1JNDA

Crystal structure of imaginal disc growth factor-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
molecule keywords Imaginal disc growth factor-2
total genus 143
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jndA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jndA01
2O9TA 1LL7A 1MW1A 1I1XA 2RGLA 1GONA 1Q6CA 3HN3A 1G94A 1JG9A 3VGEA 3VD3A 3WL0A 2GJRA 1E1EA 4EE9A 3CZEA 4ATLA 2BHZA 4MB4A 2IUZA 2XHYA 4L4PA 3EDKA 4ACZB 3W82A 3N9KA 4X0VA 1BQCA 1E6ZA 3VDHA 2GJXB 3ARPA 1HX0A 3IAQA 4QCEA 2VX6A 3A6OA 3E1F1 4AZIA 1E15A 3FXYA 3MUAA 3NCOA 2CEQA 5F7UA 1BGGA 1UD5A 2DQXA 4H8VA 3WF3A 4AY1A 1B2YA 3GBEA 4AIUA 2ZX9A 1V0KA 2YIHA 3PZ9A 1CEOA 3VGBA 4ACZA 3L4TA 1TA3A 1UZ4A 1E73M 4YHGA 5GPRA 2D24A 1GOIA 1M53A 3EDEA 4MDPA 4TTGA 2OSXA 2D2OA 1JFHA 3F5JA 1K6AA 2BHUA 3PN8A 1OBAA 1R8LA 2FH8A 1C92A 1UZ1A 3UR7A 5A8NA 2GJPA 2BXZA 4WKHA 3BCFA 3HJEA 2DSWA 4UFLA 1UWTA 2A3HA 1HIZA 1CGYA 4JFTA 3ZM8A 2EPKX 4Y7EA 5JH8A 3W27A 4GQRA 1B1YA 2YDSA 4D6IA 1ISVA 4OBSA 1ZBKA 1H0GA 2W61A 2VCCA 4PRWA 4ZEPA 4AZBA 1CENA 3VNZA 3ZMRA 4JHZA 3SUUA 2XG9A 1OIFA 1FA2A 3VM5A 1XCWA 3AIRA 4UZUA 3KL3A 1IZJA 1CXHA 1BPLB 3VPLA 3RJYA 2OWCA 5I23A 2XGIA 3BXWA 1OB0A 1DTUA 1HP4A 1YQ2A 2GJXA 3AS0A 3UG4A 1B0IA 4TVDA 2CBIA 3MU7A 2V5CA 2YL5A 1JD7A 3WQ8A 5A8QA 2W67A 1UD6A 4ZFMA 5A95A 4M82A 4MNMA 3WIJA 4GKLA 1VENA 3AROA 3I3DA 4TTUA 4HA1A 3GXFA 2DSVA 1R86A 3KZSA 4A3HA 4QCFA 1MQPA 5C70A 1D3CA 4MAZA 4HZ8A 3WQ6A 1RD6A 5A6KA 3WSUA 1QW8A 3UCQA 2BVDA 1BGAA 5CGMA 2BV9A 5EBAA 1W91A 1M7XA 5A8MA 1CBGA 1J0ZA 3AXIA 1UR0A 2VMFA 1JZ6A 3WFLA 2CHNA 2YL6A 2ZUVA 4DUWA 4XV0A 5DMYA 1J0IA 3VIHA 1Q6GA 1SYTA 3AYSA 3G6MA 3IAPA 3VIMA 1WPCA 1EO5A 2J7HA 2CCRA 1GQIA 3I3BA 1BSIA 4JFSA 1OSEA 2ZICA 3VMPA 4IPLA 4UQ9A 1GVYA 2PWFA 4AD2A 1L8NA 1RP9A 1WDQA 3FHAA 2VR4A 3A4AA 4JFWA 5HDRA 1W2PA 1CDGA 1ODZA 4YHEA 4CN4A 2D1ZA 3EDJA 2V3DA 3GBDA 5IHRA 3SIMA 3AIBA 1OINA 4J27A 1UKSA 3WF1A 4CUCA 4K68A 7TAAA 1I1WA 3OGRA 5A6MA 1LJYA 3AZSA 2J7EA 1KB3A 5A2BA 2G4FA 2XFFA 3CUGA 1G0CA 3T09A 4WKFA 1WZLA 3O9NA 4PCSA 4H7VA 1MW3A 3U7BA 5A1AA 6CGTA 1TVPA 5D9PA 2BVTA 3WNOA 4PMRA 7A3HA 1O6IA 2J79A 1TG7A 1MXDA 4JCMA 1JZ5A 1I75A 1GPFA 5I77A 3ALGA 4W7WA 2ZXDA 4DUXA 1US2A 3ARWA 2XIBA 3MKKA 2E3ZA 4B16A 1EQPA 3CHCA 1V0NA 2J74A 3GH7A 3W38A 4QLKA 5GNXA 2A3BA 2CKSA 1UH3A 3DHPA 1CYGA 3AOFA 4W85A 2A3EA 1ITXA 1ODUA 3GH4A 4ZXOA 2WW5A 3M6DA 2WK2A 3IJ8A 1JDDA 1GHSA 4HA4A 2PWEA 2MANA 1E4MM 1FH9A 1BYBA 2YBTA 3OG2A 1V3JA 1W9DM 2Q8XA 3VIOA 2WMFA 3BCDA 4HA3A 1C90A 2VL4A 3WH9A 4PMQA 4U5IA 1OGSA 1J0YA 1A3HA 3ARVA 2IXUA 1KGWA 1J0JA 3BSHA 3VGFA 1V02A 4P7LA 1H1NA 1LG2A 3K8LA 3HMCA 3IJ7A 4M24A 1V6WA 3CUFA 3BSGA 4R27A 1TMQA 1M04A 3W0KA 3SUVA 4B9YA 1GJWA 3VX0A 1W1YA 2JE8A 2J47A 1LF1A 3GNPA 3RM8A 1AQMA 1PZ2A 3K4DA 3ZJ6A 2CHOA 4OUEA 3QHMA 3WQ4A 4AIOA 1XHGA 4CU6A 4UOQA 1E5NA 2ZX6A 5CLTA 4D1IA 1ZL1A 2YDQA 3BH4A 3WKZA 1QW9A 5JBEA 1VFUA 1JYNA 1HKIA 5D9NA 3QHNA 1ZJBA 4WKAA 2CKRA 1HKJA 4CKQA 1O7AA 1GVIA 5FOOA 3WQVA 3AFBA 4PMZA 1BHGA 1GOOA 1RP8A 3SCQA 4DWSB 1W9VA 3W25A 1JNDA 4UQBA 4PSRA 3CPUA 3GNOA 4EKJA 3A3HA 1IV8A 1UD2A 2PWGA 2ZUNA 3CHDA 1CWYA 1H11A 1UWUA 2CITA 1J0KA 1V0MA 3RMEA 5BWFA 5CGTA 5M03A 4FK9A 1UA3A 5FD0A 4KGLA 4HOXA 3AHZA 2VQTA 4PMXA 3VU2A 4RE2A 3GH5A 3L4VA 3ZT7A 1D2KA 1VEMA 3BC9A 1CGXA 2GK1A 3THDA 3VD4A 4QFUA 2QV4A 1B30A 3N1AA 2ZIDA 5D9OA 3AISA 1B3ZA 4W8AA 5ABHA 4AEFA 1JD9A 3SCNA 4FLQA 1UR9A 4HU0A 1E9LA 1OWQA 5KEZA 4HOWA 3GZAA 4TXEA 2UY4A 3CH9A 1JDCA 3K46A 5BXRA 5DF0A 2QF8A 2GDUA 1WE5A 4UQDA 1D7FA 2Y2WA 3WDRA 2VTFA 2W4XA 1W9XA 3BLPX 5CPTA 1JZ4A 1JZ8A 4U5KA 1EDGA 1JYXA 2WVUA 3TTYA 3PZQA 2YL8A 1C93A 2OWXA 5DT7A 2XVKA 5AC4A 1NWTA 3QOKA 2ZXQA 4U2YA 4MB5A 4ZXLA 2YKKA 1IZKA 5ABGA 5BCAA 1X6LA 4MADA 4BZYA 4HPHA 1KXTA 3AS3A 4EAMA 5E0FA 1G01A 1U33A 4U33A 2OYKA 4MPKA 4Z2IA 4L4OA 3MUY1 4GXPA 3TTSA 4HMCA 2VJXA 3ZJ7A 1GW1A 4D6JA 1OT1A 1NOFA 1RH9A 2QMKA 4BS0A 1W32A 4J3XA 4PBGA 2JALA 3K1DA 1WCGA 4CD4A 2EQDA 3ARUA 5FKYA 6TAAA 3AMLA 1PAMA 1MFUA 3BAYA 2VQUA 5AYIA 1R7OA 5I3DA 1KQZA 2J62A 3W37A 1BVZA 1WDPA 4C7FA 1HT6A 4F66A 1E55A 3CZLA 1E56A 5M17A 3W53A 1GNXA 2WZEA 1F4HA 3OZOA 3L2MA 3UG3A 1LQ0A 4HPGA 3AYRA 1HL9A 4Z2HA 3UERA 3EMCA 3RM9A 2DGAA 4W8LA 4NF7A 2CERA 3W28A 1J12A 1V6UA 4GIAA 1OGGA 2Z1KA 4LXFA 1VEOA 5GNZA 1Q4NX 1ESWA 2VX4A 3EDFA 3A4XA 5IDIA 2ZX7A 1B31A 3WBEA 1WDSA 2J7DA 1NM9A 4EANA 4AZ6A 5D8WA 1CECA 2WC4A 4PN2A 5FIPA 4TX6A 3WENA 1GORA 4XZBA 3WDIA 2WANA 4W8BA 4PCTA 4E4PA 4QP0A 3WH8A 2XSAA 3TP4A 3B8SA 1UWIA 1H0IA 2UWFA 1E3XA 3HU7A 2V5DA 4XZWA 3ALFA 2VCAA 5CXPA 4RE3A 1X6NA 1JF5A 1NP0A 3EYPA 3AQUA 1E0VA 1WB0A 3F4VA 2J78A 3LPFA 2D23A 1CXEA 1FOBA 2F8QA 2EEXA 5GNYA 1NARA 1E72M 2VVSA 4BA0A 4CVUA 3IANA 1WZAA 2VZUA 5JIWA 1XGZA 3ZR5A 4J3TA 1UKPA 4AD4A 1EHNA 1PX3A 2BXYA 1PZ3A 3J7HA 6A3HA 1AQ0A 2OWWA 1SR0A 4MTVA 4UTFA 2J7CA 4DM1A 3MUZ1 3VIGA 5LA2A 4DM2A 1HN1A 4OOUA 1PX8A 1N82A 2BFGA 2F61A 3N15A 4UFKA 1UKQA 1VFMA 1U30A 1CXFA 4J3VA 1QBBA 2WPGA 3L4YA 2HISA 4H8UA 1GQJA 1Q6DA 1NWRA 5LA1A 2W92A 1GQKA 1C8XA 4MDOA 4ZE5A 3MMWA 2XUCA 1QVBA 5JBDA 3BMVA 4Q7NA 2YLAA 3VMNA 2G3IA 1QI3A 