1JNDA

Crystal structure of imaginal disc growth factor-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
400
Chain Sequence
b'SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Imaginal disc growth factor-2
publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
total genus 143
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jndA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jndA01
3HMCA 1FP9A 4TXEA 3BSHA 2D0FA 2DH3A 2GK1A 3CGTA 3VGEA 3NSMA 4V27A 1Q6GA 1UD4A 4UFMA 5DFAA 1E3XA 4CU7A 1E0VA 2VRJA 2JIEA 3VDHA 1JDDA 2Y24A 3NYDA 3AS1A 4JIEA 2CNCA 3PZGA 3SCRA 1OD8A 2YL6A 3I3BA 3LPPA 1UKOA 4HPGA 2DT0A 1BVNP 5ECUA 3T0DA 3VINA 5DF0A 3ARYA 4PTVA 4XUYA 4AZIA 1QVBA 1C8QA 4LGXA 2G41A 4PMOA 3UG3A 3RJXA 2JIWA 1ZBKA 2CYGA 4HZ7A 4ZFMA 1Q6CA 1XYFA 5AC4A 1KQZA 1W2VA 2QMJA 1KXTA 4MJ2A 3AIUA 4X9YA 4AIOA 5EB8A 2D0HA 1DWFM 4UOJA 3GYCA 3AMLA 1M7XA 1LG2A 4OOUA 4PCTA 2JEPA 4AZ5A 3AXHA 2CBJA 3FAXA 2D20A 4GKLA 2GDUA 1MFUA 3TA9A 2J78A 1GHSA 4A3YA 4JHZA 1H5VA 4JZ5A 2O92A 1KB3A 2OYLA 4RE3A 1V3MA 4AD5A 5AC5A 1E3ZA 3MUAA 1UR1A 2J77A 3GH5A 1UWUA 3W25A 2IXVA 1CXIA 2XPKA 2XIBA 2PC8A 3ZSSA 9CGTA 1JF6A 2Y5EA 4P8WA 4GO8A 3LPGA 1JZ5A 4QCFA 2VMFA 4V2XA 2YA1A 1C3FA 5CQ1A 4JFSA 4CU6A 1DWHM 3VIJA 3ZSTA 2IXUA 3TTYA 4E8DA 4PRWA 1TA3B 2VZUA 3RPMA 3W38A 3MSDA 2JEQA 1UH2A 1B30A 3WDPP 1V6UA 1V6WA 3K46A 5EMYA 4KGLA 3AS2A 3EMCA 3LMYA 5DMYA 1W9UA 3K4AA 1LWHA 2VO5A 3VIGA 1HX0A 4U3AA 1LJYA 3CMJA 4PYSA 3SUTA 1BTCA 3MUIA 1K9TA 4UOZA 4V28A 1OBAA 3FAWA 4M80A 1OINA 2ZXQA 2CEQA 2BV9A 4JL2A 3BAXA 2VJXA 1Q6FA 3GDBA 1AMYA 4CN6A 2CETA 1BG9A 3BCDA 1GVIA 5D9MA 2ZX8A 2ZUWA 1CBGA 1E43A 4GQRA 2YLAA 1HF6A 1JDCA 5GNXA 1EDGA 1GORA 4HA4A 2WK2A 2JF6A 1CNVA 5LA1A 3WH5A 4BQ4A 3AQUA 2YIHA 1C8XA 2XTKA 3RCNA 6TAAA 3CZGA 3UG4A 3ARTA 3WNNA 4QAWA 2F2HA 4DM1A 1HXJA 2RGMA 2V3EA 2W91A 3AIBA 4H7VA 4ATWA 2PF0A 4HTYA 2FHBA 3AMCA 5FD0A 4N42A 2XFYA 4HP5A 3SURA 2YL9A 3CTTA 2TAAA 3WDHA 1K9DA 1G0CA 1J18A 1U2YA 3CUJA 2WMKA 3WNMA 1X1NA 2XWEA 4EANA 1GOKA 3ZM8A 1QHZA 1UR2A 4B3KA 2ZOXA 4W7VA 4HZ8A 2VTFA 1GNXA 3M7SA 3IJ8A 1XD1A 2PBGA 1CLXA 4WKHA 2VR5A 1H0IA 1NH6A 4WKFA 2X8RA 3J7HA 3AIVA 3QHNA 1XHGA 3WKZA 3CUGA 2VOTA 2JF7A 3NSNA 4MNMA 2XGBA 1IV8A 1V3LA 1V3HA 1V3JA 2ZXDA 1ZJAA 1EIBA 4FLOA 3AXXA 1UYQA 1D3CA 2E9MA 1UWSA 4PTXA 1V02A 3MANA 3ZR6A 1NWSA 2X05A 3WD3A 4P8VA 1WDQA 3PHAA 3ZIZA 4FLSA 4K68A 1NP0A 1LF1A 1W1PA 2CXGA 1E6NA 3WUBA 1WB0A 1HVQA 4ATLA 1ISVA 4D1JA 5KZ6A 1TMQA 5E9AA 5A6LA 3T09A 4CKQA 3UG5A 1QPKA 4FF5A 1WZLA 3CH9A 3CZJA 3M6DA 5M3WA 2WLZA 2DSKA 4FK9A 1PZ3A 2W5FA 3II1A 3N17A 4A4AA 2VT0A 1V6XA 1V0MA 3VMNA 1MXGA 2DPEA 4B3LA 2PI6A 1VEOA 1XCWA 3EMQA 3NIYA 4MADA 4R5EA 3AHYA 3SUVA 3PZ9A 2WZEA 5DT5A 2G8ZA 3W53A 3BAYA 3AYRA 4CU8A 2WSPA 2MANA 3VUPA 1KBKA 4MB1A 1P6WA 1W3KA 4QP0A 3TTOA 2XVKA 4PMXA 1E6SM 4PSPA 2CKRA 1V0KA 1TCMA 4FMVA 2ZUMA 3VD5A 2J47A 4NSBA 4ZXLA 1I1WA 2BFGA 5IFTA 1MYRA 3AOFA 3D3AA 1OSEA 1JZ8A 5HOSA 4HMCA 5HNNA 2WNWA 4KH2A 3SUWA 1UH4A 1EGZA 1C8YA 5IHRA 2Y8KA 2E40A 3SCQA 3N13A 2CESA 4BF7A 2OWXA 2D3LA 3T0AA 3MV11 4X0VA 1UWTA 5A3HA 3WL0A 3RILA 3L4YA 5C71A 2BY0A 3AICA 5AYIA 2GUYA 4AZ7A 5I2UA 5ABFA 4XB3A 2DDXA 1RD6A 3VIKA 1E55A 3OA5A 3MSGA 3IJ9A 5F7UA 2XWDA 4DUVA 1GOIA 1QW9A 1C92A 2ZX5A 3PBGA 4W85A 3MMDA 4GQQA 4H8UA 1QI2A 1SR0A 3RM4A 3L4TA 4F79A 1JD7A 1GQIA 1OM0A 4FLQA 1ZBWA 2E4TA 8A3HA 2YDRA 3KZSA 1EO7A 1HT6A 1WCGA 1E0WA 3BAJA 2WZIA 5CGTA 3VILA 2CKSA 3WD1A 1UKSA 1ZS2A 2YA0A 1ISZA 1E73M 2YOCA 5E70A 4HMDA 4UQBA 2F61A 5TD4A 3OLDA 3WEOA 2VL4A 2WBKA 2FDMA 4MNJA 1CGVA 4PMZA 1JYXA 2D0GA 3AMKA 1UA7A 5D8WA 5HDRA 1HKKA 2WMJA 5EFFA 2Z1KA 3PZIA 4H8VA 4FLRA 5JBFA 3VGFA 2A3AA 5A2CA 3GH7A 1CGWA 4YHGA 1G1YA 3W6MA 4X0NA 1ITXA 1ZBCA 1JZ2A 3BGAA 3VGGA 3ZT6A 1FH7A 3K4DA 3IAQA 4PMNA 5BCAA 3PZOA 2WCGA 2VCCA 5BROA 5HPCA 4H8HA 2VVNA 1JXJA 2YBTA 1TE1A 4JCMA 3TONA 1R87A 1QBAA 3WDJA 3CUIA 1E6ZA 2OSYA 1KWKA 2YBUA 3WNOA 1GHRA 4J3VA 3AS0A 2AOSA 1EOMA 3QOMA 2DT2A 1ESWA 3VGBA 2UY4A 3W0KA 1BYCA 1NOWA 3N18A 3CZKA 1ODUA 3W6LA 4QFUA 1KXHA 3ECQA 2VX4A 5FL1A 4KWUA 3W29A 3NDZA 2ESCA 4RE2A 1K9FA 4WK9A 1QHOA 1VEPA 1AVAA 1GOOA 3VIFA 7TAAA 1B31A 2JE8A 4UR9A 2G3MA 3GNRA 5LA0A 2UY3A 1UUQA 2DSVA 4W89A 1GOQA 3WFLA 3PTQA 4PTMA 1JZ6A 1VJZA 5IXEA 3GXIA 3CUFA 3CHDA 1ISYA 1GVYA 1VB9A 3QGVA 3B9DA 5EBAA 2AMGA 2A3CA 4AMCA 5FL0A 4AYSA 3GBEA 3GZAA 1E5NA 2WZHA 1IT0A 3ALFA 4XX6A 2VZTA 2Z1SA 1XD0A 3A47A 3MS8A 4DUWA 4E4PA 2CBIA 1W3JA 3WNLA 4B15A 2J4GA 1NQ6A 1HKJA 7A3HA 2YLLA 1PX3A 2X0YA 4M8UA 4B16A 1WO2A 1JF5A 1W3LA 4Z2KA 5M5DA 4ZE4A 3W24A 4OOZA 1PAMA 5A6BA 4OBRA 1CXHA 1E56A 3BXWA 4LQ1A 1J0KA 2WMIA 2Y8VA 4CD5A 3CZ8A 2D23A 2YL5A 1G9HA 3ZJ7A 3VX0A 3WD0A 4D6HA 4HU0A 4W8LA 3WDRA 3THCA 2PBOA 1KGXA 2XGIA 1I1XA 4LX4A 1UWRA 1E6PA 2OYKA 2CCRA 5E09A 1WAWA 2DSZA 3AIEA 2E3ZA 1M03A 5BXRA 1BSIA 3ARXA 3DECA 1UOKA 3ZT7A 2NT1A 2WWDA 4CD8A 4W7WA 3GM8A 2CITA 1U33A 1UR8A 4AZCB 4RE4A 3VNYA 2J75A 1V02E 2DEPA 1EDTA 2BVYA 4S3JA 1C7SA 2ZUUA 1J0HA 3BAIA 3GTNA 3T2PA 3T0BA 4JHOA 5IFPA 3W27A 1HJUA 5CPSA 1TA3A 1G94A 2J8GA 1J01A 2WMIB 1NP2A 2VQUA 3VO0A 3L2LA 3W81A 3K8KA 4UQDA 4P8UA 