3MV11 4DUXA 4MNKA 1B3XA 1GOOA 4HA3A 2G4FA 1H5VA 4URIA 3WQVA 2J77A 2X0HA 1HKJA 5ABFA 3ARSA 1HJSA 2DSZA 4UQDA 4TX8A 1H0IA 1HKIA 4JFSA 4FF5A 4PMDA 2A3EA 1BFNA 2WB5A 1UH2A 1B0IA 2FDMA 3BSHA 3THCA 3ARYA 4D6HA 3WL1A 4JCLA 1EDQA 3FHAA 5A6BD 3KL0A 3GNOA 3GM8A 4WSJA 3WN6A 4QCEA 2VVSA 2G8ZA 2XTKA 4JKMA 4UZSA 5IFTA 3MUZ1 2D1ZA 1NOUA 1E6RA 4UQCA 1KQZA 3THDA 1ECEA 2X0YA 3F5KA 1VF8A 2YDQA 1E70M 3WSUA 4Y7EA 2D22A 2BNJA 2XM1A 4IM4A 2VZSA 2XVNA 5I3DA 2J8FA 1C3FA 3IJ7A 3UG4A 2JF6A 3EDEA 2J79A 1FFRA 1GQKA 1R85A 2HVMA 3UERA 3RJYA 1QW8A 4AD2A 4LXFA 1W3LA 3MANA 1JDCA 2GUYA 3TTYA 2PB1A 1W1VA 1BYDA 4A3HA 1DHKA 4W86A 3FN9A 1G5AA 2GJRA 1M53A 3QHNA 1KGWA 2W92A 4MB1A 2ZX8A 5A69A 1KR1A 3M07A 2YLLA 1E0VA 4H7VA 1B31A 3AXHA 4GI9A 3SUVA 2OYLA 4CD7A 2BFGA 5CGTA 1KXHA 1R7OA 4WK9A 4E4PA 1JZ5A 1E6XM 1EO7A 3IJ9A 1VFOA 1NP2A 5CZKA 4AD3A 1NH6A 5BCAA 1V03A 3MUY1 5E6YA 1V3HA 4TVUA 3GNPA 3K4DA 5IHRA 4W84A 4PTXA 2J62A 2QPSA 3L2LA 3T09A 2ZUNA 3U57A 3MMUA 3POCA 1UA3A 3SCNA 3BC9A 1VEPA 3MUIA 2A3CA 3W4RA 4HA1A 3WMCA 4AMCA 1TA3A 4GI6A 2E8YA 1JFXA 2DSKA 5D8WA 1E6QM 2VI0A 3TTSA 1VIWA 3AHYA 2WM0A 5D9MA 4UFJA 3AS2A 4PYSA 2QV4A 4CKQA 1HIZA 3BAYA 2J8GA 3GXDA 5BXSA 3WNMA 3VPLA 5CPSA 5HDRA 2FH8A 4H41A 2JFEX 5A95A 2WW5A 2OWCA 1XRVA 2BY1A 3RDKA 2E4TA 2QF8A 1JAEA 2DIEA 1GORA 1G94A 2WNWA 2ESCA 3L4UA 1H4PA 3TTQA 4PMUA 2J78A 4CN4A 5IDIA 1UKPA 1CIUA 2WMJA 2WCSA 2JEPA 1OGBA 2X1IA 5FL1A 8CGTA 2XM2A 2VRJA 2WHMA 2UY2A 3UCQA 1B3ZA 3WEMA 1XSIA 2BVDA 1RH9A 3WF0A 1E6NA 1NWUA 1GJUA 5A2CA 4EAMA 3WY1A 3ZM8A 3EDFA 3VNYA 2WVVA 4FLQA 1B90A 3AIQA 1CGWA 2ZXBA 3WDRA 4BQ2A 2FHCA 3N17A 1L8NA 2GFTA 4AD4A 5JUVA 2EPNA 1JYVA 5JH8A 3WDJA 3WH6A 3S6TA 1OWQA 1BTCA 3ZO9A 3W82A 1PX8A 2Z1KA 1MWOA 5HOSA 5A3HA 1FHLA 3OLEA 3VUPA 2BXZA 4TTUA 3WH9A 4UOZA 1GOMA 3VGHA 3VX0A 3W38A 3M7SA 3WNLA 4UFLA 4UQBA 2CYGA 2WK2A 3L4XA 2YDRA 1O7AA 1OIFA 2YA1A 2XYLA 5A8QA 1GVYA 2JIEA 5CXPA 1ZU8A 4M56A 1JAKA 1J0KA 1P6WA 1KWGA 4JKLA 2VR5A 3WKZA 3W24A 1UKOA 1UKTA 1W9DM 3WBEA 1NQ6A 4IPNB 1LLOA 4J3SA 4AZCA 3VD4A 2YIHA 3WELA 5CGMA 2VUYA 1QI0A 1VFFA 3DC0A 1CGTA 3K8LA 4DUVA 4PMNA 2GDVA 2ZUUA 3W28A 4PEEA 4ZXLA 3JUGA 1K9TA 1EQCA 1DWIM 1PJ9A 3AIVA 3AS0A 2ZUWA 1E0XA 4OOZA 3AMLA 2WWDA 4JIEA 3SUWA 4H2CA 1E5NA 4UCFA 4OBRA 4U2YA 2G3MA 1H41A 3GH4A 3TONA 2UY4A 3W81A 4M81A 4FLRA 4LGXA 4FLSA 3G6MA 1H49A 1C8XA 1WNOA 4GO9A 1DP0A 4LYQA 4BCEA 4W8BA 4R5EA 4QLKA 5A8NA 1E5JA 1HJUA 4MNLA 3U7VA 2A3AA 2VX7A 3CPUA 4BS0A 1HN1A 3CUFA 3GH5A 1CENA 4WIWA 4U5KA 3ZT5A 5FKYA 1W2PA 4PBGA 1W32A 3W6LA 1UWQA 2GVYA 6CGTA 1UKQA 5E9AA 4N42A 1W9XA 2XVLA 4PUDA 1J18A 1VEOA 1ISZA 3VKKA 5AC4A 2WPGA 3VIIA 2CPUA 2GJXB 3RO8A 1KBBA 3VIJA 1CBGA 3ZSTA 4ACZA 3WD4A 4AZHA 1GVIA 1XC6A 3PZVA 1C8YA 1UH3A 4F9JA 2JE8A 4TX6A 2WVVB 2J7CA 1BPLB 2VQTA 4YN5A 4CU6A 1K9FA 4GIAA 5CPTA 3ALFA 1ODUA 1V02A 3GXMA 4LPCA 5I2UA 4ZENA 1QNQA 5A6LA 2D3NA 2YL5A 2XFYA 3WDQA 1XSKA 4RE2A 1GUVA 1BGGA 1H11A 5A8PA 3OZOA 4UFIA 2GSJA 1BG4A 3ZIZA 2UWFA 4JL2A 3SIMA 2TAAA 3B9DA 5GPRA 3WDIA 4UQ9A 3UG5A 3VD3A 4PTVA 4FMVA 4Z2GA 2ZIDA 4PMRA 1OBAA 3KL5A 3N13A 5I5RA 2BV9A 2VC9A 1XGZA 4P8UA 4AZGA 4XB3A 2AMGA 3GNRA 3WMBA 1ODZA 1JYNA 2W63A 2CETA 3J7HA 1G9HA 4KRUA 3L4TA 1SMAA 1QI4A 2XVGA 1F4HA 3CMJA 1DWJM 2GDUA 1NWRA 2XPKA 1MQRA 2D0HA 3W6MA 2YDSA 2WXDM 3WENA 3KWXA 4D1JA 1HJQA 3CZLA 3N15A 4E2OA 3KEHA 4BQ3A 5I6SA 1E1EA 2QMKA 3E1F1 1G1YA 1MW3A 3WNOA 7TAAA 1CLXA 1Q6FA 5I78A 1BHGA 1C92A 2V38A 1BF2A 1BGAA 2W66A 1FHDA 2DQXA 1TZ7A 2VRQA 1BG9A 3SCOA 3CHEA 1A3HA 2ZUSA 3O9NA 4JFTA 4NF7A 4WLCA 3T2OA 3F4VA 1BYAA 1BYBA 3WF4A 1E4LA 1ITXA 1UYQA 4XZWA 4J27A 2GJXA 3WUGA 4CU7A 5BRPA 1CXKA 2DH3A 2EPKX 1E15A 5FL0A 2WC3A 3WH7A 5E70A 4AZIA 2F61A 3RJXA 4AZBA 3BGAA 4P7OA 1U33A 1D2KA 1H1NA 1QPKA 2X05A 1QI3A 2C0HA 3GZAA 2ZX7A 5E6ZA 1V08A 2OYKA 2XIBA 3ZJ6A 2WKGA 4QP0A 4XX6A 3WUFA 4WKHA 1QBBA 4EKJA 2YBUA 1CXFA 3WF1A 1JZ3A 2HISA 1QVBA 3N1AA 1E55A 3ZR5A 4U3AA 1IV8A 1ISXA 2YA2A 4PMZA 1WDRA 3CBWA 1KFWA 5LYRA 3VD7A 4YPJA 2J7HA 1MW0A 3MU7A 5EMYA 4EE9A 1UOKA 1V6XA 2YL9A 3IAQA 5C8BB 3LPPA 1EHAA 1EH9A 2E3ZA 1GPFA 1LL4A 1HJWA 5M3WA 1JZ7A 1C8QA 1UWTA 4MTVA 2EPMX 5FD0A 3ECQA 1CGYA 5AC5A 1E6SM 1DWFM 2G41A 4UOQA 1FH9A 1PEZA 2VL4A 3BMVA 1V02E 2DIJA 2O9TA 1BLIA 3DHUA 4GZIA 2J7EA 3WNKA 4JHZA 1W1YA 1GJWA 4P7NA 5KZ6A 1JL8A 1B3YA 4ZE5A 3SUUA 1V0NA 4IISA 1UWRA 4JFUA 4WJXA 1ISVA 2BY3A 1XH0A 1J0JA 2E8ZA 3AIBA 3EMCA 5LA2A 2YA0A 3AZRA 1US3A 1HP4A 3A47A 5CLWA 1ESWA 1GQLA 3OG2A 3AZSA 5I0DA 4D6JA 3PZMA 2NW0A 1VAHA 2DSUA 3AI0A 4HZ6A 3CMGA 3FHQA 2WMIA 1U2YA 5HXMA 4EANA 4J7RA 3BCFA 3OGSA 1TUXA 4B9ZA 1E43A 3U5UA 2X2YA 3VGEA 4Q22A 4CVUA 3CTTA 5A6AA 4NRSA 1FH7A 3QOMA 3TTOA 1VJZA 4D6IA 1GHRA 3GXFA 5A8MA 4Q7NA 4MPKA 1QW9A 1MQPA 2ZUMA 3VX1A 