1JNDA

Crystal structure of imaginal disc growth factor-2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
molecule keywords Imaginal disc growth factor-2
total genus 143
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jndA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jndA01
4ACZB 4W93A 3LPPA 2FH8A 1GQJA 2J8GA 3ZJ8A 1CNVA 4W5UA 3E1F1 3FN9A 3VD3A 3J7HA 5GNZA 1YHTA 1FA2A 1AQ0A 1E6QM 1XH1A 1QVBA 2FHCA 3AS3A 2CITA 1UWUA 4AISA 5BXRA 3PZNA 1KWGA 3L4VA 2DH3A 1UD2A 3GBEA 2VRQA 4UOQA 1JG9A 1HKKA 3PZVA 1OWQA 3WIJA 4UOZA 4NF7A 3WQ6A 3L4ZA 2WVVA 1OSEA 5ECUA 2J25A 5C71A 1UYQA 3MS8A 3WD0A 2CNCA 1CPUA 4U2ZA 4Q7NA 1FH7A 2VZUA 4KWUA 3CTTA 1V3KA 3PN8A 1EXPA 2X09A 1B0IA 2J7CA 2VUYA 4RE4A 3N1AA 3UESA 2E3ZA 1NOUA 2E4TA 2D3LA 3O9NA 1E71M 1VFFA 1UH4A 3VGEA 2CHNA 3VOCA 2A3EA 4H8VA 4Z2GA 1OIMA 3RM9A 2D20A 1KBKA 2V3FA 2WMKA 1M01A 2QHAA 5HOSA 3EDFA 4BQ2A 1MFVA 4ZFMA 5CZKA 3VGGA 1LWHA 4AZBA 1ESWA 3SUVA 1MQQA 4TTUA 1QHZA 3AHTA 3SCWA 3RILA 1NOWA 3VM5A 5AYBA 2CHOA 4K68A 2PWDA 4OJYA 3WNPA 3ZO9A 1NQ6A 3EYPA 1XGZA 1G9HA 4FMVA 4ZXOA 4D6HA 3VGBA 1BGAA 1DEDA 2ZUVA 3CUGA 2EQDA 2YKKA 5A1AA 3WH7A 1UZ1A 1PAMA 5CQ1A 4P8VA 1C92A 1OT1A 1W3JA 1EDTA 1LL6A 1R7AA 3TONA 3ZOAA 2WK2A 2GDVA 1OD0A 2ZXQA 4CD6A 3A4WA 2NSXA 1M03A 3ZIZA 1A3HA 1UWRA 4RE3A 3TTSA 4W84A 5DT7A 2G4FA 2YL6A 1QPKA 1LWJA 4GZIA 3PZOA 2CBIA 2JIEA 1UKOA 1K9TA 1V02A 2XWDA 3WD4A 2FDMA 2PBOA 5GQBA 3KL5A 3CO4A 3A47A 3WL1A 1HVQA 4AIEA 2O9TA 2BY3A 1GONA 1KXTA 1HKIA 2W67A 3SURA 3VD4A 1UA3A 3VTRA 2VX4A 1WB0A 4MDOA 1CGUA 5M03A 1OM0A 1MXGA 2DT0A 4PTWA 1SMAA 2CCRA 4QLLA 4HTYA 1ZBCA 1NP0A 3WMCA 4XUYA 4E8CA 1CXIA 2J4GA 3AMKA 3WDRA 3AZTA 3AIWA 3AMLA 3HU7A 3WNLA 2BVDA 2WWDA 2QPUA 4A4AA 2EJ1A 4UQCA 4X0VA 1CXEA 5A6JA 1CECA 4YPJA 1E0WA 5BCAA 4HZ7A 3AJ7A 4PUEA 1BQCA 3EDEA 1QHOA 1RD6A 3ZJKA 3VGFA 2J7EA 4PSPA 3EMCA 5M5DA 2Y4SA 1B9ZA 2XSBA 4W87A 3MANA 1KCLA 4UOJA 3L4WA 1PZ3A 1PX3A 5DT5A 1GJWA 1OBAA 2BHYA 2FGLA 2YL5A 2X1IA 3AOFA 3PTQA 3T2QA 3QGVA 1GHRA 2FH6A 4CD8A 3WD1A 4E2OA 1JDAA 3RIKA 3WFZA 4B15A 5A94A 3L4YA 3WEMA 4W85A 5FL1A 3NSXA 2W5FA 3AS2A 2MANA 1CDGA 3VD5A 5CGTA 2BY0A 1KFWA 1WPCA 1W9BM 3ECQA 4IUGA 2ZX7A 4D6DA 3WF2A 4CVUA 1DWGM 1XH0A 1OT2A 3WNOA 1R87A 1E15A 4XX6A 5D9OA 1JD9A 1KQZA 3AIRA 1I1XA 4F9DA 3AIEA 1MVYA 5I24A 1R7OA 1UOKA 1HT6A 3AHYA 8A3HA 1JZ5A 4B3LA 1GQKA 1UZ4A 4F8XA 2WC3A 1A47A 4A3HA 1VAHA 5HBFA 4DUXA 1GCYA 1ODUA 1B31A 3UEQA 1B90A 3BAYA 1E56A 3RJYA 5HPCA 1J0YA 1VBUA 3OG2A 2WYSA 3OLIA 3TOPA 1F4HA 2D0GA 1QI3A 2FHBA 1UKPA 1Y7VA 2J8FA 3VMPA 2VX5A 2W91A 4BQ3A 1JZ6A 1W9XA 3OIHA 3FY1A 1HKMA 2BHUA 1J0KA 2XWEA 1J11A 2DSUA 3AHVA 3ARRA 3WNNA 3W28A 3CZEA 3WF4A 4AW7A 1JZ4A 5JUVA 1NARA 4X9YA 4OOZA 3BXWA 4CGTA 1TUXA 1HL9A 2UY4A 4LPCA 2Q8XA 3PTMA 4HZ8A 4CU8A 4MAVA 4CCEA 1AMYA 1Q4NX 3I3EA 3WH9A 1P6WA 4CKQA 1ISYA 4JAWA 2VO5A 4YN5A 1ECEA 2JE8A 1KXQA 2VMFA 4MB1A 3II1A 2GUYA 4DUWA 2WW5A 4OZOA 1R85A 1B2YA 1EDQA 4U3AA 4NSBA 1MQRA 2WMIA 4X0NA 1VBRA 4HOXA 2G3JA 1MW0A 1HNYA 4WIWA 2VCCA 4J3UA 1E6SM 5ABHA 4UFHA 3FAWA 1ISZA 4PN2A 4P7OA 2OWXA 1OGGA 1NWRA 2VT0A 2A3CA 3AXHA 3WD3A 1WE5A 1E4MM 3KL3A 3CH9A 3AQUA 1Q6EA 4EKJA 1V08A 1UKSA 4NRSA 1TG7A 4FLSA 2VZTA 4M82A 1UR9A 1BPLB 4JL1A 3T0BA 4LGXA 2BY2A 2D3NA 2CESA 3OB8A 4TVCA 4AEEA 3CGTA 4CU7A 3EDKA 3DHPA 1EQCA 2PBGA 4GQQA 1B3YA 1UWSA 3M07A 2ZXAA 3D3AA 1NWSA 2DIEA 1IZKA 4URIA 2VNCA 2J79A 3MV01 1GW1A 4MNJA 5IDIA 5A2CA 1VJSA 1W9UA 2FGZA 3S6TA 1HJUA 1EIBA 1TA3B 2GJXB 4PMQA 2ZX8A 1SFSA 3VDCA 4FLRA 3WDPP 4QLJA 5IFPA 3U5UA 4TX8A 2XYLA 3N9KA 2WVUA 1BF2A 4P7QA 2TAAA 9CGTA 4UZUA 1VF8A 1EO7A 3L2LA 4AWEA 3DYMA 1OGBA 2VC9A 1CGWA 2XFYA 2VCBA 1XHGA 2D1ZA 5AC5A 