1DP0A 2D1ZA 5GQBA 1SMDA 2QV4A 4RL3A 2D3NA 1LL7A 2V38A 1VRXA 2EPKX 1BPLB 3SCVA 3K1DA 1V08A 1QW8A 5JH8A 4P7QA 1OIFA 3VDBA 4CCCA 5D9NA 3ARZA 2D24A 2HVMA 4GINA 4MTVA 1B90A 1BGGA 3K8MA 3WQ6A 2XUCA 3PTKA 3NDYA 2VVSA 1FFQA 3RMEA 1JZ7A 3CZLA 2NW0A 1HJXA 3ALGA 3O6AA 4QLJA 1VFUA 4PMQA 1HKMA 3MU7A 3WN6A 2W62A 4Z2JA 4URIA 2QHAA 4NRSA 3WNPA 3VVGA 1GQKA 3AHXA 2BHYA 3AI0A 2ZE0A 3WUGA 3WH6A 1KCKA 4AD0A 4D6DA 4TVCA 5E0CA 5CJ5A 2GJXB 3VIIA 4OUEA 4LYRA 2EPNA 1M53A 3UR7A 3FHQA 5A2AA 1JXKA 5JBDA 3AHTA 4P7NA 2Y4SA 4GXPA 3KL0A 1FP8A 4DM2A 3L4WA 1E4IA 3QHOA 4HOWA 2OLHA 3A4WA 3U7VA 5LA2A 2WPGA 1EXPA 1XGZA 1JFXA 1WE5A 1BVZA 2ZX9A 1OT1A 1W9VA 3ZR5A 1HJQA 2BY2A 1CGYA 5A8MA 5I24A 1MW3A 3U7BA 4E8CA 4BS0A 4CVUA 5AY7A 1FFRA 5BXPA 2XM2A 2YA2A 1UH3A 5CSUA 4B9ZA 2BS9A 3MUY1 1VJSA 1J0JA 5A95A 5DT7A 1B3WA 2E8ZA 4OKDA 2JFEX 1WDSA 1IZJA 1H2JA 2VRQA 3WBAA 7CGTA 3CO4A 1VF8A 2C7FA 2ZX6A 4U31A 3ZJ6A 4PTWA 3VD7A 1HNYA 2YDSA 1PIFA 1B3YA 4CD6A 3VNZA 4MB5A 2DSWA 1UR0A 1UQZA 1XV8A 5FOOA 1CEOA 3EDJA 2E8YA 2WMGA 4W88A 2GFTA 1FA2A 1ISWA 1HVXA 4M1RA 4AD4A 1HP5A 4AZ6A 2WBGA 3VMOA 4IM4A 2OYMA 4EE9A 2GVYA 6CGTA 1KFWA 3GNPA 4AXNA 2W67A 4BA0A 1KQYA 1VFOA 4BQ2A 2VX6A 3PZTA 4XZWA 2VC9A 1XSIA 2BNJA 1BYAA 3TTQA 1J11A 4GI6A 3ARRA 3VOCA 2WLYA 3EMZA 1J0ZA 1M04A 3FHAA 2WWCA 1QNRA 4UNIA 2J7FA 4MDPA 3D5HA 3RIKA 4TX6A 3CLWA 3WIJA 3DHUA 4AEFA 3RDKA 3AS3A 2VZSA 2OSWA 1WDPA 3PZUA 2XHYA 4AW7A 1WP6A 1GQJA 2XM1A 1EH9A 2FHCA 1WZMA 1XYZA 1X6LA 5HBFA 3OGSA 1W9BM 2WANA 1XCXA 5JIWA 2WHKA 3PZVA 1DTUA 5CSYA 4MPKA 2JALA 3PZNA 3WMBA 2XG9A 4W87A 3EYPA 3VGHA 1Y7VA 2CHNA 2V3DA 3VGDA 2O9TA 3ZJKA 1QBBA 1UD2A 1BAGA 2VZVA 4J3XA 1GJUA 3RM9A 2PB1A 5JIPA 1UG6A 1NWTA 2CIPA 3AIQA 4CN1A 1JYWA 1SYTA 3NUKA 3BMWA 2D2OA 4PMRA 1UD8A 4D6GA 4W7UA 1CDGA 1NARA 3WMSA 1BHGA 3SCUA 2EEXA 1W91A 4HPHA 4MAVA 4PSRA 5I79A 5M17A 1K6AA 2EBNA 1H09A 3O9NA 1ECEA 4GPNA 2CBVA 4UFIA 1OGBA 1JDAA 4UTFA 4H2CA 1R85A 2GJPA 2ZIDA 3OGVA 5C70A 1XH1A 3CBWA 1BQCA 2WM0A 4BQ5A 3F5KA 5A1AA 5AYBA 3TOPA 1CXFA 1UWQA 1B1YA 1BGAA 3M07A 1UD5A 1TG7A 3DYPA 5D8ZA 4TX8A 2BXYA 1CECA 1JAEA 4MAZA 3THDA 4LYQA 4PN2A 3VIOA 4JFUA 1YHTA 5A6JA 2EQDA 1GW1A 4CVWA 1A47A 1BYDA 4GZJA 1H4PA 1QNQA 3OZOA 4D6CA 3MUZ1 3MMUA 3VMPA 3TP4A 3LPOA 5A2BA 1VFFA 2ZICA 2DIJA 1O6IA 3TTSA 3CPUA 1AQ0A 4NZCA 4PCSA 4ZEPA 3AFBA 2ZUTA 5FKYA 3IJ7A 1E6XM 2W63A 1LG1A 2WVVB 3OLEA 1FH9A 3IK2A 4WJXA 1ZU8A 3HN3A 4CD4A 2VZOA 2OWCA 5BXTA 3I3EA 1JI1A 5KEZA 2B31A 5E0FA 5ABEA 5CXPA 2WW5A 5A6AA 2VRKA 3WBEA 2Q8XA 3DYMA 3FY1A 2BXZA 2DQXA 5A8PA 2O9OA 3AHVA 1J10A 2AAAA 4P8XA 3VDAA 5GNZA 4ACYA 3WFZA 3QR3A 1XH2A 1HJSA 2WC4A 3AHZA 5A6KA 1LWJA 1R7AA 1E70M 2W61A 1XRVA 4F8XA 2UY2A 3SCOA 5ABGA 4Q7NA 3FN9A 3MV01 1Q6EA 2WHJA 4KRTA 2WB5A 4AIUA 1FOBA 3GBDA 1E40A 4PBGA 1V0LA 3CUHA 5CGMA 2WYSA 1PJ9A 1US2A 3T2OA 3U5YA 4QCEA 6A3HA 1B3VA 3W37A 2GJRA 1MQRA 3BLKA 5A8QA 1QI5A 1QI4A 4CCDA 4JFWA 1K9EA 3WELA 4J28A 4MNLA 1JNEA 4M81A 3WQ8A 3VM7A 1BG4A 3SCPA 1JG9A 1V3IA 2VR4A 4WF7A 4UZUA 2EXOA 3W26A 4D71A 3UETA 4LPCA 4BCEA 2QPSA 1JFHA 3WUFA 4M24A 1OGSA 1CGUA 3WY1A 2DT1A 3ZMRA 3RM8A 3OIHA 3F5LA 4WIWA 3UCQA 1OIMA 2ZXBA 4U5KA 1TVNA 1SMAA 1H0GA 5I0DA 1ODZA 2BVDA 2O9PA 4HA1A 3L2MA 3WF4A 1CIUA 4HMEA 4CD7A 1KR1A 2FHFA 3E1F1 2OSXA 5CLTA 3WD2A 2WCSA 3A6OA 3N12A 3EDDA 2G3IA 3A4XA 3PN8A 1C7TA 3WH7A 3WEZA 3N15A 1J9YA 1E6QM 1V03A 1L8NA 1DWAM 2WSKA 3UEQA 1W9DM 3FW6A 1VIWA 4JKMA 3BMVA 4WSJA 2V5CA 1IZKA 4ZXOA 4J7RA 3JUGA 1GPFA 4ZE5A 1UZ4A 2OWWA 4DUXA 3VPLA 2F8QA 3DYOA 1ISXA 3IAPA 4JL1A 4EK7A 3WDQA 3AJ7A 3F5JA 5E6YA 3O2LA 2EO7A 1KGUA 3POCA 4GZEA 5A8OA 2CERA 4AZCA 1XSKA 3SEPA 3NCOA 1W9XA 3QHMA 1QNOA 2QF8A 5IDIA 5BRQA 1E1EA 4GIAA 4UZSA 4M82A 1GOMA 4BZYA 3WQWA 3WSUA 4JFTA 1NOUA 3N11A 2DT3A 4J3TA 2W66A 1VBRA 4M29A 3EBVA 1R86A 1JD9A 4BQ3A 5E6ZA 1W3HA 2W4XA 1DWGM 2ZUNA 3F4VA 3WH9A 1E5JA 3CZEA 1QHPA 1WKYA 5JUVA 3AMDA 1RH9A 1NOFA 2FH8A 4W5UA 1UR4A 1B0IA 4D6JA 3VKKA 4IUGA 2J7CA 1E9LA 1DWIM 2CPUA 1W32A 3VIPA 1O7AA 1US3A 1H49A 1X6NA 4JFVA 1QOXA 4TTGA 3MO4A 1W2PA 2VURA 1ZBVA 1UHVA 3BAKA 1JYNA 2J74A 3T2QA 3PZQA 2ZWYA 1HL9A 4S3KA 2ZXAA 3A3HA 5D4YA 4U3CA 1CLVA 1HP4A 4DWSC 1HKIA 4UFJA 3POHA 3VD4A 4CUCA 1CYGA 3ZQ9A 1DHKA 1LLOA 2CHOA 4AD1A 4M56A 3BAWA 4Q22A 2UWFA 4WLCA 1B3XA 4JAWA 2GJXA 4YN5A 1FH8A 3L4XA 3ARVA 2YJQA 5CG0A 1CTNA 1LL4A 1NWUA 2WKGA 4TUFA 2A3HA 1NWRA 1JIBA 3N9KA 3RJYA 4D72A 4YHEA 4NI3A 1S46A 2WHLA 4CGTA 2WHMA 2BHUA 2A3EA 4C7GA 2X1IA 4TOQA 3AISA 1W1YA 1VFMA 3AIRA 4B9YA 4A3HA 3CHEA 2PWDA 3RO8A 3SUSA 2E9LA 4GI9A 2X2YA 5D9PA 1JZ3A 3SCNA 4DWSD 4PMDA 2WC7A 1GQLA 4TTUA 3ARSA 4MNKA 1E4LA 3KL3A 4EKJA 4Z2HA 4AIEA 1JL8A 1WZKA 2GK1B 2HISA 4ZENA 5CLWA 4OIFA 1W1VA 2EJ1A 1VAHA 3AMGA 5I78A 3WEMA 3W82A 4PMUA 2UY5A 3NSXA 2ZUSA 1F4AA 4AZGA 1CZ1A 3VDCA 1MW0A 1E4NA 1V3KA 2PWEA 1MVYA 4P7OA 2O9RA 1LQ0A 1PX4A 5BRPA 1PEZA 5CPTA 2WMFA 4IPLA 4AY1A 4OZOA 5BWFA 3PTMA 4NF7A 1J0YA 4LYPA 1B9ZA 4DWSA 3GXMA 4LXFA 3AIWA 3QOKA 2DIEA 2J7BA 2WMHA 4AEEA 3KL5A 2FGZA 1MFVA 2WVSA 4U2YA 1YQ2A 1CXKA 4KGJA 2J8FA 4P7LA 3B9AA 4PEEA 4F9DA 1KBBA 1EQCA 4TVDA 1UKTA 3OG2A 1PPIA 3I3DA 3ARQA 1A3HA 3SCWA 4J3WA 1OWQA 