1GOKA 3DYMA 3PZUA 1PZ2A 2WHJA 4OIFA 1JDAA 4W5ZA 3AQUA 1UZ4A 3W29A 5CJ5A 1JI1A 3I3DA 3UR7A 3ARQA 2X09A 3VGGA 3A4AA 4ACYA 1TMQA 2PBGA 1W9VA 2WMHA 3T08A 3VIHA 5DO8A 1MQQA 4L4OA 2MANA 5E0CA 1KR0A 1E73M 1DWAM 3VDAA 1ITCA 2DT1A 2O9RA 4ZFMA 3VO0A 4CCEA 4JFVA 4PMQA 4XZBA 3SEPA 3WIJA 5JBFA 3CO4A 4MAVA 1TCMA 1GCYA 2QHAA 4FLOA 4WSKA 5LA0A 5BWFA 3GBEA 3UETA 2XFFA 2DPEA 3CUJA 3NSMA 5I23A 1WB0A 5E09A 4TVDA 2XFRA 3IAPA 3WF3A 2ZXDA 1UG6A 1BAGA 3D5HA 4TVCA 3AMKA 2J25A 2OSWA 4M29A 4UTFA 4NI3A 2VZVA 5IXEA 3MO4A 2WYSA 3RILA 1UD4A 3WUBA 3DHPA 3QR3A 3L4YA 4H04A 2JF7A 1WPCA 1AQHA 1XH1A 1NARA 2WZEA 3QGVA 1J0YA 2OLHA 1UR1A 1XH2A 4JCMA 1KCLA 1OT1A 2FH6A 4AIOA 4H8UA 1AQMA 2IXVA 4B3KA 3BAWA 3VD9A 3QHOA 1I1XA 5C70A 5CLTA 2F8QA 4J3XA 4W93A 3BH4A 3GXIA 4M24A 2RGLA 3ZJ8A 2BHUA 4C7DA 4PMOA 4CCCA 1SYTA 3FNDA 4KMQA 5IFPA 1R8LA 4HMCA 2ZUTA 2QLYA 1KGUA 2OWXA 2YL8A 4LYRA 1UR0A 2VO5A 3ZSSA 4CN6A 1JYWA 1UD6A 2JALA 2W62A 5E0FA 2WSKA 1Y7VA 4GINA 1TG7A 3T0DA 4X0NA 4M8UA 5GNYA 4MJ4A 3AYRA 1MFVA 3EBVA 1V0LA 1X1NA 1JXKA 3OLIA 5DFAA 4MNJA 1EA9C 1Q6GA 5A1AA 5BXPA 1D7FA 5ECUA 1WDSA 1B1YA 4ZE4A 4U3CA 3PZGA 4M80A 4BA0A 5FOOA 1VFUA 1S46A 2VX4A 1VFMA 1OIMA 1RPKA 3CHFA 5EFFA 4M1RA 3VGBA 1WAWA 8A3HA 1EGZA 2ZWZA 1E1FA 1UH4A 1QI2A 3IJ8A 3NSXA 4AZ6A 1C91A 4HPGA 1AVAA 4QLJA 4W7WA 1YQ2A 1V6YA 4HZ7A 1GW1A 1HXJA 3KE0A 4KGLA 3WDPP 3PBGA 1EOMA 3PHAA 4P7LA 1OB0A 1XYFA 1HVQA 3AS1A 3AFBA 2PI6A 5CG0A 3K8KA 3PZQA 1H3GA 1W9BM 3A4WA 1ISYA 3B9EA 1WO2A 2VCBA 4PTWA 1W1PA 2O92A 4J3UA 4PN2A 4W7UA 3CUHA 2B31A 3TP4A 1ZBVA 1E3XA 4BQ5A 4DWSD 2DT0A 4Z2JA 4CD4A 3LMYA 2J75A 3AICA 3CUGA 1QHOA 2PWDA 3RM9A 1ZBCA 3N12A 1XSJA 4JHOA 4HMEA 4OJYA 3RPMA 4HZ8A 2BVTA 4JKKA 3PTQA 4R27A 3VIKA 3TOPA 2WLYA 1NWTA 3BLPX 1JI2A 4H8HA 1VEMA 4L4PA 3GTNA 5A2BA 4MB3A 2CHNA 4UFMA 4P7QA 1E4NA 4PSRA 4JZ5A 4AC1X 4MDPA 2VZUA 2VOTA 3ZJ7A 4E8CA 1MYRA 3QOKA 3NIYA 2A3HA 1EO5A 4RE4A 1DWGM 3CGTA 4RL3A 4Z2IA 1WZKA 5AYBA 5ABGA 1A47A 1UQYA 1ISWA 2E9BA 3AISA 7A3HA 1OD8A 1E72M 3MUAA 5D4YA 2ZXAA 3SUSA 4MJ2A 3EDKA 1B9ZA 1W3JA 1H0GA 3SCQA 4K68A 2CBUA 4P8WA 3CIVA 5DT5A 4U2ZA 3RM4A 5EFDA 4HOZA 3CLWA 5I77A 1HL9A 1TFVA 1N82A 2OSXA 3LPGA 2VCCA 2DT3A 3A4XA 1LWHA 1B30A 3AJ7A 5BYWA 3RM8A 1DTUA 2Y24A 2EBNA 1YHTA 3VIMA 1W3KA 1BVNP 3WD1A 4UR9A 2VNCA 2Y4SA 1M03A 2DSVA 4KH2A 2UY5A 4PTMA 1E71M 1WZLA 2XG9A 5HPOA 1UR2A 2BVYA 1VB9A 1J12A 3BLKA 4AZ7A 1JNEA 4JFWA 1QNOA 2JEQA 1HX0A 3WQ4A 2ZX6A 1VENA 2CXGA 2WVUA 4AYSA 3SCRA 4UQEA 1M01A 2UY3A 1D3CA 2CBJA 3G6LA 1E6PA 3HU7A 1JXJA 1E6ZA 3FW6A 5FCZA 3NDYA 4MB5A 2RGMA 1PIGA 4HP5A 4H8VA 4MADA 5CSYA 3UR8A 4D72A 4HU0A 3AHTA 3VINA 3AMCA 3BMWA 1LJYA 3ARVA 2YJQA 1V6WA 5A94A 4GO8A 3AHVA 3F5JA 5I24A 4GQQA 4W89A 4S3KA 2D2OA 1HVXA 1O6IA 2EEXA 1X6NA 4AZ5A 1DWHM 2VRKA 4AIUA 1HL8A 2Q8XA 3VMPA 3VDCA 5M03A 1QHZA 5JIPA 1CPUA 4MAZA 1FH8A 1W2VA 1B3WA 2WANA 3L4VA 1JD9A 1CYGA 3AIEA 3WQ8A 2PF0A 2J47A 3EDDA 3T0BA 1NWSA 2J7BA 3D3AA 4CGTA 3WQ5A 4OUEA 2CNCA 1NOWA 1CDGA 1WDQA 1CXEA 1JF5A 1PIFA 2ZE0A 4F79A 5HBFA 1ZBWA 5A8OA 3BAKA 1ZB5A 4MDOA 1LQ0A 1CGXA 3MKKA 1EQPA 1V6VA 3SCTA 1TR1A 1CGVA 2DH2A 1FFQA 1QBAA 1C7TA 2V3GA 4W8LA 3T2PA 2BY0A 1CLVA 3MSDA 3MV01 4GXPA 3M6DA 1V0KA 1HKKA 3ARTA 4P7RA 2FGZA 3L4ZA 3M46A 2BHYA 2XWEA 5I79A 5C71A 3WFLA 4DWSB 1V3JA 1UWSA 1UD3A 2YOCA 2O9OA 1R87A 4GPNA 4UZUA 3AHXA 2WZHA 1Q6CA 5BRQA 4P8XA 1C93A 4D6FA 3NUKA 2VX6A 3I3BA 4C7FA 3ARXA 1KXTA 5A6JA 3AOFA 5M17A 1IZJA 3W0KA 3N9KA 4HU8A 2OYMA 1HT6A 3WD2A 3AIRA 3VGDA 3NSNA 4ATLA 1KQYA 1UQZA 2CESA 4GZEA 1V6UA 1ZJBA 3QHMA 4YHEA 6A3HA 1I75A 3VU2A 1CZ1A 5BROA 4TXEA 4D6EA 3WQWA 1J10A 4HOWA 1GOQA 4MB4A 3WD0A 4GKLA 3A3HA 4AD5A 3AMGA 2C8NA 1F4AA 2XGBA 4DM2A 3OBAA 3VMOA 4CCDA 3OGVA 3ZMRA 4WKAA 2FHFA 1UD2A 3OZPA 4PRWA 1UZ1A 1Z32X 3N18A 1KXQA 2A3BA 5JBDA 4PMXA 1MW2A 1MFUA 1BSIA 4DWSA 1GONA 1CXLA 2WMGA 1JDDA 4N0RA 5CQ1A 1MW1A 4PSPA 3ARPA 2BXYA 1KGXA 3CZJA 2CCRA 1UA7A 3ZQ9A 4W88A 4J3VA 4WF7A 2WVSA 2GJPA 3WMSA 4U31A 3ARRA 3BXWA 2EO7A 1DEDA 4UOJA 3VTRA 1OT2A 3CZEA 2VT0A 3DYPA 3SCUA 2YBTA 4NRRA 4EK7A 1NP0A 4DUWA 2W67A 4BF7A 4A3YA 1RP8A 2AAAA 4Z2LA 1J9YA 1TVPA 2J4GA 5GNXA 2PWHA 1HKMA 1E0WA 2VTFA 3FXYA 3PZIA 3AIUA 1KBKA 4AISA 3FY1A 1B2YA 2D23A 1OINA 3UEQA 1H2JA 5KEZA 2DGAA 2G3JA 3NCOA 1QNRA 1HP5A 3WEZA 3WNNA 4IUGA 4ML4A 5D9NA 4V28A 3ZT7A 2D0GA 4UQAA 3WFZA 2ZX9A 1FP8A 3RCNA 4D71A 1W91A 1OSEA 1EIBA 3VIOA 2WZIA 1J0IA 4W7VA 1UKSA 3CZ8A 2Y2WA 4LQ1A 2CHOA 1JZ2A 1JG9A 1XV8A 4CN1A 2GK1B 5BXTA 3N11A 1CGUA 2XVPA 3KL3A 2IUZA 1PBGA 3CHDA 2BY2A 3W27A 3K4AA 4XUYA 2C7FA 2JIWA 3TA9A 1J0HA 1W9PA 3OA5A 3ALGA 1AMYA 4P8VA 1KB3A 3KZSA 5A6BA 2FGLA 1PPIA 4NZCA 1WZAA 4OBSA 2ZWYA 1ZBKA 4QCFA 3GYCA 3AYSA 2WHLA 4J28A 1ZS2A 4HTYA 2D24A 1ZJAA 3CZGA 3K8MA 3W37A 3AXXA 1GQIA 1WE5A 1UUQA 1JNDA 3OB8A 3MMWA 3BAIA 5D8ZA 3K46A 1XD0A 4Z2HA 1UWUA 5CPQA 2NT1A 5D9OA 5JBEA 3VGFA 4DM1A 3VNZA 1CNVA 4J3TA 3VM7A 1W3HA 2DT2A 1OD0A 1V3MA 1QOXA 2CITA 1HJVA 1V3IA 2PWGA 4JL1A 3SURA 3EMZA 2V3FA 2EXOA 2AOSA 3WQ6A 2J7GA 3CH9A 4W5UA 3U7BA 1VBRA 2PWFA 3B8SA 2E9MA 4OZOA 3B9AA 3IK2A 1UWIA 2WMIB 4TUFA 3ZOAA 3DYOA 3AS3A 3N04A 4TTGA 3AHZA 4AXNA 4AWEA 4X0VA 3O6AA 4AEFA 2QPUA 2PBOA 4M82A 2Z1SA
