1JNDA

Crystal structure of imaginal disc growth factor-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Imaginal disc growth factor-2
publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
total genus 143
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jndA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jndA01
1G1YA 4HOXA 1EO7A 1HJWA 1JYVA 4CD4A 4XX6A 5LA0A 2ZX9A 1W9VA 1MVYA 3QHMA 1ODZA 3UESA 2W5FA 3PTKA 1DP0A 1BG4A 5AYBA 1WDQA 2WMFA 3WF2A 1ZU8A 1OWQA 2YA1A 4B9YA 4DWSD 3BSGA 5DMYA 1JYWA 1DWGM 4B15A 4J3VA 1VBRA 1CTNA 3T0AA 2Y4SA 4PMYA 1EOKA 3FHAA 2ZUUA 1JGIA 1V0MA 5CGTA 5ABGA 1JDCA 1DWAM 3WDHA 3CHEA 1ISWA 3RJYA 4H8UA 3K8MA 3ARWA 1HX0A 4S3KA 1TA3A 4V2XA 1QOXA 1KB3A 2ZXQA 3AZTA 4W93A 2FGLA 2GVYA 4LYQA 2X05A 1V0KA 3RJXA 4AZ7A 4LYRA 1UUQA 5ABFB 3VM5A 4PUEA 3OGRA 2ZUMA 2XVLA 3ZIZA 2ZIDA 4PTWA 3ARQA 2OYMA 1BYDA 2X1IA 1SMDA 1QHZA 2PWDA 4GZJA 1MXGA 1UH3A 3WL0A 3WH8A 3CZJA 3EDFA 5A8QA 2QV4A 4LGXA 4MNLA 2VX7A 5I77A 3AHXA 2WANA 2XM1A 3OA5A 1GQIA 1E3XA 2CHOA 1B31A 3VD9A 1E70M 1MW2A 4P8XA 5A94A 5BXPA 3ARPA 3QHNA 2UY2A 2W61A 3MUAA 2VX4A 1FA2A 4PMVA 3AHZA 2WZIA 2DT0A 5KEZA 1GJUA 2WHKA 3WNPA 1B2YA 1GCYA 3N17A 1FH9A 2JEPA 5IHRA 3NJ3A 2XVNA 3T09A 1RP9A 2YKKA 1EQPA 3L4YA 7A3HA 3RM9A 2FHFA 3W27A 5ABFA 3SUUA 1GQLA 1UZ1A 1WZKA 2YDSA 4JHOA 3CBWA 3F5KA 1CBGA 3SCNA 4HP5A 3SUTA 1KGXA 4GI6A 4AD3A 4FLRA 2ZWYA 3VGHA 1UR4A 3RCNA 4F9JA 2BFGA 1ZJAA 3A4AA 5CPSA 2WKLA 1E4MM 3ARZA 2Y8KA 4ZXLA 3AISA 1B3ZA 1W3LA 4AMCA 5F7UA 3VNYA 5JBEA 3VNZA 1MWOA 2GJRA 1E15A 3NUKA 1UH4A 2A3EA 2XWEA 3BCDA 4PYSA 1QW9A 4JCMA 4JIEA 1W3KA 2J79A 3UG5A 2J7FA 1W1VA 3W37A 2WC7A 3O6AA 5E6ZA 3ARVA 1CXFA 3VMNA 3CO4A 5I2UA 2D0FA 4P7NA 4JFTA 3IAPA 1GOOA 1UR9A 3VIPA 1CPUA 3WNNA 3SCUA 1W2VA 3ZM8A 4Z2HA 2WW5A 4UFJA 1BPLB 3VDCA 3B9DA 3SCVA 3IK2A 4W5UA 3L4VA 1H0IA 2NT1A 4XV0A 4A4AA 2JIEA 2Z1SA 2EPOA 4K68A 1RH9A 3MO4A 2G3JA 3N18A 3W25A 2JIWA 1UR2A 2AMGA 4GZEA 4WK9A 3QR3A 3VUPA 3VD7A 3RM8A 1N82A 4H04A 3WY1A 4EKJA 3CHCA 1CLXA 4JKMA 1E9LA 4AISA 1KWKA 1HJUA 3NYDA 1KGUA 2V5DA 1QNOA 1UQZA 4NRSA 4W8BA 3OGSA 4H41A 4UOQA 3GZAA 1JD7A 3AZRA 1AMYA 2PBOA 3SUWA 4JHZA 3VU2A 2YA2A 3UEQA 1EIBA 3OB8A 1FFRA 1JXJA 1NQ6A 1CXEA 1GQKA 3ZJ8A 2E3ZA 3NIYA 4H2CA 4MAVA 3BC9A 4CD8A 1JYNA 1NWTA 1VEPA 3PZ9A 2DT2A 4X9YA 1PEZA 4HA4A 2F8QA 4J3UA 2JALA 1CZ1A 3QHOA 1PZ3A 1MXDA 3VMOA 2WAGA 2TAAA 1V3JA 1QI4A 4OZOA 1KFWA 3B8SA 2Y24A 1J12A 2OWXA 2CETA 3MUZ1 2IXUA 1C8QA 2DT3A 1NOWA 4UQEA 3FW6A 1HXJA 1JZ3A 5JIWA 1JZ7A 1KCKA 4WSJA 4Y7EA 1CGWA 1W3HA 4W7WA 5CZKA 2QHAA 1M04A 3GH5A 2W92A 1UH2A 3W82A 2EJ1A 4P7RA 2WC3A 5EMYA 1F4AA 1CXLA 1MQQA 3HJEA 2E4TA 1M01A 6A3HA 1YQ2A 1KQZA 2ZX6A 2BV9A 4QAWA 1CGTA 3AIQA 3BMWA 2GSJA 4F66A 4LXFA 4HA3A 2VX5A 5A6BA 4MTVA 2GJPA 4ZFMA 5ABHA 3AZSA 6TAAA 1ISZA 2J7BA 4KH2A 3PTMA 1E6RA 4NSBA 1K9TA 1Q4NX 4H7VA 1K9DA 4F8XA 2YBTA 1D3CA 2Y2WA 3VIKA 2YJQA 2YA0A 2WBGA 4Z2JA 5GNXA 2X2YA 3APGA 3RPMA 1GVIA 5BWFA 4J3TA 4BQ3A 2GDUA 4U3CA 4P7LA 5HXMA 3F4VA 4UOJA 3WDRA 2WBKA 1UA7A 4N42A 4H8HA 1AQMA 1C92A 2VC9A 3KEHA 4PEEA 1EDQA 2EPMX 1OM0A 1U33A 1JF5A 1CENA 1NP2A 1JYXA 3EDJA 4AC1X 1CXHA 5CJ5A 3O2LA 2V5CA 3VO0A 1US3A 3OLGA 4PTMA 1KXVA 4M8UA 2CERA 1V6XA 3WQ8A 5CXPA 2D0GA 1Y7VA 1SFSA 2CBIA 4TUFA 1JDAA 1V6UA 2YBUA 2CPUA 2ESCA 3E1F1 3VIGA 4P7OA 1KQYA 4TTGA 4N0RA 4XUYA 2CBVA 3AMKA 3ZR6A 3OLEA 2X0HA 4MB3A 2XGIA 4JL2A 5JBDA 4HTYA 1W91A 3T0BA 3MSGA 4M81A 3F5LA 5BXRA 4HMDA 2WM0A 5CSUA 3U5UA 3JUGA 4PMUA 2IXVA 3EBVA 3WF3A 1CWYA 1BYBA 1HKJA 3VX1A 4M1RA 1C7SA 1BGGA 1ZBVA 2D0HA 3EDKA 3CPUA 3N1AA 4A3HA 3UERA 2CBJA 1JFXA 2YDRA 1V02E 4AEFA 3EMCA 4YN5A 4D6FA 2PF0A 3WENA 1VEOA 1MW3A 3WH7A 5BRPA 1UKPA 5D8WA 2G3NA 4PCTA 2PWFA 1HKMA 3VDAA 3WDJA 5JIPA 4AD5A 3WUGA 1QPKA 4Z2LA 1H5VA 5JBFA 1XH2A 1VENA 2XYLA 3I3EA 2PI6A 2W67A 2V3FA 1C91A 1HJXA 4PMOA 1OIFA 4DUWA 1TMQA 1OINA 2E0PA 3ALFA 4BQ2A 4PRWA 2UY4A 3EMZA 5A8NA 3MKKA 4GQQA 3WIJA 4ML4A 2O9OA 2ZWZA 2DGAA 1WB0A 1B3XA 2A3CA 4CCCA 2BNJA 2J7GA 1FP9A 3AICA 1XYFA 4MPKA 1OT1A 4ZE4A 3IANA 4GKLA 3ZT7A 5I79A 3MANA 1E43A 3OGVA 4D6EA 1B3VA 1LL6A 4ZENA 3W81A 1O7AA 3ARYA 1PBGA 1OD0A 1Q6EA 2UWFA 1HN1A 2FDMA 1JI1A 2VQUA 3GNRA 1VIWA 2EEXA 2FHBA 4W7VA 4UZUA 2VR5A 4HZ8A 1V08A 1SMAA 5D9MA 1HP4A 3GBEA 2A3AA 3GXDA 1VRXA 5A69A 1EA9C 3ZJ7A 1QW8A 5HPOA 4WLCA 1XCWA 1GORA 1R86A 4QLLA 1ISVA 4AZBA 1NWRA 1HJSA 3AHYA 4D71A 1UKQA 3AMLA 2CKRA 4WJXA 4CN4A 1ODUA 1V6WA 4AZCB 1HT6A 4IPNB 5E0FA 3G6MA 3VILA 2D2OA 1V3KA 3AHTA 2PWGA 1V3HA 1EOMA 1VJZA 3BSHA 3CHDA 1XHGA 4U5IA 1DTUA 1V3IA 1TG7A 3G6LA 1Q6CA 1ISXA 5M5DA 4MAZA 2NSXA 1LL4A 3AHVA 5A6BD 3BAKA 2WHLA 2DPEA 1OD8A 3TTSA 2VL4A 4CUCA 4AZHA 4IM4A 3VDBA 4XB3A 4PMXA 3D3AA 2BS9A 1E56A 4CCEA 4P8UA 2DSVA 3L2MA 1J0ZA 1WKYA 2J8FA 1DWFM 4W8AA 5JUVA 1UYQA 3WQ4A 3AYSA 4V28A 3WBAA 1HJQA 1JL8A 4TX8A 3ZSSA 3ZR5A 3CMJA 3ZO9A 1GOIA 3UR7A 4MB1A 1XD1A 3AQUA 1CNVA 4UFLA 5CPQA 2DH2A 1HL8A 2WCAA 1QNSA 2XM2A 3FHQA 3WUFA 4PBGA 2DIJA 1JNDA 4AD4A 4HOZA 1KR1A 2YLAA 2XVPA 2WC4A 3UCQA 4AZCA 2PWEA 1JAEA 4CU7A 4CD7A 1BVNP 3L4TA 5BXTA 1W9PA 1GONA 2VZVA 1KBKA 4BCEA 5A6KA 1HIZA 4MNJA 2BHZA 3OIHA 