1TZ7A 2D3NA 2EPOA 3AHXA 2VRJA 3AHVA 3FAXA 2DH3A 3VIIA 4WLCA 4NI3A 1W1VA 5BRPA 1CGUA 1WZKA 5ECUA 1JXJA 4U2ZA 1BYCA 1QOXA 3CO4A 1EO7A 1VF8A 1CXIA 3OB8A 1UR2A 3N04A 1DP0A 2UY3A 4AZCA 4PTWA 3VIJA 3WEOA 2DEPA 1FHLA 4P8WA 3F5LA 4W5UA 1ISXA 4D6FA 3VOCA 1XH2A 1CTNA 1B3YA 3U7VA 1JF6A 2G8ZA 3IJ9A 1HVXA 1C7SA 2XTKA 2ZXBA 1QI2A 2D20A 4PMVA 3TTQA 1FH8A 2XFRA 4AW7A 3AMKA 2WCGA 3WNPA 3WELA 4WSJA 4D72A 2CXGA 3ZT6A 3ARTA 2NW0A 4IM4A 3LPPA 4RL3A 3GYCA 4WJXA 1UR1A 2Z1SA 4J3UA 4J28A 1K9FA 9CGTA 1E43A 2Y5EA 1M01A 1U2YA 2CBVA 2CIPA 1MQQA 5LA0A 1QHZA 5ABFB 1EIBA 3SCWA 1SFSA 3DC0A 2CETA 2O9PA 1A47A 3AI0A 1J11A 2WLYA 3CLWA 2D22A 4MB1A 1QNOA 3CZGA 1XC6A 1KBKA 1BYAA 4B9ZA 4AZ5A 1E6QM 2XWDA 1EOMA 2X09A 5ABEA 1KBBA 1HP5A 4N42A 2G3JA 1H3GA 2TAAA 1WZMA 4V2XA 5I5RA 5E09A 4PMYA 3W29A 5ABFA 3POCA 1Z32X 5BROA 4AD1A 5KZ6A 3GM8A 2VRKA 3WN6A 4LPCA 4MJ2A 2C7FA 5CSYA 3SURA 2WVVB 4P8VA 1OM0A 2OSWA 4MB3A 4AD3A 3T2QA 5JIPA 1HJWA 1UQZA 1WDRA 1CGVA 1JYVA 4DWSA 2VI0A 4JCLA 4GO8A 3WL1A 1UA7A 2EPNA 1G9HA 5I79A 1UYQA 1ZS2A 1J9YA 3TONA 5CG0A 2XGBA 3S6TA 1LLOA 1CLXA 4TX8A 1BF2A 4BQ2A 5EB8A 5DEZA 1NWSA 2XM2A 2ESCA 2DIEA 2WMIA 2D0FA 4J3SA 1TR1A 3WNMA 3QHOA 4JL1A 3WNLA 4CD6A 4V28A 4PEEA 2WZIA 2XVNA 4AIEA 2JEPA 3MV11 2G41A 1LL4A 4IISA 3CGTA 3SCVA 3FAWA 4CD7A 2D0GA 3ZSTA 3K8KA 5HBFA 2DSKA 3WD3A 4Z2GA 4D6GA 4XUYA 5M3WA 4ZENA 1GJUA 3U57A 2ZUTA 2BY3A 4CD5A 4PMNA 1LWJA 5BRQA 2J7FA 2Y24A 3OGVA 4DUVA 4AXNA 3MMUA 5A8OA 2G3MA 3WDQA 4AISA 5HPOA 1E4LA 3OA5A 1EA9C 2CYGA 3TTOA 4GPNA 2V3FA 5DO8A 4ATWA 4AMCA 1Q6EA 3WBAA 4W84A 2CPUA 2WWCA 5HXMA 3DYOA 4H8HA 4GINA 3JUGA 2WB5A 4LYRA 3EMZA 2BY1A 4PUDA 3VDAA 2WBKA 4UQCA 3WUFA 4FLRA 1EDQA 3W81A 2DT1A 4MNLA 3AMCA 3AS1A 5I0DA 2WHLA 4D6EA 3WF0A 2FDMA 1E71M 4W86A 3MS8A 3L4UA 3W6MA 5A94A 1R87A 4BCEA 5JBFA 3LPOA 1GOQA 1WP6A 4FLSA 1EHAA 1J10A 4B3LA 3ZJ8A 1G1YA 3AXHA 2CBUA 3FW6A 3AMDA 1HF6A 2BY2A 2WCSA 2D0HA 2VZVA 2WSKA 3MSDA 1GOKA 2AAAA 4F8XA 4JFVA 4FF5A 4A3YA 1UD8A 4P7NA 4GZEA 3PTQA 3WEMA 1DWGM 3T0BA 1R7AA 3AS2A 4OKDA 3MV01 4W93A 4JHOA 2BVYA 1W9PA 3A47A 2V3GA 5JUVA 2FHBA 2E4TA 3O2LA 1XRVA 5I24A 4MNKA 1ITCA 1CNVA 1K9DA 1XSKA 3EBVA 2D3LA 5LYRA 2E8YA 5HNNA 2VVNA 2O92A 4CVWA 4HP5A 2FGZA 4BQ5A 3VVGA 4P7OA 1BG4A 2W62A 1B9ZA 1H5VA 1NH6A 4JKLA 3B9DA 1KR0A 3WY1A 3NSNA 3UG5A 4PMUA 1X1NA 2VZOA 1GHRA 3CHFA 3WD1A 4QLLA 3A4WA 1H4PA 2Y8VA 4UCFA 3RCNA 4M56A 1MW0A 5A3HA 1E6SM 2QPSA 3GNRA 3L4ZA 1WO2A 4AZGA 4KMQA 2GUYA 2EPLX 3ZOAA 1DHKA 1V6VA 3ARSA 2EXOA 3CMJA 4H41A 5A6JA 3LPGA 1JZ3A 5E6ZA 2X1IA 1AMYA 3BLKA 1BFNA 2NT1A 3VIFA 3VKKA 1EGZA 2V38A 4JIEA 3VTRA 3EMQA 4AYSA 1CGTA 2J75A 2XWEA 4HTYA 3WUBA 3U5YA 2VZSA 4OJYA 2DSZA 3VIKA 2J8FA 4S3KA 1NP2A 1QI0A 1JYWA 2PWHA 1VEPA 1E0WA 4C7DA 4W88A 1ISWA 1JI1A 4V27A 3GXIA 3QR3A 1UOKA 1VJSA 4H2CA 1KGXA 2WAGA 1TE1A 1HJXA 1HJUA 2BNJA 2WYSA 3ECQA 4KWUA 1GZJA 1FFRA 1E70M 2A3CA 1PPIA 5DFAA 2RGMA 1E40A 1RPKA 1XYZA 3FN9A 4M81A 1JAEA 4W5ZA 2ZE0A 3D3AA 2AOSA 3NYDA 1UD3A 1C8YA 2YDRA 2PI6A 2FH6A 1CZ1A 3ZSSA 4JKKA 1XYFA 2WMHA 3RILA 2ZWYA 3OLGA 3M07A 2IXVA 4F9DA 1UWQA 2XYLA 4CCDA 1SMDA 1E5JA 1GQLA 5I6SA 1UKOA 1QNQA 2DSUA 3VGGA 1E3ZA 4D6HA 2V3EA 1KQYA 1R85A 3M7SA 2YL9A 4UOZA 2WHMA 4CU7A 4D71A 2A3AA 4B15A 4M1RA 1JGIA 4CD8A 3VO0A 1C91A 4OIFA 2X05A 2W5FA 1TCMA 3K8MA 1XCXA 3IK2A 4PMOA 3SCRA 2O9OA 3OGSA 4D6DA 1DWAM 4OBRA 1E4IA 2WM0A 1CGWA 3AJ7A 2WHJA 1KCKA 4HZ6A 5IXEA 1S46A 3F5KA 2UY2A 2GDVA 3ARQA 1EDTA 2FHFA 3PTKA 3RIKA 2FHCA 1M03A 3ARRA 4Z2LA 3CUIA 1V3MA 3L4XA 1E6RA 4NRRA 1JZ2A 1UWSA 4UQAA 2ZX8A 2AMGA 4GI9A 1HVQA 4AD0A 4WIWA 1YHTA 3I3EA 3S2CA 2VOTA 3BAKA 4ATDA 4Z2JA 5GQBA 1JNEA 1ECEA 1HNYA 1KXHA 4UR9A 3ARYA 3TOPA 1DWJM 3WH6A 5M5DA 4ML4A 1PIGA 4LQ1A 1EQCA 3WQWA 1V6YA 1KWKA 2OYLA 1C7TA 1LG1A 4UFMA 5A69A 2QMJA 3PZNA 3WDHA 3O6AA 2YA1A 1OCQA 4GZJA 2WLZA 4P7QA 1C8QA 3ZO9A 3CBWA 4KRUA 3WDJA 8A3HA 4CGTA 1UUQA 3DECA 3RO8A 3SCTA 1UH4A 2E9BA 2JF6A 1JDAA 1XD0A 4W89A 2ZX5A 3EDDA 2XVGA 3POHA 2E9MA 2WSPA 1MWOA 1KXVA 2ZUUA 1QNSA 3VILA 3RM4A 4BQ4A 3B9EA 2ZOXA 1QHPA 4PTMA 1FHDA 1FP8A 1V0LA 4UQEA 2G3NA 3PZOA 3BMWA 2VX5A 5IFPA 3ZT5A 3CZJA 4RE4A 3FY1A 3WD0A 3UESA 4CCEA 1E1FA 2FGLA 4IUGA 1KCLA 1B3XA 3ZR6A 4HU8A 3TA9A 2X2YA 4KGJA 3RDKA 2JEQA 1BVNP 2NSXA 1QI4A 1JL8A 3G6LA 1H41A 3ZJKA 3W6LA 4UZSA 2XM1A 2DT2A 2E0PA 1NQ6A 2E8ZA 1AQHA 3SEPA 4UFHA 3WUGA 2NT0A 4P7RA 2DDXA 1E6PA 1OD0A 4TUFA 2B31A 2WMJA 2WKGA 1CIUA 1Y7VA 5DT5A 3ZQ9A 5CPQA 3T2OA 5I78A 3SCOA 2XPKA 1VAHA 3NIYA 4HMEA 1F4AA 3WQ5A 4W7UA 4PSPA 4AZCB 1TVNA 2YA0A 4A4AA 4UOJA 1UKTA 3UEQA 4JZ5A 1PJ9A 3T0DA 3BAIA 1ZB5A 5CJ5A 1XV8A 4GI6A 2DT3A 2E9LA 4YN5A 3VNYA 3SUWA 1MVYA 3AICA 1CPUA 1V02E 3VM7A 4TVUA 2PWDA 3CUJA 2WKLA 3CUHA 2CBJA 1NOUA 2PF0A 3NSMA 5AY7A 1W3HA 4AZHA 4M8UA 4HMDA 1QBAA 5CSUA 3CMGA 5A8PA 1BAGA 4P8XA 1G5AA 5C71A 1CXKA 4GO9A 1HL8A 4WF7A 3N17A 4N0RA 4MAVA 5CPSA 2VNCA 2W91A 1TFVA 4JAWA 1MXGA 4DWSD 1EH9A 2W66A 3PZVA 2YOCA 4JL2A 3WUEA 1VIWA 4AC1X 1K9EA 1VBRA 3SCPA 2JFEX 2QLYA 1V3KA 3NJ3A 1B3WA 4S3JA 2DH2A 1XH1A 1NOWA 1BTCA 2WMKA 5FL0A 3DYPA 3PTMA 3VD9A 4QLJA 1QPKA 3VINA 1OT2A 2WHKA 4GZIA 1KR1A 1UWRA 3BAJA 1Q6FA 