1W1TA 1H41A 4M81A 3OLDA 1LQ0A 1UR1A 1CGXA 5BXTA 1V0MA 2V3EA 2BXZA 2YA0A 3VGDA 1V0KA 4B16A 4P8WA 3SEPA 1HJSA 4V28A 4W7VA 3NJ3A 3PZ9A 3VM7A 3U7BA 4MB4A 4GO9A 3THCA 1QOXA 2VL4A 3AIVA 4M8UA 1EA9C 2E8YA 3GBDA 2D0HA 4WKHA 3RJXA 4WSKA 1Z32X 1CWYA 2CBVA 2VJXA 1NP2A 3CMJA 1WO2A 3BSGA 3KEHA 3QHOA 1GZJA 4PMDA 2OYLA 3EDDA 4UFMA 2GFTA 2W4XA 4YHEA 3PZGA 5JIPA 3GXIA 4GI8A 1FH8A 4R5EA 1BYDA 2W63A 2AAAA 5E0FA 4YHGA 3VD9A 5CPQA 1KGUA 2WCSA 5DMYA 4J3SA 1KB3A 3G6MA 4AIOA 1E73M 1H4PA 1K9FA 4MTVA 1V3LA 1CXKA 2WMGA 1VFUA 3VMNA 1BLIA 1LF1A 2WZEA 2YLAA 1RPKA 4ACYA 2ZOXA 4HZ6A 5A2AA 2WNWA 2WBGA 3VDBA 3QHNA 3UG3A 3OLEA 3PZTA 5D9NA 2GK1A 4JFSA 2JF7A 3U5YA 2ZUSA 4AZ5A 5A6AA 1AQHA 4H8HA 4DUVA 3MV11 1JXJA 4H2CA 4P7RA 5FCZA 4MB5A 3N04A 2PF0A 3W27A 3GH4A 5IFTA 3AYRA 3HMCA 2G3IA 3AI0A 2EPOA 3OZPA 3GXDA 1C93A 3WH5A 1C8QA 1U2YA 2QV4A 1E6RA 4NRRA 5ABFA 4GKLA 3GNOA 4E8DA 1E0VA 1WCGA 2C0HA 1JFHA 4F79A 2ZX6A 1QW8A 3VD7A 5CG0A 4AY1A 3NDYA 2IUZA 4AC1X 5F7UA 1VFMA 4PBGA 4JKLA 5EMYA 1CXFA 3VNYA 7TAAA 1E40A 5LA1A 3BLKA 3MUZ1 3BAXA 4OBSA 5JH8A 3A4XA 3VINA 2ZIDA 1NM9A 4N0RA 4U33A 3F5KA 2Z1KA 4LYRA 2BV9A 4UZSA 3CZ8A 4CVWA 4HPGA 1UUQA 4UQEA 3EDJA 2DSZA 1F4AA 3N15A 1DWFM 1E43A 3UR8A 1JFXA 3RMEA 4Z2IA 5FD0A 4IISA 4FLOA 5CGMA 4CN1A 3VUPA 4JFVA 2DIJA 4XB3A 2ZXDA 1SMDA 1DWIM 1VEMA 3NCOA 4XV0A 3WEOA 1V3HA 3MUAA 1JZ2A 2J7DA 4DWSD 4ACZA 1HXJA 5DO8A 2XUCA 3RM4A 3W29A 2VZSA 2WKLA 5BROA 1QBBA 3BAIA 4P7NA 1O6IA 3UCQA 1CLXA 5DEZA 2BXYA 2WHJA 1R8LA 3BCDA 2DSVA 4OUEA 5I6SA 3SUTA 1UD5A 1B30A 3WNKA 4ATWA 4FK9A 5A6KA 5BXSA 3L2MA 3OGRA 4PMNA 2G41A 4MADA 3WDJA 2X2YA 4PMRA 1VENA 1JI2A 4ZXLA 1BSIA 1IZJA 4BS0A 4Z2KA 1VEOA 2J47A 1U30A 2V5CA 3RO8A 4AZ6A 4GINA 4PMUA 1LL7A 3FAXA 2XPKA 3WDQA 3KWXA 3HJEA 2G8ZA 3SCUA 4CU6A 2XHYA 1G0CA 4HOZA 4S3KA 4W89A 2WC7A 2OYMA 4TTGA 3EMZA 5I0DA 5ABEA 4C7DA 1W2PA 3SCNA 2GJPA 4DM1A 1HP5A 3WQ4A 2XVLA 1LG2A 4LX4A 1GQLA 4S3JA 1WZLA 3RCNA 1ZBWA 1HJXA 3CPUA 4U2YA 2WM0A 3QR3A 1H5VA 3FNDA 1I1WA 5I79A 1CZ1A 5BXPA 5D8ZA 1CEOA 2OLHA 2JFEX 1JAKA 2XGBA 1XSJA 5GNXA 1O7AA 3PBGA 5D4YA 1PJ9A 1V6UA 5E09A 1EHNA 1E4NA 4D6FA 1BVZA 3ARQA 2VQTA 5M3WA 4U31A 4UCFA 4D6CA 4W7UA 1C7TA 1C8XA 1BHGA 2C8NA 3T2PA 2E40A 3MO4A 4WSJA 2YDSA 1M7XA 1KGXA 4PMXA 1GVYA 2DT1A 1QBAA 1MXDA 5I2UA 1E9LA 1CXLA 1I75A 3OZOA 5CPTA 5HPOA 2W61A 1JYVA 3ZM8A 1JZ3A 2VVSA 4C7GA 5FKYA 2XFFA 1PX8A 1UR2A 3DECA 3VIFA 2J7GA 2AMGA 2CYGA 1H09A 1J0JA 2EXOA 2Z1SA 2O9RA 4AD5A 2J62A 2GDUA 4D72A 1B3VA 3VO0A 3WMBA 3ARXA 1QI4A 3SCQA 3LPGA 4OBRA 4UQ9A 2WZHA 3IJ9A 1BGGA 4ZEPA 5AC4A 2ZICA 8CGTA 3WF0A 2FHFA 4PTVA 4RL3A 1B3XA 4KH2A 4W86A 3FHQA 4DWSC 2E8ZA 2XIIA 4H7VA 1MW2A 6A3HA 1AVAA 1GOIA 1UWQA 3VU2A 1V0LA 1KR0A 4EE9A 1ISWA 3W37A 2ZUNA 2B31A 1TZ7A 1E55A 4W7WA 2QPSA 4JL2A 2VR5A 1WDPA 1NH6A 4PTMA 3U57A 2A3HA 4HMDA 4W5ZA 4ZENA 4MAZA 5EB8A 1WAWA 4AD2A 5I5RA 2QLYA 1NOFA 1XCWA 5JBEA 4CN6A 6CGTA 2J74A 2YA1A 4CN4A 4WK9A 4J3VA 1NWTA 2UWFA 2CETA 1KCKA 4AZIA 1V6WA 3WSUA 3I3BA 2CXGA 4J28A 3ZR5A 2YA2A 2DSWA 5E70A 1HF6A 1TA3A 1DWAM 4HA4A 1HIZA 3NUKA 2BHZA 3WFLA 3CUHA 1JIBA 1VB9A 1CGTA 4MB3A 3M6DA 5I77A 5CXPA 3AROA 2Y8KA 3WELA 2QMJA 3AIBA 5TD4A 4UFKA 1J0IA 2VRKA 4TXEA 1L0PA 2J78A 5EBAA 2ZUWA 5A8QA 2WBKA 1D3CA 1K6AA 1ZB5A 5C70A 4KRTA 4OKDA 1UWIA 2DEPA 2WMIB 1ZS2A 1C90A 1GUVA 3W6MA 5I78A 2YDQA 4PTXA 3DC0A 1V0NA 3W24A 1W91A 3ARWA 4GI9A 4UQDA 3VKKA 2BNJA 1CGYA 4TOQA 3TTOA 1M53A 2DDXA 1EH9A 3SCRA 3WN6A 5A6LA 1EOKA 3AZSA 3K8KA 4FF5A 1CGVA 4MJ2A 1OIFA 4RE2A 2UY5A 4HA3A 5JBFA 4UQAA 1VRXA 4J3XA 4W8LA 4H8UA 3UETA 3NIYA 1UD3A 5E6YA 3PZMA 2WSPA 1GOKA 2UY3A 1RP8A 1WKYA 1E6ZA 5ABFB 1H49A 1FFQA 3CBWA 5FIPA 3AYSA 4WKFA 4PMOA 