4EANA 4TVCA 1UWQA 3PZMA 4ACZB 2WVTA 2DH3A 1ITCA 1JDDA 5EFDA 3FN9A 3GH4A 2DT1A 1G94A 4HOWA 3AMCA 3PZOA 4W89A 2W62A 1AQ0A 3T0DA 3OZOA 5CSYA 3DYMA 3T2QA 4TTUA 3WDIA 1HP5A 3SCTA 5HOSA 2WZEA 1SR0A 1CXIA 1QI0A 2E8YA 4U2YA 3WD2A 3W4RA 2FHCA 1XSKA 3PZUA 2J4GA 1W1PA 3LPPA 1WZMA 3AS3A 1XC6A 2FGZA 3WUBA 1ZBCA 2DQXA 5A95A 1UD2A 4JFSA 2DSUA 3MV11 1UWSA 3WEMA 4D6IA 3K8LA 3GDBA 2CBUA 1UR1A 5AC4A 1TR1A 3WNKA 1JI2A 1L0PA 1J01A 4AWEA 1OGBA 2QF8A 2PC8A 5DT5A 1KCLA 2VURA 4OBRA 1UG6A 3M07A 3AIUA 4ACZA 1HKIA 3NDYA 3K4DA 2W66A 5D9OA 4MADA 5CGMA 3VDHA 3SIMA 4W7UA 5LA1A 3SCPA 3POCA 4CKQA 5A1AA 1JZ5A 4D6DA 3RIKA 5ABEA 4TXEA 3W28A 4C7GA 3VIJA 3BH4A 2ZOXA 4P7QA 5GNYA 1JZ2A 1B0IA 4WKAA 4DM1A 3VGDA 2X0YA 3EDEA 2WMJA 1M7XA 3UETA 1JD9A 3TTQA 4PMRA 4JL1A 2D24A 5HBFA 1UWRA 5EFFA 3AS0A 4S3JA 3WFZA 4TVDA 3NSNA 5AYIA 1UD8A 2NW0A 4AIUA 3WDPP 1G9HA 4HMCA 3AS2A 1XSJA 2WK2A 4M80A 3WN6A 1J11A 1C7TA 3AI0A 2VCAA 3CUJA 2VX6A 3BAXA 2J78A 2VRKA 2DSKA 1B9ZA 2YL6A 1VFUA 3WD1A 3AIBA 1WPCA 2D3NA 3BAYA 4J7RA 3N04A 4UCFA 4W86A 3NSXA 3WBEA 5FL1A 1EDGA 3PZTA 5FKYA 4JKLA 1ZB5A 3W38A 1E72M 3WMSA 4JFWA 2WSPA 2QMJA 1E1FA 2XUCA 3SUVA 1XH0A 1GPFA 1AQHA 3BAIA 1EQCA 2WZHA 1GOQA 4D6JA 1HJVA 1VF8A 4KRUA 1V0NA 3SCSA 4GXPA 3WEOA 2WNWA 1V0LA 4GINA 1Q6DA 2WXDM 4A3YA 1H11A 1PX3A 1A3HA 2ZXDA 4P8VA 2RGMA 3LMYA 2V3DA 2Y5EA 5DT7A 1BTCA 3ZJKA 5C70A 4JCLA 4CD5A 4QLKA 3WFLA 1E4IA 2O9RA 2QMKA 3L4UA 3RILA 2WWDA 4MNMA 2XSBA 3VKKA 2XFRA 3HMCA 3BXWA 1I75A 2OWWA 1HKKA 2XFYA 3ARUA 3UR8A 1B30A 1PX8A 4DUVA 2OYLA 1NH6A 1X6NA 3POHA 3WELA 3AIEA 4QDMA 2J62A 3CZGA 4WSKA 1G5AA 2DSWA 1R7AA 4OKDA 1A47A 1UWIA 3CUGA 3KL5A 1BGAA 4FLQA 5A2AA 3U7VA 2GJXB 5IFTA 2UY5A 3QOMA 4U33A 4LX4A 2FH6A 4UFMA 4Z2GA 1OBAA 1TFVA 2W91A 3WF4A 1M03A 1CIUA 3MSDA 3AIRA 4NRRA 2BY3A 1CECA 1IZJA 1XSIA 3D5HA 4J27A 4JFVA 5M3WA 2GK1B 1MQRA 4B3KA 4DWSA 1J0JA 1E55A 4NZCA 1LG1A 1LWHA 4OBSA 1JZ8A 4CCDA 1W32A 4Z2IA 4BQ5A 2D3LA 1GW1A 2VTFA 1E6SM 2E9BA 1UD4A 4UFIA 2YL9A 3LPFA 4FMVA 1F4HA 4L4PA 3O9NA 5CLTA 8A3HA 1JAKA 1H49A 3CTTA 1V3MA 3CZLA 4LYPA 2ZXAA 1EGZA 1C8XA 2D22A 1AVAA 1E6XM 3WUEA 4CU8A 1XYZA 3PN8A 1GHRA 4OJYA 1V03A 5AY7A 1TZ7A 3CLWA 2NT0A 2WWCA 4AEEA 1BYAA 2DIEA 4UZSA 1LLOA 3GXMA 5I5RA 4XZWA 3RO8A 1JFHA 1E5NA 2YL5A 2A3BA 3IJ9A 5IXEA 3GH7A 2O9TA 1G0CA 1R7OA 1MQPA 5D9PA 2VT0A 3VIFA 3K1DA 3N15A 5E09A 3VGBA 1W9XA 4GI8A 4UQDA 3M46A 4UR9A 1UA3A 1K6AA 1XGZA 2BHUA 2G3MA 1QI5A 3VIHA 3WH5A 2GJXA 3BLKA 2V3GA 5JH8A 1MW0A 1RP8A 4GI9A 2J8GA 2CNCA 1UWUA 4CN6A 1GNXA 2XFFA 4HA1A 4CU6A 3LPGA 5E70A 2GK1A 2GUYA 5BYWA 5M17A 3ALGA 3THDA 5IFPA 3WH9A 3PZQA 3TONA 3OLIA 4UFHA 1ECEA 3AMDA 4R5EA 2WLZA 5CQ1A 1DWJM 2VUYA 4E8DA 2WB5A 2QPUA 5A2BA 1K9FA 2Z1KA 2ZICA 2ZUTA 1OB0A 2B31A 4LQ1A 3ZSTA 3NCOA 1YHTA 1RD6A 2IUZA 5LA2A 1ISYA 3CZEA 4F79A 3WQVA 2WYSA 3W26A 4BF7A 4CVWA 1W9DM 3FNDA 5D4YA 4NF7A 5A6JA 4PMDA 2WCGA 4Q7NA 1W2PA 4QP0A 1QNQA 1BF2A 5E6YA 4BA0A 1FH8A 3ECQA 1I1XA 1QNPA 3NSMA 4EE9A 3AXXA 3CUFA 4E8CA 5A6AA 1WCGA 4GO9A 2VI0A 3U5YA 4J3SA 1MW1A 1HVXA 1TVPA 2CYGA 2VOTA 4ACYA 3ARTA 3L2LA 2AAAA 1V3LA 1BQCA 4JKKA 1EH9A 1OT2A 3S6TA 1VB9A 1ZBKA 4MNKA 2WMKA 1J10A 1NOFA 2ZX5A 5I24A 1R87A 1XV8A 1UR0A 2EXOA 4GQRA 5I3DA 3I3BA 4KGJA 2E9LA 2OLHA 4FK9A 3I3DA 1E6NA 4GIAA 3PZIA 4E4PA 3AXHA 3BCFA 1UKOA 1UKTA 2F2HA 1UWTA 1FHLA 1GHSA 3KE0A 5CPTA 1G01A 2J47A 3F5JA 2UY3A 1TVNA 2OYKA 2XPKA 3DECA 4OIFA 3AIVA 2HVMA 2G4FA 2OSXA 4MDOA 1EXPA 4ZEPA 3VGEA 4J3WA 3WEZA 2Y8VA 4M29A 4AYSA 4BS0A 1BHGA 2J7CA 2X8RA 3T2PA 1KR0A 2WMHA 3HN3A 2EO7A 3IJ8A 1JZ6A 1FFQA 3A4XA 2JE8A 4PMQA 2WMGA 1ZL1A 4OOZA 1E40A 1PX4A 1LG2A 3UG3A 4R27A 1QVBA 2ZUSA 3MV01 4J3XA 1R8LA 4D6HA 1Q6GA 1O6IA 4RE4A 4U31A 7CGTA 4AY1A 1GJWA 2V3EA 3WD4A 4ATDA 3GM8A 4V27A 4UQBA 1QBAA 5EB8A 2E8ZA 2YOCA 4W84A 3WSUA 3T2OA 4W85A 2OSYA 2F61A 1VJSA 3TTOA 4HU0A 1XCXA 1UZ4A 2JF6A 4U3AA 1C93A 3II1A 1J0KA 3VD5A 4YHEA 1HF6A 1UD6A 5LYRA 6CGTA 1RPKA 4AZ6A 3VVGA 1C3FA 3IJ7A 4TX6A 4OUEA 5A8OA 1FOBA 1V02A 2D1ZA 1H4PA 3B9EA 3TP4A 3RM4A 3UG4A 3EMQA 3WNLA 3WQWA 4HPGA 3CZ8A 3OBAA 2XG9A 2XWDA 3VTRA 3WQ5A 3OZPA 2WHMA 3WD0A 4L4OA 2XTKA 1JNEA 3AOFA 1JIBA 2XVGA 4FLSA 4HZ7A 1PAMA 2A3HA 1TUXA 2VCBA 4Q22A 4AXNA 4CD6A 3ARRA 1MFVA 2XSAA 4U5KA 3AJ7A 4IUGA 2VMFA 3PTQA 5C8BB 2XHYA 2VJXA 3VD4A 5FL0A 1UD5A 2OWCA 3VPLA 4WKFA 2PBGA 3DHUA 1HNYA 3SCQA 2E9MA 3N12A 2XIIA 3WL1A 3AXIA 5I23A 4OOUA 3AIWA 4DWSC 4FF5A 1QI2A 1EDTA 1GZJA 3WMBA 3VGGA 2VZUA 1L8NA 1KWGA 1B3WA 5E9AA 1U2YA 3VOCA 3ZJ6A 4DUXA 4CN1A 1W9BM 3U7BA 1ZJBA 5GPRA 1E1EA 3IAQA 1OCQA 2O9PA 1VFOA 2WPGA 5ECUA 3GBDA 1J0HA 1UQYA 4M56A 4UNIA 2MANA 3VIMA 4C7FA 4NI3A 4PMZA 4ATLA 2BY2A 4UTFA 1SYTA 4JZ5A 3W0KA 3SEPA 4KMQA 1WDRA 5HPCA 1JXKA 4B9ZA 3GTNA 3KL3A 2EPLX 4LPCA 2J7HA 3BGAA 1VFFA 4D72A 5IHSA 3CUHA 4AW7A 3GXFA 1H2JA 1BG9A 1EHAA 5CG0A 1UKSA 5D8ZA 4HPHA 4CGTA 3A4WA 1ZBWA 4GPNA 2GFTA 1H0GA 1WO2A 1MFUA 3FAWA 2GDVA 3PBGA 2J25A 1WNOA 5DO8A 3W29A 1QI3A 1NWUA 1BSIA 3N13A 3S2CA 3AMGA 4MJ2A 2WSKA 1E6ZA 2AOSA 1P6WA 2C0HA 4W87A 2VQTA 3FAXA 3L4WA 2VZSA 4QLJA 3CMGA 4P8WA 2VNCA 4BQ4A 1KBBA 4WIWA 1H3GA 3AFBA 1BYCA 4D1JA 1DHKA 1KXQA 1QNRA 1UOKA 