1PX4A 1GCYA 1MYRA 5E0CA 2PC8A 3VGDA 5TD4A 3WEZA 3WNKA 2X0HA 4XB3A 2JF7A 1P6WA 3GTNA 3VIPA 1UQYA 4LGXA 4LX4A 1JAKA 4W7VA 1W9BM 2Y4SA 2WVVA 2PB1A 3UETA 3NUKA 2WMIB 3WF4A 2BY0A 5IFTA 3OZPA 3WFZA 4J7RA 4CN1A 3CTTA 3MSGA 2VO5A 4CCCA 5E9AA 3AHTA 4X0NA 3WMBA 4URIA 1B90A 1J18A 2XIIA 2C0HA 2DPEA 1V3LA 4PTVA 4QDMA 1WKYA 3RPMA 2X8RA 1PIFA 2EBNA 4LYPA 4AEEA 4HOZA 3OBAA 1UH2A 1W1TA 3VMOA 4U31A 3W24A 3QOMA 2WC3A 1E6NA 1C3FA 4XX6A 2DT0A 2EO7A 2VUYA 1ZBVA 5BXSA 4Q22A 3WDPP 1JXKA 4IPNB 2BHYA 2E40A 2J8GA 3T2PA 1BLIA 2J7GA 4CN6A 4E2OA 1MW2A 3PHAA 2J4GA 3NDZA 4JFUA 1WAWA 3N11A 3BAXA 3N12A 5AYBA 2EJ1A 1HJSA 4PYSA 3II1A 4HZ7A 3VD5A 3MANA 1QI5A 5CLWA 1J01A 3AIUA 3BGAA 1B3VA 1SMAA 1KFWA 3PZIA 2XVPA 1JIBA 3SUTA 5EFFA 3K4AA 4Z2KA 1TUXA 3AIWA 3PZUA 3OIHA 3GDBA 5A2AA 4NZCA 4NRSA 5A6LA 2GVYA 5FL1A 4D6CA 3AMGA 3AZRA 1ZU8A 3WH5A 2OSYA 3VGHA 3OLIA 2ZWZA 4YPJA 4W87A 5HOSA 3MUIA 1L0PA 2UY5A 3KE0A 3PBGA 2YBUA 1DWFM 1W3KA 3GXDA 2EPMX 1CLVA 1H49A 3T08A 2WCAA 2GSJA 1HXJA 1JZ7A 1KGUA 1VFOA 1ZBCA 3DHUA 1H09A 3VDBA 2OLHA 4GQQA 1VBUA 4D1JA 4FLOA 1KWGA 4H04A 4BF7A 4DWSC 3QGVA 1WNOA 5CZKA 5D4YA 1US3A 1VFFA 4JKMA 2VT0A 4F9JA 5IHSA 2WBGA 3VDCA 2W63A 1PEZA 1QHOA 1OD8A 3B9AA 3RJXA 3WMSA 3L2LA 1V6XA 5AC5A 2VC9A 1HJVA 1ISYA 1MQRA 5D8ZA 1W3LA 1AVAA 2HVMA 3AHYA 4GI8A 2X0YA 3N13A 2CNCA 4FMVA 4LYQA 1KXQA 3N18A 4UFJA 2Y8KA 1IT0A 3KL5A 1ZBWA 4ACYA 4B3KA 5A6BD 1HKKA 3APGA 2O9RA 2BS9A 1HKMA 1UR4A 4F79A 2C8NA 2F2HA 3SCUA 2ZUSA 2WVTA 2QHAA 2GK1B 4UFIA 3KWXA 1J0HA 4OOZA 1VRXA 1QNRA 1BG9A 2ZUWA 3WNNA 3PZTA 1XH0A 2XSBA 1W9UA 4TOQA 1H2JA 1UG6A 1FH7A 2VURA 1GOMA 1DWHM 2VCBA 2DIJA 4WSKA 1CXLA 1UD4A 2WWDA 5A6AA 3W26A 5BXPA 1HJQA 2WVSA 3D5HA 1UR8A 1GUVA 1V3IA 5E70A 3VX1A 3ARZA 1LWHA 4C7GA 3L4WA 3VD7A 1JFXA 7CGTA 2PBGA 5A2CA 3GXMA 1VB9A 3VUPA 3WMCA 4ZE4A 1DEDA 2J7BA 5CQ1A 5FCZA 2YLLA 4MNJA 4AWEA 3M46A 4NSBA 1QNPA 2VRQA 4R5EA 3W4RA 2ZUMA 5C8BB 4PMDA 4BQ3A 4OZOA 1W2VA 5HPCA 3CHEA 5EMYA 3AXXA 5E6YA 2YA2A 2J77A 3WD4A 4PUEA 1XSIA 3KEHA 2XFYA 3THCA 2XVLA 3DYMA 1VJZA 4J3WA 2OYMA 4U3AA 5BXTA 3LMYA 4TVCA 2WXDM 2CESA 1PBGA 4QAWA 5A6BA 5D9MA 5EFDA 3NDYA 1UHVA 1EOKA 1XSJA 1NWUA 4PTXA 1OGBA 3SCSA 4E8CA 3CIVA 2J25A 2XJ7A 2VX7A 3SUSA 3ZIZA 1E0XA 4M29A 4E8DA 3WD2A 1MFVA 1V03A 2YJQA 1V08A 5BYWA 2VZTA 4MJ4A 1BYDA 4KH2A 1V3HA 4UNIA 4M80A 1EXPA 1TA3B 3MO4A 1GOWA 1DWIM 1E4NA 2WC7A 4X9YA 3T0AA 3FHQA 3AIVA 1JI2A 4P8UA 3OLDA 3UR8A 1FP9A 1ZJAA 3AIQA 1K9TA 3U5UA 1XD1A 4KRTA 1ISZA 3CZ8A 3AZTA 2QPUA 3MMDA 3NSXA 1E6XM 3AIEA 3OLEA 3WH7A 2PBOA 3ARXA 1OIMA 2WMGA 3CZKA 2GFTA 2VR5A 3PZMA 3PZGA 4U3CA 3FNDA 1LL6A 1W1PA 3BAWA 4AZ7A 5I2UA 3KL0A 4AD5A 2WNWA 4CU8A 4WK9A 8CGTA 4EK7A 2JIWA 2WZHA 1FFQA 5A6SA 1W3JA 2ZXAA 2JIEA 3WF2A
chains in the Genus database with same CATH superfamily
4DYKA 1TWSA 1VCGA 2REQB 2HJPA 4ZBCA 2J88A 1JG9A 1GG1A 1W5MA 1TTIA 3ONBA 3G1FA 3WL0A 4QNEA 3R79A 2ATSA 1W1IE 4WRHA 1E1EA 3B3DA 2E25A 1U1HA 3GHTA 1GK8A 5LIXX 2XHYA 4L4PA 1OABA 4ERGA 1RBLA 1Z9AA 1J6PA 1E6ZA 4LBUA 3BL3A 3VDHA 3JYMA 2GJXB 4JFIA 1HX0A 4Q3MA 4A2SA 2FZNA 3FS2A 4MZ8A 4PR4A 3NCOA 1YADA 2CEQA 2KI3A 4C6EA 1Z8AA 3GSMA 5F7UA 4E2VA 4MZ1A 3RX4A 4NZ4A 4H8VA 5AHEA 4AY1A 4ERAA 4H9YA 1V0KA 2YIHA 3PZ9A 3NI6A 1CEOA 2G5WA 4ACZA 4DRQA 1O4UA 4A22A 1ZHAA 3S5ZA 3NGFA 3DKLA 4Y8FA 2Z0IA 3PWAA 1GOIA 4A3QA 1M53A 3EB2A 5TIMA 3WK0A 1QWGA 1KRMA 1K6AA 3JW7A 4LTSA 4PL2A 4JR5A 1BXCA 1L9WA 1OBAA 4O57A 4IT4A 3A3WA 2FH8A 1C92A 2PDYA 2QJHA 2TYSA 5A8NA 4JFLA 2BXZA 3LCHA 3BCFA 2YZ5A 1AJ0A 3JR2A 1OC5A 2DSWA 1FBAA 2A3HA 3SN1A 5C0QA 3KAFA 3U2ZA 3W27A 5HMSA 4J5NA 3OPSA 1EJTC 4Y6GA 5LNUA 1KT1A 1KM4A 1XRSA 4UTKA 2XIMA 4H9VA 2F9RA 3VNZA 3ZMRA 1FA2A 3O15A 3TJIA 5CZTA 2VEMA 3VPLA 4PFHA 4HYWA 1TCDA 3W6YA 2XGIA 4MY1A 5DRIA 3E6EA 1DTUA 3WZ0E 6XIAA 4I3GA 4JTGA 5D33A 4TVDA 5G1YA 1ZPTA 5CC7A 3MU7A 2OFJA 4GZ7A 3PPHA 1PKMA 1I60A 3VDGA 4MNMA 1W5OA 4AIBA 4TTUA 2XN2A 3WLPA 4LJ3A 1R86A 1ZTVA 3E49A 4FAMA 1KA9F 5C70A 1D3CA 3SW6A 5E0KA 3EB4A 2BV9A 3P2VA 2EULA 2QNEA 1J0ZA 5A6TC 5CZ0A 1XKYA 3VI2A 4HMNA 3UI4A 1J0IA 3E38A 1ZALA 3PR9A 3IAPA 3LCXA 3LCGA 5I03A 3E3HA 4GYJA 4FIQA 2CCRA 2DZAA 3GB6A 3QTPA 2H9AB 3EX2A 3FVDA 1RQEA 4F4RA 2E77A 1OSEA 1A5CA 2W6RA 4UQ9A 2VR4A 4JFWA 4UR7A 5HNTA 3RR4A 4QEHA 1VLIA 3C2EA 4J27A 4U85A 3CPGA 1W5QA 4K68A 7TAAA 5A6MA 4Q8WA 2Y0FA 3Q4DA 4IPXA 2J7EA 1KB3A 4XKYB 3CUGA 1WDWA 1B5TA 4RCXA 3UW6A 3O9NA 4H7VA 5A1AA 2HWGA 2QAPA 1W5PA 3PK7A 4CLMA 3ZWSA 3WNOA 3CTLA 7A3HA 1KFLA 1RVGA 5I00A 4BI5A 1TG7A 1RCQA 3CPRA 5I77A 1Q6IA 4IIEA 4ODNA 4PUJA 3RHGA 1OF6A 4WJEA 3CNYA 5AYZA 1VHNA 2E1DA 3TSDA 3UJRA 1GVOA 3PBVA 3ABZA 1F9CA 1Q6OA 1V0NA 3W38A 4XSMA 2CKSA 1AD1A 4PTNA 2BODX 4K37A 2Z25A 1ITXA 4NL1A 1KBIA 4JTCA 4Q8OA 1FH9A 2CLOA 3EAUA 1T8QA 4LVFA 1TV4A 1QATA 2WMFA 1PYFA 3ICJA 2BLEA 3WH9A 1OGSA 3LGEA 3XINA 2PAJA 2IXUA 4U28A 3GZ3A 3E5BA 5EU9A 1J0JA 4DPQA 4LUTA 1YEYA 4OV4A 4FN2A 1XLEA 3IJ7A 4GH1A 1ZLPA 1EPXA 1LBMA 1DBTA 3INPA 1REQB 3BSGA 3IWPA 4R27A 4O1EA 1TMQA 3SUVA 4B9YA 3QYSA 1W1YA 3M41A 1LF1A 3B0UX 3Q58A 1UUOA 1GWJA 3ZS4A 1DJGA 5AECA 3ZJ6A 5CEWA 2KGJA 5H8PA 2CHOA 4OUEA 3W2LA 8TIMA 