2PWEA 7A3HA 1CENA 2YL9A 3K8LA 1G94A 4PMYA 2CERA 4JHZA 2OSYA 1UWTA 4QLKA 3FW6A 2PI6A 2W66A 3WEZA 3VIIA 2ZUUA 4B3KA 3IAPA 3VX0A 2BVTA 3WY1A 3IAQA 3EBVA 2HISA 1W1PA 3SUWA 3B9DA 4AD3A 3ARYA 3FHAA 1EDGA 1WZMA 3AMCA 4KMQA 2V5DA 3CUFA 3VVGA 4UTFA 4U5KA 3GZAA 1N82A 3AMDA 1JXKA 4XZBA 3AZRA 4L4OA 3CHCA 1K9EA 2EPMX 3OGSA 1GOWA 3WUBA 4Z2HA 1WNOA 4JIEA 4PEEA 3VIHA 3VILA 1S46A 3FXYA 3GTNA 2G3NA 1V02E 2VOTA 3IK2A 4UFJA 4UFLA 4QFUA 4TUFA 3QOMA 5CPSA 5A8NA 4TVDA 5A8PA 1XSIA 5A95A 3WF1A 1W1YA 4PYSA 1RP9A 4W8BA 1GNXA 1H2JA 4QCEA 1QI0A 7CGTA 4GQRA 3MUY1 3B8SA 5KZ6A 1CIUA 1B1YA 2JALA 3G6LA 3VIGA 3GM8A 5D8WA 1ZL1A 4BQ5A 2HVMA 3N12A 5AYIA 3MKKA 3WQWA 4CD5A 4NI3A 1UA7A 2F61A 3M7SA 2WMJA 4D1IA 3CLWA 3WH6A 5A69A 5LYRA 1SR0A 3B9EA 1XD1A 2EPKX 4HA1A 4ZE4A 3PZIA 2WVSA 2WANA 1CBGA 4V2XA 4PCTA 3THDA 1JYXA 4CD7A 1GORA 4MNKA 2X8RA 5HDRA 1FP8A 2DH2A 3OGVA 4AMCA 2PWHA 1XC6A 3ZSTA 4C7FA 1B3WA 1JD7A 3SIMA 2ZE0A 5A6MA 1X1NA 3AXXA 1XYFA 1JDCA 1FP9A 1LL4A 3ZJ7A 5A3HA 4KGLA 2J7BA 3ZT7A 4BZYA 4IPNB 3AMGA 1E5NA 1HL8A 5A8MA 2YIHA 2Y8VA 2EPNA 3DYPA 5IXEA 4WF7A 1FFRA 2WMHA 1JNEA 1BTCA 1TR1A 1W1VA 1WZKA 2EEXA 4LYQA 3BMWA 2OWCA 1W9VA 1E72M 3K1DA 3N17A 3AISA 1ITXA 1QI2A 3BC9A 3ZJ6A 3BMVA 2X0YA 4LYPA 2DGAA 1R86A 1NWUA 2WLYA 1CLVA 4U5IA 5A6BD 1V6VA 1ZJBA 3CUJA 4JFWA 4D6GA 4M1RA 3VDHA 3GH7A 4HMEA 3CZLA 1J01A 1WP6A 1HJQA 4J7RA 1KGWA 4CCCA 1E3XA 3AIQA 4D71A 1AQMA 5CSUA 3BH4A 2VTFA 3WQ5A 4PRWA 1GJUA 3CMGA 1UH3A 3MUIA 3ALFA 3PZQA 2D2OA 4EAMA 1ZBVA 4H41A 4UNIA 3O6AA 4P8UA 2YL8A 2E0PA 6TAAA 3AHXA 1GOQA 4AEFA 1BAGA 2W62A 2BVYA 4IPLA 1UKTA 2PWGA 1ZBKA 3LPFA 3CZKA 3WUGA 3GH5A 5C8BB 3I3DA 4H04A 4N42A 3WF3A 3ARZA 4A3YA 1UG6A 1KWKA 3GXMA 4LXFA 4GI6A 3WDHA 2WHKA 4AD1A 4M80A 1PX4A 1US2A 2VR4A 3NSMA 1SYTA 3POHA 1GOOA 3WQ8A 4QDMA 5A2BA 2XVKA 5GPRA 5DF0A 3W26A 1BG4A 2ESCA 4F66A 1BYBA 3UERA 1WZAA 1Q6DA 2UY2A 2E9LA 2J7FA 3UG4A 1JYNA 2BS9A 3WBAA 3K8MA 1E4LA 2YLLA 3B9AA 4GIAA 1UD8A 1VFOA 4M56A 4BA0A 1E1FA 2J77A 5CJ5A 2CEQA 1GOMA 2ZWYA 1RH9A 2DPEA 1J9YA 4EANA 4D6EA 1JF5A 3M46A 5I3DA 1E6XM 1V3JA 4D6JA 2V3GA 3OA5A 5KEZA 1EOMA 1VIWA 3ZSSA 4AZ7A 3CZJA 3CHDA 2C7FA 1EGZA 4JCLA 1GQIA 4AD0A 4GO8A 3SCOA 2JEQA 4GZEA 2VZVA 2WXDM 1W9DM 4JCMA 1U33A 4WLCA 1TFVA 2DT3A 2CPUA 3ALGA 4AXNA 1HN1A 2AOSA 1UD6A 2GVYA 5D9PA 3WQVA 1OB0A 1C91A 2A3BA 3TP4A 4B9YA 1ISVA 3APGA 4UR9A 1YQ2A 4UQBA 3VGHA 4WKAA 1QNQA 3GNPA 3OLGA 3ZR6A 4CUCA 5BRPA 4PMZA 2VX6A 3VIKA 2VVNA 5CLWA 2NT1A 2WHMA 2WVTA 1K9DA 2QMKA 4M29A 2XVNA 1V6XA 1QHPA 2QF8A 1JF6A 2BY1A 4BQ4A 1XCXA 3SCSA 1JZ7A 2ZUMA 3ZMRA 3DHUA 3KZSA 2XTKA 3T09A 4NZCA 5M17A 3BAJA 1B3ZA 3UR7A 4J3TA 4W88A 1EQPA 1HJVA 3IJ7A 1ZU8A 1W3HA 3D5HA 1JGIA 3W4RA 3AS1A 3WBEA 4AZHA 4DWSA 3GXFA 3TA9A 4JZ5A 3ARUA 1GHSA 3POCA 4XZWA 1WDQA 3OBAA 2D0FA 3KL0A 2XVPA 1E6NA 2DQXA 5FOOA 1L8NA 2GSJA 3BCFA 4PCSA 3VIJA 2XG9A 3F5JA 3A4AA 3O2LA 2CBJA 2VZOA 1BFNA 5JIWA 1LLOA 4UFIA 2G3MA 3L4XA 1C3FA 2OYKA 1WDSA 2E9BA 1HX0A 1FOBA 3AFBA 1XH2A 1UR0A 1PIGA 1QNPA 3S2CA 1CXHA 4OOUA 4ATDA 2XM2A 1UR4A 1XYZA 3CHEA 2PC8A 4DM2A 1ITCA 1J18A 1KBBA 1QI5A 3WUEA 2ZX9A 5EFFA 2Y2WA 4W8AA 1KXVA 3ZT6A 1PBGA 1MW3A 3K46A 4GPNA 2X0HA 1UHVA 2WMFA 2WC4A 3A3HA 3MMWA 4HOWA 3SCPA 3TTQA 2XGIA 5BWFA 1JYWA 3WUFA 1H3GA 3MMDA 3TTYA 3W82A 4GXPA 5AY7A 5A6BA 4ZE5A 4DWSB 5E9AA 4HP5A 3BAWA 3T2OA 5E6ZA 2WVVB 3WH8A 2XVGA 2VURA 2J7HA 3ZT5A 4KGJA 2VRJA 1H11A 2CBUA 1C7SA 2PB1A 1EO5A 2BFGA 3W0KA 1XV8A 1ZJAA 3N11A 3AICA 2WB5A 3MSGA 3GDBA 5LA2A 3MSDA 2WCGA 3U7VA 1X6NA 1UH2A 1WDRA 3IANA 2E9MA 5IHSA 1HP4A 2F8QA 1JL8A 1E4IA 4J3WA 4JFUA 1G01A 3T0AA 3NSNA 4PSRA 1CYGA 5HXMA 1ISXA 1M04A 4HPHA 1W32A 1JDDA 4MNMA 3CUIA 4FLQA 4M24A 