3DC0A 5JBEA 1KWGA 3U5UA 5A69A 3MMWA 1B2YA 3PZMA 1CXLA 4L4OA 2QMKA 4OBSA 2XIIA 4NRRA 3UR8A 4MB4A 2XYLA 3VIMA 1GCYA 2GSJA 2VCBA 3ZT5A 1OD0A 4AISA 1UKPA 2A3BA 1GOWA 1WZAA 3VM5A 1RP9A 1MW1A 1LL6A 1E72M 1ZJBA 2D22A 4PUEA 1XH0A 3BLPX 3AZTA 4DWSB 5BYWA 4GZIA 2V3GA 4ACZA 4Z2IA 1BFNA 1UD6A 1TFVA 4MDOA 4PUDA 2VQTA 4JKKA 4D1IA 3VIHA 1PBGA 2PWHA 1Z32X 1EHNA 1EOKA 4W5ZA 3CHCA 3OGRA 2BY1A 2C8NA 1PIGA 1UR9A 3CHFA 2DGAA 1R8LA 3S2CA 3WNKA 3WF3A 3WF2A 1CXEA 5GPRA 2QPUA 4QLKA 2EPOA 5ABHA 4WKAA 5HXMA 2E0PA 3HJEA 1WNOA 5CPQA 1EA9C 1CPUA 4UQ9A 5LYRA 1JGIA 1UWIA 2WC3A 1E15A 3GH4A 4QDMA 1D7FA 1CGTA 4AZBA 3IANA 3GNOA 3WUEA 2G3NA 2XVLA 2YL8A 1G5AA 1QI0A 3SCTA 4ACZB 2RGLA 5GNYA 1C91A 3UESA 1V6VA 2WXDM 4L4PA 8CGTA 2V3FA 1E1FA 4MJ4A 1CGXA 4W84A 1I75A 1MQQA 2XFRA 1UKQA 1HN1A 2J62A 2C0HA 4AC1X 4U5IA 1VBUA 4JCLA 5DO8A 1GONA 4Y7EA 2CBUA 2PWGA 4OJYA 3AYSA 1M01A 1E4MM 1Q4NX 4W8BA 1GZJA 1OGGA 3OBAA 1GUVA 1QNPA 1CWYA 1UD3A 1C90A 1XC6A 1OCQA 3MKKA 2J7HA 1C93A 1F4HA 2WVVA 1ZB5A 1H3GA 3BC9A 1FHLA 3KEHA 3BSGA 1BF2A 4QLLA 1HIZA 1TR1A 1AQMA 3FNDA 2EPMX 1H11A 1E71M 1VENA 1Q6DA 3S6TA 2QLYA 4UQEA 2BVTA 3AROA 3A4AA 2X09A 1U30A 4YPJA 3N1AA 2ZWZA 1UA3A 5FIPA 2IUZA 1DWJM 1V6YA 4PMYA 5FCZA 2VNCA 1TUXA 4ATDA 5A6MA 3ZOAA 3WF1A 4H04A 1EDQA 2DSUA 3HU7A 3WQVA 1TZ7A 3WD4A 4PMVA 1SFSA 1AQHA 3ARPA 2J25A 3OLIA 1ITCA 3OZPA 1EO5A 2XVPA 1JAKA 1HJWA 3WQ4A 4N0RA 3SUUA 3L4ZA 5A8NA 1HL8A 3EDKA 1KR0A 4AD3A 3ZJ8A 1H1NA 2Y2WA 5I3DA 1KGWA 1B3ZA 1EHAA 4C7DA 3K8LA 4D6EA 2XVGA 3N04A 4P7RA 3BCFA 1MWOA 4WSKA 3VD3A 3AZRA 1JI2A 1OT2A 1JNDA 2VI0A 3GXDA 1PX8A 3GXFA 4HZ6A 2W92A 3DHPA 4KMQA 1JYVA 3WMCA 2G4FA 4IPNB 3CIVA 3BH4A 2NT0A 2YDQA 4UFHA 4W93A 2J7GA 4HA3A 5D9OA 2PWFA 4ML4A 1XSJA 4F9JA 1ZL1A 5HPOA 2ZX7A 4W86A 5ABFB 5A94A 2XSAA 2BHZA 3VX1A 4D6FA 4J3UA 3WL1A 3WH8A 1J0IA 1EQPA 3KWXA 5I23A 5M03A 4HOZA 1W9PA 1GJWA 1R7OA 2GDVA 4C7FA 3VD9A 5A6SA 3AXIA 3EDEA 4UCFA 1V0NA 3FXYA 3ZO9A 4UFLA 1NM9A 1L0PA 2FGLA 3OLGA 3L4VA 4GI8A 4Z2GA 4UOQA 5I77A 1KXVA 3WF0A 3W4RA 4KRUA 3U57A 4J3SA 2BY3A 2XFFA 1UQYA 3SIMA 4UQCA 3EDFA 4AZHA 1KCLA 4XZBA 3T08A 1PZ2A 1MW2A 2EPLX 1E0XA 1FHDA 1N82A 1QNSA 5I5RA 4D6IA 3G6MA 4AWEA 5C8BB 4J27A 4EAMA 4IISA 4CCEA 2YKKA 1J12A 4W8AA 5DEZA 3SCSA 2E9BA 5EFDA 1KXQA 3UERA 5IHSA 2WCAA 2J7EA 4HU8A 2WVUA 1CENA 2ZUVA 2FH6A 1UZ1A 5I6SA 3WQ5A 3ARUA 2NSXA 1MXDA 4R27A 4JKLA 4XV0A 4H41A 4UFKA 2J79A 1VEMA 3AZSA 2WAGA 5A6BD 4U2ZA 4GO9A 2X0HA 1G01A 3M46A 4CN4A 3B8SA 2VX5A 2G3JA 1OB0A 3WDIA 3VTRA 1HJVA 4Z2LA 5BXSA 3OB8A 1RPKA 1E6RA 1RP8A 3VU2A 2XSBA 2VCAA 4HOXA 2WVTA 1H41A 1D2KA 2XVNA 2VUYA 2DH2A 1QI3A 4E2OA 3W28A 3CMGA 4AD2A 4MB3A 3KE0A 1W1TA 2V5DA 5CZKA 2XJ7A 1BYBA 3APGA 2VX7A 1JZ4A 3WENA 4F66A 1BLIA 2WKLA 3NJ3A 3G6LA 1MQPA 1WDRA 4U33A 3LPFA 4TVUA 4UQAA 3ARWA 3L4UA 1DEDA 1TVPA 1WPCA 2J7DA 3B9EA
chains in the Genus database with same CATH superfamily
2BGNE 4YYCA 4TXEA 2KE0A 3NSMA 1JJKA 3S1VA 5DFAA 3A23A 1E0VA 2JIEA 3AS1A 3MKVA 2CNCA 1OD8A 5D38A 4GJ1A 1PHQA 4H01A 3ZR4A 3I3BA 3LPPA 1UKOA 2PU1A 1XDMA 3BARA 4HN4A 3KRBA 3GHSA 4WD0A 1C9HA 3VINA 2ZVRA 3ARYA 2ZC8A 3CM4A 4PTVA 1FHUA 4QS6A 4AZIA 1QVBA 1W1A1 5DO2A 1NTHA 4JY8A 3A4JA 3W02A 4F0HA 3LG3A 1KQZA 1Q5MA 1W2VA 2DZAA 2GGHA 3VKDA 4C6LA 1KXTA 4MJ2A 5EB8A 4UTHA 1DWFM 1Z6KA 2WPBA 3TSDA 3ZS4A 1AW1A 1LG2A 4PCTA 4JYDA 4RZ5A 4XTDA 3P74A 1EGVA 1TV3A 2D20A 3GFXA 1XIFA 4Q8QA 3E5BA 3TA9A 4G1NA 4A3YA 2O4MA 4E3VA 1KB3A 1NVMA 2OYLA 1V3MA 3N2CA 4XO7A 5LIKX 1UR1A 4KQNA 3W25A 2GOKA 1YTDA 1AH4A 3P67A 1CXIA 4RUBA 4O2TA 2NQJA 5A5WA 1JF6A 4IMGA 4P8WA 5C2GA 2VGBA 2OLSA 5CCZA 1ZP4A 4RX0A 5CQ1A 4JFSA 4ALDA 3AC0A 3ZSTA 2IXUA 3TTYA 4E8DA 4FXRA 4PRWA 3ME3A 4PEKA 1QU4A 1KM0A 3RPMA 3GNDA 4EXAA 2AL1A 1BWVA 1V6UA 5EMYA 2J6XA 3AS2A 4LS2A 4W4QA 5HK4A 1Q85A 2H8XA 4U3AA 1LJYA 1P0KA 4OWGA 1O60A 3CMJA 2C3ZA 3R79A 4PYSA 3SUTA 4RV8A 4GWEA 2V5LA 3DIPA 3L12A 1HO4A 2RURA 1K4GA 4DVOA 3S46A 1OBAA 5HATA 3E2RA 4GXMA 3BAXA 1M3UA 3GDBA 4CN6A 4IGHA 2VGFA 4YXGA 3WBXA 1GVIA 2ZX8A 4E8GA 2GQ9A 4YLWA 1F07A 2IQDA 2NQZA 5CZTA 2GVGA 1JDCA 3CL6A 1DIOA 1A5KC 5LNVA 4AUBA 2WK2A 4FSAA 3G0UA 2O56A 2YIHA 3CAQA 4DYJA 2NQLA 1JRCA 1HXJA 2RGMA 2W91A 2WNZA 1TMLA 3AWNA 2PC4A 4C6CA 3AMCA 2XFYA 4K8EA 4HP5A 1S38A 8TIMA 4IH3A 3CTTA 1Q8AA 2IMRA 4P5UA 3WDHA 1FKRA 4K38A 1U2YA 3M4HA 3V35A 3TCEA 3DFPA 4Q8PA 4EANA 1GOKA 2QDGA 1UR2A 1MRAA 1SFTA 4A3RA 2Y78A 3M7SA 2ISFA 3GB6A 1R9XA 1I2OA 2D73A 3FOKA 1H0IA 3W76A 4U10A 4WKFA 4ES4A 3PC0A 1Q6LA 3AIVA 1WAUA 4ZPWR 1XHGA 3CUGA 1XQKA 1IEWA 2VOTA 4IGNA 5LIYX 3M5VA 1V3HA 3UZYA 2YR1A 1XRTA 5CH9A 4GCXA 3EX1A 3HZ3A 3AXXA 3GAYA 3E38A 3I7SA 1UWSA 3MDYB 3MANA 3ZR6A 4HVXA 1W54A 2PBCA 4B5UA 3SO7A 3ZIZA 4K68A 2R94A 4D1JA 2HBXA 5KZ6A 5A6LA 3CO8A 3UG5A 4FF5A 3M6DA 5XINA 2DSKA 4FK9A 1FD9A 3H54A 1PZ3A 3II1A 4L64A 4A4AA 4RNHA 1BD0A 3VMNA 1XF0A 3UY7A 1FCUA 3GU2A 4IOTA 2H6RA 5DIVA 5CZSA 5F2LA 3DESA 2G8ZA 3UWWA 2YXGA 3BAYA 4Y96A 1TELA 2H9AA 2WSPA 1PWMA 3TMQA 3S8HA 1I2NA 3HG4A 3OQEA 4PMXA 1E6SM 4ZTYA 2PDWA 4WOZA 4HNNA 5EMJA 3W71A 3WK2A 3N2XA 4B2DA 3OTRA 3KABA 2ZUMA 1UR3M 5MHBA 2X42A 5AHEA 4L6DA 3TCZA 3NRKA 4AIBA 2C15A 3UQNA 