4H19A 3QHMA 1NDZA 1MZRA 3TJ4A 2AAMA 5CLTA 3RCMA 3VNLA 4AG0A 3EOEA 2DZTA 1FAPA 5FJOA 3NQ7A 5HW6A 1X6UA 2PODA 1JRBA 3BV4A 1XYAA 2PZ0A 2BVWA 4GI4A 1GVIA 4ZB5A 4HNTA 2A6LA 3WQVA 3AFBA 5IOBA 1RP8A 3VNJA 2WZTA 3QY6A 4DWSB 3UWEA 4Q6JA 1MI3A 2ISFA 4EKJA 2HK1A 2Z4GA 3CL8A 3C0LA 5BMWA 3SRKA 3CHDA 1UWUA 2P50A 2V81A 1D7JA 4MFEA 4N9DA 4FK9A 5M03A 5FD0A 4KGLA 4HOXA 4PMXA 4YVXA 3ZT7A 2CC0A 1D2KA 3BC9A 3GRIA 4Z1BA 1RUSA 3MTWA 1JD9A 1KM5A 2XP6A 3F03K 4IGHA 3U0HA 4HU0A 3TC7A 1OWQA 4HOWA 3UJSA 3M44A 1VR6A 3W7EA 3FJNA 2QF8A 5LXEA 1WE5A 5EMJA 2VTFA 3BLPX 4E3VA 1IWPA 1N7KA 3RO6A 1JYXA 1C9WA 3LV5A 3UFYA 3VFLA 1GKQA 4XO7A 1FKGA 3CAQA 4DPPA 3QOKA 4Q8VA 4MB5A 1XDMA 4IGNA 1JUBA 3N29A 5FA5A 1X6LA 4MADA 1AK5A 2GOKA 1ELSA 1J93A 1KXTA 3AS3A 4GQGA 3TYUA 4EAMA 5E0FA 1U33A 1EF2A 3SN0A 3TTSA 4PUNA 3G1XA 3ZJ7A 3AC0A 4NAEB 1OT1A 4RR4A 4NJIA 2QMKA 4IZGA 2QYGA 1JJKA 2EQDA 3ARUA 5FKYA 2F23A 1PAMA 4H3DA 1TVLA 5AYIA 3CL7A 1R7OA 4DBEA 3QSRA 2POTA 5LNRA 3QKZA 3NPWA 3TN3A 1KFEA 3MSYA 4JX6A 3S42A 4C6BA 4F66A 1E55A 2ALDA 4GYPA 1GNXA 1F4HA 4RXGA 1GTHA 3PUDA 4NZJA 2ZZ2A 4L72B 4H7ZA 3LXCA 3NDOA 1XBXA 4W8LA 3LUOA 3RNDA 3DZ1A 1V6UA 3B05A 3I10A 2Z1KA 4XTIA 4S3BA 2X1UA 1ESWA 1RY8A 1C9DA 1N8IA 3LLFA 4AEOA 4AZ6A 5REQA 1CECA 5FIPA 4PBEA 3GTFA 4V15A 3WENA 4E4UA 3BW4A 3MI3A 3WDIA 4J2PA 4QP0A 3L23A 3TP4A 3W75A 3ITCA 3W7MA 5DX7A 3P84A 2X7WA 2B7PA 3LOTA 4J40A 1PS9A 4XZWA 1F74A 2BOEX 3NQMA 2AL1A 3W3OA 3ZXWA 3LMZA 4NAEA 2EGZA 1NU5A 4GUIA 3QXBA 3ITYA 2D23A 1LCOA 2OPJA 4H1ZA 4FNTA 4BA0A 1EQ3A 2WNZA 2C1IA 1ITUA 2VC7A 4RPPA 2E6AA 1XGZA 1EHNA 3WLQA 1PZ3A 6A3HA 4H9TA 3KS5A 1AQ0A 4BHYA 1QMLA 1EP1A 3CQKA 4DM1A 3MUZ1 5LA2A 4DM2A 2BFGA 3W7DA 2PTZA 3UZYA 2F61A 3SDOA 1VFMA 1QBBA 1J4IA 3TWBA 2HISA 6ENLA 1GYNA 1QWKA 2PLCA 2I17A 4GNJA 4FXJA 1C8XA 3L5MA 1K7FA 1FKLA 5BOEA 1QCWA 4BFAA 3BMVA 4WXYA 2PDMA 2YCEA 3QZEA 1FTXA 3DEQA 2D3NA 5HJYA 4C65A 1KBJA 2REQA 2VRJA 3FDGA 3NOYA 2ADAA 4WLCA 1PTDA 1WZKA 5ECUA 3DKJA 1TQXA 3ISIX 1TJRA 3CQ0A 3TAKA 1BYCA 3GVQA 1EO7A 1VF8A 3GR7A 2NVCA 3O5DA 3OB8A 3N04A 2Q3RA 1SJBA 1B54A 3APTA 4NZ5A 3W1QA 1HL2A 4PTWA 1GPWA 3VIJA 1NAL1 1WXYA 1RLCL 2I5QA 2Y7DA 1TX0A 3OYXA 3F5LA 4W5UA 2ZVRA 1EC8A 3IS4A 1XH2A 3E0FA 3LCWA 1B3YA 2G8ZA 3UPMA 4NX5A 4XSLA 4L6HA 3T07A 4PUUA 3IACA 3MBFA 3A5FA 3AMKA 3TSMA 2WCGA 3WNPA 1T5AA 2NX9A 3M5ZA 2X30A 3ARTA 4IM4A 2M08A 3CV7A 4M5PA 3CWHA 4WY0B 1E43A 1H51A 3BARA 1U2YA 3SY8A 1MQQA 3SCWA 1SFSA 3NTYA 3EWBX 1QU4A 2CW6A 2NVDA 3DGRA 4R34A 4AAJA 2D22A 1AH3A 1VYPX 4NJGA 1TRDA 1W17A 1TPB1 5LIKX 1E6QM 1V79A 4LAUA 2X09A 2OLAA 3URBA 1GW9A 4QISA 4Z0JA 3N4EA 3LHWA 1GZ1A 3W73A 1DIOA 3A64A 4V2XA 5I5RA 1XF0A 4PMYA 5ABFA 1AUSL 4LNCA 1RQHA 1Z32X 3GM8A 3C6CA 3WN6A 1F8MA 3AJXA 4LPCA 2C7FA 5CSYA 3SURA 4P8VA 1OM0A 4MB3A 4AD3A 3T2QA 1XLFA 4GE8A 5LIUX 2MNRA 4DI9A 4EAYA 3EOSA 4DBSA 4LFYA 4PCFA 2OCZA 4JQ1A 4DWSA 3T1GA 2J9YA 3WL1A 2YYUA 4EF8A 3WK1A 1G9HA 3R43A 1P0KA 2GJNA 2VWTA 5CG0A 1ZGDA 5ABTA 1XFBA 3S6TA 1GYMA 1LLOA 1FWCC 1TPFA 2PD5A 2YX0A 1EBGA 3QHOA 3ABSA 1W3IA 4C1KA 4HT3A 2J27A 3H26A 1OZQA 3MVTA 2GQ9A 4CEXC 3LHYA 1OEPA 4DELA 4JTHA 2PMQA 2D0GA 3K8KA 5HBFA 3EOOA 2DSKA 1A5MC 3WD3A 2HNHA 1PIIA 3ANYA 4GUHA 3U57A 2ZUTA 3IVUA 4PMNA 1LWJA 5FJRA 4ZOAA 1KFBA 2KFWA 3HGOA 1PVNA 2NX3A 1K8ZA 1EX5A 4XBJA 5CAKA 2E5DA 4GPNA 2V3FA 1GT8A 1JGMA 1TPDA 2GJLA 3MDUA 3WBAA 2ABAA 5MKGA 3LSCA 1EJRC 3DYOA 4H8HA 2XH0A 4GINA 3JUGA 1RD5A 3EMZA 3TWAA 4PUDA 2QXWA 4Z08A 4R3UA 2NUWA 4US5D 3WUFA 1ME9A 4P2VA 4DRHA 3B8WA 3MS8A 3L4UA 3V1PA 3O5OA 3LPOA 2HBXA 4S2CA 1GOQA 2J9XA 1VH7A 4FLSA 4DUOA 4B3LA 3M1ZA 4G7EB 3ZJ8A 1YTDA 3O07A 2PRMA 3N2OA 3STGA 2PP1A 4QAIA 5HANA 2D0HA 2VZVA 3MSDA 1GOKA 4GC3A 4F8XA 3H8AA 4GWEA 1Q8JA 4A3YA 1UD8A 1W54A 4GZEA 1J6OA 2DVXA 2V67A 3T0BA 4OKDA 2BVYA 1H50A 1XLBA 1SFLA 3O63A 2FLIA 3GTXA 4RJEA 3UT0A 4HQVA 3R13A 4JHMA 1K9DA 1FWBC 4G2DA 3TXVA 4BEUA 2E7FA 4CVWA 4WDTA 2M2AA 3SY5A 2FGZA 3R11A 4BQ5A 3R8HA 4HIBA 3CH0A 1BG4A 2W62A 5AC8A 1NH6A 4JKLA 3WY1A 2PDBA 1X8FA 1JQVA 3BTNA 3WQDA 4Z17A 3UXLA 3CHFA 2CXEA 5MKGB 3A4WA 3T6CA 4I6KA 2QCDA 4DRIA 2FTYA 2VXNA 4M56A 5AHLA 2QPSA 5AYYA 3WLMA 3GNRA 4C6PA 4HGXA 3TK7A 3UBPC 1V6VA 1JZ3A 2X1IA 4G6CA 3L5AA 3TZNA 3HM7A 3FK4A 2I56A 3LGGA 3H55A 4Q4KA 3O6DA 2V38A 1ICQA 4WHBA 3JXVA 3VTRA 4AYSA 3ONCA 5KETA 4JQAA 3U5YA 1FHUA 5GJPA 4DIPA 1X8CA 2Y7EA 1KCZA 1QRQA 1NP2A 4O50A 2V0TA 1VEPA 3QR3A 1QASA 4H2CA 1P4CA 1R2SA 1TE1A 2IQDA 2IKJA 4KWUA 5HT1A 5CZSA 2RGMA 1E40A 1US0A 3NEVA 3W87A 3S9IA 4M81A 4NHVA 2B4GA 2W0UA 3KCLA 5DBUA 2AOSA 1JUKA 2VYOA 1R3VA 3S5YA 4C6CA 4ES4A 1UD3A 4XAFA 5EY5A 4A2RA 4UUIA 3ZSSA 4IP5A 4JKKA 3D6NA 2YR1A 1QFEA 1W31A 2R1LA 3OLGA 2XFWA 5K9DA 2OTDA 4ZO7A 3M07A 4CQAA 4PCPA 1AL7A 5I6SA 3S83A 4Q4MA 1UKOA 1H1ZA 1R85A 3M7SA 2WHMA 1KRBC 4QSFA 4DROA 5C55A 4C90A 1JUEA 4M1RA 1JGIA 4GH3A 1C91A 4OIFA 1N8WA 2X05A 3K8MA 3E9AA 5HK4A 5GJMA 4JEQA 4EP8C 4PMOA 3LYEA 1XBVA 1TZZA 3SCRA 3KLKA 4L9XA 4F48A 1DWAM 3CAKA 3GVVA 5K9XA 1V77A 1E4IA 3MKCA 2X1SA 4QDPA 3AJ7A 4QBXA 2PE4A 4JTJA 4UTLA 2P5NA 2B7QA 4HZ6A 2NV9A 1S46A 1W0MA 4WJ8A 4HVXA 3F5KA 3ITVA 3C56A 4NNAA 2FHFA 