chains in the Genus database with same CATH superfamily
1JCMP 2NSXA 1OEPA 3WO8A 1A50A 2ZXQA 4C6EA 1V0MA 3GRIA 3IACA 1Q6EA 2GWGA 3WBAA 3L67A 1NM9A 3R11A 1MEIA 4QGCA 3PZOA 3T8LA 2Z00A 1PAMA 2VELA 4CVWA 5HUOA 3T78A 3QKEA 2ABAA 2P88A 1SZEA 3WLQA 2YKKA 1G67A 1KCKA 1TIWA 3RO6A 5HJXA 5K7JA 2EPLX 4Q8UA 4M3PA 2NT0A 4HIBA 4UNIA 4CQCA 1PDZA 4DB7A 1S5WA 5I3IA 4AD1A 5GPGA 1OFAA 2OT0A 4U5IA 1CT5A 4YVXA 3AROA 4LAMA 1WUFA 2ZICA 1DXEA 3V18A 3Q2DA 2OFJA 2YL6A 5GJPA 1DKWA 4KRTA 4NIRA 3SFKA 1XINA 2GOUA 4O8RA 3OODA 2ZZ2A 1SZFA 1OCJA 1J96A 2DZUA 5K4ZA 4HMDA 2ZDRA 1V79A 2QMJA 3K13A 4ACZB 3R0KA 3HFTA 5DIUA 2Y8KA 5LHFA 4V2XA 4MFDA 3FAWA 1E3ZA 3PUGA 2A4AA 1U79A 4PUEA 4AW7A 2G3FA 1MXDA 1B3VA 4GABA 3FS2A 3MS8A 1VRXA 3A3WA 4PMYA 4Y9NA 4RW5A 1K9DA 1M41A 3L5MA 2F2KA 1GOIA 5K4XA 1TVNA 2XJ7A 3ARZA 4XIMA 4F66A 2GGIA 1T11A 3KFTA 2V5DA 2V3EA 1JNSA 4ZGYA 4DPPA 3TVAA 5JIWA 1RQBA 4TOQA 1JZ4A 2WMKA 2X16A 4DXXA 1R5YA 4QJ1A 1LOQA 1WDDA 3UWYA 4NZ3A 4C7GA 4DO7A 3OTRA 4KWUA 1Q3NA 4QDWA 1LF1A 2VFHA 4IPLA 4GCAA 1NELA 4AVNA 2Z7GA 1C90A 1XIIA 2EJ1A 2EQDA 5HNTA 1J5SA 2WC4A 1UD8A 1V3KA 3SCVA 3NL3A 4DN1A 1I1WA 1UR8A 4CD8A 4RPPA 2OWWA 4QJ3B 2C3ZA 4EVZA 3POHA 3B4UA 4MSSA 2GSEA 2WSPA 5DT7A 4J2MA 1G7VA 3O5LA 2YCKX 3AMDA 3T0AA 1HXVA 3UVAA 3VKBA 5I3FA 1SGJA 1UD5A 4RE3A 2D69A 3HG3A 1XCXA 3U3HA 5T8GA 1GG1A 3XINA 4GIVA 5HNNA 2ZADA 4J2PA 1T8QA 2CKRA 1EFZA 2JKEA 1XIHA 4O4WA 4TYOA 4LUTB 1SFSA 1E9LA 3GXTA 4KCVA 1BXBA 3CQHA 4DI8A 2A6NA 4FX7A 4NJHA 4PMJA 5AC8A 3DECA 3RFWA 4HYWA 3L12A 4IIFA 1R7AA 2XIIA 2DDXA 5DCEA 2C79A 4QEEA 4DWDA 3P0XA 1TE1A 4ATDA 7ODCA 1KLYA 5M5DA 4H83A 3EA3A 3SCSA 2DSWA 1CX9A 1CXHA 1VJSA 1XUUA 4MWAB 1LL6A 4LYPA 3HJEA 3VDHA 1FKJA 3UG3A 4QFUA 4BQ4A 5EA9A 4AFYA 4UB9A 1EWDA 1R9XA 3C8NA 4IP4A 4IFOA 4PH6A 2CEQA 1OGGA 1GTHA 1ZTVA 3UXAA 5AC6A 3UESA 2QULA 4FO4A 2H90A 3U5YA 2E0PA 2O9PA 3B8UA 2O55A 4BY3A 3AUOA 4DRJA 3GG0A 2WKJA 7CGTA 4ES4A 4M7SA 3TAOA 4W9PA 1EXPA 3ZR6A 3V1HA 3DKLA 4H00A 4ZXOA 5B7YA 3SGUA 3G1RA 3OZYA 4O53A 4S1FA 4A6GA 3NDZA 3T55A 2PURA 3AIWA 1UPMB 5DMYA 1QNPA 4F8XA 1TV3A 1VPXA 4JTUA 3L2MA 1KCZA 3O5OA 2DVXA 2GK1A 3KVKA 2Y8VA 4QAWA 2ACSA 1MEWA 1R0MA 1EHNA 2FZ8A 3ABSA 2OQHA 3LPFA 5AVHA 4MPQA 3SCWA 4Z2KA 2INEA 3TC7A 3RIKA 3PK7A 1TPVA 2UZ9A 4K1WA 3S6OA 5HWJA 3VMNA 1GZJA 5ABHA 2CLLA 3W7PA 1FDJA 5I3HA 3CB8A 3HG2A 1P1XA 2OU4A 4YTQA 1WZMA 3STFA 1YPXA 3HGOA 3FAXA 1XHGA 3H54A 4MNMA 4NXSA 5DELA 2PWEA 3A6OA 4OGZA 2GDQA 3S2CA 2PC8A 1GVQA 2E9LA 5C5YA 4IJRA 4ZEPA 3SCPA 4MWAD 4BI7A 3OGRA 3LU2A 3E0WA 3NZ1A 4DEFA 3U0HA 3SN1A 3VAWA 2G4FA 2QDHA 2YCIX 2PV1A 5HQMA 1YATA 2PPNA 1HJSA 2VGIA 1DJZA 2P0IA 4TX8A 3IJQA 3ZWTA 1HKIA 4RV8A 1OG0A 4QBXA 4WEVX 3EEGA 4PMDA 2A3EA 1BFNA 2E6AA 2V2DA 4R34A 3DFQA 2Z2AA 3LK6A 2V2HA 3MO7A 3ARYA 4K7VA 4C1NB 1AODA 4D6HA 4ORIA 2CZFA 4E3TA 3MUXA 5I02A 1E0TA 3WN6A 3TV8A 3GE7A 1POJA 1TUFA 4S2CA 2G8ZA 4D8ZA 1KQZA 5EYWA 2X0YA 4C6KA 1FKGA 3UG8A 1RHCA 4H4IA 3VAVA 1DIDA 2ZC8A 4DROA 1SU5A 3PFRA 1REQB 4IM4A 4FOKA 5I3DA 2J8FA 1C3FA 4A29A 1W5MA 2J79A 2HVMA 3P67A 2QDEA 2CLIA 3EIPA 1QW8A 1VP5A 3OVPA 4PTDA 1E0UA 4O0KA 1XYCA 3TWAA 3RGCA 3SJNA 1G5AA 4EXBA 3B97A 4MB1A 2ZX8A 4EWND 1KR1A 2VD9A 3U48A 4H7VA 3RR1A 3E38A 5HMSA 3LV6A 3SUVA 1FKWA 1OFPA 3EOOA 3I6EA 5BU6A 1R3RA 3CJPA 4IX0A 3SDOA 1W5QA 2PPGA 1X6UA 2ZC1A 5AKQA 4LALA 3TA6A 4DO5A 3TFCA 4AD3A 4X60A 5BCAA 1V03A 1TPUA 4ZR8A 4FA3A 1TJ0A 3GNPA 3K4DA 4S2BA 4W84A 4IIEA 2J62A 2P3ZA 5DRIA 2ZUNA 1VEPA 2Q02A 2GVLA 3WMCA 4GI6A 3DBNA 3SFWA 1VIWA 5D9MA 7ENLA 3R10A 3ZFHA 1TKKA 3AS2A 4PYSA 5BXSA 3LI1A 1Z89A 1X1ZA 6XIAA 5XINA 1B6CA 3LQLA 5ECVA 3O5KA 1J2WA 4G8TA 2E4TA 1JAEA 5DMLA 2WOQA 2WNWA 3L4UA 3AYVA 4DLFA 4EP8C 4CN4A 1RLCL 2F38A 4N9EA 1W8GA 2JEPA 1J93A 1SZGA 1VS1A 3REQB 3CAWA 4H9TA 3IRSA 3WEMA 2BVDA 3RPDA 1MO0A 4ALDA 1RH9A 1GJUA 3VOFA 1P5BA 1OK4A 1UOZA 3VNYA 1ONRA 2NWRA 1QAPA 1EZ2A 3W7EA 1RBOB 2WVVA 1G4SA 1B90A 3AIQA 2CZEA 4H19A 2ZXBA 1NIUA 4BQ2A 1BD0A 2FHCA 4PA8A 3CAKA 1L8NA 1FCBA 5FF2A 4Q8VA 4XZHA 3WDJA 4CNPA 3W82A 1VCGA 4ML9A 1MWOA 4C6CA 3OLEA 3VUPA 2BXZA 1D9EA 1W3NA 4TTUA 3WH9A 2LJ4A 4UOZA 5FEZA 3TTEA 4ERAA 3M0ZA 2FIQA 3BURA 3VX0A 3W38A 3QYSA 3DOPA 2PN0A 3WNLA 2PRMA 2HXTA 3SGGA 4UQBA 2CYGA 2WSQA 4PUJA 3FJLA 4K36A 2YDRA 1XF0A 1KFEA 4FX8A 2YA1A 2XYLA 2PV3A 2JIEA 