3W53A 1KQYA 2D23A 1QNRA 2Y24A 1UQYA 4ML4A 5CSYA 3BAKA 2NW0A 4AZCA 1V03A 2WWCA 2X05A 4HU8A 3K4DA 3BGAA 3SCTA 2D22A 2YJQA 1E0XA 3L4TA 4HU0A 4R27A 3VIOA 3QOKA 2DSKA 2CKSA 3GNRA 1FHDA 4BF7A 1GVIA 3PTKA 4BCEA 1US3A 2D24A 3ZQ9A 2WAGA 4QCFA 3WL0A 4L4PA 1J12A 1DP0A 1ODZA 5LA0A 5I23A 3VX1A 3CHFA 4D6IA 5EFDA 1PPIA 4Y7EA 5A8OA 4EK7A 3LPOA 1E1EA 4MNLA 1TVPA 4HMCA 2V3DA 4PUDA 2GJXA 4J27A 3WENA 2W92A 2IXVA 3NDZA 1MYRA 1HVXA 1QNOA 1D7FA 2OSWA 2XM1A 2WCAA 4AZGA 3DYOA 3WNMA 2EBNA 1VEPA 3BSHA 3AIUA 1TVNA 2PWFA 4QAWA 1VJZA 2GJRA 2IXUA 2JEPA 4Q22A 5HNNA 1UKQA 4V27A 2RGLA 4AD4A 4GZJA 2OSXA 4JHOA 3L4UA 1E70M 4JKMA 5FL0A 4MPKA 5GNYA 1CTNA 3PHAA 2O9OA 3QHMA 3BLPX 3MMUA 1XRVA 3EMQA 4B9ZA 3CIVA 4PMVA 1Q6FA 1Q6CA 2VQUA 3N18A 3AS0A 1H0GA 1EHAA 2OWWA 2WHLA 4AIUA 2WKGA 1FHLA 3ARTA 1E6PA 2ZUTA 3VPLA 1W2VA 5ABGA 3F5LA 3WKZA 1V3IA 2VX7A 3PZUA 1G5AA 3N13A 1TCMA 1LJYA 1IT0A 3CZGA 1UQZA 2ZWZA 4Z2LA 4P7LA 1XD0A 1DWHM 1FH9A 1G1YA 2VI0A 2XSAA 1XSKA 2WZIA 2JF6A 3SUUA 3RM8A 3W25A 3IJ8A 3UG5A 1J10A 1Q6GA 3GYCA 4AZCB 2WLZA 4QP0A 1HJWA 2RGMA 3MU7A 2A3AA 1DTUA 5BYWA 2V38A 5BRQA 1OD8A 4P8XA 1GPFA 3K4AA 1D2KA 2GK1B 2WSKA 2O92A 5JBDA 3VIPA 1C8YA 4LQ1A 4MJ4A 4IM4A 1X6LA 1BYAA 3SCVA 2F2HA 1MW1A 4TVUA 2O9PA 1UD4A 4MDPA 3LMYA 4OIFA 4JFTA 1W9PA 4D1JA 1PEZA 1QW9A 3VNZA 1DWJM 1BG9A 3JUGA 4CD4A 3ARSA 3NYDA 1QNSA 1HKJA 4E4PA 1KR1A 1TE1A 1JI1A 1MQPA 3W38A 1J0ZA 2XFRA 3WD2A 4Z2JA 2YDRA 1DHKA 3ARVA 3SUSA 2DT2A 1J0HA 1UR8A 1LG1A 5IHRA 1TMQA 3RPMA 3RDKA 4JKKA 2VCAA 4AYSA 3W6LA 1E3ZA 1W3KA 2JIWA 5E0CA 2CIPA 3T0DA 3WMSA 2EO7A 2ZX5A 3F4VA 1H1NA 1PIFA 1OCQA 1JZ8A 1KXHA 4ATLA 3AXIA 1BVNP 1H0IA 3T08A 1JNDA 3VMOA 2CKRA 2XJ7A 3A6OA 3KE0A 5CLTA 3VDAA 4F9JA 2Y5EA 1MFUA 1V6YA 5D9MA 4WJXA 2NT0A 5A6SA 1W3LA 1JAEA 3HN3A 2J75A 2EPLX 3AHZA 4CCDA 1MWOA 1OINA 2XIBA 3WDIA 4TX6A 3VIMA 4U3CA 1E5JA 5DFAA 1OGSA 4KRUA 3ARPA 2WPGA 1IV8A 1BYCA 2YOCA 3W81A 1V3MA 2YBTA 2ZXBA 1PZ2A 2YBUA
chains in the Genus database with same CATH superfamily
3IJ6A 1IXOA 4HNNA 1N8WA 3LPPA 2QJMA 4UTWA 4DO5A 2GUBA 2EKGA 3TNBA 4A3RA 5FF0A 1RQBA 3CIXA 3NQVA 2UZ9A 3B9NA 4DO6A 3URBA 1V4YA 5LNWA 1YEYA 4KKXA 3L4VA 3L65A 5FF3A 1UD2A 2D2HA 5G1YA 1IHIA 3PZVA 4IIHA 3L4ZA 2WVVA 1W5MA 5C71A 3MS8A 4WGXA 2ZC1A 1EA0A 6XIMA 5BXJA 1XISA 4RV8A 1RUSA 5H91A 1PDZA 4KWUA 1S3TC 4AAJA 3QTPA 1QR7A 1FCBA 2ANUA 5D03A 2X09A 1S5MA 4DF0A 2J7CA 2VUYA 4Q8VA 3NO3A 4A21A 4JTUA 2J9YA 3NQCA 3VOHA 4YJ5A 4YTQA 4O50A 1NFPA 3O6YX 2PDPA 3RM9A 3QQ1A 2V3FA 1RCOB 1L6SA 3EDFA 4BQ2A 1TJ0A 1XBYA 2HXUA 4PUWA 5CZKA 3VGGA 3VOFA 2QAFA 4TTUA 2Z2BA 4LS2A 4S3AA 1WA3A 3LTPA 3SCWA 1T99A 3IEBA 5AYBA 3KX6A 3C52A 1TX0A 1UB3A 1XGZA 4FMVA 4D6HA 2FVLA 2O7QA 5HUPA 3GTXA 4XIAA 4K3ZA 4Q4SA 3W6YA 3UYIA 3R5EA 2XH0A 2V69A 3LDVA 1C92A 2NVDA 3IIXA 1VD6A 4GI4A 1LL6A 2G97A 5HQEA 3ITVA 3GNXA 5K3VA 1RLDA 2ZXQA 2X30A 3ZYZA 4B5UA 3S0CA 5CC7A 1Y5XA 4J4KA 2XDFA 3TTSA 4XSLA 3UI6A 4HK7A 1P6CA 2E5BA 4MKVA 2M2AA 1TPFA 4H6KA 4UMAA 3SADA 4IGNA 1V02A 4O0KA 2PBOA 5GQBA 3A47A 3WL1A 4AIEA 2O9TA 4ZQCA 1KXTA 1S1PA 2W67A 4FAPA 3VDGA 3VTRA 2CWNA 4KETA 4B5WA 3BV7A 2QULA 3RLHA 4MDOA 1FKRA 1XIHA 3V0TA 2FZNA 4QLLA 1ZBCA 3L67A 1NFBA 2PDYA 3C2YA 3AMKA 3GG8A 1W1A1 3PC0A 1W5QA 3AMLA 3VCRA 3WNLA 2BVDA 2OR2A 2QPUA 1BL4A 4GY1A 4A4AA 3IKDA 4KCWA 4UQCA 1CECA 4YPJA 4US5A 3EOEA 1NVMA 1QTWA 4C1NA 4CNSA 1J8VA 1TKKA 4ZR8A 3VGFA 4EXAA 3HFYA 3CXOA 4DZIA 3LRKA 1Q6RA 4G7EB 1PZ3A 5DT5A 1OBAA 2BHYA 2FGLA 1SJAA 3PTQA 3RU6A 1NAL1 4CD8A 1MEIA 4GZ7A 4B15A 3MUXA 1XDMA 1X8CA 3NSXA 2W5FA 1CDGA 3KAHA 3VD5A 2CLKA 1QZ2A 5CGTA 4IQDA 5HUAA 3S46A 1VYPX 1V6TA 1W9BM 3WJZA 2VR2A 1A80A 3NGJA 4CVUA 1OT2A 4JIIX 3U2ZA 1YYAA 