3PTKA 2FHCA 1M03A 3ARRA 4O17A 4NRRA 3CUIA 1V3MA 3L4XA 4GJ1A 4LYKA 3HOJA 2ZX8A 2Q71A 4WIWA 1YHTA 4RDYA 2V6AA 5I06A 3GC4A 3FCPA 2VOTA 5EMKA 3B97A 1GYLA 3BQ6A 3PUOA 1ECEA 4U10A 3HGJA 1TREA 4RK8A 1RA0A 4PGLA 3IK4A 1S3TC 1TWZA 2PSNA 3OVQA 3IEBA 3WH6A 4YTQA 2QUVA 3AO0A 5DXXA 1JCNA 1F3EA 2FYMA 4R7OA 3STCA 1KWKA 1C7TA 2QZRA 3I6CA 5A69A 3PZNA 3WDHA 3O6AA 2F2KA 3FOKA 4C1NA 4LUIA 4P7QA 1C8QA 2ANUA 1MUWA 1FCUA 4CGTA 1XIBA 4S3DA 3AUJA 3FFSA 4O28A 3SCTA 2I5IA 4NT0A 1JDAA 1EBHA 1XD0A 4W89A 2IPGA 5E1QA 3VYLA 2ZX5A 1I2NA 3PBWA 4E5TA 3KOYA 5DN1A 3LZ5A 2WSPA 4K7YA 1KXVA 4K7VA 4Y9PA 1ZFJA 1XINA 3LCIA 6REQA 1QHPA 2H8XA 4JXCA 1EUNA 2Y7FA 2G3NA 2OQLA 1A53A 2OXNA 2HPIA 4N9EA 3KCJA 4MFDA 5CSSA 3TA9A 5HQMA 4O10A 4KGJA 1P1MA 3RDKA 1BVNP 4ROPA 2NSXA 1TB3A 3ZJKA 4LSBA 1I9CB 4YLWA 1AQHA 2E8ZA 1Y5WA 5K4ZA 4O1AA 1FKDA 5DCEA 1TJ2A 1FKSA 5HATA 2PN0A 1Y7VA 5DT5A 1K70A 5LNSA 3S3GA 3SI9A 3T2OA 5I78A 2XPKA 2Z1XA 4D8ZA 3HV8A 4HMEA 4PUKA 1VFLA 1HGWA 4O4WA 4DHGA 1R3TA 1I8JA 2YA0A 3UCDA 1UKTA 2QJNA 3MT1A 1XLHA 1XV8A 2DT3A 1AJ2A 2ABBA 3TC5A 1LYXA 1CPUA 1AMKA 4B5VA 2PWDA 3GU0A 4C6QA 2C18A 4JYEA 4AZHA 3M0YA 4NUWA 3W72A 5CSUA 3NQGA 1P1XA 3FA5A 2N87A 4UTJA 1YPIA 3IVTA 1G4SA 4WF7A 3N17A 2FTPA 1DVJA 5CPSA 4JTTA 4JAWA 2HE5A 1XI3A 3AWOA 3LM7A 3WUEA 4UNLA 4G56A 1A3WA 1K9EA 1VBRA 3WH0A 2JFEX 2QLYA 1KLZA 3SQMA 4RZBA 5CC5A 1B3WA 1XH1A 1NY1A 3PWGA 3P82A 4MYXA 3DG7A 5EA9A 3VOGA 3PRDA 4H83A 3W00A 1VFSA 5JH2A 1Q45A 5BMXA 1PX4A 1MYRA 1POJA 4EVZA 2PC8A 3TYBA 3VGDA 2Z6JA 3WEZA 2OOGA 5HULA 1S5WA 3CB3A 3GTNA 4TW8A 1NTHA 3VIPA 2ZRZA 1FXPA 2VFHA 3T8LA 2GQAA 3UZXA 1W9BM 2Y4SA 4IQCA 1ZCOA 2PB1A 3UETA 4QG6A 4JIPA 4GNKB 5IFTA 1KTBA 3OZPA 2Z1BA 2DG9A 2XIOA 1LOSA 1K4HA 4CCCA 5E9AA 3AHTA 4X0NA 3WMBA 2XP9A 2ZBTA 1OC7A 2D73A 4O13A 4ODMA 2C0HA 2DPEA 4BWLA 3CAVA 3FSUA 2CHRA 2XP5A 5FF7A 3OBAA 2L2SA 3UJEA 3MSRA 4IT1A 3VMOA 2PPNA 3W24A 1EJVC 4XAYA 3VOIA 4WEVX 1ZBVA 4UR8A 4PEKA 3PFRA 3B9OA 4MMWA 3WDPP 4I9JA 1IT8A 2J8GA 4UBPC 1BLIA 1A5BA 1MW2A 3M47A 2V2DA 2BOGX 2ACQA 2Q09A 4C02B 1T6MA 2NV1A 3DBNA 4CCZA 3P67A 3JVAA 4DJFD 3XIMA 4R33A 3H7RA 1GQNA 4KFOA 4XKYA 2R1MA 3HPAA 5CLWA 2CFFA 3EX3A 4RDWA 3FLUA 3PAOA 1DXEA 4IMCA 1SMAA 1JIBA 5EFFA 4FR6A 1A7XA 2OOFA 5K3VA 3GDBA 5A2AA 4NZCA 3C86A 2UZ9A 3EXRA 4FNUA 3TEVA 4UMBA 4NIRA 1FKTA 3RF9A 1UMYA 3N6JA 5HOSA 3PBGA 1CB7B 4NZ1A 3Q94A 4TR9A 1QNVA 2HK0A 2R8WA 4IQJA 4S3FA 2J24A 4JFJA 1FKRA 1OFDA 4XTDA 4GQQA 1KV8A 1VBUA 2FMOA 3QGVA 1WNOA 5D4YA 1NSGA 5DITA 3E0LA 3N2TA 3T42A 3IIZA 4Q4OA 2R91A 1IR1A 3B9AA 1DHPA 2VC9A 2YB1A 4GHRA 1ISYA 1MQRA 1LP6A 5C54A 2HVMA 3CJPA 1Q5MA 3A9IA 3V1HA 1ZAIA 3U6WA 4GI8A 4KW2A 2J13A 3N13A 4M6UA 4FMVA 2Y8KA 3P74A 3TQKA 1I2QA 2C71A 3DFNA 4YJ5A 1PDZA 1UR4A 4PRTA 3DU0A 2WVTA 3GVGA 4EX4A 4BWLC 4E2DA 4RPQA 2QHAA 3AXKA 4UFIA 3MI2A 4Y9NA 3R94A 1GKRA 3ABRA 1QNRA 4JFMA 2O56A 4AUBA 5CZJA 3GQYA 4XD5A 1YE4A 3Q2DA 3O6CA 4TOQA 3MJMA 1GOMA 4DT4A 3ANVA 1CW2A 2BTMA 3PSVA 4LAMA 4WSKA 3L21A 2WWDA 5CJNA 3I7SA 4ADSA 1HJQA 2JQXA 3F4NA 4O4VA 2WVSA 4PUWA 1MEIA 2VD8A 3ARZA 1FWEC 1QPNA 1NELA 4YTSA 4ZOEA 3EPMA 3WMCA 2XPBA 3PY2A 1DEDA 1UZHA 5CQ1A 4GA8A 5D09A 1I4NA 4TV5A 1IWAA 4MNJA 2MUCA 3M46A 4I8DA 2VRQA 2ZUMA 3S5SA 2G4JA 1PTGA 4OZOA 3W2NA 3TKFA 5EMYA 1F73A 1XG3A 3N73A 4WY0F 3BMBA 1JEZA 3MC5A 5E6YA 4FA3A 2J77A 3WD4A 2RSEA 2R1NA 1H60A 3LV6A 3M0KA 4ENLA 4UB9A 4U86A 3DYMA 3HZ3A 3BW3A 4J3WA 5BXTA 3MB9A 4QAWA 4B90A 2HNEA 1XSJA 3GDMA 2VM8A 4IFOA 1H1YA 3SCSA 4XG1A 4ZO9A 3CIVA 3KLLA 2VX7A 2C0AA 3W1RA 1L2QA 3W2KA 4MYAA 4Q7IA 1UP3A 4L1XA 1BYDA 2YDAA 4KH2A 3M43A 1SFJA 1R47A 1EXPA 4A3RA 1DYSA 4A8RA 4X9YA 2WC7A 3PP7A 1WKFA 3T0AA 3FHQA 3AIVA 2I14A 4LOCA 4E38A 3UR8A 3OLDA 3QPZA 3HG5A 5FEZA 3W85A 1JCXA 4L64A 3V5CA 1ISZA 1Q63A 2QPUA 5HWJA 2P0OA 1H63A 3GC2A 5B80A 2PBOA 1OIMA 3QH2A 4NI8A 3K30A 2Z1VA 1M68A 3A12A 1LL6A 3BAWA 3S1WA 4QS5A 2V5JA 4HPXA 4KESA 3KL0A 2QEZA 3UVAA 4Y9AA 4GJJA 4CU8A 3NURA 5B7ZA 8CGTA 2VWSA 3OOBA 4EK7A 5HMEA 2WZHA 1PE1A 2GQ3A 5CPMA 3F4CA 2O9TA 2BX7A 1XDLA 3HFTA 1MW1A 2LPVA 1SO5A 3BSMA 4G2PA 4XD3A 4XVDA 3R0DA 3HN3A 1G94A 1ROTA 2VHLA 3H2CA 4S1FA 5F4WA 3G77A 2KAUC 1ADSA 2Y70A 3SBFA 1TCOC 2BHZA 4IMDA 4OHQA 1DKWA 3WMLA 2DZSA 4AMAA 3W70A 4RE0A 3W82A 3N9KA 3LG3A 4O12A 3ARPA 1RALA 1SJCA 3A6OA 3LRKA 3E1F1 4AZIA 4IUOA 3L5LA 1VCFA 3DXIA 4O2TA 4NQ1A 3WYZA 3BPWA 2ZDRA 4N4QA 2ZA1A 4LEQA 2Q6ZA 1OHLA 3GBEA 3H70A 4AIUA 1RV8A 3VGBA 1TA3A 1XYBA 1PKYA 3LY0A 3T05A 3L68A 4QGCA 1A80A 1YX1A 4WX2A 2D24A 3FA3A 3QV8A 2GGJA 4UCGA 1MZHA 3EDEA 4MDPA 4TTGA 1FCVA 3G1SA 2G96A 4Q8UA 4ML9A 3D3FA 1R8LA 4WOZA 2QDDA 2PS2A 1ZQ5A 3MKVA 4TV6A 3SECA 3FAPA 3UR7A 1TPH1 5FJUA 4GVHA 4RNHA 4WKHA 4IT6A 3V0SA 1HIZA 1CGYA 1F3WA 4JFTA 1NDWA 4Y7EA 3GW3A 1NQKA 3GLCA 4GQRA 1B1YA 2YDSA 4D6IA 4Q8PA 2ZTJA 2W61A 3UA4A 4PRWA 5J04A 1KM3A 1XIEA 1BWKA 1TTJA 3UR5A 4QROA 3AIRA 2DJLA 1DOSA 4F0LA 1CXHA 2ZVIA 1BPLB 3A23A 3H12A 5DXYA 3RJYA 4DWDA 3M0IA 3KOFA 1Y8BA 1CI1A 1V8EA 2CZDA 4MVAA 4F3HA 2HS6A 2A79A 4JYFA 2CBIA 3C2FA 4TQTA 3S1UA 3WQ8A 4ZFMA 3GXNA 3KTCA 3R8RA 4OGZA 5FEXA 1RAKA 1XR2A 3TQPA 2Z7GA 3AROA 1WOBA 5E5CA 1XUUA 3GXFA 