5CXPA 4C5YA 1ZUAX 2A7PA 4Q4MA 1H7WA 3WKZA 1XIDA 4MM1A 1UKOA 3KRBA 1NQ6A 1DIOA 1YNYA 1IEXA 4F0SA 4GYKA 2HE8A 3VC5A 5CGMA 4ZQMA 1VFFA 3DC0A 3SAZA 3K8LA 4Y8EA 1A5LC 3JUGA 1EQCA 3BARA 1PJ9A 3AIVA 1E0XA 4OOZA 3W85A 2RURA 2PUZA 2Z1XA 3C3NA 3GAKA 1E5NA 3D3FA 4OBRA 4NZ5A 5C9UA 3O5DA 4YYCA 2UY4A 5BOEA 3W81A 1WOAA 5F1UA 3HZ3A 3HB9A 2G96A 4IFKA 1H49A 4IG2B 1AH3A 4BCEA 3GAYA 4QLKA 3GVGA 1NSJA 2HTMA 2Y7EA 2X42A 3LSCA 4Z0SA 1PZ1A 3H70A 3U7VA 2VX7A 1E9IA 4JTAA 2Y61A 4JTFA 3LY0A 4ZQNA 2CLKA 4QROA 3CPUA 3SW6A 2M2AA 1SO3A 5D32A 3GH5A 1FJDA 4WIWA 3ZT5A 4RUBA 5FKYA 4NILA 3GHSA 2Z25A 1W32A 3W6LA 1F6YA 3S3GA 2GVYA 4N9BA 1UC4A 3NXLA 1UKQA 3C2VA 1QFEA 2F4EA 4XBKA 5E9AA 4N42A 4PB4A 4PUDA 3DG6A 4FOJA 1DTNA 2HVOA 3FXGA 4LWWA 3FEMA 4XSMA 3RO8A 1CBGA 3GNXA 2E5DA 2FJKA 4ACZA 1YKWA 4JTIA 5BWAA 3PB2A 2NQ9A 3O5PA 4NAFB 4FI4A 2H3BA 2J7CA 3L0GA 3GIYA 4AWUA 3KRSA 4GIAA 4Y9MA 1IZCA 1Y0OA 3BK0A 1F5ZA 2I14A 3MTWA 1QNQA 3H26A 2DU2A 1J4IA 2YL5A 2XFYA 4MKNA 5FJJA 1VH7A 4Q32A 2FZ9A 4UTKA 4UFIA 4INFA 2GSJA 2FB3A 3H2CA 1G6CA 3EX6A 3H7VA 3BMXA 4FIRA 3SIMA 2TAAA 3B9DA 3FLUA 5GPRA 3PWAA 1GRJA 2VGFA 3T07A 3U2OA 3HBLA 3O6YX 1K7XA 3VNDA 5LIYX 5KITA 1XJBA 5I5RA 2BV9A 2PE4A 4P8UA 4MLJA 1JYNA 4WSHA 4MIMA 2W63A 2CETA 4JEQA 2ZRXA 4FXJA 1X7FA 1SMAA 1Z44A 3DHFA 3KZ7A 3RAOA 3EA1A 4HHLA 4BR1A 5G2IA 4FNSA 1NWRA 4OV4A 2R6OA 2VWSA 2YR1A 3WENA 4Q4RA 3KWXA 4D1JA 1HJQA 3N15A 2QJGA 4A3RA 3KAFA 3E6EA 4Q4PA 1K8CA 3E2RA 4ZZ9A 1DIKA 5KZEA 2Y70A 4TNSA 4TIMA 2DQXA 3QY8A 2HWGA 2LGOA 1IXOA 2VRQA 4IPPA 1MDRA 3GHUA 4A8NA 3CHEA 1AA1B 1LT8A 3O9NA 4EF8A 3O0KA 4EPBC 1BYAA 1X7IA 3WF4A 1QZ2A 3A23A 4ITZA 1G4TA 1PYMA 2GJXA 4F40A 4LNCA 5BRPA 4C6FA 2VKZG 1CXKA 3MI6A 1I4NA 1E15A 4HN8A 3CMFA 5FL0A 1JJKA 4AZIA 3FVMA 4DRNA 3UZWA 3KOZA 1U33A 2QPXA 1QO2A 1QPKA 2J9ZA 3WBWA 3GZAA 2ZX7A 4IGNA 1O60A 4K39A 3GDRA 3ZJ6A 1W54A 3G3DA 3WUFA 1G69A 1QBBA 2YBUA 1BWKA 3D0CA 2OOFA 3FX4A 1IIHA 2HISA 1QVBA 1E55A 3UGVA 2B81A 2W79A 4PMZA 2Y6ZA 4PC8A 5EMYA 3MCOA 1UOKA 1LBMA 1V6XA 2YL9A 1HUVA 2Y5JA 4HCLA 3LPPA 7REQB 1HJWA 2PAJA 3E12A 4R3UA 5E93A 4JY8A 5CJMA 5M3WA 4X22A 3NQEA 2EF9A 4MTVA 1FWCC 2EPMX 4RDYA 2YX0A 1PV8A 4HN4A 1D7IA 4JDBA 3JR2A 1DWFM 2RJGA 3GTFA 1VHCA 1DJXA 3DFNA 1ME9A 3SRHA 2DIJA 4GZIA 4XBSA 1EPXA 1GJWA 4ODMA 1JL8A 3P5ZA 3SUUA 1XIGA 2R1MA 3QPEA 4ZB0A 1J0JA 2B7NA 1O1ZA 1U5HA 1N2VA 3P7YA 1QK2A 2PDUA 4AX6A 3W1AA 3AI0A 4HZ6A 3FHQA 3MP3A 5MF5A 4J5NA 5HXMA 2G4JA 4EANA 4J7RA 2QZRA 3BLLA 3CO8A 1TUXA 1E43A 1EPVA 3W2MA 2PDYA 3KTCA 3VE7A 4ZO9A 3OG3A 1XXXA 3BWWA 3R89A 1ZFJA 2AWGA 4ZS6A 1EC8A 3WQOA 3UZYA 2OELA 2A3LA 3QOMA 2OQLA 3CIXA 4LUJA 1GHRA 4Q7NA 4AB4A 5DITA 1TTPA 1MQPA 3VX1A 1GOKA 1PZ2A 2WHJA 4C6OA 4W5ZA 5CJ5A 3I3DA 3ZVHB 2C15A 3P82A 5HMEA 3ITTA 2O56A 4L5ZA 3FAPA 3ABXA 3GUWA 2WMHA 3VIHA 1TV4A 1A53A 1MNZA 3NVTA 2BODX 1TV7A 3MDYB 3LM3A 4JYEA 1E73M 4I6KA 4LT9A 2DT1A 4O10A 4AG0A 4LF2A 3VO0A 4CCEA 4RZ5A 3A24A 4DRHA 3SEPA 1T40A 4LY4A 3LM7A 2GWNA 3CO4A 5LA0A 4FIQA 2PP1A 3GBEA 3UETA 2F7FA 2DPEA 4AY8A 1YBQB 4NXKA 5HR7A 2ZE3A 1VCVA 2ZZ5A 5I23A 4K8EA 5E09A 3P74A 2FDSA 3D5HA 4YTSA 1RK5A 2J25A 3D6NA 3NM1A 3O1NA 4M29A 4UTFA 3TSDA 2D2GA 2QNEA 2VZVA 4FZIA 1IX5A 6REQB 3L4YA 4GC3A 4LU0A 3QGVA 2OLHA 3HPXA 1UR1A 4YL2A 2PU1A 3N2MA 4N6FA 1QXLA 3QBUA 4H8UA 1AQMA 3VDGA 3L23A 4N7QA 3A5FA 4LB4A 2GGEA 5C70A 3W1QA 4W93A 1QT1A 3BH4A 3GXIA 2ZZ6A 2RGLA 4GZ7A 4CCCA 3DG3A 3FNDA 1VD6A 3TCSA 5BOOA 1W3TA 4HMCA 4RKAA 3M0MA 3CUXA 4B4HA 3DFTA 1L2QA 3QN3A 2Z4GA 3AU6A 1UR0A 4JYDA 3ZLFA 4Q8WA 5E0FA 2XPAA 2Y8UA 4IGMA 4P2VA 5EL1A 2POZA 4CCZA 3L5AA 3JW7A 4U28A 3T0DA 4X0NA 1ITQA 3LV5A 3WLRA 4MJ4A 4H9XA 1MFVA 4ZPTR 3IRDA 1V0LA 4JDYA 4DZ5A 1Q6GA 1J4EA 3HG5A 3LS9A 1D7FA 3R8RA 4AF0A 2QUTA 4AYGA 1WDSA 1A3XA 1YDYA 5BMWA 3PZGA 4M80A 3C52A 1EJRC 5FOOA 3EWBX 1Z48A 2CLPA 4XZNX 4Y2WA 1RPKA 3ZZ1A 3FV9A 3F1QA 1RCOB 1WAWA 3UU0A 2B4GA 4NJJA 5FA5A 3MYOA 4XAZA 1GEHA 1ME7A 1QI2A 3IJ8A 4WHBA 4AZ6A 1QR7A 1OX6A 2AKZA 4LS2A 3LGDA 5FJUA 2PSNA 3O15A 1P0BA 3P8JA 1A4LA 3S5SA 4WGXA 3XIMA 4R7OA 1X96A 3PBGA 3C0SA 3JU2A 1EOMA 1XYFA 3AS1A 3KCJA 2PI6A 5CG0A 1FRBA 3PZQA 3A4WA 3CQ0A 2DVTA 2V2CA 2YCJA 3KTXA 3PUEA 5AZ1A 1W1PA 4J3UA 2ZRVA 4PN2A 2B31A 4O52A 2Z1WA 4O14A 2YCLB 1E3XA 4Z2JA 1TZZA 3PY2A 3NTPA 4GQGA 1TIMA 3SQLA 2IPJA 4EAYA 4PRTA 4HMEA 4JQ3A 1ZP4A 4F48A 3CV1A 3IIZA 2HCVA 2WLYA 3BLPX 1KRAC 1VEMA 3GTNA 4NJIA 2QS8A 4MB3A 3GPKA 1E4NA 7XIMA 1DIEA 1NVMA 2MPHA 3TZNA 3MCNA 1NSGA 2PDBA 4R7WA 3W22A 3QOKA 2A3HA 3VC6A 1EO5A 3EWZA 4WJEA 2MLZA 4Y96A 4RE4A 1D7HA 4O15A 4RL3A 4RJEA 4Z2IA 1JPKA 5ABGA 3V3WA 3BTNA 3GKAA 1E72M 3R8HA 1W1ZA 3KLKA 3MUAA 4LTSA 4A8LA 1F3EA 1B9ZA 5C54A 4CNTA 1LT7A 3LBOA 5EFDA 4HOZA 5C0QA 5I77A 1TFVA 4IIBA 1WOBA 1DPMA 4HQVA 4J4KA 