2I14A 3W75A 1FWGC 2P76A 1JD9A 1KQZA 1OFPA 4F9DA 2WNQA 3LM3A 1UOKA 1Q85A 8A3HA 1JZ5A 2VGFA 4R9OA 4GLEA 4A3HA 1VAHA 1XG4A 3VKJA 3G1AA 4GX9A 3CIWA 1VBUA 3A5FA 4ODRA 2PWUA 2WYSA 2GQAA 2QJIA 3NNTA 1F4HA 2D0GA 3PUOA 1Y7VA 3GVWA 3TYEA 3VMPA 2VX5A 4DVOA 4BQ3A 4L9YA 3FY1A 1M41A 4G7EA 2OJPA 1ZJIA 4L56A 5FI8A 2XWEA 4MWAD 4PCFA 4L6OA 1J11A 3ARRA 2QCGA 3URNA 4O12A 4OOZA 3BXWA 3BMBA 1KM1A 4DPQA 4LPCA 4M51A 1HTIA 4JTIA 4RZBA 2PTYA 3E49A 3DG7A 4KWWA 4CCEA 3LN3A 3WH9A 1ISYA 1ECEA 2VMFA 3B4YA 1XLCA 1B9BA 3II1A 2WW5A 3ERPA 4HMNA 3SZ8A 3TWAA 5C2XA 4U3AA 1UP3A 2P8BA 4RZ6A 4PZVA 4WIWA 1E6SM 2H3DA 3P82A 1ISZA 3MHFA 4PN2A 4C6LA 3TTEA 2CZDA 4LVBA 5D04C 3AXHA 1WE5A 1A5UA 1E4MM 3QVQA 2FPTA 5C2GA 4EKJA 1V08A 3D47A 3IJIA 3PJWA 4XTDA 5J04A 4JGDA 3VFCA 1DXIA 1GEQA 3GO2A 3T0BA 4LGXA 3ABQA 4B5VA 2O0TA 1GVOA 1VCGA 1HG3A 3O8AA 1K7XA 4Z0SA 4B3ZA 3DHPA 1WXJA 5EMMA 4N19A 3SDOA 3GX9A 4WDWA 4NNCA 3D3AA 3H6OA 1FWFC 1NWSA 2DIEA 4O1BA 4C6NA 1AH0A 4QE5A 5IDIA 2XGZA 4JD4A 1EUAA 3T6CA 3S6TA 3UQNA 3B40A 2W6RA 4CEUC 4HCLA 3FYPA 2GJXB 3VDCA 4FLRA 4FHAA 3T8LA 3E5PA 2XYLA 3TR2A 4DBWA 4P7QA 2QUUA 3H2CA 4UZUA 3V16A 1EO7A 3L2LA 1ZTVA 3FIGA 4AWEA 1JCYA 1OGBA 4L9XA 3C3UA 2VCBA 1XHGA 3M0JA 3LA4A 3H2AA 1IZCA 4JFIA 3S1GA 3NOYA 3WK1A 3TJXA 1V0MA 4RLIA 3L5LA 4GX8A 7PTDA 4GFIA 3VGDA 1BWVA 1FDJA 4XZNX 1PBKA 3SEPA 4BF8A 3EX3A 3VM7A 4RDWA 2INZA 3U2OA 1TV7A 4MB4A 3NVTA 4H7CA 3F7JA 1WKDA 2E8YA 4M8UA 1ZLPA 3CS2A 4UTIA 4WKHA 3H23A 4EPBC 2BDQA 4BWLC 4NJJA 3G18A 1NF7A 1U1UA 3CMJA 1WO2A 3BSGA 4S23A 1KFJA 3QHOA 1UIPA 3RNDA 3TVAA 2OYLA 1VCFA 2HJPA 3FSTA 2HV5A 3KAGA 3GXIA 3I10A 5CPOA 4YYCA 3B04A 3BUVA 4DRQA 3AYVA 3MWAA 3FJNA 5HWNA 2QDHA 4CNTA 1R3TA 1KGUA 2BLEA 3TX9A 2FTPA 2WCSA 4AIOA 4HPXA 2NVAA 4YWSA 4MTVA 1CXKA 1RBOB 3U48A 3VCCA 1VFUA 4MLRA 5AC6A 2ZOXA 4GG9A 2WNWA 2WBGA 4CNPA 3VDBA 4MOZA 3PZTA 4JTJA 3S6DA 1KT1A 1ECQA 4AZ5A 1GGOA 3P3BA 2QIWA 3CUXA 1JXJA 2W79A 5CAKA 4GNKB 1WKFA 6REQA 4I8YA 3CB3A 2G3IA 4Q8PA 5I3HA 2RUDA 4MIMA 1OJXA 3BVJA 3GXDA 4DY1A 2QV4A 4LUTB 4E2VA 1SU5A 4Y9OA 4E8DA 1WCGA 4PUKA 1JFHA 2ZX6A 2X2GA 4AY1A 1LROA 3EGJA 4DBSA 3OYZA 7REQB 5F7UA 1CXFA 3KHDA 1I0DA 1MDLA 3BLKA 5JH8A 4O0ZA 3VINA 4MPQA 3PWGA 1A5AA 2V2CA 4ZMGA 3EDJA 3OJGA 1QPNA 1LRQA 4NG3A 4JYFA 3UR8A 4FLOA 3UXLA 3VUPA 2HVNA 4XVDA 5KMYA 3EX4A 2PTXA 2HROA 3B8DA 2OQLA 4FX8A 5DELA 2PV3A 3SJNA 4E2BA 1IWPA 3NCOA 3WEOA 1V3HA 4B5XA 2BOGX 3MUAA 1JZ2A 4DWSD 5FJRA 2Z7GA 1H7RA 3LNMA 2RFGA 3UA3A 4WVXA 3CYVA 1O12A 3DG3A 4EX4A 2PMQA 2XISA 5D37A 1CLXA 3TSMA 2BXYA 3MC5A 1RZMA 1UWAA 1UD5A 3ATZA 5BXSA 3EWYA 1SW0A 3BDKA 1TV8A 3PM6A 1TV5A 4PMNA 1Q6LA 1F2JA 1AODA 1VENA 1JI2A 1K77A 1A5OC 2ZQUA 3GG0A 1I2RA 4BS0A 4Z2KA 2J47A 3V18A 4I5RA 1UR3M 2V5CA 2VELA 3RO8A 2FZDA 3WG6A 4MWAE 2W0UA 1IQ8A 4K1GA 2PBCA 5C55A 4ADUA 4Q32A 2XHYA 3W1UA 4DBEA 3LHTA 3W1AA 2PLMA 2OYMA 5MHBA 4C7DA 2Q8LA 3HIJA 3QFWA 2YCLA 1FX6A 1WBHA 3ATYA 1WZLA 1ZBWA 2JGQA 1V79A 3R13A 1I9CB 3P81A 4JFJA 1CEOA 2OLHA 2JFEX 3K13A 3W1NA 2C91A 2XGBA 4NZ5A 1O7AA 1EJXC 4P5UA 4TU1A 4YTUA 2PDFA 2VD8A 1HQTA 3ARQA 3E0FA 4U31A 2YZ5A 3MO7A 4UCFA 5KSWA 4TV5A 3TKFA 1P1MA 2EG7A 4GJJA 4JN8A 4RR4A 4C65A 3CYJA 3TWBA 3EB3A 2BGQA 3WX7A 3EPMA 4L72B 2C79A 2IPGA 3I4EA 5BZAA 1QBAA 4JDYA 1W3IA 3NZPA 3V7PA 5I2UA 3OZOA 5FSEC 3E02A 1P0NA 3KW3A 5FKYA 3G3MA 1WDDA 2XFFA 3MB9A 3OO2A 3TW6A 4ODLA 2FTWA 2IKHA 1H09A 3DCPA 1ML1A 4G7FA 5CPNA 4NVTA 2YCEA 2J62A 2GDUA 3W1PA 2OT1A 2GQ9A 3VO0A 1E1CB 4HB7A 3ARXA 4JN6A 1VS1A 4JIQA 3IJ9A 3M0MA 5AC4A 8CGTA 2FHFA 4PTVA 4RL3A 2IKGA 2E6DA 2Q3OA 4DWSC 4JIHA 1T11A 2P53A 3MP5A 5LSMA 4L1XA 4UBPC 3W84A 4GC3A 4LAZA 1KR0A 2VDGA 1EJVC 3P93A 3NXLA 1E55A 4N6FA 