4A3HA 1AH4A 3OVPA 3EWUA 4MAZA 3EX1A 3WQ6A 3G1DA 1QW8A 3UCQA 2BBFA 3IUHA 3UPWA 1M3UA 1F61A 1W91A 2FVLA 3BDKA 4OECA 3QVQA 1M7XA 4DJFA 2EKGA 4UWMA 2VCDA 3OHMB 1H61A 3P3BA 3NQCA 2WQDA 2CHNA 4C6LA 2XU2A 4XV0A 3WBXA 3KZ7A 1Q6GA 3AYSA 4ZODA 3VIMA 4L4LA 1GG0A 4FHAA 2QJGA 1PXGA 1K03A 1GQIA 1BSIA 3IJIA 1RP9A 1WDQA 4CQBA 2AQWA 2DZUA 3EZ4A 1F5ZA 3O06A 1ODZA 4YHEA 5HTGA 3AYTA 5H1WA 3IIVA 4NYYA 3SIMA 1RJRA 1OINA 4DJDD 1BEUA 3T78A 1S5TA 5EL1A 4KWOA 2O55A 1FWHC 1Q7MA 3JZEA 3BE7A 3LTPA 1T99A 4ZA0A 3AZSA 4H6EA 4WGXA 2XFFA 2C19A 1G0CA 3M5YA 1A49A 4PCSA 1TJ1A 4LU0A 1BWLA 1O94A 6CGTA 2QW5A 1K4GA 5D9PA 1H7RA 3RLUA 1O6IA 1MXDA 1JZ5A 1I75A 4JYDA 1GPFA 5LHFA 3F4WA 3CXOA 4LV9A 4ZB0A 3LI1A 4DUXA 3ARWA 4KR0B 4K6AA 1KBLA 3EGJA 3MKKA 2E3ZA 4GIEA 4B16A 1LLZA 1FWJC 2J74A 3GH7A 1X1ZA 1UH3A 1IIHA 1CYGA 3UJFA 3CUXA 4LCQA 2NUYA 2WK2A 3CT7A 3HG4A 2PWEA 2MANA 4X22A 3STFA 4Z1CA 2YBTA 3OG2A 3RG6A 4D8AA 3ABXA 1F6PA 3VIOA 4HA3A 3TN5A 2BGQA 4GXWA 3MP3A 1A3HA 1KGWA 1R3RA 1V02A 5FSEC 1UBPC 3EWWA 2PCEA 1H1NA 4PB4A 1LG2A 1ALDA 3HMCA 4C60A 1KC7A 1XJBA 3E12A 3U2OA 4NNCA 1TYGA 4GYKA 3RLVA 3S2MA 3VX0A 4EPBC 2J47A 2Z7KA 3ES8A 4CNOA 2FPYA 3GNPA 3RM8A 5KZDA 3SAZA 4XAPA 3GU2A 1YRRA 4IFKA 4JNYA 4AIOA 2H8ZA 5FSDC 3PJUA 4UOQA 1E5NA 3W1NA 4LUTB 5HMFA 2ZX6A 1VGAA 3TYZA 4UMAA 3CYVA 3L0KA 2YDQA 3IIOA 1QW9A 2YSWA 1VFUA 1JYNA 1HKIA 3UA3A 2CWXA 4JDBA 1O7AA 3QPYA 1S1PA 5FOOA 4KBXA 5D2VA 2E6DA 1BHGA 3SCQA 1EYMA 3W2JA 5EYWA 5CBJA 4ERIA 3WJWA 3PNUA 4JDYA 2A4AA 4JTFA 4PSRA 8XIAA 3TAOA 2WSYA 3LHUA 1VJIA 2PRHA 1UD2A 2ZUNA 1CWYA 1H11A 2CITA 3V18A 4IFRA 1RVKA 1V0MA 3EWYA 3RMEA 1ZCNA 3GNXA 1Q13A 1S3HA 2FQIA 3DFHA 2VQTA 3EWXA 3VU2A 5LSMA 1U5HA 4ZPVR 1WXZA 1D7HA 4R7JA 3NQ2A 1VEMA 4RV3A 5FACA 3SJ3A 4NXSA 4QFUA 2LLEA 3N1AA 2ZIDA 5D9OA 3MO7A 2FZ9A 3UWZA 4XIAA 1T96A 1T40A 4AEFA 3ZVIA 4QE4A 2HVNA 4LVGA 1UR9A 1E9LA 3FJ6A 5AHNA 5KEZA 5LNVA 4GY1A 3I6RA 2AGKA 2UY4A 3CH9A 1JDCA 1SM9A 5DF0A 4UQDA 2Y2WA 5FF0A 3TOYA 1W9XA 4C6IA 3BW2A 1EDGA 4H00A 3QGKC 4HU4A 5CSRA 2OWXA 5DT7A 1NWTA 4LW7A 4ZXLA 1DIDA 1JRCA 2NUXA 3R0KA 2GGHA 3TNBA 2OB3A 5F2MA 1PZ1A 1G01A 4PBFA 4U33A 5H8MA 4MPKA 2VFIA 1HUVA 1P0NA 4DBDA 1FKFA 3MUY1 1A5LC 1MDRA 1SJDA 2VJXA 1GW1A 4D6JA 1E0UA 1RH9A 1EJXC 1BQGA 1W32A 3IRDA 3U4AA 2ACSA 4PBGA 2JALA 3K1DA 1WCGA 5LIWX 4CD4A 5IM51 2A7NA 4Q32A 5DY2A 3AMLA 1PB0A 1LOQA 1BKSA 2VQUA 5I3DA 1PZ0A 1WDPA 4YTUA 4C7FA 2QCCA 4LF1A 3CZLA 5M17A 3W53A 5HUAA 4MPQA 2WZEA 3OZOA 1EEPA 4LEFA 5HQEA 4H7CA 3UWUA 5T9CE 3AYRA 1Z3NA 1HL9A 3UERA 3KP0A 1OY0A 2DGAA 2ASHA 4NF7A 3CAWA 3NQAA 1GRJA 1OGGA 4MKVA 2DZWA 4K38A 1M5YA 5AVNA 5GNZA 3V16A 4B2DD 3EDFA 3ES7A 2A2IA 3OVGA 5IDIA 3KW3A 4HARA 2PPPA 2ZX7A 1B31A 1QW7A 3WBEA 4EWJA 2J7DA 1XLIA 4O0QA 3V75A 2X16A 5D8WA 4ZOCA 4PULA 4F2TA 1XYLA 4IOTA 4TX6A 3KTXA 4YIWA 3PANA 5XINA 2WANA 4W8BA 4PCTA 4E4PA 2AL2B 2HSAA 4HCLA 3B8SA 1UWIA 1QPQA 3WLOA 2DW6A 1H0IA 4XZNX 4S3EA 3HU7A 2EG7A 8RUCA 5CXPA 4ZO8A 4RE3A 4J35A 1JF5A 3LA4A 3AQUA 3W7OA 1RQBA 4C1NB 3LPFA 4BY3A 2QJIA 2F8QA 2W3ZA 2EEXA 3DX5A 3ZLFA 3THAA 1F6YA 3WLLA 5DIVA 2VZUA 3IRSA 2V5LA 3H7UA 2YCLB 2BXYA 3AWNA 1Z89A 4MTVA 3C61A 5FJJA 2G95A 1HN1A 4OOUA 4X3ZA 3N15A 4XZ9A 4RLIA 3GE7A 4I5RA 4UFKA 1UKQA 1CXFA 3SFKA 2WPGA 1SW3A 3N2CA 4DXKA 1NWRA 4MDOA 4KCUA 4QE5A 2HDJA 3W07A 3MMWA 2FMNA 3UF9A 4S3GA 2ZA3A 1Q6UA 3HO8A 2G3IA 1QI3A 3B8UA 1TZ7A 2EPOA 2EF9A 2GDQA 3AHXA 2VDIA 4JTEA 1NVMA 3ZYZA 2QJJA 2DH3A 3FAXA 3A9BA 3NM1A 5L6UA 4DX3A 1WUFA 1CGUA 1B6CA 3PA7A 1BF6A 1LRQA 2LGOA 5FAGA 1QOXA 3DOPA 5DCBA 2NZLA 5BZAA 4JTQA 4P61A 1HFBA 7ENLA 4Q4SA 3W86A 2DEPA 3KVJA 2NQJA 1WOAA 2CZ5A 1Y0EA 1A4LA 3LTYA 5F4XA 3VOCA 1CTNA 3U7VA 4QG9A 3ENLA 3KZPA 5CPNA 1QI2A 2Y7GA 3TA6A 5C7VA 1FH8A 2NQLA 4GX8A 3W1AA 4D72A 3O6YX 3ZT6A 4FX6M 4RL3A 3LPPA 3SGUA 4ICCX 3QEZA 2YPIA 7REQA 2Z28A 5G4EA 4DB7A 1VFTA 4O1DA 4LVBA 3VK5A 4DRPA 5ABFB 1EIBA 3DC0A 2CETA 3DERA 5D05A 1A47A 3AI0A 4MB1A 4L5ZA 3B8IA 1QNOA 3E2QA 4E2BA 2PDWA 1IXNA 3GYEA 1XC6A 5CBIA 4ZTXA 4YCPA 4AZ5A 1OCBA 4G50A 2UZ5A 2E1WA 4LS1A 4H8NA 1HP5A 3M0XA 3A24A 4N42A 3G3DA 3H24A 4L9ZA 1L6YA 4L6DA 4M0XA 3W29A 4NU7A 3QKEA 1RSCA 3BGJA 3BJSA 4MJ2A 4HYVA 2WVVB 3VNDA 1OYCA 2H9AA 5JIPA 2Z1WA 2P3EA 3QR0A 5T26A 2Y5JA 2GUUA 5J5DA 3GNNA 4Q6XA 2JZVA 2EPNA 1VPQA 1UYQA 1FDYA 2GUBA 3GVWA 2ZZ6A 2XGBA 4TX8A 4BQ2A 1DXFA 5DEZA 2XM2A 2DIEA 5D04C 2WMIA 2D0FA 3WNMA 2EAWA 4JL1A 2DQWA 2Z2AA 4N02A 4CD6A 4PEEA 2WZIA 3PWIA 3O16A 2XVNA 5I98A 5EGRA 3CWOX 4LANA 3DI1A 3DDMA 4MLJA 1DV7A 3GTYX 2YBVA 3S1XA 4XIMA 4QHRA 2EJAA 5HW8A 4D6GA 4ZENA 1GJUA 4QM1A 4A05A 3BANA 4PMJA 3LB0A 3UF8A 2G3FA 4AXNA 4LUSB 1ADDA 3IKGA 2H90A 3QFEA 4DF1A 4KCVA 4AISA 4XZHA 1PINA 3UZJA 4NJHA 1HKWA 5EPDA 4W84A 3K4WA 4D2JA 1LUCA 4JIQA 4LYRA 2BY1A 4DN1A 5FJPA 2GPTA 1UR3M 2ZQSA 4DVOA 4EOUA 4IPIA 4L4MA 5C2CA 2WBKA 4HN8A 3F1QA 3W2UA 3W81A 4IQLA 2DT1A 3AMCA 5I0DA 2RH9A 2GL5A 2AKMA 4DI8A 3W6MA 5A94A 2HV5A 3A3XA 5AOUA 1MEWA 5C6MA 4LAXA 4JY9A 4UXDA 3H9RB 1G1YA 3DENA 1EGVA 4HNCA 3FW6A 1ZP3A 2TRSA 1Y0OA 2YCIX 1ICSA 3G0SA 3EXTA 4L61A 2V5BA 4JFVA 1G69A 1UIOA 1Q3NA 4TX0A 3C2YA 4JHOA 4A8LA 2QCDB 2J6VA 4EACA 