2NUXA 3MB9A 1A5CA 3I6EA 1BKHA 1JZ8A 5HOSA 3O5FA 4HMCA 5HUOA 4KH2A 2VD8A 1EGZA 3C52A 5FAGA 1QASA 3SCQA 3N13A 3GHUA 3WK3A 2OWXA 1UWTA 2P0OA 3L4YA 2BY0A 5CC5A 1S2CA 3NQGA 2P1FA 3QQ1A 5I2UA 4XB3A 4XQ6A 1XIEA 1RD6A 2E28A 2XWDA 4XAGA 1K7EA 3ZLHA 1SW0A 3CTLA 4C6BA 4GQQA 2I16A 1SR0A 3L4TA 7PTDA 3S1WA 4XAZA 1UZDA 1OM0A 3W00A 1Z89A 2E4TA 2YDRA 4ZMGA 1EO7A 3BAJA 3AYVA 2WZIA 5CGTA 3WD1A 2X30A 3H22A 3GTYX 3TAKA 5E70A 3BANA 5EBUA 3OLDA 3QFEA 2NWRA 4MNJA 3MYOA 1JYXA 2XZ9A 5LHFA 4GISA 2D0GA 3AMKA 1Q45A 2A3LA 4HK7A 5EFFA 2WMJA 1FWJC 2Z1KA 3DN5A 3FJLA 5JBFA 3LHZA 4QRNA 1CGWA 1G1YA 1US0A 3EIPA 4KRZA 4DJEC 3O1NA 1ITXA 1ZBCA 3VGGA 3ZT6A 1FH7A 1P1MA 4MFDA 3COTA 4XO6A 3PZOA 3S83A 3T8LA 3B8IA 1NDZA 5BXJA 1AFSA 1TE1A 4JCMA 3TONA 3LGEA 1TJ1A 4FNRA 4F4RA 3CUIA 5LNWA 3KP1A 1VFSA 2OSYA 5C9ZA 3E2VA 3KVJA 1GTHA 4J3VA 2AOSA 1EOMA 1YNQA 1YX1A 5LIWX 3VGBA 3A9BA 3QXBA 3W0KA 4JTIA 4O52A 4HHPA 1GVSA 1U22A 2A0NA 1XFCA 1JUKA 4HMNA 3ECQA 2VX4A 4KWUA 2PUZA 1TIMA 2LGOA 5DN1A 4UBPC 3H6OA 1I45A 3W29A 4Y6GA 4YTTA 2ESCA 1UPPA 2X1TA 4Z1CA 2PDUA 1O5QA 3CPRA 1W1IE 1I2QA 3QV6A 4I3GA 4I9TA 3VIFA 3UJEA 1B31A 3W01A 3W1TA 3O6CA 4S3GA 5AN7A 4F0LA 3VNJA 1GYMA 5MKGA 4JFKA 3N2OA 2OOGA 1OQFA 2I9EA 3E2SA 4RR4A 3MCOA 1F05A 3OODA 1PCKA 1VJZA 1VLIA 2Z00A 4AMCA 2A3CA 4GYPA 4BI6A 4F2TA 3OZMA 1D7IA 2HE8A 3S1GA 5ECVA 1E5NA 3LBOA 3ALFA 4XX6A 3HMJG 3A47A 1XLEA 4E4PA 1TWWA 4FIRA 2VR2A 5EMUA 3WNLA 4B15A 2J4GA 1NQ6A 1PX3A 2X0YA 2Y89A 2PRLA 4I9JA 3S5ZA 1W3LA 4YCPA 4C65A 5A6BA 5I03A 4OBRA 1CXHA 3BXWA 4LQ1A 4INFA 2Y8VA 4PB4A 3RPDA 4YCOA 3CZ8A 1G9HA 1V4YA 3ZJ7A 1IXNA 1SZGA 4HU0A 4EX4A 2QAPA 2PLCA 2PBOA 2XGIA 2OYKA 1J2WA 4GQBA 3N34A 2YFOA 1ZGDA 3QTGA 1M41A 3USZA 1XXXA 3HGOA 5AYZA 1WAWA 2QCHA 3GIQA 3L21A 3DGBA 1UOZA 1BSIA 3DECA 2QPXA 1M7OA 4MZ8A 3TR9A 1UOKA 3ZT7A 1Y8BA 1BXNA 2NT1A 3CASA 1U33A 3AXMA 1UR8A 5EYWA 2DJXA 3SJNA 4AZCB 4IUOA 4RE4A 2J75A 4US5D 3VNYA 4L1GA 2F38A 5CAHA 2BVYA 5F1VA 4DZIA 1J0HA 1PE1A 3GTNA 3T0BA 5BOOA 3BURA 3M0XA 5IFPA 4X2RA 3C2RA 4UTMA 4ODMA 1AA1B 2VQUA 1X97A 3K8KA 3STCA 5L9FA 4UQDA 4P8UA 1DP0A 2HV5A 4RL3A 2D3NA 1J79A 1LL7A 5FJPA 4GXWA 1SQ7A 1VRXA 1W1ZA 3C61A 1F3XA 1WOBA 2IPFA 3ARZA 1K8XA 1B90A 2GGEA 5FJUA 2XUCA 4JQAA 2IPWA 3AYTA 4Y9AA 1Y0EA 1EZWA 1QNVA 1DHPA 3EWDA 4JQ3A 1H1YA 4PMQA 3VA8A 1JQXA 3WN6A 4ZZ9A 4MF4A 3VVGA 3R58A 2Q01A 3KACA 1KCKA 3F2CA 1TREA 4ZPTR 1P5BA 3QPZA 3VIIA 4TX9A 4H2HA 2A6LA 2EPNA 3M9YA 1EF3A 3UR7A 4DNHA 3OEXA 2YCIX 3NPWA 4IIFA 5AVHA 5CPMA 1YDOA 5BW6A 3F03K 1XDJA 1K1DA 3XINA 2DG9A 5C0QA 3QHOA 4H7ZA 3DZ1A 2AGKA 4DRMA 4HOWA 1YXCA 3BQ5A 5PTDA 3PY2A 2LPVA 3G0XA 2GOUA 4S2BA 1JFXA 4O12A 1HJQA 4XZ9A 1MW3A 1XLKA 3U7BA 5HT1A 4E8CA 2V5JA 1W56A 3SBFA 2NUYA 5AY7A 1AG1O 2XP5A 2C18A 1FFRA 1TJ2A 3D47A 1F7BA 3W7KA 2YA2A 4MLRA 4JEQA 4DO4A 3QY8A 2E8ZA 4OKDA 3GTIA 1RD5A 4IT6A 2G95A 3M43A 4AFYA 3QPYA 1ML1A 2ZADA 3VD7A 1BSLA 4H6EA 3U0HA 3UPMA 5AYYA 1B3YA 4MWAB 5G1MA 3HM7A 3IJ6A 1YLVA 3VNZA 1UR0A 2YGYA 1XV8A 4H9MA 3W7QA 3EDJA 2WMGA 4W88A 2GFTA 2F6KA 1ISWA 2PCEA 3G2GA 4E5TA 1KTCA 4I7VA 1RQEA 3O63A 3TSMA 3PB0A 4J40A 2E6YA 1EF2A 3UR5A 3ZXWA 2ZR6A 4BI7A 4AXNA 3RLUA 4BQ2A 2Y61A 1XSIA 3TTQA 1Z8AA 3HG5A 3VOCA 1F3TA 4REQA 4UMAA 5FSDC 4BI5A 4ODPA 3O5QA 4NL1A 2IPJA 3TC3A 3QLLA 2OSWA 2V5BA 4IJRA 2BVWA 1EH9A 3JZUA 5HR7A 3SY8A 2WHKA 2DZUA 2XG9A 2GUUA 3EYPA 2CHNA 2Q09A 1W3IA 2O9TA 3KS5A 3ZJKA 3P81A 1QBBA 1UD2A 4IJCA 1C29A 2VZVA 4DRJA 2UV8G 1RBOB 1QPNA 3FJ4A 1S5WA 1KO0A 3NURA 3VYLA 4D6GA 3WMSA 1BHGA 4QQUA 2OEKA 5JQ9A 4PSRA 2RUDA 3WLKX 4YTUA 3A9IA 3H24A 1R2RA 2PD9A 1ADOA 3Q65A 4ZODA 1H09A 3O9NA 4GPNA 1FCQA 2NUWA 1OGBA 4UTFA 2HROA 3OGVA 2ZVIA 3GDLA 3H7UA 3NFUA 2I7GA 2R1MA 2VM8A 2VCDA 3FEQA 4U86A 3S2JA 5G2WA 3SRKA 5AYBA 1AD1A 1WOAA 2DQWA 3SADA 3Q94A 1BGAA 1D8WA 4DO6A 2LKNA 2TPSA 2BXYA 3I6RA 3EX4A 1GGOA 1R3YA 1EGMA 4XAFA 3TW9A 2FVMA 4LYQA 2R8WA 4DJDC 4JFUA 2EQDA 3ITXA 1A47A 4QE5A 2NQ9A 4IZGA 3MMUA 3VMPA 3TXZA 3KP0A 2J9XA 3TP4A 3LDVA 4MLJA 4MMWA 1BRLB 1O6IA 6XIMA 3ENLA 3W72A 2E5DA 2ICSA 5HQMA 4JIIX 1RCQA 1VPYA 5HWNA 3V5FA 2W63A 3QGKC 4ZCWA 2FKEA 3OLEA 3IK2A 4CD4A 4NU7A 4GBDA 3I3EA 1VZWA 5ABEA 5CXPA 5FEXA 4FALA 5A6AA 2GVEA 3WBEA 3DYMA 3MMTA 2BXZA 1EX1A 2JKEA 4LU0A 1J6YA 1J10A 2AAAA 2AQOA 4PCPA 3BJFA 1TWIA 5BMWA 3WFZA 4UTWA 3AHZA 3BUVA 5HJLA 4XD4A 1XRVA 1K4HA 3GU9A 4G7FA 3F1QA 2UY2A 5TF0A 1ONEA 3VXGA 1L2UA 3FN9A 3CGNA 2GLKA 1OF8A 3L0GA 2ISVA 2WHJA 1E40A 2WQDA 1K02A 3CUHA 5CGMA 3KADA 1LOSA 2WYSA 3IJQA 3KLKA 1FKIA 3T2OA 5DXYA 4OE7A 6A3HA 1MNSA 1XBXA 3RNDA 4GY0A 1S2TA 3EXTA 1QI4A 1T11A 3TLQA 1SPQA 4RW5A 3KCLA 3EWYA 5CPLA 4GMEA 3C0LA 2PMQA 4HPJA 1IZCA 4FNUA 1PS9A 3IGSA 4LJ3A 3F7JA 3SCPA 3VZXA 4XAPA 2R1KA 1EC9A 1R3WA 4WF7A 2BTMA 1JNTA 3UI5A 2O55A 3TROA 2Y85A 1UB3A 3R89A 1OGSA 4I5XA 3T6CA 3WY1A 3FKKA 3UCQA 2ZXBA 4U5KA 3UJRA 5D2TA 4IX2A 3UWUA 3KAGA 4HA1A 4ASTA 3GW0A 4HNVA 1ZY9A 4HMEA 4CD7A 3LQGA 5M1TA 3E1F1 2OSXA 3WD2A 3A6OA 1TPEA 3TW6A 4JTUA 4NXSA 2DY3A 3IUDA 1E6QM 2GWNA 1W9DM 2EGZA 1VIWA 4FPSA 3S2MA 4J9JA 2EF9A 4PC8A 1UMYA 1X98A 3E74A 4DUXA 1EX5A 4G50A 4DX3A 4Q4SA 1QFEA 3SFWA 4AZCA 1T7LA 1EFZA 1XKYA 