1PJ9A 2XVKA 3DYOA 1E4LA 4JFUA 2BVYA 4RE2A 1EO5A 4RE3A 2WVUA 1CGYA 2XIBA 4AD2A 5HNNA 1DWIM 3U57A 1E0VA 4X0VA 3OG2A 2DEPA 1W1TA 4D1IA 5A6LA 1UHVA 3PZVA 3WMCA 2WVSA 2G41A 1E5JA 4IISA 5DF0A 1H41A 3DC0A 2WKGA 5HDRA 3CZKA 1WDPA 4MB4A 2CESA 3MMUA 4X0NA 3WF1A 4PTVA 3A6OA 3RMEA 1LWJA 4MJ4A 4DWSB 1X1NA 1H1NA 2BY0A 1D2KA 3MUY1 1Z32X 4PSRA 1Q6FA 2WVVB 3L4ZA 1TE1A 3RDKA 4HZ6A 4EAMA 2ZUWA 1BVZA 2JFEX 2QPSA 3ZT6A 3A3HA 3EDDA 1W9UA 3ARSA 4UOZA 4GZIA 2EPNA 4JAWA 3M7SA 3CGTA 2BXZA 1LL7A 3VM7A 3AROA 3LPOA 2D20A 4B3LA 3NDZA 1OSEA 3MU7A 5BRQA 2VVNA 2BY1A 1JZ4A 3MMWA 1MYRA 4UQ9A 3K4AA 4DM2A 3A47A 5A3HA 3TOPA 3WNOA 5A2CA 4YPJA 4MB5A 5FIPA 1GOWA 1WDSA 1US2A 4TVUA 5FOOA 2BHYA 2O92A 3FY1A 2VR4A 2J7EA 4PCSA 2HISA 2QLYA 1X6LA 1GOKA 4C7DA 1UR8A 4ZXOA 5FD0A 4AIOA 4WKHA 3GXIA 1JF6A 3BAWA 3W6MA 1QHPA 4W5ZA 1CEOA 2ZX8A 3CHFA 8CGTA 3PZGA 5C71A 3DYPA 3FXYA 4ZE5A 3SUSA 2W4XA 1XH1A 3THCA 2VO5A 3N11A 4IPLA 1NARA 3QGVA 2C8NA 1NP0A 3VIOA 3VINA 1OGGA 2ZUNA 2ZX7A 1DWHM 4TOQA 3CH9A 1D7FA 1LQ0A 2VRJA 3DHPA 1JG9A 1QBBA 1CDGA 2WVVA 1OGSA 1E6PA 4URIA 1K9EA 1XD0A 3SCWA 5D9NA 5AC5A 1VFMA 1PZ2A 3WDQA 1M53A 1CYGA 3WKZA 1WE5A 1GQJA 2G8ZA 3OLDA 5A8PA 1E0WA 1PIFA 5GQBA 4HMEA 3GYCA 2EBNA 3SCRA 5A6MA 4ATWA 3T08A 4YHGA 1B1YA 2CXGA 1BFNA 4FLOA 3KWXA 5DFAA 4UQAA 1E71M 1U30A 3ZOAA 2G3IA 4WF7A 3ZQ9A 1KXTA 4MDPA 2JEQA 2DSZA 5A8MA 3VX0A 5EBAA 3K46A 1WP6A 4HU8A 5FCZA 1FHDA 1CXKA 4AZ5A 3ARXA 2CEQA 2WLYA 5GNZA 1BLIA 5BXSA 1NM9A 3VGFA 2PB1A 2Q8XA 2CHNA 1C8YA 3GNPA 4H8VA 2BVTA 1PIGA 2CIPA 1B90A 3WNMA 4KGLA 3J7HA 1WZAA 2WHJA 5M03A 3QOKA 3WH6A 4QFUA 1V6YA 3ZMRA 3PZNA 2WCSA 1W1YA 1CGUA 1S46A 3WF0A 4PTXA 3AS1A 1LJYA 2PWHA 4D6CA 4AZIA 1PPIA 4GO8A 3VD3A 1E0XA 2DDXA 4PUDA 4W8LA 1J9YA 4BZYA 1LF1A 2CITA 3PHAA 5I0DA 3MMDA 1DEDA 3N9KA 2X09A 4KWUA 2WMIB 1ESWA 1CGXA 1E6QM 3VIIA 1I1WA 3B9AA 1E4NA 5E0CA 1VBUA 3W53A 2XGBA 5I78A 5I6SA 4E2OA 1KGWA 1GUVA 2D23A 5IDIA 3ZT5A 1WZLA 4B16A 2VZOA 1UD3A 1GOMA 3M6DA 1KXHA 5BROA 2OSWA 1IV8A 1ZS2A 2ZE0A 3HU7A 2EQDA 1J0IA 1CLVA 2CCRA 4EK7A 3SCOA 4M24A 4KRTA 4AD0A 2FH8A 3W24A 1W3JA 2V38A 4AD1A 2VVSA 4QCEA 1XRVA 1C90A 4F9DA 1B3YA 2YLLA 4UQCA 9CGTA 3WQ6A 4UFKA 1CGVA 5CLWA 4D6GA 4Z2KA 1OIMA 1VAHA 4J28A 2JF7A 4QCFA 2RGLA 1HVQA 1J18A 4XZBA 2BXYA 4CVUA 1ITXA 1H09A 4AIEA 4PN2A 4W88A 1E3ZA 1WAWA 5TD4A 3L4XA 1VEMA 2YIHA 3BMVA 2ZUVA 4M82A 2VCCA 3VMPA 2XJ7A 1E73M 1QHOA 1BAGA 3K8KA 2CKSA 2WMIA 1EHNA 2E40A 3KZSA 1J0YA 3BLPX 2C7FA 1FP8A 3TTYA 2J75A 2J74A 2ZXBA 2YDQA 5KZ6A 4U2ZA 1TA3B 3BAJA 3EYPA 1HL9A 2J7DA 3MUIA 1NOUA 3W6LA 4RL3A 5A6SA 2VRQA 1R85A 3KL0A 2YL8A 4AZGA 1GVYA 3TA9A 7TAAA 4PMNA 5DEZA 2J77A 3GNOA 3WD3A 3CIVA 3MS8A 3AYRA 1IT0A 1FH7A 1IZKA 1TCMA 2W63A 1NWSA 3SURA 5BCAA 2VZTA 2EPKX 4PSPA 1V6VA 2BVDA 3CUIA
chains in the Genus database with same CATH superfamily
1G1YA 1EO7A 2Y0FA 1DJGA 1F9CA 2DZPA 3TK7A 4ALDA 1H7XA 1HJWA 3GC4A 2GQ9A 4TYOA 2Y7GA 3UESA 5DN1A 2W5FA 3JZEA 3GNNA 5AYBA 1W5MA 4B9YA 2Z0IA 3FSTA 4GY1A 1JYWA 8TIMA 3AXMA 4Z1DA 1L8PA 4BWLA 1CTNA 3T0AA 2EHHA 1J8VA 1T0OA 1EOKA 4PMYA 1UUOA 3FHAA 4MJMA 1JGIA 2IPWA 5ABGA 1JDCA 1SPQA 5H1WA 4LSBA 4S3KA 1ME9A 2QW5A 1QOXA 4S3FA 4IPXA 5C9UA 2G37A 3AZTA 1OFOA 4LYQA 3PNZA 1WDDA 3B4YA 4U10A 3MBDA 4BI6A 4FOJA 3G8RA 2ZIDA 1BRLB 1DXIA 2F9RA 2I7GA 4YVPA 2CLKA 1P4CA 4LNYA 1F74A 1PKYA 1MXGA 3WL0A 3SADA 3L7RA 2E1DA 5A8QA 2QV4A 3VABA 4LGXA 3P67A 2VX7A 4RK8A 2WOQA 4K36A 3QMSA 3CUZA 2F2DA 4HK7A 1S38A 4MUPA 4AEOA 3OBEA 4F3HA 2P5NA 2FLIA 4L4LA 3P82A 3MHGA 3RN6A 3CT2A 1FA2A 4HQVA 4IIFA 3BG9A 2DT0A 2WHKA 2AQWA 3E0FA 1XR2A 3WNPA 3IJIA 3N4AA 3WJSA 4C6MA 4KF1A 5EBUA 3V3WA 4TU1A 1FWBC 2J9XA 2QGHA 3N17A 1EC9A 1X1ZA 1T6MA 7PTDA 3GPKA 2JK2A 3O06A 3TZFA 1BXCA 3RX2A 2C71A 2ZQVA 3FFSA 3RM9A 3KLLA 5ABFA 3SUUA 1JJKA 1FRBA 2PPNA 4AD3A 4Q7BA 2ZWYA 4FNUA 1VIZA 4QQUA 1O94A 3RCNA 3RU6A 3FDKA 4F9JA 2BFGA 3PNUA 3S42A 2XH0A 4AMCA 4B2DA 3VNYA 3CGNA 3NQ8A 1MWOA 2Q01A 4XK2A 3HMJG 3TXZA 2A3EA 3SAZA 1OCBA 2PWVA 4JIEA 1ROUA 4GX8A 4TQTA 2J79A 3LHTA 3VKBA 3WH0A 3VMNA 2GWGA 5I2UA 2D0FA 4DLFA 3I7QA 2VGGA 1GOOA 4AX6A 1F6YA 1UR9A 2R24A 3WNNA 3QPZA 4PEKA 3B9DA 2CZDA 4Y8EA 3E2QA 3L4VA 1JVWA 3UI6A 3MHUA 1W0MA 4FAPA 2Z1SA 2P3EA 2ZRXA 1FKJA 2ATMA 2JIWA 3B8IA 3GVQA 3HBLA 1XLJA 3V5CA 4L5ZA 1EQ3A 4WK9A 3QR3A 3VD7A 3RM8A 1N82A 4H04A 4GZ7A 4O13A 1PV8A 4EKJA 2FJUB 1FY6A 5CCZA 3ITVA 3G18A 1UIPA 1AJZA 4NX5A 3AU2A 1QNOA 4W8BA 3TC7A 2JKEA 4O57A 4H41A 3MKCA 1JD7A 3PB0A 2RUQA 2A0NA 4JHZA 3O5DA 1VR6A 1PTAA 5AHMA 1EIBA 5FJRA 1JXJA 3NQAA 2Z28A 3P80A 1GQKA 1JYNA 2OB3A 3PZ9A 2DT2A 3KWSA 3FLUA 1PEZA 4HA4A 1RUSA 4K6AA 3QHOA 1MXDA 1R0MA 1FCQA 1V3JA 3VI2A 5BXJA 2J13A 3B8SA 2Y24A 3LHVA 4HYWA 2IQTA 3IKDA 2OWXA 1ROTA 2CETA 3JVAA 2IXUA 5CKSA 2DT3A 4ERGA 2C15A 2YBVA 3R7MA 1Q6OA 4UQEA 4HPNA 4ICNA 2HSAA 2XP6A 2XP8A 3GY1A 4W7WA 5CZKA 1U1JA 1YNQA 2QHAA 4IIHA 2EJ1A 1I2OA 5EMYA 1CXLA 1MQQA 2YYTA 3BV4A 4DRPA 1YQ2A 1B5TA 1J6PA 4QAWA 2HBVA 4Q8WA 3B3DA 1CGTA 3N73A 1K7EA 4ODLA 1NFPA 4X2RA 2BMBA 2VX5A 2IKGA 1UBPC 2ON3A 2V68A 3RX4A 4CQ9A 3AZSA 2DJXA 3N9RA 4Q4KA 2PP0A 1Q2SA 3PTMA 1E6RA 4EXBA 1FWRA 3M47A 1K9TA 