1IR2A 3A47A 3M5XA 2V3GA 4IWWA 5C2XA 1P5QA 1LDCA 2E4TA 1F40A 5I24A 1ITCA 1CNVA 2Y8UA 2E8YA 5HNNA 2VVNA 3M0LA 2WPBA 4AVOA 3T55A 4P7OA 1B9ZA 1KR0A 4EPEC 3NSNA 1UIPA 1DIKA 1ZSXA 3EOLA 2GGEA 3PF3A 5PTDA 5FF2A 1KM2A 1W1ZA 2ONEA 2Z26A 4QLLA 3QZAA 3B03A 1TZ9A 3WO8A 3TYEA 4LAVA 5F2LA 1MW0A 5A3HA 4B2DA 1E6SM 3IIPA 3L4ZA 1WO2A 3GHRA 3PBUA 1YPFA 3MI6A 3ARSA 3PUGA 2EXOA 3CMJA 2IKGA 1PO9A 3KAIA 1WKEA 4QR6A 1BFNA 3VIFA 1EGZA 5CGQA 2VR2A 4FNPA 3C8FA 3VFCA 3EMQA 1CGTA 1Z41A 4QRNA 3TQ0A 2FPVA 1YTKA 3AUOA 4HTYA 3WUBA 1S39A 2DSZA 5HNRA 5EBUA 4S3KA 1UMLA 4O1FA 1JYWA 2ZQUA 2A0NA 3WK3A 1HTIA 3QV9A 4V27A 4YTTA 4AWTA 1VJSA 2P8CA 2HCVA 2WYSA 4KIEA 4QDWA 3MUCA 2A3CA 2FDSA 5BOOA 3GG7A 3NL5A 4Q4QA 1RPKA 4RX0A 1LORA 1XYZA 3HMJG 3LXBA 1JAEA 1F6KA 5D75A 2ZE0A 5J6EA 1H7OA 3KVMA 3S1VA 2H6RA 2FH6A 1CZ1A 4C5ZA 1XQLA 2QCMA 2X1RA 2WMHA 1YNYA 1RBOB 3S1GA 2ISSA 3RILA 2ZWYA 4F9DA 1MXSA 4IJRA 2AKZA 4CCDA 1GQLA 2X42A 2JK2A 4NZ3A 1QNQA 5J5RA 5DIUA 5I02A 3BG3A 2YL9A 4UOZA 4C1LA 2GWGA 5BW6A 4G9PA 2B81A 4QXIA 4B15A 1O1HA 3VO0A 4RUBA 1IEVA 3UY7A 3RFWA 1XCXA 3IK2A 3RLGA 3P14A 5D2XA 3QY7A 3BK0A 1Z69A 2OT1A 4MY8A 4D6DA 3H6OA 4OBRA 3W9ZA 2DFAA 1AW5A 5C2GA 1BSLA 1F8AB 1EJUC 5IXEA 3UQBA 4IXXA 2KX9A 4YS1A 3O1NA 4PZVA 1DQUA 4WCJA 1JZ2A 1E6RA 4IGMA 4HBEA 2HMCA 1UWSA 3LI0A 2AMGA 4GI9A 3DBPA 4HYRA 3TCZA 3S2CA 3BAKA 1SO3A 3RK8A 2RJGA 5C9XA 1JNEA 3VKDA 1HNYA 3WLJA 3S2NA 4UR9A 1AODA 1RK5A 2F7FA 5M5DA 4FF7A 4KEZA 1EQCA 4QJ1A 4ILSA 5IDZA 4UFMA 3S5NA 3LLDA 3MY9A 1NFGA 2WLZA 4NXKA 3P5YA 2QUUA 8A3HA 4NZFA 3MZ2A 5CCZA 2IKHA 3QQ1A 2B0MA 2JF6A 2Y63A 1M7OA 5I09A 3L2IA 5E9XA 2XVGA 2E9MA 4POCA 1TPEA 3TJXA 2GSHA 4CQ9A 1Q7ZA 4NX0A 5HQLA 2F6UA 3B9EA 1J5SA 1XG4A 1PCWA 4DJED 4PTMA 4F2UA 5D38A 4UQEA 1Q7QA 1SZGA 4ICNA 3KP1A 4KCWA 2DZXA 2VX5A 5IFPA 3K2GA 3ZT5A 3WD0A 3UESA 4CCEA 2KR7A 2FGLA 3FXGA 1Q8AA 3ABQA 3LQLA 3C2VA 1LZOA 4UIOA 4OBTA 1ME7A 3NM3A 3QYQA 3W6LA 1CCWB 4QE1A 1NQ6A 3SEPA 3WUGA 2NT0A 4DEFA 3THQA 3IV8A 2DDXA 4TYOA 2B31A 3MHUA 1CIUA 3ZQ9A 5CPQA 1DXIA 2P76A 4LUSA 1O95A 1A3XA 1P5BA 3N4AA 3LD5A 5K9CA 4AZCB 3LEPA 3URQA 5DBTA 3B06A 5FEPA 3UEQA 5LXXA 1VFHA 3T0DA 3N2XA 3BAIA 1ZB5A 2WKJA 3HPSA 3SUWA 3CS2A 1MVYA 2H3BA 1HXVA 3OQ8A 3F2BA 1V02E 4KKXA 4M3PA 3CUHA 3GFYA 3NL2A 4H9UA 3Q45A 3P80A 3LRMA 3IUDA 5AHFA 4AYGA 5F4SA 3CMGA 4NNRA 3ZVHA 1ONEA 3O05A 3MMTA 1G5AA 5AZ0A 2NV2A 4GO9A 3HPXA 4N0RA 3LDVA 2VNCA 1TFVA 1MXGA 2BGNE 3GDKA 4C6DA 3DFPA 3MW7A 1PWMA 4LRSA 2YOCA 4JL2A 3W1XA 4KEUA 3VAWA 3SCPA 1YNQA 2NLIA 1V3KA 2DH2A 1DJQA 2HBVA 1FCBA 1NOWA 4IG2A 4YU1A 2VC5A 4M6QA 5FL0A 4WOQA 3MQTA 4I5UA 5C9WA 3HPFA 1OT2A 3DHFA 4GZIA 4ZVJA 5FI8A 1LLWA 3O5EA 3QF0A 1J4RA 4ZFCA 3GU9A 4YMZA 4NAFA 4IJBA 4H6KA 2OZTA 1XFCA 4LGXA 4LX4A 4GD0A 3WF4A 2OQHA 3R8GA 2BY0A 1D8CA 3GD6A 1YNPA 1ZJHA 3TCEA 2PV3A 1OC6A 3WBYA 4PA8A 4URIA 4IIDA 2BDQA 1J18A 1EZ2A 1XISA 4QDMA 1WKYA 3NPUA 1P6BA 2X8RA 2EBNA 2Q02A 4DF2A 2A5HA 3BOFA 4KQZA 2HE8A 2FJKA 4U31A 3HIJA 4IP7A 4MWAC 3L0GA 3GG1A 2WC3A 4LBRA 4ZO6A 4ODOA 1E6NA 1GZGA 3LBCA 2DT0A 3EKZA 4AC7C 4Q22A 3OA3A 1TJPA 2YW4A 1JXKA 1QXLA 2BHYA 4AWUA 1XX1A 1TELA 2E40A 3TW9A 4K8HA 1J96A 1G4EA 1O12A 2KE0A 5LGXA 3NDZA 5AC7A 1WAWA 1WXJA 3N11A 5IRPA 3WQGA 1J8VA 2O0TA 3N12A 3S9YA 1YDYA 4PYSA 3II1A 1I2OA 1Z44A 2ACRA 2V69A 3MANA 4JNZA 4DLMA 1XIIA 1J01A 1XQKA 3AIUA 1R9ZA 2PDNA 4U84A 3PZIA 3SUTA 2XINA 5K7JA 3UXAA 1TUXA 3OIHA 3GVRA 3GKAA 5MHBA 3HTWA 2BOFX 3D47A 3L9CA 2GVYA 3AMGA 1ZU8A 3LNMA 1T8XA 4GBDA 4HK5A 3MUIA 4LC8A 1L0PA 3D0CA 4ZL1A 5XIMA 5GJNA 3KAHA 4O8AA 1S2AA 1TTQA 4X60A 1H49A 3T08A 4ZZ9A 5CC3A 2VC6A 4LB3A 4K36A 3RITA 2OO6A 1KGUA 2XH7A 3VDBA 2OEJA 2OLHA 3UY8A 2QR6A 1GTEA 4D1JA 4FLOA 1KWGA 1X7FA 4DWSC 2A6NA 3PULA 1XC4A 1A5UA 1US3A 4JKMA 1ME8A 3QLLA 3QTGA 4LRTA 4O19A 4LH8A 1IEQA 1V6XA 1W56A 3KBNA 5I7GA 5C5YA 3FYPA 5D8ZA 2C6QA 4YVVA 2PU0A 3AHYA 1QR7A 4RW5A 4W9PA 4FX7A 3BLDA 2YXXA 3N18A 4DY1A 1H7PA 1MUCA 4UFJA 1IT0A 4B3KA 1ZBWA 4MG4A 4W9QA 4MLRA 3UR2A 4F79A 3LXAA 3SCUA 2ZUSA 1OFEA 4Y96A 1V7AA 3LHZA 1EZWA 1EGMA 4OOZA 1VRXA 1TR9A 3PZTA 4J3ZA 3O3RA 2XSBA 1EYWA 1IEWA 1XBZA 2RFGA 1SGJA 3VKJA 3U3HA 1SUXA 5B7YA 3MVIA 1AA1B 1UD4A 1UASA 5A6AA 3W26A 1DJIA 1U1JA 3D5HA 1UR8A 1GUVA 2ZDSA 3KCEA 4C7GA 4QX4A 5A8GA 3S6OA 1YLVA 1W3TA 3GXMA 1VBGA 1OCNA 4LY8A 3VXGA 5FCZA 2HTMA 4AWEA 4PE8A 1QNPA 3I4EA 3R0UA 3W4RA 3G3MA 4BQ3A 4QJ4B 2PBCA 2V68A 3R4IA 5JXQA 3C4UA 4FOUA 3AXXA 1IE7C 2YA2A 4F2BA 3M6YA 4IH3A 2YZRA 4LT9A 1TMLA 3G22A 4C6OA 3DAQA 4JTDA 3EPNA 1BWVA 3B4UA 2WXDM 1PBGA 3KOWA 5D9MA 1OX6A 2R94A 1YYAA 3NDYA 1EYEA 1F8IA 1UHVA 4PTXA 3P0XA 2J25A 2R9RA 1I6NA 4E8DA 3BV7A 4IHCA 1Q1CA 1V03A 2YJQA 3G5EA 4I9TA 5BYWA 4MJ4A 3L12A 4M80A 5FF4A 2QF7A 3CUZA 3MO4A 4GGBA 4JTAA 1E44A 3KCOA 4L56A 5M2FX 3EWZA 1FWGC 2PDQA 5BU9A 4S38A 3C0QA 5HWBA 1ZJAA 3AIQA 1K9TA 1W5NA 3CGNA 1M9HA 4G7FA 4KRTA 3MMDA 3ZVHB 1XLJA 3NSXA 3MWCA 1E6XM 1P6CA 1R38A 3WH7A 2OZ3A 1FWFC 2VR5A 1IYXA 3PZGA 1YXDA 3W1LA 4GVIA 1XLGA 3SIZA 1LRTA 4AD5A 4WK9A 4O1BA 4JGDA 4H9MA 4IF2A 1XXXA 2ZFAA 3WLRA 2NXHA 3W7GA 3COTA 1XPGA 4FSAA 2JIEA 3WF2A 4FOJA 4LAOA 2BMBA 3NQ8A 5AHIA 4HNVA 