4LC6A 3KLLA 1IGWA 3BZJA 4GG9A 2QF8A 4O1FA 5BRQA 3NQVA 4TIMA 3LCLA 4OFCA 4UZSA 1GOMA 3AU6A 3MP3A 1XLDA 2C91A 3GTXA 4ODLA 1Q66A 4Z0JA 2J9YA 5G1TA 4M3PA 2A21A 4GUGA 4BQ3A 3R5EA 4HNCA 1RJQA 1HGWA 2HE5A 4M7SA 4RPPA 2VXNA 5EA9A 1UIOA 3CZEA 1QHPA 1F40A 4W5UA 1UR4A 1XLFA 2OT0A 4FP1A 2VC7A 3B4YA 1OFDA 3HF3A 3OYXA 1DWIM 3URBA 3PJTA 5LHEA 3E0VA 2FPVA 1X6NA 3R8GA 3B8UA 3FAPA 4TTGA 2W79A 3BAKA 1ZBVA 4IQJA 1JYNA 1SW3A 2ZXAA 4I6VA 4GH1A 5D4YA 4F0MA 4UFJA 3POHA 4PRRA 1CYGA 1VQTA 4JAWA 1V77A 3MT1A 2C6QA 2PTDA 2X0SA 2YJQA 3OVGA 3R6IA 4HK6A 1NWUA 2WKGA 4LAZA 2A3HA 3N9KA 3C0SA 3DHDA 4LY8A 4LAWA 1A5LC 2WHMA 2BHUA 2X1IA 2VWSA 2PV2A 4FX7A 1P48A 3AISA 2Y8UA 3O07A 4A2SA 1JVNA 4DLFA 4AVFA 4A05A 1X38A 2V67A 3LERA 4A3HA 1EC7A 4NYUA 3EEGA 4GI9A 1TTJA 4AC7C 4AB4A 4ZOBA 1JZ3A 2OU4A 2REQB 3SCNA 1GQLA 1M6JA 4MNKA 1W1VA 2IF4A 3IGHX 4C6EA 4QIBA 3W82A 2WZMA 1TR9A 4QAIA 2E5CA 3MZ2A 3VDCA 1IEXA 1JRBA 1RY8A 1E4NA 1EBGA 1KCXA 2CC0A 3LBCA 2O9RA 1G4PA 3H23A 4AY1A 3NG3A 1CT5A 4OZOA 2MPHA 4NT0A 4IF2A 4PTDA 1DORA 2EPHA 4DWSA 3PWAA 4FEZA 4EPKA 3C2EA 4G7EB 4LAMA 5AHMA 3RR4A 3KL5A 2NX9A 4MWAA 3EOOA 4H19A 4WGXA 3LTSA 1NDWA 2ACSA 2Q6ZA 1YQ2A 3OU8A 4WY0B 1CXKA 5E5CA 3U9IA 3B9AA 5F4XA 3B0XA 1EQCA 4DBEA 1D3HA 3ARQA 3IKDA 1XJBA 3UWQA 1YPIA 4QJ5B 3EPMA 5DX7A 3I65A 1KWGA 3G8RA 3U5UA 5A69A 1B2YA 3BLDA 3KS6A 3PAJA 1U5JA 4ROQA 4NRRA 1RQHA 2ZE3A 1GWJA 4IIHA 1EXBA 3VIMA 2FTPA 3INPA 1OD0A 1UKPA 2A3BA 5BOEA 1GOWA 4IP4A 4DBDA 2BB0A 2F2KA 1MW1A 1ZHAA 2W27A 3QYSA 2VELA 3UZWA 3HJZA 3N9RA 1F8AB 1AK5A 3BLPX 1QPLA 5BYWA 4ODNA 3QZAA 3I7RA 1BFNA 1TPB1 1TFVA 2VQTA 1B6CA 4H1ZA 4LAUA 3SQSA 3O0KA 1EOKA 4W5ZA 4NAFB 5H1WA 4NNCA 1XPGA 4IIBA 1PIGA 4L5ZA 1UR9A 3IJLA 3REQB 4A21A 3GR7A 3WNKA 1A5AA 3NQBA 4V1XA 3QY7A 1A53A 5GPRA 3H2CA 1UMLA 2QPUA 3IIXA 4MUPA 4O0ZA 3OOQA 4DHGA 3SI9A 4WKAA 2XH4A 2CLMA 5CPQA 3H2MA 4UQ9A 4C5ZA 4H3DA 1UWIA 3TMLA 3GH4A 4QTGA 2PSNA 2YCKX 3HPSA 2G3NA 4O28A 2FZ8A 1YW5A 1M1BA 2RGLA 2FVLA 1OCBA 1OYBA 3LNMA 1IEQA 2WXDM 2YFNA 4NZ4A 3Q2DA 1E1FA 3NWRA 4YVXA 4XG1A 2DZWA 3O5GA 3UJFA 3CS2A 2XDFA 5DY3A 1OYAA 4ZQNA 3S2NA 1ZK6A 4Y7EA 3P82A 4LAKA 1LQ2A 4A8IA 1VCVA 3C8NA 3NL5A 2HWGA 1QOQA 3FGCB 3EZ4A 2Z25A 2INFA 4HIBA 2OPJA 1TPH1 5TIMA 2RJHA 2ETNA 1EJUC 4P61A 4KETA 4K3ZA 1KTNA 1ZB5A 1TWZA 2DZTA 3UWYA 1VD6A 2IQTA 1FHLA 3KEHA 1R3QA 3IHZA 1HIZA 2P0IA 2AWGA 3FNDA 4JBRA 1AQFA 1E71M 4WY0F 1QO2A 2VDHA 5BZAA 3CB3A 4UQEA 1FTXA 4LOCA 3AROA 1PKMA 3HGSA 2Y62A 1I6NA 2X09A 4YPJA 1KTBA 1TPVA 3N1AA 3NQ7A 2Y88A 1A5OC 4W9TA 1JCXA 5FIPA 1NIUA 1LTDA 4ODRA 1S2UA 3BCJA 4PMYA 1TTIA 3WLJA 3M0VA 3T05A 3NVDA 2GGGA 3ZOAA 3WF1A 4G1KA 3DFTA 3HV9A 3QTPA 3H4XA 2WKJA 3IS4A 2QUNA 5B7YA 1TZ7A 3WLLA 1V7YA 4AU0A 4DRHA 3SQLA 1SFSA 3NM1A 3KCJA 1AQHA 1KKOA 3AALA 3OLIA 1TUFA 1ITCA 1TMHA 1EO5A 3GWQA 3IIZA 1QCWA 3L4ZA 3ZJ8A 1JQVA 3DCPA 1H1NA 2Y2WA 1EHAA 2XVGA 3APYA 1MWOA 1PB0A 3S2LA 4WSKA 2ZKMX 3AZRA 4JR5A 4MJMA 4AY8A 1O95A 1LQAA 1P0BA 1PX8A 4HZ6A 2BXVA 3LI0A 1O5KA 4DRIA 3IIOA 1IT7A 2PWFA 4ML4A 3P60A 4ADTA 2M08A 1TO3A 1ZSXA 3BOXA 3H70A 1OVDA 5G4EA 2P5NA 3HGRA 2DZPA 3LCWA 3W7PA 3RMJA 3LS9A 2V2CA 1ME9A 3VX1A 2MF9A 5MF5A 1WDDA 7REQB 5M03A 2EKCA 3NA8A 3UJ2A 1GJWA 1R7OA 4C7FA 3VD9A 5HWMA 4H6RA 2XPAA 4E0CA 3FXYA 4ZQPA 2X1RA 4UFLA 2DJLA 3WLTA 1AUSL 1FKWA 1LBLA 3L4VA 4UOQA 2PDHA 1KXVA 5BU6A 1B3OA 2PDGA 4FXSA 5EGRA 1H50A 4IG2B 2V81A 2PU0A 1UQYA 2VHLA 1KCLA 4O1AA 4KPLA 1E0XA 4Z0SA 2NXHA 2ZFAA 2Z6IA 5EPDA 4AWEA 4K36A 5C8BB 4EAMA 3P5ZA 1HXVA 7XIMA 2GL5A 3FS2A 3GVGA 4W8AA 5DEZA 4Y8EA 3TA6A 4K6AA 4XBJA 4FB7A 1LRTA 3GU1A 4HU8A 2WVUA 1T8QA 2ZUVA 3CXOA 3CAKA 3EA1A 3H26A 3DX5A 4IPJA 1QR7A 3CPGA 4JKLA 1EJXC 2PV1A 4FNPA 3R2GA 4H41A 3NQFA 5AC6A 1A4LA 2V68A 5A6BD 3ITGA 4CN4A 1VIZA 1Q7ZA 2VX5A 1OABA 3LHVA 3NQ8A 1E6RA 2GQ8A 3IACA 3MA8A 1BF6A 2HRWA 4NVTA 1VBJA 1D2KA 2BOGX 1SFLA 3MDWA 4LUTB 2VUYA 1MZRA 1YBQB 3GK0A 3NGFA 4E2OA 5IM51 3W28A 3CMGA 4C6OA 1RBLA 1K8YA 1H7XA 3KOYA 3L23A 1FKJA 1RCXB 4TYOA 3WENA 3PBUA 3TC5A 3QGAC 1SR9A 4X2PA 2WKLA 1MUWA 4C91A 5K9CA 4ZSUA 4C6KA 1TVPA 5CZ0A 2J7DA 1ZNNA 4RZ6A 4AXKA 2VEPA 1J5SA 3HMCA 3BSHA 3EKLA 1Q6GA 1UD4A 4M6PA 4UFMA 2MLZA 2VRJA 1HQTA 3C3UA 3E9AA 1JDDA 3DDMA 2I57A 3EWBX 3SCRA 4O4VA 4QG9A 3RG6A 3UXIA 4HPGA 1RJRA 3C2FA 3R10A 3NVTA 1R38A 1DJYA 1TJPA 3C8FA 4XUYA 1PTGA 4G7EA 4QBXA 1WKFA 1Q6CA 5D2YA 3QN3A 3K4WA 5FF0A 4H9TA 1Q6UA 3T9PA 4ADUA 2D0HA 4UOJA 4ZOCA 3T8QA 4HU3A 4WY0A 1TPDA 2I14A 2JEPA 3AXHA 3GDTA 5I3GA 3FAXA 4GKLA 1WUEA 1MFUA 4E2VA 5D32A 4GNJA 3G1DA 4IQ2A 4RE3A 1R47A 3MUAA 2ATMA 4UMBA 3QKEA 2XPKA 2XIBA 3PBYA 2PC8A 9CGTA 4HU4A 4PCFA 3VKBA 1T96A 3ISIX 1JZ5A 1DJIA 4XBSA 3FDKA 1OC5A 4TX0A 1TZ9A 3DFOA 2VGIA 1GVFA 4CU6A 4MJZA 3LRKA 3VIJA 5I02A 3NL3A 1TJRA 1PBKA 3MSDA 4GUIA 1UCWA 1YE6A 2JEQA 3H8AA 4YL2A 1QRQA 3WDPP 1IT8A 5I09A 3QQWA 1V6WA 3K46A 4KGLA 3REQA 5D04C 3EMCA 3KAOA 1SZFA 3YPIA 5F4WA 2QDHA 1FKHA 3WJZA 2OO0A 3GO2A 3SN0A 4UOZA 2WV8A 2F21A 4KCWA 3S42A 5B7ZA 3GC2A 3N2BA 5G2HA 5DY2A 1OINA 2E77A 2CEQA 3E6EA 4JL2A 4Q8VA 2VJXA 5CPOA 2QCFA 4GBUA 3LB0A 3IV3A 1W5OA 5D9MA 1T5AA 3VAVA 3S3GA 1E43A 5EMLA 2Y5JA 1XBZA 4GQRA 1HF6A 4JYSA 