2C3ZA 5G4HC 1Q4NX 2YBTA 1D3CA 3B4UA 2QCMA 1N8IA 2YJQA 5I3HA 3QKZA 2WBGA 2NLYA 3TYEA 2X2YA 4RPQA 1TX0A 4GIVA 4J3TA 2PV3A 2GDUA 2AKMA 5HXMA 4S3AA 2P3ZA 4UOJA 1ELSA 3WDRA 3SGUA 5D04C 1EDQA 3VNIA 4POCA 1EYWA 1CENA 1NP2A 1JYXA 1EZWA 2CC0A 4LVDA 1TCOC 3TKFA 4DZAA 2XIQA 4JIQA 3M4HA 4EP8C 3PA7A 4PTMA 2QCDA 3QW3A 1POJA 1RD5A 4M8UA 3VKCA 4MSSA 3WQ8A 5CXPA 4O8RA 3MKVA 3NL6A 4I9MA 3R25A 2O7SA 5D2TA 3QF0A 4MY1A 2ESCA 1RCXB 5IBXC 3S6DA 2DZVA 1GVFA 4GC3A 4MB3A 3MDUA 3QY6A 4S23A 2C1GA 4US6A 2GL5A 3QPYA 3EWXA 4HCHA 5CSUA 4E3VA 3CL6A 2R8WA 4XD5A 1VP5A 3NEHA 2Z1WA 4AY8A 4FB7A 2D0HA 3KTCA 3EDKA 3DGBA 3UERA 1LLWA 3S8HA 1JFXA 4IF2A 4YNGA 4AEFA 3EMCA 2G4JA 4FAMA 3WENA 4NU7A 2PDBA 3LHYA 4E5TA 2G3NA 2EJAA 2PWFA 1HKMA 4HT3A 3UJ2A 3VK5A 3OQ8A 5JIPA 3OVGA 4KESA 5D38A 2XYLA 2MLXA 3P7YA 2PF8A 2V3FA 5BMXA 1MDLA 3RAOA 1YYAA 2PEVA 1OIFA 3F4DA 4KWSA 2QCFA 1KTCA 1KRCC 3W1RA 4LC6A 4HCDA 1K02A 3SFKA 3LA4A 3M0KA 1L6YA 5A8NA 5EY5A 1VPYA 4JTTA 4Z1BA 4MSPA 1NIUA 4CCCA 4RX0A 4FOUA 2V9DA 4NAFA 4ES4A 3HFYA 4MPKA 4JFKA 1K8CA 1VYPX 4ZE4A 1LOLA 8XIMA 3GX9A 1BSLA 2LPVA 3W74A 1W1B1 4D6EA 3NQ7A 3EPMA 4Z08A 3GTIA 4QXIA 2PDXA 1Q6EA 2UWFA 1SW7A 1JI1A 3C8FA 4UZUA 4HZ8A 1PB0A 1V08A 2OGYA 4XKMA 1GZ1A 1YATA 2GQAA 2HJPA 1KA9F 2PRHA 3NYZA 1LZOA 4EPKA 4YCPA 1AODA 4WLCA 3IUHA 3DI0A 1E9YB 3MCMA 4QHRA 3AMLA 3P62A 3ABXA 1QU4A 4CN4A 1V6WA 3BOLA 4MYXA 4ZS6A 4A3QA 3VILA 2WV8A 2HRWA 2PA6A 3QQ1A 1XHGA 1XLLA 3LTPA 4Q4RA 4AF0A 5CGQA 1FKFA 1ZAJA 1TG7A 1ISXA 4MAZA 2NSXA 3URBA 5BW6A 1JUKA 1KM3A 3R0UA 3TSDA 4NG3A 2XGZA 2TODA 3GXPA 2ZR6A 3S2MA 2IS7A 2PGRA 4XB3A 4PCNA 4H00A 1E56A 3SFWA 4XAFA 2J8FA 5AN7A 3AYSA 4F48A 1HJQA 3H55A 1DKWA 3CMJA 1XIDA 2ZRYA 4JN8A 4LCSA 1XD1A 1WBHA 4XZIA 3GUWA 1CT5A 3WQOA 3H26A 4PBFA 3WUFA 3GKAA 4O0ZA 1XW8A 4PFHA 4Q4QA 4GUGA 2PRMA 2WC4A 4AZCA 3G0SA 3LB0A 2PWEA 4CD7A 1JRBA 2Y6ZA 4WDTA 1NY1A 4IG2B 3OPSA 3GZ3A 3E9AA 4R3UA 3OIHA 3BQ5A 3TC5A 2FJKA 2DG3A 3PZMA 3BG5A 2CZVA 1SJDA 2DH3A 3GNDA 4ZQCA 2DT1A 4DROA 1FWWA 4M0XA 3XIMA 3PZOA 4W89A 3DI1A 3IGHX 1AQ0A 1AMKA 1OEPA 3T0DA 3VKJA 2HS8A 3DYMA 3NTPA 4TTUA 3T0TA 3LUTA 1SR0A 1IXNA 1J4EA 4A05A 3DGRA 4U2YA 4JQ4A 2X1SA 2FHCA 1JCXA 3DERA 2PDUA 3WUBA 1J2BA 3PWIA 2A6NA 4JFSA 3PTDA 4ODKA 2FTYA 5LIYX 3GDBA 3CAKA 4NKCA 3FS2A 3NL2A 5HMDA 1TR1A 3KRBA 3WNKA 4REQB 2X1RA 1L0PA 2FZNA 5I00A 3G1HA 4CEUC 3ERPA 1OX4A 3T4CA 3U2EA 2YXOA 3NQBA 2QDDA 3AIUA 1XPYA 5LKYA 1HKIA 4RNHA 2W66A 4WY0B 3M9YA 2FZ9A 5F1UA 3V18A 3NO3A 3SIMA 4WVXA 1J5SA 3POCA 3RLGA 2OXNA 1JZ5A 2WZMA 4E2DA 2X42A 1KBJA 3G2GA 3W28A 4C7GA 1SFLA 3UQNA 3M5XA 2HZGA 4GE8A 3O8AA 4WKAA 4DM1A 3W7PA 2PDLA 4DELA 3ISIX 3DH7A 1B9BA 4YU1A 3EDEA 3KBWA 2WMJA 3OU8A 1M7XA 3TTQA 4JL1A 1PE1A 3WQPA 1U22A 2Q8ZA 3MMTA 1P0BA 1R9XA 4DVOA 1UD8A 3C61A 2BODX 1G9HA 2WK2A 4M80A 4W9OA 3B03A 5AHFA 4F0KA 4Y2WA 2VCAA 2VX6A 3GYEA 3W1AA 3OTRA 2J78A 2DSKA 2YL6A 1WPCA 4J7RA 3W73A 1NSJA 2VFDA 3IJ6A 2X1UA 4GVIA 1YE6A 3WQCA 4W86A 3WBEA 3FKRA 4JKLA 5C9XA 1JVNA 1Y65A 2ISFA 3HGJA 3OG3A 2WSPA 2QMJA 3SUVA 1OF6A 1EWEA 4Q6JA 3G1VA 1EQCA 4D6JA 1Z41A 5E1QA 2WJEA 1VF8A 1VPXA 3A4JA 4KRUA 1G4SA 1DOSA 1HKVA 1K8ZA 1SJBA 3WFAA 4GINA 1DIEA 4I6KA 3VZZA 1H11A 1A3HA 1LROA 3K30A 3JRKA 2ZXDA 2V3DA 4Q3MA 2Y5EA 3TDFA 5DT7A 3QRHA 1EUAA 3H2AA 3SSZA 3FIGA 1E4IA 2G95A 4MNMA 1GEQA 1I75A 4PMJA 3R0KA 3HQOA 1UOZA 3S9IA 1JRCA 4MPQA 2H6RA 3TYBA 1SW3A 2ABBA 5DQPA 2QCGA 4IPJA 2XH7A 3OQEA 3SN1A 4UTTA 1Q7QA 4QDMA 2NV9A 1KFBA 1G5AA 3W7DA 2E6AA 4OKDA 2VCDA 1A47A 3CUGA 1X38A 3KL5A 2BOFX 1RPXA 5A2AA 5IFTA 1JPKA 1VFHA 1GW9A 3PRBA 4O50A 2A3LA 4U33A 3MZNA 3W7RA 4B4FA 3OZMA 4UFMA 2W91A 1XP3A 4F0HA 3H12A 1CECA 3E38A 3CYVA 3DAQA 1V7YA 4RV8A 1JZ8A 2DW6A 1XF0A 4I8YA 2CZEA 4CCDA 1W32A 4MWAD 3UZWA 1UIOA 2BOEX 1G69A 3GTHA 4UFIA 2GYIA 3LPFA 4O19A 1E1CA 4UTIA 1H49A 4MZ1A 4FX6M 1DJIA 4XZHA 2D22A 4O4VA 2ZDSA 1O1ZA 3WUEA 4CU8A 4OJYA 1OK4A 4QISA 3CLWA 2DIEA 4QEHA 4ZQMA 9XIAA 3DKLA 3W9ZA 2QDHA 2YL5A 2A3BA 2CLEA 3BURA 4XSLA 4MZ8A 2VT0A 1W6TA 3LRLA 5E09A 1W9XA 3U6WA 4AVNA 2RUDA 1A7XA 4MKSA 1UA3A 2O0TA 1K6AA 2VC7A 2RSEA 1YXCA 3O5LA 4GI9A 3W85A 3ICJA 3JR2A 1F7BA 1GNXA 3C5QA 1IYXA 5EMUA 2BG5A 1LM1A 3DDMA 3RR4A 4CU6A 5E70A 2GK1A 3OO2A 3L23A 2PRLA 2ATSA 3NR0A 4JFMA 5LIWX 3OLIA 1RVKA 3AMDA 4LUYA 4M51A 4BI7A 1VYRA 5A2BA 2Z1KA 2TSYA 1QPQA 3ZSTA 4ADUA 1YHTA 3TC6A 2VYOA 4ZO7A 1PSCA 2IUZA 2O55A 1M41A 1K7XA 1XS2A 3C86A 3V5OA 1L1PA 4W9TA 2PURA 3W26A 4A8IA 3TYZA 3C2VA 4RW5A 4LTSA 4GACA 1LT7A 5EKYA 4NF7A 4KKXA 4PMDA 3BWWA 1KM0A 2KR7A 4QP0A 1LORA 2OGJA 1XGDA 3BOXA 4HTBA 5CSRA 2ZZ3A 4O53A 3SM0A 1XG4A 3VC6A 1C8VA 4EE9A 5TNVA 2Z00A 1G4EA 3M0IA 4PRRA 3P93A 4G1NA 1WCGA 4GO9A 3W01A 3EOEA 4BKNA 2CYGA 2VOTA 4ACYA 1VCFA 3L2LA 3FVDA 4C6PA 3KX6A 4X2PA 1ZCNA 1BQCA 4JKKA 3VE7A 2V81A 3V1PA 2ZX5A 1R87A 1XV8A 3CTLA 4QG8A 4FO4A 4KGJA 5C0QA 2ACUA 2E9LA 4FK9A 4TMBA 3ZWSA 5BOOA 4GIAA 2PN0A 2OKTA 4H4IA 4S2CA 1UKOA 3R8GA 4GYKA 4DEFA 1QUMA 1G01A 2J47A 3H54A 3HGSA 2OYKA 2MNRA 4OIFA 4MDOA 4IT4A 2VEFA 3VGEA 2ZFAA 3E2SA 3WEZA 1KBIA 2Y8VA 3PBYA 1I2RA 4AYSA 4JY9A 4MMWA 3HN3A 1BF6A 2YFOA 1U5JA 1KRAC 3T42A 1JZ6A 4J2PA 1E40A 4KWVA 