1BWKA 3KOZA 4JL2A 2VR5A 1KV5A 4PEKA 3MJMA 1NH6A 4RKAA 4G8TA 4IL0A 3NQFA 2A3HA 3R12A 4TMCA 3ABZA 4W5ZA 3BPWA 5EB8A 3ITXA 1S5WA 2VHLA 3E12A 5J5DA 1TWIA 4TX0A 1SZGA 2E1WA 2OXNA 3RGCA 1L2QA 2H9AB 2UWFA 4NJIA 3E2RA 3MI3A 3WSUA 3OYXA 1ZCNA 1X96A 4ZQNA 4FXJA 3DFQA 3UG8A 3QKEA 2BHZA 5IOBA 1DQUA 2VDIA 3KTXA 3WFLA 1W1IE 2JKEA 4IJRA 8RUCA 4ONVA 4MF4A 4OT7A 3BOFA 3AROA 1LRNA 4JNYA 3WELA 3TYUA 3AIBA 3LI1A 2VRKA 1L0PA 3H54A 4FOKA 2WBKA 3SI9A 4LALA 4OKDA 4Q8NA 3NG3A 2GOUA 1AFSA 5CPMA 3TH6A 2ZCGA 5IBXC 1DJQA 3VKBA 3W24A 2INEA 2DDXA 3PR9A 3WN6A 5A6LA 3O06A 3CGMA 3CGNA 3EKZA 3M64A 4MJ2A 2A7RA 3MWCA 5JBFA 3HG4A 3QV8A 1VRXA 1NQKA 3UETA 3NIYA 1UD3A 5E6YA 3RGTA 3PZMA 1GOKA 3W7RA 2UY3A 3I6TA 1RP8A 3W7OA 4OHQA 3PBMA 1B5TA 5ABFB 2PTDA 4WKFA 4PMOA 3V1HA 3MSRA 7A3HA 4XBSA 3SN0A 1WOAA 4PMYA 4GD0A 2OSYA 2RKXA 5K9XA 3KVMA 2L2SA 1RJQA 4B3KA 2IS7A 3VX0A 4A2RA 2BVTA 4UWMA 4HHMA 4ENLA 3IAQA 3PUDA 3EBVA 2HISA 1QO2A 2MUCA 1W1PA 3LCIA 2POTA 4ICCX 3SUWA 3B9DA 1RBAA 3N9SA 3NL6A 4DIAA 2REQB 3W7QA 2HWGA 4Z1AA 3KRUA 1U79A 4Y9AA 1A0CA 2V5DA 3VVGA 4XD6A 4UTFA 1YKWA 2DQWA 3VZZA 1RVKA 4GCAA 1I6NA 5CC3A 4BEUA 1P0KA 1UCWA 5IRPA 3CHCA 1EZ2A 1TREA 5FA5A 1DE5A 2I9EA 2GVGA 1QT1A 4ZA0A 1MSSA 2Q71A 4NQ1A 1XI3A 3GDTA 2VOTA 1JULA 3DU0A 4A29A 3O16A 5A95A 1W1YA 1XC4A 4JYDA 3ORWA 3WCZA 3GKFA 1GNXA 4CNNA 1H2JA 5B8IC 1XRTA 7CGTA 5JMUA 3W7CA 1CIUA 3RLGA 4YVVA 1LLWA 1DYSA 1PWLA 3BJTA 3VIGA 2RJHA 2FQIA 3ODKA 3R43A 1VYSX 4QJ1A 5J5RA 4BQ5A 4N6EA 4JYEA 2W9MA 2E09A 5AYIA 3HGRA 4XD3A 4WX2A 5G2WA 2BZNA 4CD5A 3MZ2A 3QF0A 1R9XA 4KERA 2QQ6A 1V51A 3KOXA 3I7SA 5A69A 4DI9A 5LYRA 2EPKX 4JTHA 3F4CA 4ZE4A 2WVSA 1D8CA 4BR1A 3ZZ1A 4B5SA 3NM3A 3HG2A 1XLLA 2RUCA 1XQLA 2Y0FA 3P5YA 4G9PA 5CCZA 3THDA 4LAMA 4L3NA 5HDRA 2DH2A 3CAWA 3KACA 4JFKA 3AALA 4JQAA 1P43A 2ZA2A 4AMCA 1XC6A 3W70A 4F0LA 1L6WA 5DQPA 4ZB0A 3GHRA 4NL1A 1FKJA 4IGSA 3WLQA 1X1NA 4OTKA 1LM1A 1OFEA 1XYFA 3ZJ7A 2NV2A 4FAMA 2F2DA 2ZQVA 2NQJA 4BZYA 3QC3A 4TW8A 1YDOA 2Z1BA 2EPNA 3DYPA 3PPCA 4WF7A 4B4FA 1FFRA 4HBKA 3ABOA 2C16A 2P10A 2HTMA 3CLMA 3NQGA 1W1VA 3WK0A 1WDWA 1Y0EA 1VKFA 2ZFAA 2Y85A 4X2PA 3KP1A 4LT9A 4KW2A 4FALA 5LNUA 1W54A 1P0BA 3AISA 3ZJ6A 4K7VA 2ALRA 3TQ0A 3BMVA 4DZHA 2X0YA 1R86A 1X98A 4IL2A 2IPJA 4ZS6A 4DJED 2PDJA 2WLYA 3RYSA 5HQLA 3HPSA 3IVTA 3FV9A 1KO0A 3CO8A 1ZJBA 2DUAA 4AVNA 1KCZA 1PTDA 3G22A 5I03A 4D6GA 2WNNA 2X16A 3UI4A 1ZP4A 4DI8A 2ZTJA 4CQAA 3PG9A 1H63A 2XH2A 3HQPA 5FEXA 1GJPA 3ZR4A 3BV4A 4CQ9A 2P3EA 1SSGA 4MWAA 3TU9A 3TV8A 1V7YA 1XLEA 4EAMA 1XIDA 4AY7A 2YYTA 5LNVA 3IWPA 3O6AA 3TW9A 2E0PA 2I1OA 3C8FA 1BAGA 1FWNA 4Z17A 2BVYA 4N7QA 4N42A 2WHKA 4FPSA 5GJMA 1PX4A 1US2A 1XIEA 1IEXA 1SYTA 3POHA 3KLKA 2PGEA 1H1ZA 2ESCA 4EXQA 1WZAA 2VGGA 4Q4KA 1TTJA 4GUHA 3TK7A 3ZFHA 4CQ8A 1XLBA 3NPWA 4M56A 4JIRA 2BBFA 2IW0A 1FWDC 1KRBC 2Z2AA 1E51A 4LAVA 3N73A 1WKEA 4EANA 1DJYA 4Y9MA 1V3JA 1KFCA 3OA5A 5KEZA 1EOMA 1FDZA 4O17A 4FI4A 3CZJA 3O5LA 1EGZA 2ISVA 4NX5A 1GQIA 4AD0A 3SCOA 1ZCOA 2WXDM 3ITTA 2C13A 3N2XA 3R2GA 1TFVA 2E6FA 4AXNA 5D9PA 3OODA 1EJ7L 1OB0A 4B4HA 3GU9A 1A5NC 2A3BA 1C91A 3BLDA 5F4XA 2DZXA 3APGA 4UR9A 3RPTA 1OYBA 4JX4A 4WKAA 2YCIX 3L21A 4UTLA 1YXCA 1GW9A 5CLWA 2KX9A 1WV2A 3BANA 2QMKA 5C5YA 2P88A 1V6XA 3C6CA 2BY1A 4MM1A 4DPPA 1XCXA 1SW7A 5M17A 4Z1BA 3W2NA 4GC4A 4A8LA 1G4SA 1NEYA 3AS1A 4MZ1A 1OG6A 4EXBA 1DOSA 3CT7A 1R5YA 3IK8A 4DAFA 1JUEA 1ZJHA 1OFBA 2FAPA 3OBAA 1H61A 3KAOA 3UR2A 1L8NA 5A8GA 3BCFA 3LNPA 2V9DA 1BXNA 2G37A 3WK3A 3H26A 1BFNA 3K1GA 4YL2A 4R7WA 4AHPA 1W26A 3C0SA 4HIBA 2QCDB 1FOBA 2PU1A 1DJXA 1QNPA 3GVGA 3LXAA 5G4WA 1Q6OA 4RNJA 4OOUA 4ATDA 2ALDA 4GNVA 5LXEA 1TPEA 3W7HA 1PKLA 3A13A 4GA8A 1QI5A 4QE4A 