2UZ9A 2ZZ3A 3RLGA 3W1NA 2BOEX 5I06A 4H9XA 4JTDA 4XSMA 5LA1A 4BQ4A 2BP1A 3V0TA 3M0MA 4LW7A 3UG4A 3ARTA 2V3EA 4ATWA 2PF0A 3KRSA 5FD0A 5DCDA 3SURA 2YL9A 1E44A 1O5RA 3CK5A 1K9DA 1AMKA 1J18A 3UCCA 2WMKA 2HJPA 4L72B 1FWAC 1XYMA 2Y7FA 4JFLA 3W7LA 1GNXA 1NAL1 3IJ8A 1CLXA 1W17A 1NH6A 3H21A 4EF8A 3QHNA 3WKZA 8XIAA 2OX1A 4MNMA 4MVAA 5DIUA 3OJGA 2HNHA 1V3LA 4GJIA 1ZCNA 3WQOA 1CB2A 1WQ5A 3RLHA 4Q8OA 1TRIA 3B9NA 3A24A 3HQPA 4XD6A 4PTXA 1NWSA 1N2VA 2X05A 1WDQA 3PHAA 4FLSA 3UU0A 1LF1A 2CXGA 1E6NA 4KKXA 4CNSA 3VZYA 3T4CA 1WB0A 1HVQA 1P6CA 2A2IA 3IVTA 3PBVA 4RK8A 2A5HA 3TOYA 5M3WA 4L1WA 2W5FA 2R6OA 3N17A 2VT0A 2DPEA 2PI6A 5HQEA 4GRSA 2EG7A 3L7RA 2IW0A 4R5EA 2XP8A 3G1HA 3HIJA 1GTEA 3QV9A 3W53A 1O12A 3CMFA 2DZSA 1DXIA 3VUPA 1AJ2A 3C2OA 3O05A 4BF8A 1FXQA 2CLKA 4HYRA 1ONXA 3BG3A 3KHJA 3BMBA 1TCMA 4LTSA 3VD5A 5CC6A 2J47A 1RBAA 3PNZA 1DXEA 4CLMA 1I1WA 2BFGA 5IFTA 4DH0A 1SSGA 4BHYA 3O15A 3D3AA 1W0MA 1WKDA 5IHRA 3EB2A 1R30A 3AUJA 4BF7A 2C1GA 2ZA3A 3HPFA 1I8JA 3UR2A 2NQ5A 3RILA 3FK4A 3AICA 3M5ZA 5AYIA 1DOSA 4DRQA 4AZ7A 2VYOA 3LHUA 2DDXA 1E55A 3A5VA 3IJ9A 5F7UA 2ITKA 4DUVA 5DBTA 3LGGA 2ZX5A 3O06A 1ROUA 3UNTA 4G8TA 4O17A 3UYIA 1JD7A 4JEJA 4DB7A 1ZBWA 5D33A 8A3HA 4M6UA 4NUWA 4G56A 1P1XA 3KCEA 1HT6A 3G22A 4DBSA 1OFQA 3VILA 5H2ZA 1DBTA 1UKSA 3QLDA 1ISZA 1E73M 2WO5A 2F61A 1R2TA 1MDLA 4IG2A 1Y5XA 5KTLA 1XBVA 1EWDA 1CGVA 4PMZA 1H7NA 3N6JA 4K8HA 4CNNA 1L2QA 3EOLA 1X39A 4JIRA 4H8VA 1F9CA 4FLRA 3RF9A 2CLPA 3ATYA 4LNYA 2A3AA 4QDPA 5A2CA 4RXFA 4YHGA 3W6MA 4X0NA 4DIPA 4LAXA 1XCFA 3BGAA 3LV5A 4GYPC 4LCQA 3VNDA 1XIBA 3K4DA 4RW3A 4PMNA 1OYCA 1UASA 2WCGA 1XRSA 3LENA 3VKAA 3SIZA 2YCEA 5HPCA 2FZNA 4O50A 4H8HA 2VFHA 4CNUA 1JXJA 3RCYA 1QBAA 4IT1A 1KWKA 2YBUA 1T8XA 3WNOA 1GHRA 1YADA 2BGSA 3EX2A 4JYEA 3RFWA 3LK6A 4Q7BA 3EPNA 3W2NA 3AS0A 4FR1A 3FVMA 1G7UA 1ESWA 1QDSA 3U8GA 3N18A 1EPXA 2VEMA 3N3MA 1DV7A 5FJJA 4Y90A 4IL0A 4LUTA 4QFUA 4YTRA 1H7PA 5FL1A 3L5MA 3E02A 4IFRA 2GUBA 5KINA 5LIXX 3NDZA 2QW5A 4WK9A 1VEPA 2J66A 2P76A 1IQ8A 2XP7A 3N25A 7TAAA 4EOUA 2JE8A 2ZZ7A 3NZGA 1J5TA 1VFTA 4UR9A 3ZLFA 3RX4A 2DSVA 3OVPA 2XGZA 3WFLA 2ZA2A 5DMNA 4PTMA 4HN8A 1FQ0A 3V5OA 1JZ6A 4ECLA 5IXEA 4V33A 4RDWA 3CHDA 1GVYA 3QGVA 4LBSA 3B9DA 3V3WA 5EBAA 2AMGA 5HMDA 1S5MA 3LSBA 5FL0A 3QV7A 4TR9A 3GZAA 3U3HA 1IT0A 2J88A 1ZFJA 1XD0A 2PTYA 1H63A 2I17A 1A3XA 2ZDSA 3T44A 3UVIA 4DUWA 4GC3A 5C2CA 1HKJA 4RDVA 2BSLA 2YLLA 4KFPA 4DBWA 3F2DA 3BMXA 3TQPA 3EX3A 3TAOA 4GJJA 5M5DA 1PAMA 3FSTA 3QC0A 2WMIA 3TDBA 3L5AA 2D23A 2YL5A 3QEZA 1LDCA 1M7PA 2Z1XA 3O5IA 3L0KA 4D6HA 4Z1YA 3WDRA 2R91A 4LX4A 4IQEA 1UWRA 3UXLA 4EXBA 3MDUA 4XWUA 3ZVHA 3LD5A 5LSMA 4HPXA 1SW7A 2E3ZA 4MM1A 5BXRA 3W75A 3F4NA 3ORWA 3R0UA 4W7WA 1R5YA 2CITA 3E49A 4YS1A 3CIXA 5EMKA 3BPWA 1J96A 2DEPA 4JFIA 1LP6A 2ZUUA 4CNPA 2IQ0A 2PF8A 3BAIA 4JHOA 3W27A 1XIIA 2E5BA 1NP2A 3GPKA 3LV6A 4JTSA 1LLWA 4AF0B 5GQBA 3GAKA 3KTCA 3NOEA 3W07A 2V6AA 4US5A 2PDIA 2EPKX 1BPLB 1V08A 4MSSA 1A5BA 3PUGA 5D9NA 4GINA 3PR2A 3CV7A 2FYMA 2E09A 1OX4B 4WR3A 3K8MA 3MWCA 2ZR5A 3HPXA 4YYFA 1FFQA 4R0XA 1JZ7A 4MKNA 3I4KA 1YPFA 4GVIA 3UNDA 3ANYA 1MO0A 3MU7A 4MWAD 4Z2JA 4URIA 2NSOA 1YMYA 2FTWA 5IDZA 3GNNA 1GQKA 3AHXA 2BHYA 3AI0A 1I9CB 3LUTA 1LZOA 1FCVA 3MPGA 4AD0A 1Q13A 4D6DA 4G2DA 4OUEA 2CZEA 1M53A 5EU9A 4P7NA 2XP9A 1H7WA 2Y4SA 4GXPA 1FP8A 5U7SA 2OODA 3L4WA 1FKXA 2JKPA 2NZLA 2GGJA 2CLOA 2J24A 5T9CE 3MKCA 3O5MA 3WJYA 5GPGA 2QUTA 5LA2A 1XGZA 3BW3A 1WE5A 1NSJA 3BJSA 1BVZA 4DRNA 2ZX9A 4GVHA 3N29A 3TJXA 4PUKA 4GABA 4DWDA 3CV2A 4Q32A 2VWTA 4BS0A 1UC5A 5AHFA 4CVUA 4YNGA 1E1CB 4B9ZA 1JGMA 1Y5VA 3RAOA 1VJSA 3CQ0A 2X2GA 5A95A 1B3WA 1SJAA 1M7JA 3U4FA 3KDOA 2JFEX 3M47A 3RX3A 1H2JA 7CGTA 4ZQCA 4DXKA 1EJRC 2ZX6A 1HNYA 2YDSA 3C3NA 3GTHA 2OZ3A 5CGQA 3JR2A 1KM2A 5TAOA 3DOPA 5FA5A 4AHOA 2F2DA 1WX0A 3N6HA 2PGWA 4TV5A 2E8YA 8RUCA 4AZ6A 5DITA 2WBGA 3VMOA 4IM4A 1RY0A 2OYMA 1NY1A 2QCDB 3SJ3A 4OHQA 1S5NA 1XW8A 2EHHA 2W67A 3E0IA 1FDJA 1VFOA 2VX6A 3PZTA 2OCZA 4KCUA 2C14A 4K7YA 1J11A 1RJPA 4D9PA 3ARRA 2ODOA 1LBMA 1M04A 1R3VA 2A79A 3FHAA 2J7FA 4MDPA 4TX6A 3CLWA 2X7VA 3M5YA 5HULA 4AEFA 5FAJA 4HNOA 4XBKA 3AS3A 1P0EA 1WDPA 5CSSA 1GK8A 3FIGA 4AW7A 1ZALA 3C4UA 4FXJA 4K1WA 3BG9A 2OELA 2QJIA 2V3DA 1EKOA 1XG4A 1EJWC 2HTMA 3FCPA 2OKTA 4J3XA 3WO8A 2CIPA 4HBEA 4CN1A 1G4TA 2J9ZA 3LCFA 1RSCA 1KLYA 3W1UA 3NUKA 2D2OA 3M6YA 3SCUA 1W91A 4DJFD 4MAVA 2DFAA 5XIMA 2TMDA 5M17A 1PUDA 3OYZA 4MIMA 3O5PA 2PAJA 1EWEA 4UTWC 5D75A 2CBVA 3CH0A 2ZIDA 1KM4A 4QJ3B 3HB9A 3W1AA 5DCBA 3PAOA 4QS5A 4BQ5A 3FX4A 1QJWA 3NAVA 4IMEA 1CXFA 2PZNA 1TG7A 3DYPA 5D8ZA 5FEPA 5D2VA 3W9ZA 5K7JA 3GG0A 1U1JA 1FRBA 4PN2A 2ZQSA 3VIOA 3P14A 1ZQ5A 4DPQA 1UW9A 1GW1A 1BYDA 1HZYA 4GZJA 5A2BA 1TQXA 2PE4A 1YATA 2ZICA 3R13A 2TSYA 4A35A 1AQ0A 1A0EA 3VK5A 3DXIA 1JPIA 3WJWA 1AW5A 3GIYA 1ZU8A 4QISA 5BXTA 4HNTA 3IV8A 2RFGA 3QVQA 2Q8XA 3FY1A 1LROA 3N6QA 2DQXA 2DVTA 2ZQTA 2O9OA 1TPC1 3AHVA 4P8XA 5IRPA 5GNZA 4MGVA 3W1XA 1K70A 1XH2A 3PM6A 1Q6RA 1LWJA 1R7AA 2FQIA 1S5VA 4V1YA 3H2NA 1YYAA 1NF7A 2WJFA 3MC5A 4KW2A 3GRIA 3G1AA 5ABGA 4Q7NA 1QT1A 3SCOA 4NI8A 4H7CA 4JOMA 4E2DA 3LCXA 1KFEA 1X6UA 4DI9A 