1PX4A 1QVBA 2ZUSA 1RBAA 4B5UA 1DIKA 1MUMA 1YXDA 1YTEA 4HARA 1L6FA 3O6YX 2H9AA 3WD4A 1UUMA 3AUJA 3GM8A 1QBAA 5CJNA 4I9AA 4L61A 5MKGB 3T2OA 1VJSA 1AL8A 3UI4A 2CHRA 3LGGA 4RPPA 2JF6A 1C93A 3II1A 1J0KA 3W7GA 4YHEA 1HF6A 3NWRA 3C8NA 1C3FA 3IJ7A 4TX6A 5A8OA 1V02A 3DG6A 3B9EA 4UTWA 4IGMA 1UR3M 2OODA 1GG1A 2QUVA 1RXOB 2XG9A 3M0HA 3WQ5A 3GO2A 1QTWA 3PUGA 3RFAA 4JFJA 1JNEA 1Z6KA 3AOFA 3GNXA 5FF2A 3IVUA 1R9ZA 4KT2A 1KCXA 2VCBA 2PDJA 1IT7A 2OVLA 4KQZA 1MFVA 2XSAA 4U5KA 4DRJA 4NYUA 5K9DA 2XHYA 1PZ0A 3PAJA 5G2IA 4MFDA 3LXCA 3R1ZA 4WKFA 1ZPTA 5AC6A 2X2GA 2E9MA 2XIIA 4AHPA 1QI2A 3CB8A 1GZJA 2ZRZA 2JGQA 4I8DA 3URNA 2VZUA 1B3WA 5E9AA 1BXNA 4HHHA 3IUDA 3VOCA 3USZA 1GGOA 5AFDA 1KTBA 1T5AA 4B91A 3U7BA 4WJ8A 4K7VA 4IX2A 3FVMA 5E0KA 3FYYA 1WKFA 1VFOA 5ECUA 3N3MA 1FDJA 2MANA 3VIMA 1SZNA 1G4PA 2I57A 4JIIX 5HAOA 4PMZA 1KLZA 2TRSA 3B06A 1SZFA 3W7CA 4TIMA 1JCJA 1XIIA 3B0YA 5DIUA 1PTDA 3KAGA 3T07A 4DH0A 1WDRA 1PCWA 4B9ZA 3M44A 3DKJA 2PTDA 2J7HA 1MNSA 1VFFA 3ELFA 5CBIA 4L1XA 3GXFA 3KTSA 1MEHA 3UWZA 1C9DA 5CC5A 3F7JA 3TLQA 1M3UA 1RZMA 1H0GA 1SM9A 2NWSA 4M19A 5DO8A 1WNOA 4MZYA 3W29A 4KBXA 3E0LA 1MEIA 1QI3A 3FDGA 4M6VA 3HGRA 2D9FA 4HN4A 4MJ2A 2V63A 2NQLA 4GIEA 1VH7A 2C0HA 2VQTA 7REQB 3L4WA 1K77A 1QAPA 4QLJA 1A50A 3CMGA 5FEWA 2VNCA 3OZYA 1XLEA 1H3GA 2QUTA 4GFIA 1R3RA 2VHLA 1BYCA 2JKPA 1VZWA 1QNRA 3NEVA 3WZ0E 3ES8A 3K2GA 5EU9A 4F0SA 1RR2A 4R7OA 2PCQA 3WLSA 2J8TA 4AD2A 3U57A 1FKIA 1E0VA 4DF1A 2IKJA 2QJNA 3OG2A 2DEPA 1PBKA 2GOUA 3PZVA 4INFA 3IIOA 1UMYA 4KETA 3W7MA 1EB3A 3DC0A 3YPIA 2RDXA 3EA1A 4ZMGA 1QO5A 5KINA 2J24A 3RMEA 5HW6A 3VKAA 4DWSB 1X1NA 3Q65A 1Z32X 4IFKA 5FF7A 3BLDA 4OECA 1V77A 4EAMA 4AVOA 2A21A 4HK5A 1BVZA 3ZT6A 3PRDA 3A3HA 3Q2DA 3HG2A 2RAGA 1XQKA 1Z3NA 3UWVA 1PYMA 2Z2AA 3CUXA 1PIIA 3M7SA 3H4XA 3GIPA 1X97A 4A2RA 5I3FA 3M0ZA 3AROA 2D20A 5K2ZA 1XLHA 3EXSA 3I7RA 2BY1A 2LJ4A 4G7EA 3R6IA 3K4AA 5LGXA 4Q8VA 5A3HA 5A2CA 4YPJA 1LOQA 3RRXA 1EC8A 4JGDA 4NILA 2BHYA 3KOYA 3MDYB 5G1MA 4DJED 5C9ZA 3SIZA 4IPIA 2I16A 3KHDA 4ZXOA 5FD0A 2O4MA 3BLIA 1DQWA 1F05A 3LNMA 3TMLA 4W5ZA 4QTGA 4IWWA 5C71A 2V6AA 3DYPA 3SUSA 3F4NA 2W9MA 1XH1A 2VELA 2EGZA 4IPLA 4QX4A 3VINA 4K8HA 1OGGA 2ZUNA 2B7OA 1D3GA 2CLMA 3PF3A 2OT1A 1D7FA 3I6CA 2VRJA 3DHPA 2A7NA 2QUNA 3AU6A 3OODA 4IIDA 2GUBA 3SCWA 5D9NA 1VFMA 1XBVA 1PZ2A 4PGLA 1KKOA 3W71A 1CYGA 5B7YA 5C9WA 3OLDA 2BP1A 4DBUA 2EBNA 3SCRA 4ATWA 2Q02A 1Q7ZA 3P2VA 4FLOA 1H7OA 3UP8A 3CXOA 3M41A 1MUCA 4H6EA 1HL2A 2G3IA 1UWAA 5BZAA 3ZYZA 1F5ZA 1ZENA 5A8MA 3VX0A 1L2UA 4H9VA 3DX5A 2Y5SA 1WP6A 3S47A 5JQ9A 3LEPA 3MC5A 2IW0A 4RZ5A 2WLYA 5GNZA 3A3WA 1YBQB 1XQLA 5HMSA 4DRNA 2NXIA 1C8YA 3GNPA 4RUBA 1B90A 3WNMA 2ZA2A 2F84A 4LBSA 5M03A 3WH6A 1SJAA 4JTJA 4L9YA 2NUXA 1CGUA 1S46A 5TBOA 1XIHA 4PTXA 1LJYA 1W3IA 4D6CA 1JNSA 4O52A 3UWYA 3FGCB 4W8LA 5D2XA 2E7FA 1LF1A 1LT8A 3PHAA 4KCWA 3MMDA 4HNOA 2E5BA 4KWUA 5HWNA 1ESWA 1IT8A 1Z9AA 2R94A 3MP5A 3RITA 3TC3A 3B9AA 4A3UA 1E4NA 1PO9A 1SO4A 5G4EA 3W53A 4H3DA 4E2OA 4L3NA 3S1UA 4B16A 1OYCA 3E2VA 4GC4A 1XI3A 4ORMA 2H8XA 3HU7A 4DXXA 1C29A 4LVBA 2EQDA 2Y61A 4D2JA 2B7PA 1CLVA 1T8QA 1H61A 4EK7A 3SCOA 4M24A 2ACSA 4AD1A 3MUXA 4LVFA 2VVSA 1XRVA 3GHTA 2GWNA 1XBXA 1US0A 1CGVA 1P5BA 5CLWA 1DV7A 1VAHA 1M7OA 1Q63A 3KADA 1ONEA 1GYNA 4XZBA 2BXYA 4CVUA 3CASA 3EB3A 1KBLA 3W7EA 3FV9A 4O11A 4AIEA 3DFQA 4PN2A 4IT6A 3ANVA 1E3ZA 1WAWA 4H1ZA 3BMVA 2ZUVA 1XFCA 4XO7A 3VMPA 2XJ7A 4TW8A 1BAGA 1LBMA 4JYFA 4MIMA 2C7FA 2XIMA 1A3WA 3HV8A 5F4WA 2J74A 2YDQA 4R88A 1HL9A 1NOUA 4NUWA 1YDOA 4XSMA 4RL3A 1R85A 2G97A 3GC2A 1UW9A 7TAAA 2MNTA 1W1ZA 3CIVA 4ZTYA 4PB4A 1IT0A 1ECQA 2ALDA 1P1XA 3QLLA 3C2OA 5BCAA 2VZTA 1XKJA 2EPKX 4PSPA 4PC8A 3NVTA 4DAIA 3EB2A 3O5EA 1E9ZB 4LS0A 2BB0A 4ZR8A 1JYVA 4NJKA 1F8IA 4J4NA 2ZX9A 3WLOA 1ODZA 2Q5AA 2I5QA 3O0KA 3PTKA 3C0QA 4M3PA 5HUPA 3FSUA 1BG4A 1XINA 1OWQA 2YA1A 5DMYA 1P48A 3O63A 4LUTB 1MI3A 4J3VA 3CPRA 4IX0A 4LT9A 1YNYA 4Z1CA 3KP1A 1F2JA 3IIVA 5CGTA 2UZ9A 4JN6A 4O0QA 3P8JA 3I4EA 1TWSA 4V2XA 2PLMA 1DJHA 3GVWA 3NZPA 3VZYA 1KB3A 2ZXQA 3NM3A 8XIAA 5AYXA 4W93A 2FGLA 2GVYA 1V0KA 1V93A 4LYRA 5ABFB 4MGGA 2OX1A 4PUEA 2QUMA 2VKZG 1AA1B 5AYYA 2FTPA 2X1IA 2PP3A 3ONCA 1FKGA 2ITKA 3U2ZA 1QHZA 4J4OA 2PWDA 5FF3A 2I5GA 3OJGA 3WH8A 1R6WA 3EDFA 4K8EA 4K39A 1ME7A 3AHXA 2OR2A 2X30A 3UF8A 2XM1A 3GD6A 3OA5A 1TR9A 1E3XA 2XSXA 4GUIA 5A8GA 3G1RA 1O66A 3VD9A 3IKGA 1E70M 4UTJA 5D2YA 3STFA 1PINA 2P8BA 4P8XA 3EX6A 2QPXA 5A94A 1R3QA 1TWDA 1EC7A 1OG0A 5BU9A 1IEWA 3AYVA 3P60A 5LNRA 3UGRA 2VX4A 4PMVA 3CIXA 1WXYA 4R9XA 3R0DA 4QJ3B 3AC0A 2WZIA 4IGNA 1SGJA 1ZNNA 2I1OA 1ZK6A 5I03A 4MY9A 4B5SA 5XIMA 3SN0A 4AHOA 3NJ3A 1CLKA 3MW7A 2XVNA 3W72A 4YYCA 5D2VA 2FDSA 3DEQA 1J4IA 2X16A 3TQKA 3H2OA 1UZ1A 1WZKA 1Q45A 3V0UA 4RXFA 2XP7A 3CBWA 3UVIA 4NNRA 5FAGA 4GI6A 4PZVA 4FLRA 1VHCA 1ZY9A 1EJVC 4ORIA 4Q8QA 1EF2A 1YLVA 1N7KA 3BLLA 4RDYA 1W5OA 3AISA 4B5VA 2I14A 5JBEA 1ENUA 4N7QA 2ZQ0A 4H01A 3PM6A 3N6HA 1RLCL 1NMVA 1UH4A 5CBBA 3H2NA 4HJFA 2PU0A 4GA8A 4JCMA 2FZ8A 4WX2A 2J7FA 4FALA 3LTSA 3WLNA 5AB3A 2L2SA 3CO4A 4LUSB 4P7NA 3IAPA 3K1GA 3TYAA 1X98A 1CPUA 3QVQA 3C0LA 2EG7A 4P61A 