3U4AA 7ODCA 1YW5A 5EFFA 1ZQ5A 1UC4A 1YIXA 4JFLA 1MW3A 1QNVA 5LGZA 3EOLA 2WMFA 2OX4A 4XD4A 3QBUA 3KOFA 5I00A 1S38A 1JYWA 3MMDA 3SQMA 4GXPA 2X1TA 1SO5A 5A6BA 3VA8A 1KT0A 4DWSB 5E9AA 4HP5A 3HO8A 3TA6A 4GABA 3W2KA 2Z1WA 1TB3A 3DFHA 4O8RA 3WH8A 1N7KA 4GH1A 1H11A 1LOLA 1ME8A 6PTDA 1EO5A 1KBJA 4TR9A 2BFGA 4JXCA 2Q6ZA 3T42A 5AYZA 4REQA 4RCXA 4NX0A 5PTDA 1ZALA 1R0MA 3MSGA 1SPQA 5LA2A 3MSDA 3LHWA 1WDRA 4LS1A 3O5JA 1HP4A 2F8QA 1G01A 4G6CA 3LV5A 4U84A 3L0KA 3T78A 1SVDA 3NSNA 3M16A 4LS0A 1JR1A 1JCHB 2ZZ1A 3NFUA 3LCWA 4MNMA 3GVRA 4FLQA 2X1SA 1A5BA 3W53A 1FWWA 4L5ZA 2D23A 5CSYA 2CHRA 2X05A 4NAFB 3K4DA 4OV9A 2D22A 1E0XA 4HU0A 3O5MA 2V30A 3C0QA 2ZA1A 3QOKA 2CKSA 5D2XA 1TO3A 4RK8A 3RK8A 1ADOA 2MNTA 1FHVA 4L9ZA 4RNIA 4O53A 3ZQ9A 1ZAJA 4PCPA 4GKTA 1A5CA 2XP4A 1VQTA 3HM7A 1J12A 4LB4A 1DIOA 2Y5SA 3VX1A 3CHFA 1OFDA 4Y7EA 3C2OA 1HKWA 4MNLA 4PUDA 4XO6A 1D7KA 1HVXA 1RJRA 4C6QA 5I3GA 3UQIA 2OSWA 2WCAA 4AZGA 1QAPA 4UCGA 1VEPA 3BSHA 3O5FA 3AIUA 2V2HA 3N2BA 4GY7A 2YBVA 4JTEA 5HNNA 2G3FA 3QLDA 3TXVA 4HNCA 2QJNA 3E6EA 4LB3A 3IHZA 2OSXA 3UJ2A 2XP3A 3B8UA 4JHOA 3L4UA 2FYMA 4IX2A 4DLFA 5C54A 5FL0A 3ABXA 3PHAA 3QHMA 4E5TA 2X0SA 3EMQA 1M65A 1EZWA 4PMVA 2DZTA 1Q6FA 2VQUA 1EHAA 2WHLA 4AIUA 1FHLA 3ITLA 1E6PA 1W2VA 3A23A 4HNVA 1V3IA 4F4RA 2OZ8A 2IPFA 1LJYA 4WOQA 3GW0A 1XD0A 4LSBA 1DWHM 1FH9A 1FCUA 3W2LA 3KBVA 3G1DA 3LCFA 3U8GA 2W27A 3BQ6A 3GVVA 1ICQA 3UNDA 1F73A 1SJBA 3B03A 1Q6GA 2H8XA 4QP0A 1R47A 2RGMA 4I7UA 3GIQA 3MPGA 3GVQA 2V38A 5BRQA 3K4AA 1OZQA 3WLTA 1EJWC 4LAOA 1VIZA 3VIPA 5HULA 3SCVA 3GR4A 4F2BA 4FB7A 1FWSA 4ZO7A 1AW5A 1UD4A 2HS6A 3LMYA 4RUBA 1U83A 3EB4A 4JFTA 4TQTA 1PEZA 1QW9A 4XAGA 2PEVA 4TIMA 1F8AB 1J0ZA 2XFRA 3RN6A 1Q3NA 2DT2A 3ZWSA 1S2AA 1UR8A 3BMXA 3VKDA 3LQLA 1XDJA 1S2WA 4NAEA 1UUOA 1H1NA 2ZKMX 1JZ8A 3TN5A 4I7VA 3G1YA 1KXHA 1A3WA 1JPDX 1X1OA 3AXIA 1BVNP 1H0IA 4IGMA 3T08A 1JNDA 3VMOA 3C0LA 4IXHA 1O68A 5CLTA 3VDAA 4G50A 1V6YA 4Q8WA 2NT0A 1EP1A 1JAEA 1R46A 2GJLA 2J75A 2XP6A 1OINA 2XIBA 3EOUA 3MP4A 4LFYA 2ZC8A 5HWJA 2HVOA 4IIFA 1BKHA 3S9IA 4Q8UA 5TAOA 1OGSA 5FJJA 4KRUA 3W2JA 2NQZA 1PHWA 2WPGA 1BYCA 3RHGA 2R6OA 3M5XA 3M9YA 1PZ1A 1RPXA 5C9ZA 3GFZA 2WO5A 3ZJ8A 4OUIA 3SAZA 3IIPA 1CNVA 3O3RA 4W5UA 5JH2A 4P2VA 3VD3A 2CC0A 5T9CE 4AU0A 3DFTA 1P0DA 3W88A 1FA2A 1E6QM 1XH1A 3PBUA 1OY0A 3AS3A 2CITA 1UWUA 1RK5A 3PZNA 4ERAA 4KFOA 1K4GA 1KWGA 4OE7A 2DH3A 3GBEA 2VRQA 1JG9A 2CZFA 1OWQA 4UOZA 4NF7A 3H21A 9XIMA 3CM4A 1UYQA 3MQTA 3WD0A 2PPPA 2CNCA 4DN1A 1CPUA 3NL5A 3CTTA 4UUIA 2C1HA 3L12A 1ZK6A 2VD9A 4QBXA 1R3VA 3BSMA 3AC0A 4RE4A 3UJFA 2BVWA 3N1AA 1F6KA 3NPXA 3NR0A 3IS4A 4ODOA 1SO3A 4Z08A 4O10A 1GYLA 2A3EA 3LYEA 1LTDA 5HNUA 2A3LA 5JXQA 1B4EA 1KBKA 3MBFA 1M01A 2J24A 3JU2A 1K3UA 2OU4A 4WD0A 2QHAA 4K8EA 3BOXA 1BD0A 3GWQA 3R11A 3GC5A 2I16A 4AZBA 4ZPWR 1QHZA 3AHTA 1YXYA 5KITA 2EJAA 2ON3A 3RILA 1GG1A 3AXMA 3VM5A 4EOUA 4I6KA 5FJTA 4K68A 3UY8A 3D46A 4OJYA 3MCOA 2O56A 4DEFA 2NX3A 1G9HA 2WJFA 1BGAA 2VOMA 2ZUVA 5G2IA 3CUGA 2YKKA 3UWYA 1MXSA 4GBUA 3K5XA 2GSEA 3WH7A 2DG4A 3N2MA 1PAMA 5CQ1A 3PNUA 4P8VA 4J4OA 3AAMA 1W3JA 2XN2A 4C91A 3TONA 3USZA 2WK2A 2GDVA 1OD0A 2ACQA 2WV8A 3A4WA 5TIMA 2NSXA 1M03A 2HK0A 3GDMA 1UWRA 1DXEA 3DHDA 5DT7A 1PB0A 2YL6A 1QPKA 2WSYA 1REQB 3NZQA 1GOXA 3PRAA 1YXDA 4EPEC 1UKOA 3G8EA 4EF9A 4YTRA 2FDMA 4RNHA 3CO4A 1T40A 1HVQA 2BY3A 1HKIA 2OPJA 4LVGA 5MKGA 1UA3A 1PTAA 1HGWA 1W1ZA 3LUTA 5AHIA 5G5IA 2AKMA 1OM0A 2DUXA 1MXGA 4PTWA 1SMAA 2D69A 1OX6A 2I7GA 2CLEA 3TQVA 2ZDSA 2Y7FA 4PULA 3WDRA 3AIWA 1AW2A 2G0WA 1JQXA 2BMBA 5T9BG 1Q1CA 1CXEA 1E0WA 2ZYFA 4UR7A 1TQXA 1S5TA 3EDEA 1QHOA 4DJDA 1RD6A 1W1B1 5EBUA 1SGJA 2J7EA 4PSPA 3NL2A 3TMQA 