2ANUA 2WB5A 4XUGA 2MLXA 4PBGA 1V0LA 3KCOA 4JTHA 1US2A 2B0MA 2AL2B 3P80A 2R1NA 1Z41A 3W37A 4NKCA 1DJQA 5J5RA 4TMBA 4O4WA 3WELA 4J28A 5FJTA 3TW7A 1IWBA 4ZO6A 3RUBL 3WQ8A 4DAIA 3HO8A 1S5TA 5KITA 4QE1A 1BG4A 4AYGA 3JVAA 2PN0A 1XC4A 3NR0A 1JG9A 1V3IA 2VR4A 2JKAA 3ABRA 4OQVA 4RZ4A 4D71A 3T1GA 3VOHA 4BCEA 3KW3A 3E0WA 3KVLA 1P0NA 3TN6A 1W8GA 1CGUA 2DT1A 3ZMRA 3KZ7A 3OIHA 3F5LA 3VAWA 2O4QA 2ZBTA 2FTYA 2WSRA 3N73A 3CQJA 1AZ2A 3IARA 1KR1A 3ANVA 3CQIA 2A6NA 2WCSA 3R0DA 1P7TA 3MP4A 4E4FA 5LNUA 3EDDA 4JN8A 5GJMA 1XLHA 4OV9A 5L6UA 1SGJA 3WEZA 3THAA 1J9YA 1L8NA 1DWAM 5C6MA 4WHBA 3UEQA 4N2YA 3BMVA 1IZKA 4J7RA 3JUGA 1UZ4A 1ISXA 3F5JA 3G1VA 3Q45A 3CB8A 4B90A 4QIUA 4GZEA 1A0DA 3DFNA 4RJEA 2CERA 5A8OA 1BWKA 1L6SA 1XSKA 1WV2A 4Q7IA 3QHMA 1A5NC 3ZFHA 1QNOA 2H8ZA 1KM5A 1JCHB 1E1EA 4GIAA 2IPGA 2QUVA 3VABA 5GVJA 4M82A 1JCNA 3GW3A 5M2FX 1XM3A 1XLCA 2GWGA 3GS6A 4EAYA 4J4NA 4ZQRA 2DT3A 1Q4WA 2W66A 1VBRA 4IGSA 4J3TA 2Q8LA 3URQA 4ZO8A 3EBVA 1R86A 1SO3A 1OZMA 4EWJA 1PVNA 4GQ0A 4WVXA 5E6ZA 2PLJA 4XKMA 1DWGM 4M7TA 3F4VA 3WH9A 2YW4A 1A5SA 3FVDA 1E5JA 3NEHA 1WKYA 4ERIA 3AMDA 4LV9A 3TUUA 2F9RA 3VKKA 3THUA 2JK2A 1A49A 4L1XA 1E9LA 1KM3A 3LU2A 3NQEA 3UWZA 3KOZA 5C9UA 1O7AA 1US3A 1H49A 4F3HA 1V93A 2VEGA 3MO4A 1XISA 4HD5A 4IFOA 2J74A 3T2QA 1Z48A 3PZQA 1HL9A 4ITZA 3O5OA 4U3CA 1HP4A 4DWSC 4GHRA 1KFKA 2X1UA 3QSTA 2PV3A 2PDLA 1R6WA 3TJ4A 1DHKA 4MWAC 2UWFA 4WLCA 4D8AA 2JGYA 4YN5A 2AQVA 2C19A 1PIIA 1AJZA 1XI3A 4GYKA 3P7YA 4B4HA 1FKFA 4TUFA 4IFKB 4NI3A 1XUZA 4CGTA 3LEPA 2A3EA 3RRAA 3DG7A 4LWWA 2DUAA 3UXAA 1AW2A 3MHGA 2DG4A 5HNRA 1W1YA 1FKSA 4MG4A 4B9YA 3CHEA 1J8VA 1VYSX 1XLMA 3SUSA 2E9LA 5D9PA 3B0UX 2PDYA 1E4LA 4Z2HA 2QJNA 2GK1B 2HISA 4LS0A 3XISA 1MEWA 2OFNA 3A3XA 4ZENA 2VFGA 4UC5A 3NSXA 1F4AA 4QHRA 1RVGA 1MW0A 3VOJA 1V3KA 4G9PA 1FWDC 2MLYA 4P7OA 5HMSA 4GK8A 5CPTA 3TYUA 4XVDA 3KBSA 3PS7A 1HO1A 2R1LA 3VOIA 1ZPTA 3PTMA 4A8RA 3L65A 5BWFA 2NLIA 3W7GA 4IMDA 1J0YA 3TZNA 1SZRA 1TIWA 2VFFA 3GXMA 4W9PA 4LXFA 3QOKA 1NSGA 2J7BA 2WMHA 2QGYA 3F2BA 1HL2A 4AAJA 1KLZA 4LF1A 4CQCA 4DUOA 1PTAA 4CEXC 1UBPC 4HT3A 4PZVA 5G2IA 1GRJA 1VYRA 3OZYA 2J8FA 3D46A 2FB2A 2IKHA 1REQB 3OG2A 3PWGA 1RA0A 4PR4A 1PPIA 4CNOA 4Z17A 2ZDRA 3SCWA 2ALDA 4UWMA 4J3WA 4ZQMA 1OWQA 1L1PA 3DC0A 3PG8A 2OXNA 3H2OA 3S1XA 3PZMA 1PYMA 5JH2A 1MEIA 3KBJA 1VCGA 4GUHA 2FDSA 4OBSA 3UR8A 2GSJA 3ZT5A 3QR1A 2RDWA 4JGDA 3A21A 4DF1A 4OT7A 4DXXA 1RP9A 1ITUA 4GLEA 1E72M 4RE0A 1RCOB 1ZJBA 2ZRVA 1GQNA 4PUEA 3VUSA 2OFJA 2QGHA 4Q3MA 2RHGA 4RDYA 4ERGA 4ODQA 1FCBA 5FACA 4ACZA 3LTPA 4Z2IA 2VDGA 4MDOA 1CI1A 1NMVA 4PUDA 4JKKA 4D1IA 1PBGA 2GVJA 1Z32X 4RCXA 1H62A 3LHYA 4LUSB 4UTJA 5I07A 1R8LA 2VFDA 5I3FA 3WF3A 1CXEA 1H60A 1XGEA 4MY9A 4QLKA 2PTXA 5TQLA 4O11A 2EPOA 1W5MA 4DPPA 3V5CA 2PP0A 4JNMA 3WLRA 3UP8A 4O54A 1KBIA 1CPUA 5LYRA 2XFWA 4GZ7A 3QSRA 1E15A 3RGCA 2PD5A 4PULA 3W7OA 1VS1A 1FXPA 3GNOA 3WUEA 2WZTA 4DJFC 2NVCA 4GFSA 1SO4A 2ASHA 4IPPA 2VD9A 3VE9A 3VDGA 2C0AA 1QI0A 1ZTVA 1LORA 2E1WA 5C5YA 4HKPA 2CXEA 3E3HA 3CUXA 1I75A 3CV1A 3G1RA 3HV8A 1UKQA 5A6TC 1HN1A 3LLFA 3LZ3A 1EJSC 1D7JA 2ZR4A 4JCLA 3GG1A 4TQTA 1QW7A 2PWGA 1XS2A 4OJYA 3NI6A 1XX1A 1E4MM 4L65A 1KRMA 5CBJA 4W8BA 1GZJA 3ZZ1A 3THQA 3H7VA 3EPOA 1UZHA 3R12A 3ITLA 2Z6JA 1EJVC 3UVAA 4N7QA 1C93A 4DIAA 2SFPA 3GSMA 4YMZA 1TPFA 2G50A 3BWWA 2NLYA 4RZBA 3OIXA 1AQMA 2DZXA 1IWAA 5FEWA 1OFEA 2DVUA 3RYSA 1Q6DA 4HSOA 3G18A 2BVTA 4GX9A 3NZ1A 1U30A 3SQMA 2QCMA 5HJXA 3GQYA 1FWGC 2IUZA 3LM7A 1N8IA 3GXTA 2FJKA 2W0UA 1F8IA 2JBMA 3OQ8A 4R85A 4F0RA 1G7VA 3QY6A 3F4CA 5FCZA 4GUJA 4MYAA 4K7VA 3G3MA 2DSUA 1LRNA 4KT2A 2FMNA 3DBNA 3PBMA 3HU7A 3O5RA 3WQVA 2AL2A 2A85A 1XPYA 1VRDA 3A22A 2F84A 2PDXA 3G1SA 2PP1A 4JIQA 3HPZA 3W7HA 2ABAA 1HJWA 3SSZA 4KWOA 3WQDA 1HL8A 4PFMA 4ODOA 5JU6A 3EDKA 4LAOA 1KR0A 1TE6A 3LHWA 2Y7DA 4PUMA 3B04A 2HXUA 3K8LA 4D6EA 4XD3A 3R0KA 5H8MA 2OGJA 2QCEA 4B5SA 1R3SA 2DU2A 3VD3A 1BVWA 1JI2A 3GXDA 9XIMA 5AECA 4KMQA 2XN2A 2G4FA 4IPNB 3VNIA 2CLHA 3TYBA 3SY5A 2NV2A 4R3UA 1EL3A 4PL1A 4YVVA 2YDQA 3QBUA 3UWVA 5H6HA 2J7GA 3EA2A 4HA3A 5D9OA 1HW6A 4JQ2A 5TNVA 4GCAA 1ZL1A 1LRQA 5HPOA 4I7UA 2FMOA 2BDQA 2ZX7A 3UA4A 1S3TC 4W86A 2Z1VA 4ZR8A 3C2YA 1J4IA 5HA7A 4EWND 5ABFB 3V4BA 2PP3A 4PUUA 1AH3A 1FDZA 4D6FA 3V18A 4HNLA 4H9YA 5KMYA 1FJDA 4XTIA 4A29A 3H4WA 5A6SA 3EDEA 4ZOAA 1V0NA 4DO7A 3M16A 3GR8A 3OLGA 1FWFC 1Q2SA 4QNEA 3HQNA 3WF0A 3U57A 2FB3A 3EEZA 2YCJA 4MWAE 3GC5A 3SIMA 1O68A 2DV0A 3HGJA 3WK1A 1GVRA 3E96A 4A2RA 3KZPA 1QNSA 5I5RA 2I9UA 3C86A 4O53A 4IISA 2P53A 3LYEA 4S3CA 4J4OA 4AX7A 1M5WA 3KXQA 1MZHA 3NQ2A 5IHSA 4O15A 3OOBA 2MNTA 1TZZA 2O0TA 1EYEA 3TSBA 3CGMA 5AB3A 2FH6A 5I6SA 4C02B 3F4WA 3W1QA 3ARUA 4LEQA 1OG0A 1JDEA 4JYFA 2AMXA 2ZRWA 2PDBA 4HSNA 3AZSA 4L61A 4U2ZA 4GO9A 2X0HA 3FKRA 5DRCA 3W3OA 3B8SA 2KI3A 2C71A 3VTRA 5BXSA 5CKSA 3OB8A 2YB1A 5CBBA 4ILSA 3IRDA 3VU2A 1W5PA 3WQGA 1S1RA 4XZMX 2FAPA 4JIHA 2XVNA 4LEFA 2QJHA 3V7PA 4AD2A 3ABXA 1W1TA 4J35A 1ZJIA 3WK0A 1HG3A 1POJA 2XJ7A 1BYBA 3CUZA 3APGA 2BX7A 4F66A 1UUMA 4ERAA 1BLIA 4Q4PA 3V75A 3TYDA 3NJ3A 4U33A 3LPFA 4NZ3A 3W2KA 1YIXA 1S2VA 1EJ7L 1D6OA 1WPCA 5J6EA 2C1IA 4ML9A 