3LXCA 5H8MA 1T96A 3BCJA 5JH2A 3NPVA 2Y24A 4GXWA 3TU9A 4UNKA 3WD1A 3QEZA 2Y4SA 3S83A 1M03A 2DSVA 1Z3NA 3MW7A 4LBSA 3V0UA 1YBQA 4WOQA 3CV2A 2XG9A 3GXNA 3DX5A 2DZVA 1VQTA 2A5HA 3LG3A 3L2IA 1JNEA 1ROUA 3TE9A 1XLGA 1OQFA 2C16A 3NQ2A 3F2CA 1OK6A 3AC0A 4WY0A 1FWFC 2WVUA 1EBHA 2PDFA 1M01A 3HMJG 3WFAA 4YXGA 1K4HA 4HT3A 3HGJA 1B3OA 5FCZA 5C2XA 1X8CA 4HP5A 3BLEA 3AHTA 1KCXA 4ZO8A 3BMWA 1LJYA 3UXDA 2YJQA 2V0TA 4S3AA 1TWWA 2Y1HA 3AHVA 3LQGA 5T26A 4U10A 3F5JA 4GQQA 3W9ZA 2VYOA 1HVXA 3A3XA 3BANA 3BG5A 1YRRA 3LX9A 1VBHA 2VRKA 1HL8A 1D7KA 1X39A 4PBFA 3VDCA 4MAZA 3T7VA 1W2VA 3L4VA 5EU9A 5EY5A 4YCOA 3O06A 1Z7AA 4ZMGA 2GZXA 3MHUA 3OHIA 4H01A 1CDGA 1WDQA 1S5VA 1ICPA 1SZNA 3M41A 4UMCA 3BAKA 2F6XA 1R3TA 4BI5A 4MWAA 5CPLA 1PYFA 3SCTA 1TR1A 2V8ZA 4GIEA 1QBAA 2NX3A 1C7TA 3UFYA 3T2PA 4W9OA 3OO2A 3DFOA 1XRFA 5HMDA 4LS1A 3E2SA 4LAWA 1VLWA 2QR6A 4KT2A 3O5IA 3S47A 2CLHA 4MYXA 3KBVA 3SN4A 2BHYA 3GWQA 3V0TA 4A05A 2XWEA 1FDYA 4WDXA 4TX0A 1IWAA 3QQ1A 3MUCA 1UD3A 3QY7A 2O9OA 4GPNA 2Q5AA 3ZWSA 2PS2A 4UZUA 5G4WA 2Y7FA 2WZHA 1FWTA 4QTGA 4XG1A 3RU8X 3NUKA 1CB7B 2PLKA 4TMBA 2L2SA 4O1CA 2M08A 2KAUC 5IM51 5J8LA 2OYMA 5E9XA 1HT6A 3WD2A 4ADTA 3NSNA 3T4WA 1AW2A 2CESA 3E49A 4JNMA 3SBFA 4GZEA 1EUAA 1ZJBA 3VA8A 4Q8TA 3PG8A 2IPGA 5BROA 3TKFA 3W1XA 3C86A 1FKDA 4D6EA 1CB2A 4HOWA 3KADA 1W31A 5I07A 3BOXA 1GOQA 2NLYA 3AMGA 1F4AA 4DM2A 1ECQA 3OBAA 3VMOA 4E0CA 1OFOA 1FWNA 4C6JA 1K77A 3NG3A 3OZPA 1PBKA 1Y5WA 3CXOA 2NV1A 3M0KA 4N9DA 3THUA 5JBDA 1U5JA 4PMXA 3U6WA 3W7QA 4MZYA 3OYZA 1EQ3A 2PDXA 4IIHA 1Q7MA 4QG6A 3QVQA 3LCGA 4O19A 1YLVA 4MOZA 2OGJA 1MZHA 2CCRA 2NVDA 3MDWA 4DXVA 4F0LA 4QG9A 2GJPA 2EAWA 3KTSA 4QE5A 4UOJA 4XUGA 2H8ZA 3G18A 4HYRA 3SCUA 1O5RA 3K2GA 3Q58A 4BJHA 2CLEA 1NP0A 4DUWA 4EOUA 1SW7A 1S3HA 2X1TA 4Q33A 3KAHA 1X8FA 3W1PA 1FWSA 3U2EA 1O68A 1E0WA 5DRCA 4KETA 3AIUA 2D23A 4GC4A 1OINA 4XZMX 1TPFA 1TX2A 5LHEA 1W8SA 2G3JA 1IEWA 2PPPA 4C6PA 4K37A 3W7LA 1XS2A 3KBJA 3S1GA 5J5RA 4H2HA 4UQAA 2PTXA 2ZR6A 3P2VA 4MWAE 1EIBA 3VIOA 1R3YA 3DUGA 4DZ3A 1PHQA 2Y2WA 4D2JA 1O5XA 1XV8A 4CN1A 5CAKA 2GK1B 1PSCA 2RUSA 3M4HA 4C1LA 1EKOA 3KBNA 3UWVA 3VFLA 2QIIA 5BW6A 2ISSA 1SSGA 4DYEA 2QW5A 3W27A 1TJRA 4RDZA 1U22A 3NZQA 3WK2A 1M65A 4ZCWA 3OA5A 1JCXA 3UYIA 2BSLA 4P8VA 5A6BA 3PR9A 2INZA 3RRXA 2PGRA 4OBSA 4KWVA 2ZWYA 1ZBKA 3BGGA 3TYUA 2HK0A 2WHLA 4UMBA 3PTDA 1MRAA 3DKJA 3EOUA 3TQKA 4RX0A 3MY9A 3BG9A 3UR5A 5D8ZA 3BAIA 3K46A 2NQ5A 3DEQA 2ACRA 5D9OA 1EBGA 3LTPA 4GD0A 4DM1A 2XU2A 4N19A 1SFJA 3RUBL 5DCDA 2CITA 5BRBA 3SURA 3IKDA 4JL1A 1NU5A 3VYLA 3M0YA 2J7GA 1RD5A 3CH9A 4H9UA 1JNTA 3RRAA 4FX6M 4OZOA 1KV5A 1Q13A 3IK2A 2D2HA 4TUFA 3ZOAA 3AS3A 2TSYA 1WV2A 3AHZA 3O6AA 3T6CA 3H2EA 3TLQA 3WJYA 1IT7A 2NXHA 5F4XA 2PC4A 2Z1SA 1HO4A 2XH0A 3MMDA 1RUSA 1FX6A 2VDGA 4XWUA 1EC7A 3ES8A 1G0CA 2NQLA 1XD1A 2E68A 5TIMA 3BSGA 2J7DA 1ZCNA 3HG4A 4Z0JA 2E67A 2Z7KA 5EMMA 2XP5A 3UWEA 3W7HA 3GVVA 4OFCA 5D03A 1S2TA 1A0DA 2X30A 4AY7A 2IKIA 4D8LA 1VC4A 4X2PA 4JXCA 5HUAA 3L4WA 4I9MA 4RNFA 1KM1A 2PGEA 5DMNA 3WH8A 1XWYA 1ML1A 2IPFA 3V5FA 1IT0A 2E28A 4S3BA 4GJ1A 3UVIA 4DNHA 2E09A 4LY8A 4QSFA 3C2YA 3LHWA 2J13A 1W9UA 5CZ0A 5CSUA 1PZ3A 5U4NA 2ZUVA 1W1TA 1NDZA 5FJIA 4GX9A 4C6QA 1ZLPA 4Z42C 4JFKA 2HEJA 3NOYA 1K3UA 1KXVA 3HM7A 2BGSA 3SUTA 1JVNA 1ZHAA 3VE9A 1BRLA 4BZYA 2BOEX 2YXOA 3G0UA 3OLGA 2J6XA 2BASA 3LDVA 4XV0A 2E1WA 2VJXA 4G1NA 1V7YA 4D8AA 2HK1A 4GQRA 3VVGA 4CD6A 2DZWA 1UIPA 1NFGA 2Y85A 3BLIA 3PZ9A 1LG2A 2I5IA 1XYZA 3PTKA 3PRDA 3HN3A 1FP9A 5A5WA 4FP1A 1TPWA 1B4KA 3MSGA 3ABQA 1KTNA 1J01A 4B16A 2PZ0A 3SB0A 4RE0A 1ZALA 3P14A 3NQDA 3LN3A 1RD6A 3NGJA 3WD3A 2QUMA 2HV5A 2YXGA 1Q1CA 3HMCA 4DJDD 4IG2A 5LNSA 1T7LA 4W8AA 3LTSA 4OVXA 3EOSA 1WBHA 2QCFA 3H4WA 1KBIA 4XAPA 1XCWA 4HNNA 1FWRA 4A2SA 1GOWA 2ZVIA 5AYYA 3G8RA 4XVEA 4V27A 4BWLC 4GCXA 4KF1A 3KDOA 2V5CA 1SMDA 1I0DA 4F4RA 2F2HA 1JGIA 1K70A 1IGSA 3RMEA 5LGZA 1BYCA 1TA3B 1V5XA 1VBUA 1J11A 3WLIA 1KTCA 5CJNA 1U5VA 5DEZA 2G5WA 4Z1DA 2WVTA 3CYJA 1H1ZA 1B4EA 4FAPA 4NQ1A 3T9PA 1T0OA 1VBJA 1PWMA 3N6QA 3GLCA 4QE4A 2WKLA 1L0PA 2NV2A 4M0XA 2PWUA 4CNNA 4MUZA 1EP3A 1NMWA 1BQCA 3E0LA 2QXWA 2SFPA 2WMFA 3GZ3A 2ISWA 2CC0A 3W84A 1JRBA 2W5FA 2R1PA 1OCQA 3QRHA 4HSNA 4GRSA 3PTMA 1OFDA 1JFHA 2VFGA 1PX3A 1MRQA 2WHKA 4RXGA 2YLAA 1Q6DA 5FIPA 5LSMA 2DW7A 2XIJA 4LBRA 3IANA 3WUEA 3VM5A 2CBVA 1EGVA 4UTWC 5IOBA 2WCAA 4IJCA 3ZS4A 3USBA 3PZTA 1F76A 3G1YA 2GSHA 3UWZA 4BKNA 4HTBA 4HPHA 4TV6A 2VURA 5HATA 3PJTA 2AGKA 4X9SA 4JTGA 2X8RA 3GDBA 3W83A 2ETNA 3CUIA 3EDJA 4KPLA 4D6GA 2BXVA 1Q6OA 2ZOXA 1PB0A 1OGSA 3THAA 4KESA 4ZTYA 1PS9A 1R3WA 3M7WA 4GIRA 1J0ZA 2HBXA 5AYIA 1A5NC 3W02A 1Q63A 2CBIA 2PGWA 4AD0A 3CAVA 5ABFB 1X6LA 3U9IA 4NX0A 4LNYA 2QJJA 5AY7A 4S23A 3CHCA 3IV8A 