4Z2HA 2VWTA 1BPLB 1NSGA 3T7VA 4D9PA 3IK2A 4W5UA 1KNWA 4N4PA 2FGBA 4GG9A 3AO0A 2W27A 3GAYA 3CQIA 2XPBA 4JDYA 1A5MC 4K68A 5JMUA 3MO4A 5LNUA 4A22A 4K38A 3EPOA 1WQ5A 4DY1A 3T81A 1DXFA 2DQWA 3VUPA 1YTDA 1LDCA 3CHCA 2YB4A 1CLXA 1QT1A 2HWGA 4JKMA 1E9LA 4AISA 3H24A 1KWKA 4RV3A 1MZRA 4P2VA 3W2NA 5C7HA 3AZRA 1W5NA 3LBMA 4PUNA 3VU2A 4H2HA 4WY0A 4JX6A 3CV6A 4L6HA 4UMCA 4EACA 3ZLGA 1GKRA 3FEQA 1LQAA 3OB8A 1B4EA 3GHRA 1NQ6A 3M0JA 1YW1A 3W84A 4LVAA 3UBPC 1PKMA 3BC9A 1XRSA 3W1XA 1VEPA 2D69A 3RF9A 1W3NA 2QR6A 3TN5A 2JALA 4QZVB 2WNZA 1PZ3A 2HROA 3VMOA 4IL0A 2TAAA 1I0BA 1QI4A 7ODCA 1OX5A 3H4WA 3UFYA 2QCCA 3C4UA 4TR9A 3FW6A 3V16A 1HXJA 3A5FA 5JIWA 2QCDB 2V30A 4EXAA 4WSJA 3DOPA 4KCTA 1XLBA 3ZVHA 3QZEA 1CGWA 4IMCA 4FIRA 4EPDC 1M04A 2W92A 4LAMA 3W82A 2Y7FA 4YWSA 4JOMA 2FPVA 4YIWA 2E4TA 4DRIA 1KQZA 2ZX6A 4OU1A 1R9HA 1AFSA 3TW7A 1YDVA 4IMDA 5DITA 4F66A 3RLVA 4QDPA 4CNOA 4HA3A 4LBRA 2QNEA 4GCXA 4UIOA 1JCLA 4XBKA 4MTVA 4ZFMA 1UC5A 3U2OA 2J7BA 3CGMA 1RCOB 1DJYA 3BUVA 4H7VA 1XYLA 2Y2WA 5H91A 3IWPA 4Z2JA 1FKLA 5GNXA 2VGBA 3IARA 2C1HA 2IPJA 4U3CA 3NPVA 3ABQA 3DG7A 4H8HA 1XIGA 1AQMA 3LLFA 3KEHA 3UNTA 3WK1A 4RCXA 1OM0A 1FXPA 3EDJA 3MWAA 5D75A 2V5CA 3VNMA 4E6MA 3ABOA 1WDWA 1V6XA 2JGYA 2CBIA 1KT1A 5DCBA 2YBUA 2CPUA 3E1F1 2D73A 3VIGA 4QEEA 4P7OA 4N0RA 1T99A 2CBVA 1PKLA 4FR1A 3UT0A 3AMKA 2XGIA 4Y9OA 2JQXA 1D7JA 1EL3A 3GXTA 4HTYA 4X3ZA 1V4YA 3F5LA 4N2YA 4HMDA 1A3XA 3AYTA 1RSCA 2R1PA 4I5XA 3U5UA 4PMUA 3W22A 1CWYA 2ASHA 4NAFB 1BYBA 1HKJA 3VX1A 5I06A 2ZC8A 1GT8A 1M7JA 3FCPA 4JTCA 4QSFA 2OX4A 2CW6A 5C5YA 4YN5A 2OEJA 3UY7A 4D6FA 1VEOA 1MW3A 1NDZA 3WH7A 5BRPA 2DVXA 1TPDA 2V67A 4PCTA 4PCFA 3WDJA 2FB3A 2XISA 4ZO6A 1OG6A 1BKSA 3D47A 3WUGA 4DZ5A 4Y90A 5JBFA 1XH2A 5K4ZA 3CIWA 5HWBA 3E5PA 2XP9A 2W67A 1XISA 1AZ1A 1GKPA 4LS1A 4IQDA 3OHMB 3UA4A 4XD6A 1OINA 4DRQA 4BQ2A 2VEKA 4PTNA 1YDYA 1DJZA 4GQQA 3CC1A 3O5FA 2R82A 1HGYA 3KBMA 4S3GA 4ML4A 5FA5A 1OK6A 1DQXA 1NF0A 2YZ5A 2O9OA 2Q71A 2ZWZA 3NO1A 4BF5A 4RKAA 1W37A 5AZ1A 1B3XA 2Y7EA 2A3CA 4AF0B 5AOUA 2BNJA 4QE5A 3RCMA 3L68A 5HK4A 1A80A 4Z1YA 4GKLA 3ZT7A 3WMLA 3P3BA 3SN4A 3N29A 1E43A 2ZA3A 3OGVA 3O5MA 4NIRA 4L1GA 3VAVA 1B3VA 4GKTA 1MXSA 3R94A 5BOEA 1LL6A 3CNYA 3TFCA 1SO5A 4UMBA 1PBGA 1D7KA 2FDMA 1H51A 2VQUA 1VIWA 2EEXA 2FHBA 4W7VA 4WY0F 3LRKA 3JU2A 2N87A 1AD4A 4DRSA 1ITQA 2WNNA 1HP4A 3KVMA 1ICQA 1EA9C 5T8GA 3LRMA 5HPOA 3O7UA 3NRKA 4C65A 1R86A 2NSOA 1ISVA 3WYZA 5ENLA 4OFCA 4AZCB 1HT6A 6XIAA 1SFTA 1V3HA 4JPGA 1YDNA 1VJZA 1XYAA 3AWOA 1X7IA 2PLKA 2OO6A 3ITXA 3QV9A 1FWHC 1SW0A 1J2WA 3I6RA 4HB7A 5CPMA 3WBWA 1LL4A 3AHVA 5A6BD 4DJDC 2WHLA 2Z29A 4AVFA 3LN3A 3UI5A 1OD8A 4R53A 4CUCA 4IM4A 1CB2A 1FCVA 2A4AA 1T11A 4AX7A 4C60A 3IHZA 4GH3A 1FWAC 4CCEA 5H8PA 2DSVA 3HPXA 4JTQA 4ZOAA 1KFEA 3CWOX 1BVWA 1UYQA 3LUOA 4W8AA 5JUVA 4V28A 4XAZA 4NQ1A 5IDZA 3G1XA 1GOIA 3UR7A 3SW6A 3KABA 3AQUA 1SSDA 3KVJA 2DH2A 4BY3A 1YXYA 1QNSA 2XM2A 1XDLA 4ZCWA 3W1NA 1TPEA 3GDTA 3ABRA 2DIJA 1E0UA 1Y0EA 2XU2A 3RU8X 1SSGA 2VEPA 3RRAA 3EB4A 4GBDA 5BRBA 1OC7A 5HMFA 3NZQA 3PG9A 3WLIA 4G56A 1W9PA 1TYGA 3KRZA 2TMDA 1OX4B 1KBKA 1S5NA 3TN3A 3LQGA 3LV5A 2WVTA 4U85A 2YXGA 3SBFA 1ITCA 1JDDA 5EFDA 3V75A 4YVVA 5HNTA 3Q4DA 1NU5A 5D03A 2GLKA 3NVDA 3W7KA 3PBVA 4C90A 4XAKA 3T2QA 3QPEA 3WDIA 1HP5A 1FDZA 2AKZA 2WZEA 4BJHA 3RGCA 2KE0A 5MKGA 4GJJA 1QI0A 3EOOA 2J88A 2E8YA 2IPFA 2ZDRA 3P84A 3LGEA 3S1XA 3WD2A 4C6FA 5I7GA 3LPPA 1XDJA 3AS3A 1XC6A 4LBUA 4OWGA 2YCEA 1SU5A 1FWJC 3MV11 1U1UA 4ZB2A 1I2NA 3WEMA 4MLRA 6REQA 1GRJA 1CX9A 1TSIA 2CBUA 2FPTA 4GGBA 3GHUA 2P88A 3H2EA 1XCFA 1Q6UA 5AC4A 2G50A 4X63A 4OGZA 1J01A 3S3GA 1H5YA 1P7TA 2PC8A 5DT5A 3VC5A 3TH6A 3PR2A 1UG6A 3M07A 4RLIA 4ACZA 3LNPA 4PRTA 1ADDA 2CLLA 4MADA 5LA1A 5AZ0A 4CKQA 4D6DA 4DBWA 4TXEA 3VA8A 4A8RA 4F0MA 4QT2A 3R79A 4QSHA 4M6PA 1U83A 1MRQA 4RW3A 3D6NA 5CPNA 2ZOXA 4P7QA 3CV2A 1OFDA 3CPGA 3VGDA 1I9CB 3KBVA 1YX1A 3GDLA 5HBFA 3CL8A 2QVNA 5B7ZA 3AS0A 3NSNA 1KKRA 4IUOA 5DMNA 2ABAA 1XSJA 1AW2A 5MF5A 3CUJA 4B90A 3PP7A 5F4XA 3TYDA 4UNKA 2VRKA 4YMZA 4DJFC 1VFUA 2V5KA 2QEZA 3N2CA 3AIBA 5FI8A 2CWNA 4IMEA 1UP2A 3CK5A 1NQKA 1O4UA 3N04A 3GG0A 3NSXA 1TWZA 5FL1A 1EDGA 4XZMX 3O5GA 4RJEA 2BBFA 3KAOA 3W7LA 1P43A 4E2VA 4JFWA 3NPWA 2J27A 4IFRA 1VJIA 5D05A 4HU3A 3MI3A 3BAIA 3C2RA 2VC5A 1Z42A 1O60A 1OC6A 4X9SA 5CEWA 2ZBTA 2WNWA 5LSMA 1TRDA 4WD0A 5IM51 5D02A 1N55A 1PX3A 1P6BA 3LMYA 1E1CB 4JQ2A 1H7WA 1SFJA 4JCLA 4CD5A 1KTNA 1O1HA 1A5AA 2HV5A 3WFLA 2AGTA 2O9RA 3RILA 3IJDA 2WO5A 2WWDA 3PR9A 2XSBA 1M9HA 4WDUA 1L6SA 1TPVA 1FTXA 4LF2A 3ARUA 5FAJA 4DF0A 2OYLA 3WELA 3AIEA 4IJRA 1RLDA 1LQ2A 2J62A 2DSWA 4IQ2A 3LSCA 5HJYA 1UWIA 5D32A 1IR2A 4FLQA 1XLFA 3M5YA 1S3HA 2UY5A 4O15A 4UR7A 3QOMA 4LX4A 3N2BA 1PTGA 2GJLA 4Z2GA 1TFVA 1JDFA 4WRHA 4DYKA 3QR1A 1CIUA 3LSBA 1XSIA 4WQ6A 5M3WA 3F4CA 1LUCA 2GK1B 5H6HA 4DWSA 1J0JA 4NZCA 1LWIA 4WOZA 1LG1A 1LWHA 1WX0A 4Z2IA 1A4LA 4HNVA 3TYUA 1RQHA 1UD4A 2R1KA 2YL9A 4L4PA 1S2UA 1JAKA 2XH2A 3CZLA 4LYPA 2ZXAA 1EGZA 1C8XA 4ILSA 2DZAA 1EJSC 1EWDA 1E6XM 3W6YA 4QBXA 3LCFA 1OZQA 4QAIA 2WWCA 4AEEA 2PTZA 3BL3A 3HPFA 1LLOA 3O16A 3RO8A 5HW8A 3KOFA 