3NTPA 1EC9A 1WDDA 4V33A 3VGEA 1EP2A 4GYPC 1OVDA 1B3OA 5FJTA 3OQEA 1TO3A 2ITKA 4FIRA 3E96A 2XPAA 2Q3OA 2GJRA 3UI6A 4EE9A 3MCNA 2NQ5A 5EMLA 4MB4A 2IUZA 1MRAA 5U7SA 3EDKA 4K2SA 6REQB 3FIGA 1BQCA 4KT2A 4G5DA 5MF5A 3NO1A 4GOAA 4INFA 1KLYA 3IAQA 4QCEA 2QS8A 1E15A 1O66A 2YFNA 1BGGA 1W37A 2X7VA 3VNKA 1DIEA 4UMCA 3WF3A 1B2YA 4LF2A 2XISA 4M7SA 1E73M 2D69A 5HINA 2QUMA 1P48A 5GPRA 2PRLA 3CK5A 4E6MA 1J4HA 3LCLA 4LUYA 4MWAE 3WBWA 2OSXA 3RLHA 2D2OA 1F2JA 2O7SA 1VYRA 3WJSA 5DCDA 1H7XA 1UZ1A 1TTPA 3VC5A 3HJEA 4RXFA 5D30A 1O5XA 4GUGA 1UWTA 2IQTA 3ZM8A 4JTUA 4AU0A 3VNIA 1ISVA 4DJEC 1TKKA 3UVIA 1A5OC 4JIIX 1H0GA 2JGYA 3NQFA 4XD4A 4XAZA 3CGMA 4ZEPA 4FZIA 3OG3A 2ZTKA 4JHZA 2XG9A 2I9UA 4LB4A 3W7PA 1IZJA 4WGHA 3UNDA 4R7WA 4YCOA 3WLHA 2Q8ZA 5I23A 1VCVA 5AC6A 1PUDA 1YQ2A 3NA8A 2GJXA 1YBQA 3PPGA 1VRDA 3MCMA 1B0IA 3SR7A 4QIBA 2YL5A 1JD7A 5A8QA 1UD6A 2V2CA 3U8GA 5A95A 3QN3A 4M82A 3WIJA 1N2VA 5EMUA 2DW7A 1VENA 3H21A 1TV7A 1A4MA 3T0TA 3EKLA 4XISA 4QCFA 1MQPA 3GR4A 1RD6A 1SW0A 3BCJA 3XISA 3WSUA 2PTYA 4I9MA 1BGAA 4KFNA 5CGMA 1WQ5A 2RHGA 1QOQA 3TMQA 1C9HA 4AY8A 1CBGA 1RBAA 1O60A 1Q4WA 1UR0A 1B9BA 2VMFA 4WR3A 4NY2A 1JZ6A 2ZUVA 4HNUA 5CPOA 1TV2A 3VIHA 1SYTA 3G0XA 1WPCA 2F84A 2FGBA 2VD9A 1BD0A 1EO5A 1XGDA 4LAWA 2J7HA 3P93A 3AU6A 2PEVA 3KDNA 1Q6QA 3I3BA 4JFSA 1EKOA 1FWAC 1IGWA 2RKXA 3MPGA 1NMVA 2ZICA 4IPLA 3M16A 1DE6A 1Q6RA 2A1YA 5AZ1A 1L8NA 3FHAA 3MDWA 3GY1A 3V5OA 2CLEA 2QQ6A 3VCCA 1C8VA 3GBDA 1SZFA 2ISWA 5IHRA 4EPKA 3AIBA 1EX1A 4CUCA 4GCXA 4NVTA 1I1WA 3OGRA 5KSWA 1LJYA 5D03A 3IJQA 3DGBA 4WD0A 5A2BA 1SQ7A 3HG2A 4WKFA 5A5WA 4JN7A 4JX4A 3R10A 1WZLA 1PWLA 5F1UA 4GX9A 3U7BA 1L6GA 1FWNA 1TVPA 3FA4A 2BVTA 4PMRA 3EA3A 4JCMA 2WSQA 4YXGA 4IMFA 2DIKA 4RNIA 4W7WA 3TYDA 1HZYA 3NEHA 1US2A 2ZQ0A 3ATZA 1I45A 4WUIA 3R2GA 1EQPA 3CHCA 4CNPA 4QLKA 5GNXA 5D37A 2A3BA 3UWYA 2Z00A 3KRBA 3DHPA 3AOFA 3G1VA 2QULA 2RUDA 3GH4A 2WW5A 3IJ8A 4A21A 1OFOA 1JDDA 1GHSA 3GIYA 4ECLA 1E4MM 1D7KA 1V3JA 1W9DM 3QMSA 1C90A 4HSHA 2VL4A 1G4PA 1OQFA 2FVMA 4U5IA 3QSTA 1J0YA 3GXPA 4NYUA 5AKQA 3PR2A 2KZHA 2P1FA 3TN4A 5F1VA 3NAVA 3W7NA 2BZNA 4CQCA 3CUFA 4REQA 2VEPA 3W23A 2PA6A 1KKOA 3DHDA 5AFDA 3UYIA 1U5VA 2J6XA 1QDSA 3K4DA 4ITZA 1Z42A 3NOEA 1OX5A 3WQ4A 1RCXB 4D9PA 2VDHA 4ZGYA 5HW7A 5C7HA 2ZR5A 4D1IA 1ZL1A 2PDFA 4PB5A 1W6TA 1SU5A 3VZXA 2O4QA 5G2IA 3WKZA 4GLEA 5D9NA 5I3IA 4BI7A 3QHNA 2EKCA 4WKAA 2CKRA 4XD6A 5DLCA 3DFTA 4NG3A 4PMZA 2TMDA 4JQ2A 4ZCWA 1RY0A 3CIWA 3W25A 1A5NC 2X40A 4Y90A 2DU2A 4OTKA 3CPUA 3GNOA 4B5SA 3A3HA 1IV8A 1XIMA 3M7WA 1J0KA 1UC5A 1KO0A 5CGTA 3LU2A 4GY7A 4KF1A 3RGCA 5FEWA 1UA3A 3SFWA 3AHZA 3M0VA 4RE2A 3GH5A 3W7HA 4Q4RA 1CGXA 2GK1A 3THDA 5B8IC 1FDZA 3VD4A 2QV4A 3H54A 3UJ2A 1BKHA 1B30A 2C16A 3AISA 1B3ZA 2ZQTA 1LT8A 3NQEA 4W8AA 1TPVA 1EPVA 3TMLA 4JEJA 3FEQA 3B40A 4FLQA 4F40A 1K02A 1DQWA 1GVEA 2GLKA 2Y62A 4EXQA 3GZAA 3K46A 5CJMA 3STPA 2EPHA 2GDUA 1D7FA 3WDRA 1JZ8A 1JZ4A 1A0CA 2QCFA 4MKNA 3TTYA 1YDNA 2NLYA 3PZQA 2YL8A 1C93A 3TROA 4XK2A 3UQAA 2AQOA 3SRFA 2ZXQA 4U2YA 4EIVA 3N4FA 2YKKA 1IX5A 1IZKA 3IGUA 4BZYA 1XLMA 1UCWA 4GFIA 2Q5AA 4GJIA 3RX2A 2VOMA 4NKCA 2IPFA 2E09A 4Z2IA 4L4OA 4GXPA 3TR2A 7ODCA 4HMCA 2OODA 3DIPA 3UWWA 3BZJA 3OTRA 2IW0A 4J3XA 3I7RA 4Y9OA 1ITQA 4ODQA 6TAAA 3IV3A 1L6SA 1KQZA 3K5XA 2J62A 4UTMA 4QJ5B 1BVZA 2Z2BA 1K77A 4PCNA 2FPTA 4UTUA 1E56A 2H3DA 4GGQA 4DZ2A 3GU1A 3V4BA 1NDVA 3L2MA 1LQ0A 4LAKA 5AHMA 4Z2HA 3N19B 2FZMA 1XBYA 2PPGA 3WQPA 3W28A 4GIAA 4DYJA 2OR2A 3RR1A 5EKYA 1ZAHA 4PB3A 3EA2A 3W83A 1Q66A 3CQJA 3MBDA 1NF7A 3V35A 5HJLA 4DJEA 1WDSA 4EANA 1AZ1A 2XZ9A 1ZZMA 4WDXA 2WC4A 1GORA 3G24A 1ZK6A 2PP0A 3WH8A 4HK6A 2XSAA 3N2BA 2UWFA 2V5DA 3KBWA 1WX0A 1TV8A 3G0UA 3EOUA 1E0VA 4LVAA 3C5QA 3PAJA 1CXEA 5GNYA 3QGAC 2PF8A 2VVSA 1O68A 3IANA 1WZAA 5JIWA 1A5SA 2OZ8A 4GKTA 1E1CA 2YFOA 4J3TA 3ZR5A 4MJMA 1PX3A 3GO2A 4AD4A 4CNTA 3Q67A 4JTRA 2OWWA 4C6KA 4QQUA 1Q85A 2OG9A 1R0MA 4FALA 3VIGA 1W26A 4DIAA 4LC6A 2LKNA 2P8BA 1U30A 3VZYA 4H8UA 5C9UA 1GQJA 2GZXA 2WJZA 5CAHA 5LA1A 3L66A 1GQKA 4D8LA 3T81A 1SFTA 5IBXC 2XUCA 5JBDA 3TYCA 4Q7NA 3NZ1A 4R53A 3NQVA 2YLAA 4JOMA 3VMNA 4FXRA 3SQSA 4HCHA 4QJ3B 3I65A 2FJUB 3AHVA 3O0FA 4TMCA 2WSRA 3VKCA 2RQSA 4IP4A 4RZ6A 1LQAA 2NVAA 3CO4A 4FXSA 1CXIA 4OWGA 1UR2A 4MM1A 4AZCA 2ZYFA 5G4HC 2V5KA 3DUGA 1Q2RA 1FHLA 3GK0A 4FAPA 4DZ3A 1ISXA 2FKEA 4MF4A 1JF6A 4L6OA 1C7SA 2ZXBA 4PMVA 5JMUA 2XFRA 4EXBA 1ZY9A 2CXGA 2NW0A 4YTRA 3WLNA 3GYCA 2Z1SA 4J3UA 1QUMA 1K9FA 2XP8A 1BRLA 1M01A 2CBVA 2MLZA 1V4YA 4PFMA 3IUIA 4A3UA 5LA0A 1TMHA 1DJXA 3W7IA 3GDRA 2QAFA 4PH6A 4REQB 2WLYA 3CLWA 2B5UB 2E6YA 9XIMA 5BXJA 2OT0A 3CT2A 1BYAA 3MWAA 2XWDA 3RRXA 1KBBA 2IS7A 1QPLA 1TWWA 1H3GA 4FS9A 4HPNA 2GVGA 2QDEA 3OBKA 5F2IA 5EMMA 3POCA 3N3TA 5BROA 4AD1A 2A3LA 5RUBA 3EWDA 3T9PA 2PDHA 3HB9A 1D9EA 1KCXA 1HJWA 3UWVA 6ALDA 3B0PA 1LM1A 2OGJA 1UQZA 1WDRA 1JYVA 3KVLA 1U83A 5DY3A 2INEA 2VI0A 3DESA 4CQ8A 2YCKX 4JCLA 4GO8A 5JQ9A 1UA7A 4KEMA 3KAOA 1JQXA 5HJXA 5I79A 1ZS2A 4J2MA 3S4TA 4IX0A 3SRHA 3QV6A 1QO2A 1YBQB 1NWSA 4HB7A 1ZUAX 1Z48A 4O14A 4J3SA 1M6JA 1TR1A 2PUZA 3FKKA 3WNLA 2M1IA 2I7GA 4V28A 1GVFA 2OFNA 3CGT