1MMFA 2IQ0A 2ZA2A 3MA8A 2ASHA 5IRPA 3UI6A 2FAPA 2PRHA 3NO3A 1AG1O 3VNMA 1JUBA 4G9PA 1YW1A 3DGBA 1HJXA 1ZL1A 3PFMA 4HA0A 2RHGA 4R7JA 3TJ4A 3WEOA 2WWCA 3A9BA 2OODA 1CEOA 4IUOA 3SSJA 4NY2A 4B5SA 1DQXA 1K8YA 1M3UA 4C90A 5D9PA 1P7TA 3PJUA 1GQJA 1UASA 4D6DA 2CIPA 4DT4A 1BVZA 4DUXA 1K7EA 4MNKA 4FN2A 1B3XA 1DQUA 1GOOA 3HQNA 2RKXA 1XFCA 4LVBA 1RSCA 5LGXA 4FNPA 4CQAA 2WJZA 1HQTA 5CGQA 1A5SA 3VOJA 5F4WA 3SECA 1GYMA 3UZXA 2FDMA 3UQIA 2XSXA 3THCA 4GOAA 1SM9A 3FHAA 5A6BD 3KL0A 4MJMA 3GM8A 1DE5A 1G4EA 3GDTA 3LHVA 2FB2A 5IFTA 3RCYA 1E6RA 2O4QA 1NY1A 1FKFA 4ZL1A 3THDA 3UJSA 4RV3A 2YDQA 3EXRA 5E0KA 4GA8A 2NSOA 3NQMA 2XVNA 1XYLA 3TN4A 2PF8A 2I57A 3W87A 2JF6A 3EDEA 1FFRA 4PZVA 4H9MA 4UC5A 3B03A 3KS6A 3NL2A 3NO1A 1W3LA 2HROA 1JDCA 1NQKA 3N4FA 2GUUA 2PDIA 2AQWA 4O50A 1W1VA 1V4YA 3WZ0E 4A3HA 1S1PA 4W86A 3CT7A 3M5XA 1IGWA 1TQXA 1MUCA 2RDXA 3HQ1A 4E4UA 3AXMA 5EMKA 1SFTA 3WK1A 4IT1A 5F2LA 3M07A 2YLLA 4G56A 1B31A 2WO5A 5KMYA 3AXHA 4CD7A 5AZ0A 3RX2A 1R7OA 4S39A 1JZ5A 3KW3A 3IJ9A 1Q2RA 2QGYA 4GYPA 5HNRA 3G3MA 5CPNA 3NQ8A 4R85A 1DE6A 1OG6A 1TTIA 4TVUA 4CQ8A 2QUUA 3KOWA 4PTXA 4DZIA 1UA3A 3BLDA 3LBCA 1GKPA 3MUIA 1XYBA 4LVGA 1H60A 4DPQA 3W4RA 3I7SA 1JFXA 2DSKA 2OO6A 1N8FA 2CLOA 1SO4A 3RF9A 4ASTA 4PR4A 3G1AA 3RXZA 4M51A 3TYBA 4CKQA 3BAYA 3GXDA 4XBJA 1A5UA 3WNMA 4DO6A 1FKLA 2FH8A 2WW5A 4OV9A 2BY1A 3RDKA 2QF8A 4M19A 4MY1A 2BG5A 2J78A 3VABA 4DBWA 4JQ4A 3KABA 2ADAA 1ZAIA 1UKPA 2WMJA 2WCSA 1NMVA 5K2ZA 3ABRA 3HPZA 4QJ4B 1OGBA 8CGTA 1WKDA 5HJLA 2GL5A 2VRJA 1EJWC 1F74A 2WHMA 3UCQA 1B3ZA 4EF9A 1XSIA 1NWUA 4AC7C 4KCTA 3IK8A 2WQPA 4ZQOA 2PGFA 1CGWA 5LNRA 1SSDA 5HW6A 3I6TA 3M16A 3N17A 2H9AA 4AD4A 5JUVA 1C29A 3KVJA 1JYVA 5JH8A 2RFGA 1XPGA 5G4EA 3S1VA 3BZJA 4OHQA 3R2GA 2Z1KA 1PZ0A 3P93A 1KFJA 2XN2A 3FJ4A 1SFLA 4FS9A 2XISA 4JPGA 4UFLA 3ZLHA 3KS5A 1HGWA 1O7AA 1OIFA 3PPCA 2X1SA 1Q45A 4HBKA 4HU3A 1ZU8A 3N3MA 4I9AA 4DBUA 2FZBA 4Q8PA 4QSHA 8RUCA 3WBEA 3APTA 1ADOA 5K3VA 4QNEA 4GJIA 4AEOA 1P0DA 1UB3A 1WXYA 4PMNA 4DUVA 3LERA 2ZUUA 3W28A 5H91A 1K9TA 1C8VA 1B9BA 3AS0A 4H2CA 2ZZ1A 1L6FA 3CGNA 1BL4A 3LCXA 4YLWA 3ONCA 3S8HA 4LH8A 4DYKA 4FLRA 4LGXA 3G6MA 3OVRA 1I2NA 1O1HA 4HSHA 1RK6A 2IW0A 4W8BA 3KCEA 4R5EA 4TW6A 3RMJA 5A8NA 4MGVA 4S3GA 1ADSA 2OT1A 4L1XA 2PA6A 3I10A 3TLLA 2A3AA 3M0HA 2OQYA 1TO3A 2HXUA 1OJXA 3QR1A 3OQ8A 1DHPA 2PCEA 3S6DA 2KX9A 3V7PA 3CUFA 3S1WA 2QCEA 3I4KA 2TPSA 3B0YA 4M1BA 4O1AA 2HPIA 4U5KA 3OZMA 5I00A 4YNGA 1UWQA 1WA3A 2VR2A 4CQDA 1ONXA 1T99A 3NTYA 4JTDA 3JYMA 3GYEA 4L4MA 1ONWA 2V30A 4I9JA 4HNCA 2XVLA 2Q71A 3SY5A 3VIIA 5T91A 4HHHA 1KBBA 3VIJA 2MF9A 2DZSA 3NYZA 3WD4A 1GVIA 3GVQA 3PZVA 1AQFA 4QHRA 1UH3A 4F9JA 2QQ6A 2DV0A 4ODOA 5AYXA 2WVVB 1K9FA 4GXMA 1FBAA 5HT1A 3MP4A 1KD0A 4ZENA 3UR2A 1K7FA 3ITCA 4FALA 4GQBA 5A6LA 5SWUA 2H9AB 1XSKA 3W2UA 3UPMA 1UMLA 5CPOA 3W7MA 3N34A 4Y8FA 1LRNA 4JL2A 5LIKX 3NQVA 4HHMA 3UG5A 4FMVA 3C4UA 2D2JA 1DORA 2ZIDA 3OHMB 1A7XA 1XUZA 1OBAA 5L6UA 2Z1VA 2PP3A 2ZQSA 2AMGA 3GNRA 1ODZA 4IICA 5CBBA 3L4TA 1QI4A 2XVGA 1F4HA 1LCOA 1IR1A 4DRIA 1UMYA 3DESA 4NL1A 2VEPA 1XLLA 3TJLA 3B8IA 1V6TA 3PAOA 4L3NA 1P5QA 3SRKA 3CZLA 4E2OA 1KFKA 4GQ0A 3LCLA 4BQ3A 5I6SA 1DV7A 3A12A 3I4EA 5AC7A 1FVPA 1MW3A 5HULA 7TAAA 4O1BA 3BJTA 1C92A 3NVDA 2V38A 4I5XA 2ZQUA 1BGAA 1E1CB 4MKSA 7REQA 3R0UA 3DH7A 1EJSC 2KI3A 3S2MA 2VFEA 3TROA 3T2OA 1E4LA 4DJEC 1UYQA 3TSBA 1RJQA 1D3HA 4J27A 3N2TA 3GXPA 1AH4A 1TWIA 3E5BA 2A2IA 1F6PA 1DYSA 1Q85A 5E70A 3RJXA 2VUNA 4L6OA 3URAA 4P7OA 2PODA 1D2KA 1ZZMA 3LEPA 1XLFA 1FWDC 4DNMA 1H7OA 4GNVA 3QGKC 1WKEA 5DY3A 1CXFA 1QOPA 4BEQA 1M5YA 4U3AA 5DQPA 2QCNA 1ISXA 2QDGA 3CBWA 2P0OA 3R4IA 3FKRA 4EXQA 4L56A 2J7HA 5AHLA 1EF3A 2V81A 1S5MA 3B9OA 4EE9A 5C8BB 5CPMA 1TYGA 3SSZA 1EH9A 3UZ5A 1I6NA 3A21A 1LL4A 3IJ6A 3WQDA 5JXQA 4A2RA 1TX0A 1U1HA 3VOGA 3S1UA 4PCFA 5FEWA 4PUNA 1E6SM 2G41A 5CZJA 4UOQA 1VCFA 1FH9A 1FXQA 4KR0B 1PEZA 3BMVA 4MF4A 4H9YA 3VZXA 2O9TA 3W76A 2NV9A 2J7EA 1P7TB 5KZ6A 3M0IA 1B3YA 4MSPA 1UCWA 2UZ5A 1V0NA 4IISA 4HNVA 5I98A 4LF1A 3CGMA 2PDMA 1R3VA 1L9WA 2EG7A 1EWEA 3AIBA 3FGCB 4DRMA 1ESWA 1HG3A 1Y5XA 3ES7A 4GYJA 5FJTA 4F2UA 1OCBA 5I0DA 4D6JA 4HGXA 2IPWA 8TIMA 3CMGA 4YTUA 3HGRA 1EX5A 2TRSA 1P48A 1XFBA 2WMIA 2YZ5A 1U2YA 1A80A 4B9ZA 3HQOA 3VZZA 2F2DA 2XINA 2BZNA 2C1IA 5KZDA 3CV6A 3I68A 1Z8AA 5A6AA 4NRSA 1FH7A 2BDQA 4ZPVR 1VJZA 3GXFA 3TNOA 4GHRA 1PCWA 3GFXA 4ZB2A 4JYFA 1RY0A 2CZ5A 2O0TA 3AQUA 4G2DA 1J4RA 1JCJA 6REQA 3FOKA 3GHTA 3Q65A 1JCNA 2FZNA 3UR7A 3ARQA 3TDFA 2X09A 3VGGA 4OBTA 1TR9A 1R6WA 3QMRA 5DO8A 5U7SA 4L4OA 4AVOA 4L9YA 4DELA 2MANA 2VXNA 1EZWA 2ACUA 1PO9A 4HZMA 1FWBC 1KR0A 1DJYA 1C9WA 4PBEA 1ITCA 4JD4A 1PHWA 2O9RA 3H12A 4JFVA 4QXIA 1LP6A 3WIJA 4JBRA 1GK8A 4FLOA 4WSKA 4MAVA 5BWFA 9XIMA 