4TW6A 3IJ9A 2O9TA 1G0CA 4R33A 3TN6A 3SQLA 1Y8BA 4JXCA 3PWAA 4N19A 4IOTA 4WZHA 1GK8A 2G3MA 3VIHA 3UA3A 1OZMA 1MW0A 3V0SA 1XX1A 1R46A 3GTFA 1EF3A 2J8GA 2TPSA 4JDBA 3IRDA 4CN6A 4O1BA 1P5QA 4RE0A 5DRIA 4A21A 4O14A 2XFFA 4HA1A 2PTYA 4C6IA 3PJWA 3QMRA 5M17A 2Z4GA 2ZE3A 2IQ0A 5IFPA 3WH9A 3G0XA 3TSBA 4J5NA 3BV7A 4UFHA 4C6BA 1KM1A 4HNLA 2WLZA 3HM7A 5CQ1A 3IJQA 4E8DA 3F2DA 2WB5A 1K9FA 1OB0A 3ABSA 3SY8A 3W1PA 3E3HA 2Y88A 4LQ1A 4R7JA 3NCOA 3W7JA 1RD6A 1TPB1 2FTWA 1OFPA 3QSTA 2Y7DA 3MHFA 1Y0OA 4F79A 3WQVA 2WYSA 2DIKA 4BF7A 1ZP4A 2ZVIA 2Z1XA 2OT0A 1V7AA 3KAIA 4ZGYA 2X7VA 1PYFA 2CU0A 1W9DM 2E25A 4E38A 3FNDA 5D2WA 5A6JA 3LV6A 2WCGA 6ALDA 1QNQA 5E6YA 4HNTA 2GQ3A 1FWSA 1I1XA 2PDQA 2RH9A 2OLSA 3W1QA 1GOXA 3WO8A 3O1NA 4ONVA 5A6AA 2PTWA 4JIPA 3XISA 5HTGA 2VI0A 4J3SA 1JEZA 1S2AA 2J9YA 2NWRA 2IQDA 3WLKX 1H7RA 1V3LA 5G2HA 2H9AB 1EH9A 2HVNA 1KM4A 2WMKA 3LM7A 2HK0A 4LH8A 4O4WA 1AQFA 1ZCCA 4YJ5A 2XN1A 5I3DA 1IXQA 4YCOA 5LGZA 1E6NA 3C3NA 3AXHA 2OZ0A 3BCFA 4O1AA 3CAWA 1UWTA 5DY2A 4JTGA 4WCJA 3MPGA 5REQA 3ITYA 3NI6A 2BASA 3TZNA 4M7TA 1WUEA 2VWSA 5E9XA 3H7VA 1EXPA 1EJ7L 5BNKA 4J3WA 5M2FX 1XJBA 4M29A 2VM8A 1ZAHA 1Z44A 1XLKA 2EO7A 2MPHA 3RLHA 5IOBA 1HG3A 4LU0A 1LG2A 3H53A 1HO1A 2XIOA 3MV01 4J3XA 3PULA 1U1HA 2ZRVA 2AQVA 4S3DA 2C14A 7CGTA 2PDGA 2V3EA 3B8WA 3A12A 4ZL1A 5BMWA 1TJRA 4HHLA 5EB8A 4A3RA 5LHEA 4DNMA 1DPMA 4J3ZA 2OSYA 2BOGX 2A79A 3WLLA 1XCXA 3P0XA 5EGRA 3WBXA 3LBCA 3TA6A 5BU6A 4Q4PA 3R2GA 2NX1A 1RPKA 1PWMA 3PY2A 4OUEA 1LCOA 2VDIA 4PODA 3HA1A 1FOBA 5TQLA 3I4KA 3G1AA 1JUBA 2ACQA 3KW3A 4XD4A 5ECVA 4HPGA 4GHRA 3O5QA 1QPRA 3OBAA 4DJEA 2E67A 3VTRA 3PS7A 2WHMA 1REQA 5I02A 2XTKA 1ZCOA 3EA3A 2A7RA 2XVGA 4HZ7A 2A3HA 1F3TA 2QIIA 5DCEA 4I7UA 1MRAA 3ARRA 3AJ7A 4IUGA 2VMFA 5C8BB 5GJPA 3VD4A 5FL0A 3H6OA 1UD5A 3EEGA 2B0MA 3DHUA 1HNYA 1VS1A 2AL2A 2GGEA 3SCQA 4LOCA 1RBLA 5I23A 2PDHA 2Y78A 4FF5A 3TCEA 4GOAA 3WMBA 1BL4A 3VGGA 2FZBA 1NVMA 1XIBA 4OT7A 4LUTA 3L21A 2YPIA 3MP3A 3RHGA 1CI1A 3QYQA 3UZJA 1ZJBA 1E1EA 3T0CA 1A5BA 3GFXA 3BZJA 1ZJIA 3N4EA 1OCQA 2O9PA 3EWDA 4TX0A 2OKOA 5DXYA 4HNCA 3ID7A 2GGHA 1X8FA 3NL5A 4NI3A 3TROA 5MHBA 4DNHA 3A9IA 2PLCA 4LUIA 1Z48A 1XYCA 3QQ0A 3N4FA 4ZOBA 4XO6A 3TWAA 5C6MA 1JXKA 2R1MA 1EJWC 5LXEA 4LPCA 3T8LA 4D72A 4QS5A 3CUHA 3N14A 1GYLA 1H2JA 1BG9A 2IF4A 1EHAA 2Y62A 1XUZA 2YCIX 5CG0A 2PLJA 5HNRA 5FEPA 4FSAA 4FNTA 2B4GA 1UKSA 4GGHA 5D8ZA 2VFHA 3NGJA 4CGTA 5K4XA 2PZNA 3Q67A 1BXBA 4C1NA 1WO2A 4DO6A 3FAWA 4IFKB 2ISDA 3N13A 4C6DA 3KOZA 4QJ5B 2DZSA 2AOSA 4W87A 2UV8G 2VZSA 3E6EA 3U2CA 3GVRA 4P8WA 3TW6A 4JICA 4UCGA 1VPQA 4IQJA 4WIWA 1IXOA 4JTHA 3AFBA 1DHKA 1KXQA 1FKDA 4G7EB 4HYRA 1UOKA 2QGYA 1OFBA 2XVKA 1QCWA 2A6LA 2AL1A 4KFPA 3O5KA 2ZZ6A 1W56A 2BVYA 4RE2A 3WQDA 3KP0A 3LU2A 4FNSA 5DBUA 1IX5A 1EBHA 3Q58A 4CQ8A 3REQA 3HFTA 2VR2A 3P0WA 3R89A 4NP7A 4X0VA 3QN3A 4R34A 1TTIA 2WVSA 1FX6A 4IISA 3IJLA 2X7WA 4HA0A 1HGWA 3FJLA 1WDPA 1N1AA 1TX2A 2VGFA 4DRHA 1OFAA 4PTVA 5HUAA 2NV1A 2PDMA 1EFZA 2XIJA 4OBTA 3MUY1 2P0IA 1F6KA 4PSRA 1L6GA 3WJWA 3L4ZA 4HZ6A 2ZUWA 3HPZA 2OO0A 3OYXA 3EDDA 4BK9A 2VGIA 1CCWB 1T41A 3UPWA 1TO3A 4O1FA 2G0WA 2VENA 4LUSA 3A24A 3CGTA 1LL7A 4Z17A 3VM7A 3LPOA 4B3LA 1VBHA 1OSEA 3KCLA 3MU7A 4AWUA 1JZ4A 2W6RA 3DBPA 2FQIA 4M6QA 3W00A 3WNOA 2C1IA 3QQWA 4DYJA 1YPIA 1F07A 1Q65A 5AC7A 5FOOA 2E6FA 1FWDC 1AJ0A 1XLCA 1QMLA 2QLYA 1X6LA 1GOKA 3F1QA 4B5XA 3GIQA 3WLQA 4AIOA 4WKHA 1ML1A 2DZXA 3W6MA 4XTDA 2KFWA 3M5VA 1CEOA 3V7PA 2ZX8A 3DCPA 3SI9A 1R3TA 4QIUA 5TF0A 4CQDA 3GU1A 4ZE5A 1Q6HA 3LENA 4LJ3A 5F2LA 3DFHA 3PB2A 1NARA 3QGVA 2C8NA 5DX7A 3L0KA 5AECA 4TOQA 1LQ0A 2ODOA 4H9UA 1TWIA 4M1BA 2WVVA 4DB7A 1A49A 1VCGA 4ADSA 1XYMA 1OGSA 4LYKA 1E6PA 4URIA 3P6LA 2LKNA 2PODA 1GJPA 3WDQA 2R1NA 4X61A 2ZZ1A 4DYEA 1E0WA 1PIFA 4HMEA 4G50A 5CSSA 4XZNX 3T08A 4IMGA 3BZGA 4YHGA 1B1YA 3TJLA 1S5TA 4Q4SA 1IIHA 1ALDA 5HINA 1FWIC 2YW3A 3ZQ9A 1YPXA 3QV7A 2JEQA 4PFMA 3B97A 4HKPA 1I45A 2OCZA 5BOFA 6ENLA 3UQIA 2PU1A 3S1VA 3XINA 3IACA 1TZZA 1FHDA 5HANA 1S3TC 3ARXA 3MY9A 4K37A 4O28A 1DHPA 3I6EA 4AU0A 1BLIA 1NM9A 2VFIA 5AHEA 7TIMA 3ME3A 2Q3OA 2PB1A 1QZ2A 4H8VA 3AAMA 2BVTA 2FPYA 2Y5JA 1FWNA 3VKDA 1WZAA 4Q33A 4UUIA 2OZ3A 3UD6A 3TX9A 2WHJA 4D8ZA 3ZMRA 4UTUA 4O16A 4FZIA 3T8QA 2GSHA 3B05A 4TV5A 3WF0A 2VP8A 1A0EA 1PPIA 3A13A 3VD3A 1KM5A 3W02A 1RV8A 4BZYA 1QRQA 2PPGA 1GEHA 1DEDA 3VCCA 2ZA1A 2X09A 4HSOA 5TIMA 1I1WA 1IEXA 1UP3A 4FI4A 2F23A 2GVGA 3W07A 3HO8A 3M0MA 2X41A 4Q6XA 5I6SA 3N2OA 4NT0A 3PK7A 3G3MA 2D23A 5IDIA 3ZT5A 5CZ0A 3TOYA 1UD3A 1QPFA 4UC5A 3OVPA 1KXHA 3H22A 1FWTA 3SY5A 1ZS2A 1J0IA 1WOAA 2R6OA 4DO4A 4AQLA 3E2RA 4KRTA 2FH8A 3W24A 2PMQA 2KGJA 2B81A 1TPC1 4PBEA 3HG4A 5AVNA 3UXKA 2QDEA 5CBJA 4GABA 4ZQNA 1W17A 5CZSA 1F3WA 2V5BA 4D6GA 1OIMA 4J28A 2JF7A 3UZZA 2RGLA 1HVQA 1J18A 3KRUA 4OHQA 3C0SA 4LAXA 5HT1A 3APYA 3A22A 5CC6A 4I9JA 4W88A 3QC3A 2YIHA 4M82A 4UTKA 3MSYA 3K8KA 2WMIA 1EHNA 3PPHA 3FJ6A 1FP8A 4KERA 3IVTA 1Q6LA 5KZ6A 1SZRA 3EYPA 4U84A 3N6JA 3MUIA 1NMWA 4DX3A 5HR6A 1GVYA 2PAJA 4PMNA 2J77A 2OZ8A 2OELA 2NV2A 1NDVA 3NDOA 2O56A 4P5UA 3MS8A 2FIQA 1DJWA 3QJAA 1IZKA 3SZ8A 1NWSA 3GDRA 3S2LA 4WGXA 