3B9EA 1FP9A 4C1NB 2D0FA 2DH3A 2GK1A 3N19B 1ZZMA 4V27A 2NV1A 3U48A 4NQ1A 1E3XA 2I56A 2BG5A 1KA9F 3VDHA 3DFYA 3O5DA 4JIEA 1D7HA 4O0KA 2PDJA 1NJJA 3PZGA 1EB3A 4HBOA 1IR1A 3ZLGA 1EYMA 2DT0A 1BVNP 4H00A 3T0DA 3PNUA 3KAHA 3UJSA 1OY0A 7ODCA 4LGXA 4LUYA 3UG3A 1I4NA 3RJXA 4YVPA 1L9WA 4DN1A 2P10A 2CYGA 4ZFMA 2FZ9A 3GY1A 3SAZA 5HANA 4S3BA 2QMJA 2GJLA 3GYCA 3AMLA 1A7XA 1U1UA 1M7XA 1R3RA 4L56A 3N2TA 4AZ5A 5HINA 2P8CA 2CBJA 1T41A 3B03A 4C6IA 2Z29A 2ZRXA 4DT4A 1TB3A 3H2EA 3S5NA 4J2PA 3TC7A 3ES8A 2J78A 2NQHA 2ISWA 1H5VA 2O92A 1ROTA 1E3ZA 3N4FA 4MUZA 2J77A 1UWUA 4J3ZA 1VC4A 4ORMA 1VHNA 3T42A 1E9IA 2Y5EA 3HPAA 4GO8A 4IICA 3LPGA 4V2XA 2QDEA 4MFEA 2XP4A 4FNTA 3GX9A 2K8IA 3ERPA 1XYAA 1TA3B 1TX0A 5AHLA 1KD0A 4C6MA 4FNSA 4JX5A 2VZUA 1VHCA 4B5VA 3QH2A 3LGDA 1IGSA 2I1OA 3LLDA 4JTFA 3LMYA 3K4AA 1JPDX 3O7UA 1KV8A 2VO5A 4O18A 4WDXA 1ADSA 1HX0A 1MSSA 4M51A 2ALRA 1BTCA 4PBEA 1K7XA 3OO2A 4V28A 3IUIA 3RGTA 4LY4A 3FAWA 2ZXQA 1DJNA 3PVFA 1FWNA 1Q6FA 1YNYA 1AMYA 4UB9A 3HFTA 2Q71A 3BCDA 4O1CA 3K5XA 4Z08A 3DUGA 3G24A 5GNXA 2QJJA 3MBFA 1WBHA 3STFA 3PULA 3AJXA 1GORA 4HA4A 1R2SA 2JF6A 1DJGA 3L68A 3WH5A 2ZTKA 3FDGA 1EIXA 1FX6A 3AQUA 4S2CA 2XTKA 6TAAA 3CZGA 3WLIA 2FVKA 2F2HA 1XLAA 4IL2A 4DM1A 2OKOA 3I68A 4H7VA 2FHBA 3HQOA 4N42A 3E5PA 1SJBA 1WYIA 2ZQVA 4N6FA 2Y0FA 1FWTA 3BZGA 3ATZA 4RNIA 3T0CA 4XD5A 3WNMA 3ZYZA 1JULA 1W6TA 2XWEA 3GUGA 3ZM8A 1QHZA 5CC7A 4IT4A 2CLIA 4WGHA 2XN1A 2AKZA 2VTFA 1XD1A 2PBGA 1W37A 2YYUA 2Q8ZA 4WKHA 4OUIA 4C6DA 1N7KA 2XIOA 1EZ2A 3J7HA 4ZVJA 1NFGA 2DUZA 4LAVA 3GXNA 1L8PA 4ICCX 4IQDA 2JF7A 3NSNA 5SWUA 2PPPA 1TV5A 3AU2A 4OV4A 2ZXDA 1RLDA 1ZJAA 1OFRA 1EIBA 2Q5AA 1UYQA 2Y70A 1V02A 5I00A 4P8VA 1OFPA 3W2LA 4GVFA 3CT2A 3ELFA 1W1PA 3EY6A 3GHTA 4CQBA 3BJTA 4GGHA 3N9SA 4AWTA 1TMQA 4QJ4B 4H4IA 5F2MA 4S3FA 1WZLA 4JFMA 2CZ5A 3BK0A 3WLHA 1V6XA 1V0MA 4PE8A 1YRRA 1NELA 2YSWA 4JTTA 1XCWA 3EMQA 4OECA 3NIYA 3SUVA 3PZ9A 2WZEA 2G37A 4I9AA 1QWGA 3PK7A 1V51A 4IPIA 2MANA 3W85A 4MB1A 2FIQA 1W3KA 2XP3A 2XVKA 4TU1A 3LRLA 5D02A 4FMVA 4WX2A 4GH3A 1BWLA 4ZXLA 3FJNA 4ZSTA 3QMSA 3CYVA 1MYRA 2B7NA 2F7FA 1OSEA 3IRSA 3SUWA 4Y9MA 1UH4A 4Y9OA 1C8YA 3MW7A 4QR6A 4S23A 2E40A 1S2AA 4PH6A 2D3LA 3T0AA 3MV11 4Y9PA 5C71A 4QT3A 4FHAA 4M1BA 1OHLA 2I5GA 4S3EA 1NU5A 2Q3RA 4KIRA 5ABFA 4ZTXA 5AC8A 3VIKA 4QEHA 3MSGA 2H9AB 1GOIA 1QW9A 1C92A 5LKYA 3PBGA 4W85A 4H8UA 4YWIA 1QI2A 1F74A 4L4MA 3UXDA 1ICQA 1PL9A 3MP5A 1R0MA 1GQIA 1J4RA 3T40A 4FLQA 1CCWB 3GHRA 2AAMA 1JUBA 5HUAA 1YKWA 3KZSA 3MI6A 3EB4A 4IWWA 4KWVA 3H4GA 4A8NA 4DAFA 5BU9A 1ZJHA 2CKSA 1G69A 1ZS2A 1IEIA 2NWSA 2YA0A 4HMDA 4UQBA 5TD4A 1TKKA 4C60A 1UIPA 3WEOA 1EEXA 1XYBA 2VL4A 1O94A 2GJNA 1VPQA 3QR0A 2CW6A 1UA7A 1HKKA 4H83A 4GQGA 3PZIA 1RLCL 3VGFA 4C90A 4DLMA 4C5YA 1RR2A 2GSHA 5HTGA 1FKGA 6ENLA 3W2UA 1KRAC 2VCCA 1S39A 3IK8A 1D8CA 2B81A 2D9FA 1W31A 2NVAA 5H91A 5I7GA 1R87A 3OA3A 2M2AA 1F8MA 3WDJA 4H9UA 1Z9AA 4FOKA 4I90A 3SGGA 1O5XA 3I10A 3EWWA 3R4IA 2VDIA 5HNTA 2DT2A 2UY4A 4TV6A 1BYCA 4QM1A 3XIMA 4TW7A 2PTWA 3CZKA 1ODUA 3ABQA 3W6LA 1WXZA 3E2QA 5I3HA 4GIVA 3KUMA 4GD0A 7ENLA 4CCZA 4RE2A 5AOUA 2HNEA 4IX0A 3S47A 3AO0A 3SDOA 1A3WA 1IYXA 1GOOA 2RDUA 2B7OA 2CU0A 2VGGA 2G3MA 3GNRA 2UY3A 3K13A 3R7MA 2VC5A 4W89A 1GOQA 4H6KA 2NX1A 4FA3A 1KFLA 1RUSA 4C1NA 4LAYA 3PF3A 4NX0A 4AYSA 3FA3A 4UUIA 2KR7A 3ZWSA 2WZHA 3RR1A 1Q6OA 2Z1SA 2EG8A 3MS8A 2DVXA 1XIMA 3D6NA 1W3JA 4GYFA 2ISDA 1SJDA 4JHMA 2HMCA 4LC8A 1FWIC 2VFEA 1JF5A 2QJMA 3NQMA 2E1DA 3EWZA 3U2CA 4ZA0A 4ZE4A 4OOZA 3U2ZA 1E56A 4BJHA 3EA3A 4CD5A 3RX2A 1Y65A 4Q4OA 1XLLA 3PSWA 4L6OA 3SR7A 1FVPA 4RPQA 3LBMA 5MKGB 4HCDA 1G6CA 1KGXA 1E6PA 1GZGA 2V5KA 3BSMA 1T99A 2CCRA 1TPWA 5E09A 2DSZA 3B0PA 3AIEA 4OBTA 1KRBC 4L9YA 1M03A 4GE8A 3ARXA 4DROA 3TYZA 4C6JA 3GD6A 2WWDA 4CD8A 3IVUA 2QXWA 5FI8A 4NHVA 1GG1A 4OGZA 3BGJA 2OT1A 1EDTA 1PXGA 3IVSA 5T8GA 3STGA 3RHGA 3KWSA 4IXHA 1C7SA 3GZ3A 3CWNA 1HJUA 5CPSA 1TA3A 2J8GA 1QWKA 2YB4A 3GVQA 4IP7A 1FWEC 3VO0A 1H51A 3L2LA 3DAQA 2PRHA 3I6CA 1SMDA 1XIJA 3JS3A 3GC4A 2KGJA 1A80A 3W1LA 3EXSA 1LCOA 2XIQA 1XUUA 3SCVA 3K1DA 2Y7GA 4DZ3A 5JH8A 5CBIA 3VDBA 3WQFA 2HVMA 3TCSA 4MTVA 3MSRA 2BMBA 5DXXA 3WQ6A 1T40A 5T9BG 4MGGA 3IK4A 2VVSA 1RQBA 3RMEA 4ZL1A 2INZA 4LVBA 1UP3A 2YPIA 3ALGA 2KX9A 3O6AA 1VFUA 1VBGA 3TDFA 4LUIA 4XK2A 3WMLA 3EKZA 4K8GA 4IMAA 2ZE0A 3LOTA 4TVCA 3VFLA 4UR7A 1W3TA 2GJXB 4FI4A 3TYCA 4YJ5A 3DG3A 3FHQA 1JXKA 5JBDA 3AHTA 2ZRYA 4WJ8A 1PZ1A 3KL0A 4DM2A 1D3GA 4QX4A 3CAWA 3FXGA 3LX9A 1RHCA 3GIPA 3CL7A 2OLHA 3BVJA 4B5WA 3OPSA 2RH9A 2WPGA 1KKRA 2ATSA 3GDRA 3LRMA 1FAPA 3VFCA 5E93A 1OT1A 1W9VA 5TBOA 2BY2A 1CGYA 2ZZ2A 1SUXA 1Z42A 4FN2A 1IXPA 4LBRA 3I6TA 5J5DA 1CX9A 3GLCA 4AH7A 5IBXA 3MUY1 1GKPA 3C0QA 3FEMA 1JPKA 5DT7A 1FKLA 5GJNA 1MUCA 2E7FA 3HFYA 4JPGA 1WDSA 3TNOA 1IZJA 1VCFA 2VRQA 3WBAA 3B3DA 1VF8A 2FZDA 1YNPA 1UP0A 3ZJ6A 4PTWA 4MYXA 4JY9A 4JTEA 3MYPA 4CD6A 1ZENA 1GVQA 4J5NA 5FOOA 1SVDA 4M6QA 2P8BA 1FA2A 4CQDA 4M1RA 1HP5A 1YTKA 1Z7AA 4NJGA 2QEZA 4DRKA 3DU0A 3W6YA 3KOFA 2GVYA 3GFYA 3ZVIA 3BW2A 3WJSA 4M5PA 1KFWA 3GNPA 1PZ0A 4BA0A 1KQYA 3BQ6A 1XYCA 4XZWA 4NJJA 3TFXA 2F4EA 1ENUA 2BNJA 2ZCGA 1GVEA