1SJDA 3PBWA 3CUJA 2AGTA 2QCCA 2QYGA 4TVDA 5I7GA 5AFDA 1EIXA 2Q8LA 5JH1A 4TVCA 4FNQA 1JRCA 1FKXA 4G2PA 4JQAA 2V63A 3GU0A 4NI3A 1QWGA 4UTHA 1FWGC 2ZR5A 2WYSA 2BP1A 2ICSA 3WUBA 3MBDA 4H04A 1WPCA 1XH1A 2NVCA 2VHLA 4ZODA 1JUKA 1J0YA 4EX4A 1EA0A 4UCGA 1L6SA 4QT2A 2FH6A 4R33A 5I3GA 3GB6A 2I9EA 2J88A 3AJXA 3VD9A 1I1XA 3M0LA 3WQPA 5CLTA 1Q5MA 2F8QA 1QATA 4IQEA 3PAJA 2R82A 3CT2A 1AJ2A 4UTJA 3ZJ8A 4PMOA 4PUUA 1SYTA 2MLYA 3C2FA 4XVDA 4KMQA 4J1OA 2ZUTA 3V0SA 1KGUA 1D8WA 1XLCA 4JFJA 4LYRA 3RU6A 3B0PA 2WSKA 2DVUA 1YDVA 3BGJA 4PODA 4BEUA 4OTKA 1TG7A 1QPNA 3LXBA 3GS6A 4S3CA 3AYRA 2VC7A 1X1NA 5DFAA 1JXKA 1YPFA 4MNJA 1EA9C 1XLMA 1GVEA 3FJNA 4CQ9A 3HO8A 3WLOA 2ZZ4A 1DXIA 3UQNA 3MKCA 3TR2A 3DFYA 4C6DA 3IVSA 4ZE4A 4O0QA 3IEBA 2FKEA 4BF9A 3L21A 5L9FA 1VFUA 1S46A 3Q37A 5BXJA 2P50A 1UP3A 1OIMA 4LVAA 3AYTA 1N1AA 4UUIA 4O1EA 5CC7A 3JS3A 4F0RA 3WQCA 8A3HA 1BXCA 1YTKA 1UH4A 4XZ9A 1C91A 4Y9OA 4WJ8A 5AN7A 5LNWA 2ZDSA 1AVAA 4QLJA 4W7WA 3E02A 1FWIC 1F9CA 1V6YA 1WAUA 1EP2A 4HZ7A 5HUPA 1Q4WA 3KE0A 1ZPTA 3WDPP 2PDJA 4N4QA 2C91A 4P7LA 1RQEA 1HVQA 2FQIA 2VOMA 4P61A 3I65A 1FCUA 1WKFA 3K8KA 3EKZA 1DJNA 4XKYB 3WLTA 4ZO6A 4AMAA 1YXYA 3F2DA 1W6TA 4AWTA 1K8XA 1PDYA 4S3DA 1PTGA 4KS0A 4HMNA 1UJPA 3W2NA 1ZBVA 4RCXA 4BQ5A 2DT0A 3M64A 2HQAA 4CD4A 4NZJA 3AICA 2HSAA 3CUGA 1UR3M 1XSJA 4OJYA 2B7QA 4XIAA 2I56A 3RPMA 4HZ8A 4JKKA 1NWTA 5HW8A 1JI2A 3TH6A 2XP7A 2GQ8A 2CHNA 4Q6XA 4LVFA 3P3BA 1ZRQA 4JZ5A 4AC1X 4E8CA 3S46A 3UXLA 3W75A 2YYTA 5LIWX 3CL6A 4JTQA 3CLMA 4UIOA 2WM1A 3AISA 1OD8A 3N2BA 8XIMA 2ZXAA 1WX0A 3HPFA 1W3JA 4TU1A 4QT3A 4LAXA 4P8WA 4QDPA 4U2ZA 2PTYA 1RALA 4LAVA 3FSTA 4E5TA 4IQCA 1M5WA 3N2OA 2P4VA 2JKPA 1B30A 3AJ7A 4HK6A 1DTUA 2C0AA 3HFYA 5LXEA 1MZRA 1ZQ5A 3BQ6A 2VNCA 1XYMA 4XD4A 3KCOA 2FZMA 3EOLA 1XIEA 1XI3A 4KH2A 2H3DA 4PTMA 1E71M 2NQZA 4GFSA 1WZLA 3V75A 2WZMA 2BVYA 2QVHA 5KTLA 3UY8A 1VB9A 2NQJA 4KWOA 4JFWA 4AZ7A 1QNOA 5FJPA 3WQ4A 2ZX6A 4DRSA 3A4JA 2CXGA 1OYAA 4UQEA 3TK7A 2W9MA 1D3CA 1G4PA 2FLIA 1Q6HA 2NWSA 3GNNA 4ADUA 4PFHA 4DBEA 3G6LA 3HU7A 1D6OA 3QXBA 2W6RA 4LS0A 3FW6A 4Q8NA 4MB5A 4GH3A 3KBMA 2MNTA 4HCHA 2KGJA 3UR8A 1WUEA 1UBSA 4HU0A 3T40A 3UT0A 3GR4A 5AVNA 1V6WA 2Z2UA 1QPQA 3T4CA 4E4FA 1UUOA 3VUSA 4GNJA 3KAGA 1BWVA 3E0IA 1XKJA 4L6DA 3FA3A 5D30A 2V68A 4WRHA 1X6NA 1PKLA 1Q6LA 3RLGA 2N87A 3VMPA 3ATZA 4JNZA 3HJZA 4A21A 5JIPA 1JD9A 3GU2A 3DAQA 3AO0A 3EDDA 2J7BA 3QMTA 2OLSA 4CGTA 3W7NA 1B5TA 2Y89A 1R2SA 1NOWA 4F79A 1PIFA 3TW6A 5HBFA 1F7BA 4BI6A 4JFLA 3MPGA 4L9ZA 1LQ0A 4K8GA 1V6VA 1E9ZB 2DH2A 1XLBA 3NL6A 1NJJA 5M1TA 2RDUA 4L1WA 4REQB 2Y88A 2V3GA 1DXFA 1B57A 2GGGA 5IBXA 3MJYA 4RW3A 3M6DA 4YWIA 3SR7A 4S38A 1H1YA 4YTRA 3B8WA 3W2LA 1M7OA 2FGZA 4H9VA 3MSYA 5I79A 5C9WA 9XIAA 3R5EA 1KNWA 2YOCA 1J5TA 4LUSA 4DHGA 3HF3A 1TPDA 2ZA3A 1WYIA 1Q6CA 5AB3A 2LLEA 5DANA 2VDIA 2VX6A 3GDMA 3STCA 3LUOA 1KXTA 1YIXA 3AOFA 5A6JA 5M17A 1IZJA 1QMLA 4DJEA 1O12A 2TMDA 3AWNA 2OZTA 3AIRA 2EG6A 1Z6KA 4HK7A 4C5ZA 3QC3A 1IIGA 1K6WA 1OFQA 4XKMA 1TWDA 4B92A 1I75A 1PE1A 3VU2A 3V5CA 5EMJA 1H61A 1ALDA 1J10A 1V93A 4AH7A 2DQWA 2XH7A 3WD0A 3ELFA 2C8NA 2XGBA 1XBYA 2Z28A 4PRWA 1UZ1A 1Z32X 5D09A 3N18A 4LC6A 2LKNA 4IMEA 1MW2A 3W1RA 4DWSA 3QJAA 2ZRUA 4AUBA 1GONA 1CXLA 2WMGA 2NUYA 1SPQA 1JDDA 4Q7BA 3QTGA 4I7UA 3WYZA 5HR6A 1KGXA 3CZJA 4RZ6A 4LV9A 5IBXC 4J3VA 5IDZA 3CEPA 2PCQA 1XRTA 4AWSA 2VFDA 4U31A 2BLEA 4TO8A 3BXWA 2ZR4A 2Q01A 3WK0A 1H62A 1DEDA 3O0FA 4YVVA 4DZ2A 2VT0A 2ZRZA 3GD6A 1VFLA 1FUYA 2PP0A 3BLFA 1LDCA 3GUGA 4DLMA 4Z2LA 1J9YA 2J6VA 2PWHA 4Q8OA 1HKMA 1VBGA 5K9XA 4FR1A 2AQVA 3PZIA 1KBKA 1OFBA 1B2YA 3TMQA 4CEUC 1S2VA 1TE6A 3TYZA 4MWAC 2DGAA 3W1UA 4G7FA 3WEZA 3PPHA 3PBUA 4IUGA 3GTHA 3PWGA 2D0GA 3DCPA 3O5GA 1W91A 3DG7A 2WZIA 1J0IA 4GWEA 4W7VA 3HTWA 4UR8A 1JZ2A 1GWJA 3W01A 3FGCA 6TIMA 3LB0A 1UIOA 1W1B1 1QCWA 3JRKA 2ZTKA 3VOHA 3O5QA 2IUZA 5MKGB 4PB3A 3CHDA 3PA7A 3K4AA 4I6VA 4XUYA 5REQA 2JIWA 4YS1A 4L64A 3TA9A 1MXSA 1V77A 1MI3A 3PWIA 2FGLA 2X1RA 3VCNA 4L61A 3RG6A 1UW9A 2FJUB 4ODLA 4AAJA 2D24A 3NPXA 2RSEA 4FPSA 1AW1A 3AXXA 1GQIA 2DZXA 1GGOA 1AZ1A 3RLVA 3UWWA 2RQSA 4RDWA 4Z2HA 3AU2A 2RDWA 1UWUA 2NT1A 1UZDA 3VGFA 3M5YA 2VENA 2QJIA 4J3TA 3VNZA 1IYXA 4ILSA 5C6MA 1AFSA 1ENUA 3K30A 4HSOA 3T0TA 1V3MA 1QOXA 3W7DA 3W7KA 3XISA 3K5XA 2V3FA 4MGGA 3QV9A 4J4OA 4W5UA 1FY6A 1W1IE 1XICA 1S2AA 1XBXA 3NGFA 3MI3A 3TXZA 5I03A 3B9AA 4NT0A 4EPKA 3CASA 4GUGA 2G37A 5C9XA 4AEFA 1RLDA 2ZRWA 3GNDA 2ZTJA 4M82A 3OQEA 3WLSA 4WR3A 9CGTA 1KLZA 5H8UA 4QLLA 5FAGA 1CTNA 3MYPA 3CL8A 1JIBA 3OLDA 2FHBA 4JIQA 3PUDA 3ZJKA 4AX7A 1LL7A 4GVFA 3VCCA 4NAEA 3H2AA 1KFCA 2CKSA 1JZ6A 1F61A 3VNJA 4HOXA 2NQHA 3NJ3A 3OIHA 4AZCB 1J6YA 4RNHA 4W85A 4AVFA 1PKYA 4CUCA 2NLIA 3GDLA 2PDWA 4B9YA 1MEHA 1EJVC 