1FJDA 3SURA 1BD0A 3UY8A 2A7PA 1JCYA 3U4AA 4PR4A 4I9TA 1V6VA 2BVDA 3CUIA 3W2UA 4HOXA 2BVWA 1TCDA 1AK5A 1TPH1 4CD4A 4R9OA 5LA0A 4KWWA 1ICSA 2Z6IA 3NURA 3DC8A 3UQAA 4LEFA 1DP0A 1WDQA 4DIPA 2WMFA 1KM6A 3WF2A 4EAYA 3R4IA 2FKPA 1DWGM 4ZSUA 3QV6A 3RX3A 1VBRA 3S2NA 5AHLA 2Y4SA 4IMAA 2D2GA 1T8XA 3ZLFA 3O0FA 3CHEA 2C16A 5T9BG 1ISWA 4H8UA 3GRIA 3K8MA 2CLOA 5L9FA 4GD0A 4IQCA 2GPTA 1EIXA 3DBNA 3LHUA 4JTFA 1JCHB 1QPLA 2X05A 5GPGA 4AZ7A 1UUQA 4LUJA 4XAPA 3VM5A 1YADA 2ZUMA 3I65A 3ZIZA 1RJRA 4PTWA 3ARQA 5E93A 4JTUA 1SJCA 1SMDA 3CV7A 2QF7A 1Y5WA 4GZJA 3OBKA 5IBXA 1UH3A 3V4BA 3CZJA 1TV5A 4NJHA 4MNLA 2F6KA 1M6JA 3LG3A 1GQIA 4S3CA 5AHNA 3CO8A 1H7NA 1B31A 1PHQA 1FDYA 5BXPA 3ARPA 3KS6A 4QGCA 1IZCA 1DJNA 2YCJA 1Y5VA 3AUOA 3MUAA 5HWCA 5LNVA 2IMRA 5KEZA 1GJUA 3H4GA 1GCYA 3MCOA 3E02A 5DLCA 2FVKA 3QW4B 1FH9A 2R14A 5IHRA 3L65A 4H6RA 3VFLA 3T09A 3A9BA 5J6EA 1QJWA 1SO3A 3MVTA 4K2SA 7A3HA 2FHFA 3W27A 2AWGA 1GQLA 5G1TA 4JHOA 9XIMA 5T91A 3F5KA 3SUTA 1AJ2A 2P0OA 1EP1A 3DHFA 3TQ0A 1UR4A 4IQEA 1PUDA 1ZJAA 2XN0A 4DBDA 2WKLA 1E4MM 1LLZA 4G7FA 4OTKA 2Y8KA 1W3LA 5F7UA 1R47A 4NY2A 3UCCA 2GJRA 3CL7A 1IEVA 3NUKA 3B0XA 2GGGA 3HZ3A 5H2ZA 1XRFA 3SECA 3WK0A 1FHVA 1W3KA 1HZYA 2AAMA 4H9ZA 3W37A 2WC7A 5E6ZA 3PPGA 1CXFA 3SRHA 1W1A1 4JFTA 1U79A 4GISA 3VIPA 3G3DA 2DUAA 3R8RA 3VDCA 3K4WA 1H0IA 2NT1A 2INZA 4A4AA 1QPOA 3KM8A 1RH9A 3GG1A 4IMFA 1UR2A 2AMGA 3TJIA 4GZEA 3ZVHB 3KCJA 2LGOA 3WY1A 4LAVA 3SQMA 1R9YA 1RALA 2Y63A 2PFHA 1MEWA 2HPMA 1ZRQA 2V5DA 1UQZA 4NRSA 3OGSA 3C52A 4TNSA 3I10A 4UOQA 5J8LA 1AMYA 2PBOA 3CH0A 1PHWA 2YA2A 5D09A 3TV8A 1T40A 4ZZ9A 1KV5A 4PB5A 2REQA 1GTHA 1N2VA 2NX9A 4ROPA 1CXEA 3ZJ8A 1V8EA 3NIYA 4H2CA 1EBGA 4MAVA 4CD8A 1DBTA 3RR1A 4GH1A 3VUSA 4Q8MA 2F8QA 3RNDA 4J3UA 3L5LA 3B0VC 5G4WA 1ZFJA 1GPWA 4UXDA 2DZBA 2PE4A 3W1UA 3ANUA 5G5IA 1KFWA 1FVPA 4EWND 4WXYA 4D8AA 4GNVA 1C8QA 5DMMA 3BK0A 5I07A 3TMQA 3INPA 4LF1A 2I17A 3NQMA 1NOWA 2Q8LA 3CEUA 1WXJA 3SO7A 2QCNA 4PL1A 4Y7EA 1S1PA 1W3HA 1QWKA 3S1WA 3DFPA 4P7RA 2WC3A 3B8TA 1V5XA 2CZ5A 3ZFHA 2BV9A 3BMWA 2QULA 5A6BA 3CYJA 5ABHA 4JEQA 6TAAA 2NQ9A 1ISZA 4KH2A 2WZTA 4NSBA 4JX5A 4G2DA 5D37A 2DORA 1K9DA 3VOIA 4F8XA 4UDMA 1KFLA 2ISVA 3H23A 4BWLC 3SQSA 4P7LA 4AFYA 3MCNA 1OF8A 1XG3A 2WBKA 1UA7A 4C5ZA 1TV8A 4PH6A 3EWUA 5EMMA 1U33A 3AALA 5KZDA 5K3VA 1M65A 2KI3A 3UCDA 3O2LA 4IJBA 1XICA 1US3A 3M0XA 4JNZA 5TAOA 2E77A 4YXGA 3CMFA 2PDCA 3O5PA 2D0GA 1Y7VA 3VNDA 1FKXA 4TUFA 1JDAA 1V6UA 2GOKA 3WLPA 1H50A 3EY6A 2BWGA 3VNLA 1KQYA 4TTGA 4XUYA 4I5UA 1VCVA 3OLEA 2X0HA 3ZR6A 4O0KA 5JBDA 3UJSA 3FKKA 1IIGA 4DBSA 3MSGA 4M81A 1R30A 4X22A 5BXRA 1M5WA 3GU0A 3R43A 4F2UA 3JUGA 1AH0A 1EUNA 2IXVA 4M1RA 1C7SA 3G77A 1BGGA 3GUGA 1TIWA 3KAFA 4JTAA 4C6EA 2ZTKA 1K70A 3N1AA 3S4TA 1OADA 5LXXA 4UMAA 4I90A 2PGWA 4O12A 4DXVA 2YDRA 1K4HA 2PF0A 4Y9NA 1HFBA 3IGUA 1OFRA 1UKPA 4AAJA 1SR9A 3PBUA 1DIDA 2NQ5A 4LS2A 4IGSA 5G2WA 3T1GA 1DXEA 4OE7A 2FMOA 4MVAA 4QG9A 1H5VA 2CLIA 3UG8A 3TUUA 4PA8A 1VENA 1P0NA 2PI6A 4GRSA 4FA3A 1C91A 2V69A 3CT7A 4ZSTA 2F38A 1TMQA 4DUWA 3ALFA 5J04A 2UY4A 3HG3A 3MKKA 3PPCA 3WIJA 3STPA 1R2RA 2OJPA 2OPJA 2X1TA 1WB0A 1XXXA 2J7GA 2HEJA 2I9UA 2ZCGA 1TQJA 4QITA 1W1IE 1OT1A 3NQGA 2IKHA 4EOUA 1I6NA 2EULA 4RDVA 2AMXA 3MANA 3UW6A 1ZALA 3EAUA 1POKA 4DJDD 2XP3A 1S5MA 3CV1A 3VZXA 4TX9A 4ZENA 3W81A 1O7AA 4ICCX 3ARYA 3VOGA 4ERIA 5JXQA 3VOFA 1OD0A 5DBTA 1TUFA 4HSHA 4FOKA 3S2JA 5EA9A 3GC5A 2VR5A 3ANYA 1V79A 5LIKX 5C2GA 3GBEA 2A3AA 3OYZA 5G1YA 1VRXA 5A69A 3ZJ7A 2PDIA 2H3DA 4L1WA 1QW8A 1XCWA 4FNPA 1GORA 3U9IA 4QLLA 4OQVA 1NWRA 3AHYA 3BJTA 4C6CA 1ODUA 1BWKA 3PJTA 4IPNB 3G6MA 3Q45A 2D2OA 1V3KA 1E0TA 2ONEA 4IXXA 5HQEA 3BSHA 3P61A 3CHDA 1DTUA 4LAYA 3W76A 1A5LC 3Q37A 1FCUA 1HXVA 1V3IA 1ZJHA 3G6LA 4GXWA 4N6EA 3P8IA 4A8LA 3DZ1A 1TV7A 3D46A 3DIPA 4LB3A 5FSEC 4AZHA 4MWAB 4N9EA 2RUCA 3D3AA 4W9QA 3CB3A 2ZQUA 3JZUA 3L2MA 3TQPA 3M16A 1D8CA 1DWFM 4FXRA 2DFAA 1IR1A 4QE1A 3WQ4A 4EVZA 3WBAA 2DP3A 4TX8A 3ZR5A 3L66A 3ZO9A 1QO2A 4MB1A 3VNKA 2GVLA 4UFLA 5CPQA 3S5SA 1XYBA 3FHQA 5EPDA 4PBGA 3KCOA 3S6OA 1JNDA 2RDTA 4AD4A 4MY8A 1TQXA 3GR8A 4GJ1A 6REQB 4H6QA 2HBXA 2RDUA 4J40A 2DZTA 2XVPA 4AYGA 4HBEA 4GXMA 3NPUA 4TV6A 1JAEA 4CU7A 1J6YA 5AC8A 4Y6GA 5BXTA 3NL3A 1GONA 3CU2A 1P7TB 3B8UA 4BCEA 2HVOA 3JYMA 4UTLA 1O12A 4TVCA 4ODPA 2ISWA 1S2TA 4U28A 4DZ2A 1GYMA 4ACZB 4L7ZA 4DT4A 3UYIA 3U3HA 3FN9A 3GH4A 4C6QA 4HSNA 4HOWA 2NVDA 3AMCA 4NL1A 2W62A 3TVAA 1IF2A 2YCLB 4B92A 5CSYA 4MOZA 3KTXA 1J79A 5FJJA 4J2MA 1O5XA 3SCTA 4BI5A 3UXIA 3FAPA 4JFIA 1CXIA 4V1YA 4FPSA 1OFEA 4KCUA 1YPFA 3IGSA 3PFRA 4LC8A 1AZ2A 5CAHA 1TZ9A 4MYAA 2Z24A 4JD4A 2J4GA 4OV4A 2FGZA 1NF7A 3F2BA 4C91A 3KOWA 4N4QA 4N6FA 2DSUA 3I6TA 1UWSA 3NQFA 4D6IA 1FKSA 3K8LA 3EXTA 5C54A 3LM3A 4YS1A 3WLTA 3TJ4A 4QG6A 4JQ3A 4AWEA 4IFOA 2I56A 1IWAA 1OGBA 4DJFD 2QF8A 3M0LA 1KCLA 3I7SA 2DZUA 1FXQA 2VURA 2OOGA 3NNTA 4ADTA 4KS0A 1P0KA 5CGMA 3F4WA 1QFEA 1M1BA 3RIKA 5ABEA 3PBWA 1UJPA 4NX0A 1DIOA 1EX5A 2PWUA 4ZODA 2V5LA 4WEVX 3BH4A 5HWJA 4O1DA 1XL9A 1JZ2A 3CQHA 1MDRA 4A8NA 3H7UA 1ONXA 2J6VA 2XP5A 3GKFA 3D3FA 2P4VA 2X0YA 4FIQA 3O5IA 4PMRA 1A5UA 2D24A 1F6PA