4IIGA 2UV8G 3BAXA 3VILA 3JZUA 1LORA 3BDKA 1R3QA 2DG4A 2OOGA 2O4MA 1S5NA 4IMCA 1EC9A 1OY0A 4B3LA 4LAUA 1UR4A 2E6YA 5LZLA 2WAGA 1XDMA 2OSYA 4U33A 3EWDA 1WDPA 2ZQTA 4G6CA 2BBFA 3VZYA 5HJYA 5C9ZA 2VZOA 4JTKA 1YDOA 4LCRA 4NJKA 4ODPA 1VYPX 3GW3A 3HOJA 3ZVHA 4NAFA 1IXNA 4HPNA 4ROPA 1XGDA 3IIXA 2W91A 3IIOA 4X9YA 1NOFA 2BB0A 4ZVJA 3W26A 2XWDA 5BMXA 4D1IA 3PJWA 3PP7A 3GIPA 3O7UA 4IQJA 4FK9A 1E40A 1K9EA 1R86A 2VWTA 3QSTA 5XIMA 4IZGA 3VCRA 3EPNA 2Y7DA 3EWUA 3OPSA 4GI8A 3LCIA 5A6SA 3PVFA 2TODA 2GPTA 1K6AA 3W70A 1G01A 4J4NA 4KEZA 2E77A 4L9XA 2J7FA 1I2OA 5CBIA 3NYDA 1LOSA 4QQUA 3CQKA 4CNSA 1FQ0A 3VD5A 4D6CA 4QNWA 3NQ7A 3R8GA 2IMRA 3OVQA 3GG8A 2PDPA 3DBPA 4I5UA 1XIBA 3VDBA 1FOBA 3PBYA 3NPUA 5HPCA 1RVGA 2DZBA 3EMQA 1OFRA 4ONVA 1CXIA 2BS9A 1MSSA 4QZVB 2P53A 1LBLA 3PSWA 2IXUA 1Y5VA 2C71A 3QV8A 4MFEA 1GYLA 2WC7A 1JCYA 2KFWA 4AF0B 2DG9A 1C7SA 4A3QA 1XLJA 1JZ8A 1QNSA 4CU8A 4RNJA 1Q4NX 5LA1A 3MQTA 3AXIA 2WBKA 3QW4B 1OX4A 3BVJA 3VKJA 4OE7A 3WLJA 3FA5A 1SO6A 1AD4A 4KGJA 3LTYA 1XLEA 1RP9A 2XUCA 4AHPA 3KLLA 4YU1A 2AKMA 3OA3A 1N8IA 2GYIA 3OU8A 4AQLA 1QPRA 3EB4A 1KM3A 3L7RA 4GBDA 1U83A 2YB1A 2BOFX 4IFRA 1YE4A 4JTCA 4L65A 2QEZA 1JYXA 2A6LA 1P0KA 2VX5A 2YFNA 2W4XA 2DJXA 3Q94A 4XKYA 5G1MA 3NQGA 1TTJA 1WCGA 2D0FA 4GVHA 3R58A 1IE7C 1HNYA 4AIEA 4CNUA 1F05A 1YMYA 5E5CA 4UFHA 1PX4A 4Z08A 1YE6A 3CL7A 1YNPA 1NEYA 2DG3A 3A22A 4KFPA 2DZTA 1M7XA 3TAKA 4E8DA 4AY1A 1GHSA 5FJRA 3L65A 2I7GA 2Y5EA 3APGA 4C1KA 5A6KA 2R91A 3NRKA 5FEXA 4GY0A 5KINA 3GBDA 3S5ZA 3UBPC 5TNVA 3F4WA 4XZIA 3F2BA 2CFFA 5G5IA 3SGZA 4OKDA 5DY2A 1JD7A 2FGBA 1OZQA 1TPH1 4CNOA 4FOUA 2DEPA 4PCTA 6PTDA 2VR4A 5FSDC 3W2KA 4L1GA 3ANVA 4I8YA 1XX1A 3W53A 3GR7A 4KFNA 3IVUA 3EKLA 3U4FA 2OCZA 4IT6A 2OKOA 4UFKA 3N3TA 1BTMA 2GQ3A 4O28A 2DUZA 3S5OA 1P1MA 1U30A 5J04A 3DXIA 3OIXA 4XSLA 3TC3A 1X98A 3UD6A 4J9JA 2EKGA 3GG7A 1F3XA 3W25A 1DVJA 4UDMA 2WNQA 1KO0A 5I3KA 4E2BA 5B8IC 2J24A 2PZNA 1O4UA 1OM0A 1UP2A 1EDGA 2XHYA 2YW3A 1Q8AA 3G77A 5GJMA 3LA4A 2XGIA 2NZLA 1AQ0A 2ABBA 4B5TA 2XVKA 4NYUA 3O2LA 2Z0IA 3F03K 2VQUA 3N9SA 4GVGA 1A5MC 5ABEA 1EOKA 1WP6A 1TJ2A 3OBEA 3HV9A 3M0JA 2ZQ0A 3NFUA 1A5OC 2VEFA 3P8IA 1H5VA 3HA1A 1HKJA 5ABFA 2DSZA 1BXNA 4E38A 2VEIA 1RY8A 1Q6RA 1S1RA 2GGHA 2FPYA 2BMBA 2PDHA 1QPFA 3KRUA 1Y0EA 3I7RA 2WB5A 4ZQPA 4ZOAA 4K38A 3WL1A 1SUXA 3RR4A 2WQDA 1EDQA 3IWPA 3IIVA 3CV7A 3S9IA 4JTHA 3GNOA 1JCTA 2ZFAA 2VVSA 4QCEA 3G1XA 2XTKA 3K1GA 4UZSA 2D1ZA 4ODRA 2FMOA 3O5FA 1NF0A 3WSUA 3N4AA 4WCJA 1AK5A 1AL8A 5TBOA 5GJNA 4NYYA 3ME3A 1XQLA 3G5EA 3KDNA 2ATSA 2HDJA 4HVXA 1DL3A 1W0MA 3C61A 1R85A 3UERA 3RJYA 4AD2A 1QTWA 2V6AA 4LXFA 1GEQA 2XP3A 3NZRA 2BGNE 3TTYA 5T9BG 3N29A 4K2SA 2DY3A 2V69A 1DHKA 3FN9A 2GJRA 1W56A 2XGZA 3A13A 3O6CA 4B5VA 5A69A 4YCPA 3N25A 3H21A 4GGBA 1OFEA 2X7VA 1JCLA 4EPEC 3FYYA 5CC6A 3LI0A 1R47A 2NX1A 2BFGA 4OUIA 3KAOA 3U2ZA 1FKTA 1KXHA 4JIHA 5KETA 4E4PA 2VFIA 3STPA 1HGYA 1VFOA 1NP2A 4GBUA 1XL9A 5CZKA 2YGYA 3FKKA 4L72B 3MUY1 4RK8A 5E6YA 1V3HA 1W5OA 4LSBA 2QPSA 4QIUA 1J4HA 3L2LA 3SADA 3U57A 3CU2A 4LUIA 4JX4A 3SCNA 3C0LA 2PRLA 3DFPA 4HA1A 3PBVA 1TA3A 1FCQA 3NZGA 1YEYA 4LB3A 5D8WA 3LHUA 2VI0A 3TTSA 2WM0A 3VK5A 1VYSX 3RX3A 4PUKA 5F1VA 1HIZA 1NFPA 5HNUA 2J8GA 4E2VA 3BUVA 1KFBA 3VPLA 1L2UA 5CPSA 5HDRA 2C1HA 1XRVA 3UXIA 3VNKA 1G94A 3TIMA 2ESCA 4BHYA 2ON3A 1H4PA 3TYDA 3TCEA 3EKGA 1CIUA 4DF0A 2X1IA 1V8EA 3ITVA 1WXZA 2UY2A 4FNUA 2I17A 1E6NA 3LNMA 2C6QA 5A2CA 3W73A 1YDNA 3ZM8A 4O54A 4TX9A 5J6EA 3S5YA 3UA4A 4IMGA 3WLKX 5DBTA 3KRZA 3FK4A 2RUDA 3KVLA 4A3UA 1TSIA 5D75A 2GFTA 3KOFA 4PFMA 2EPNA 2QCHA 4TW8A 3PF3A 3CH0A 3KBWA 3WH6A 4L4LA 3S6TA 1BTCA 3ZO9A 1PINA 1PX8A 1AMKA 5HOSA 4Z17A 2OEMA 3GQYA 2QUNA 5BNKA 1GOMA 3VGHA 2ZYFA 3U4AA 5EPDA 5AOUA 4KIRA 4OECA 4RPQA 3W2JA 1Z41A 1UUMA 2WK2A 4XISA 1K4GA 1T6MA 1ZAJA 3R43A 3LCFA 3ANYA 3TMLA 5A8QA 2GUBA 5ENLA 3V1PA 4FXRA 1P6WA 4I90A 8XIAA 1KWGA 2AAMA 4JKLA 4Q3MA 1LM1A 1IHIA 2PLCA 4FSAA 1MUWA 1UKTA 4F0KA 4TV5A 4J3SA 3TWBA 3VD4A 4B2DD 4MG4A 3DZ1A 1QI0A 4NVTA 3NDOA 4ZB5A 2FVKA 2M1IA 5HINA 1DWIM 4FF7A 4IWWA 2WWDA 1F8MA 3SUWA 3RHGA 4GE8A 1VFTA 4U2YA 1LWIA 2JGYA 3GH4A 1YXDA 3F4CA 3TONA 3N2XA 2Z29A 5EMLA 4M81A 4H1ZA 4J3ZA 4ICMA 1A5AA 3IK4A 4FLSA 1NDYA 2OXNA 3E2VA 1WNOA 5HWBA 4GO9A 1DP0A 3H7RA 4LFYA 4XAFA 1M68A 3IGXA 1TV8A 1HZYA 4JFIA 1E5JA 3LSBA 1KM5A 3EXTA 4MNLA 4R53A 3LLDA 3H2OA 2VEMA 3SI9A 5AHIA 2A85A 1KM2A 5JVLA 1ZNNA 3R25A 3LUTA 4X3ZA 3P6LA 4TR9A 3QH2A 1W2PA 2MNRA 4K7YA 4BFAA 1I45A 4RZ4A 4PCPA 1FHUA 4IQDA 2Z1BA 5C55A 1DJGA 5EMUA 3RN6A 1W9XA 3LZ5A 3IUIA 4XTDA 4XQ6A 2CPUA 3W74A 2GJXB 3FDKA 5I3JA 4YTTA 1HFBA 3PUOA 4AZHA 2Y7GA 4X2RA 3H8AA 3MWCA 3TW9A 2EKCA 4Q8MA 2BWGA 2VQTA 2OO0A 5CPTA 5D37A 3WQGA 1ODUA 1V02A 1EYMA 4QJ5B 1W5NA