3WLMA 1B9ZA 4W87A 4IHCA 4J2MA 3L4WA 3PR2A 3M47A 3P67A 2YL5A 3ONBA 3Q4DA 1PL9A 2Y78A 1IEIA 1M6JA 4QEHA 3FA5A 4IQLA 1GYNA 4E2OA 2MPHA 3S5SA 2A0NA 2OGYA 4DXKA 4IIGA 3L23A 3LM7A 2IMRA 3KVLA 3AS2A 2MANA 1KW1A 1WPCA 2ZRXA 3DGRA 4YYFA 4D6DA 3O5GA 3SIZA 3UY7A 3S1UA 4QNWA 3UWVA 3AIEA 1R7OA 2J9XA 1UZ4A 4F8XA 3EEGA 1AW1A 1H50A 1L8PA 1O5RA 3A5VA 4L80A 3DHFA 1ODUA 2QCMA 3GTFA 1B31A 3KZPA 3UNTA 2PDQA 1TPWA 3MKVA 4TMBA 1W37A 3RJYA 1E56A 3BG3A 3EEZA 3OG2A 1XPYA 3OLIA 1THFD 3TOPA 1QI3A 1QOQA 2FMNA 3Q45A 3WQPA 1P6BA 2JGYA 2VEGA 1WBJA 1RLCL 4IMGA 2W91A 1JZ6A 1W9XA 1OC7A 1HKMA 4JYSA 2CLLA 4F2UA 4CEXC 2PC4A 1QPOA 1VLWA 3DFOA 4UTWC 1IIGA 3CZEA 2HDJA 4M3PA 5JUVA 1P1XA 4CGTA 1TUXA 3M0KA 2Q8XA 2AL1A 4HZ8A 2OB3A 3PP7A 4MAVA 2XPBA 1AMYA 1Q4NX 1CLKA 4GBDA 4NJKA 1EC9A 1KM0A 1P6WA 4FXFA 5CSRA 1PHQA 4YN5A 4H2HA 3W87A 4MY1A 3R58A 4A8NA 3H24A 3L5MA 4OZOA 1R85A 1MQRA 2WMIA 2PDXA 3N25A 4Q8TA 3CWOX 1MW0A 2RH9A 3SGZA 1QPQA 1BTMA 1EGVA 4O14A 5HUOA 3FAWA 4P7OA 1OGGA 4MWAB 2A3CA 1Z48A 3CAVA 1KC7A 2P4VA 1JUKA 3KL3A 1J6YA 1BXCA 3MYPA 3HOJA 4NRSA 1R2SA 2PU0A 2YR1A 3DOPA 4R0XA 2XFWA 1BPLB 4L64A 3S5ZA 4XKYA 3OB8A 4DRNA 5I06A 5G2HA 2NV9A 3W01A 4AEEA 3CGTA 2DV0A 4Q3MA 3LRLA 4MYXA 3CWHA 3W1RA 2PBGA 1F5ZA 1BKSA 4GQQA 1QXLA 1B3YA 4JTRA 4QIBA 2ZXAA 4WXZA 1IZKA 4MWAC 4URIA 1E0UA 4XIMA 5BOEA 4IFRA 4JDBA 1VJSA 5FACA 4GHRA 4M6UA 5CZ0A 4LYKA 2QUVA 1HJUA 3RLVA 3T0CA 1EQ3A 4C5ZA 3JS3A 1SFSA 7ENLA 4KPLA 3VOGA 3WDPP 4QLJA 5IFPA 3W02A 2DZPA 2ISFA 4TX8A 1JCNA 3QZAA 1JQVA 2WVUA 1BF2A 1XYCA 1OFRA 3PPFA 4K39A 3BGJA 4R7JA 4F48A 4MJZA 4WOZA 3DXIA 2D1ZA 5AC5A 1W1TA 1H41A 3OLDA 3N2CA 4ILSA 5REQB 1CGXA 2XP5A 4XKMA 1LT8A 1A4LA 1I2NA 2ZZ3A 3MCMA 2BXZA 2WQPA 4KS0A 4LAKA 1V0KA 3U9IA 3HGOA 4ALDA 1HJSA 3PS7A 4V28A 3NJ3A 1AJ0A 1MUWA 3V4BA 3RX4A 2ZR4A 3OZYA 2P0OA 3DFYA 2F23A 1AD1A 4MY8A 4GO9A 4JR5A 3THCA 2VL4A 1TWSA 1XW8A 3GBDA 1KM4A 4DAIA 4I5XA 2Q3RA 3QR1A 1YADA 3N4AA 1UMYA 2CBVA 3H55A 1TMLA 2Q5AA 1XQKA 3N2OA 1SFLA 1HL2A 3U2EA 3O7UA 2XH4A 3O5IA 2W4XA 1UZHA 3PZGA 3KBJA 4US6A 3RR4A 4GI8A 1FKLA 1FH8A 1FUYA 2C71A 2GVLA 3CH0A 4LW7A 4MY9A 2AAAA 3UZYA 1JRCA 1XBVA 1XIGA 3MI2A 3GDLA 5CPQA 4KQZA 4L1WA 4E3VA 4KBXA 2FZMA 1KB3A 1OX4A 1E73M 4PUJA 4R88A 3PPGA 2LGOA 5HA7A 2YLAA 5TBOA 4HZ6A 3RXZA 3NM1A 3R0DA 1WUEA 3QHNA 2OEMA 7TIMA 3G2GA 1O95A 3GR8A 2JF7A 3UJSA 3GKAA 5A6AA 3N3MA 5HINA 3CQHA 4BEQA 4P7RA 4X60A 5FCZA 5SWUA 2OO6A 1MEHA 1XDLA 1RSCA 3FGCA 4S3EA 1OYAA 4E8GA 2IKIA 3GH4A 3JW7A 5HMDA 3W2UA 3OZPA 3WH5A 1EBHA 1K70A 3EA1A 4AMAA 3KCEA 4Z0JA 1Z89A 1E0VA 5D2YA 3FGCB 1RBLA 3ZVHA 4QM1A 4AC1X 4LAWA 4JKLA 2A79A 5LA1A 5I09A 1JVNA 1U5HA 4NJHA 1VZWA 1CB7B 4PFMA 3A4XA 3U2CA 2ZIDA 4RDZA 4N0RA 2Z1KA 4LRTA 4LYRA 2BV9A 3CZ8A 5G1TA 2BXVA 4CVWA 1BKFA 2BOFX 5BRBA 5F2LA 1YNYA 3EAUA 2DSZA 1F4AA 3N15A 1E43A 4Z2IA 5FD0A 4IISA 5CGMA 4GGQA 4CN1A 3G0XA 4EWND 4ERGA 1DTNA 3TDFA 3W76A 1YE4A 5F2IA 4XB3A 3W1XA 4C6JA 1SMDA 3KRZA 3LZ3A 3IV8A 2QF7A 1DWIM 3E74A 3RG6A 3WFAA 4C6FA 4XV0A 3QMTA 3HGJA 5DLCA 5E0KA 4FNSA 5DO8A 2XUCA 3WYZA 3RM4A 1N8IA 3LD5A 4PBFA 3W29A 2VZSA 1NSJA 2WKLA 5LHEA 4BKNA 1ZGDA 2FZ8A 1O6IA 3UZ5A 2WHJA 2DSVA 4OUEA 1XLKA 5I6SA 2D73A 3OGRA 1QUMA 2G41A 4MADA 4PMRA 1YTDA 4K38A 4QQ3A 1VPXA 1U30A 1ZY9A 4H4IA 1MMFA 3S6OA 4N4PA 1GWJA 4PMUA 3OW1A 3FAXA 2RDWA 2J66A 3KWXA 5BMWA 4CU6A 1VFHA 1G0CA 1NDVA 3B97A 4S3FA 2YXGA 4PCNA 3MTWA 1DL3A 1ZENA 5ABEA 4A2SA 2CWXA 3SCNA 4DM1A 1NDWA 1IE7C 1HP5A 3WQ4A 3VNDA 2XVLA 3QV6A 1LG2A 1HJXA 3HBLA 1VRDA 4U2YA 2WM0A 1Z3NA 1I1WA 4R9XA 3BLLA 3LHUA 1CZ1A 5BXPA 5D8ZA 1IWBA 4G1NA 1I2PA 3FKRA 1XSJA 5D4YA 1Q7ZA 5CC6A 1EHNA 1GQNA 3TSDA 4IF2A 2I5QA 5M3WA 2VQTA 4W7UA 1YBQA 1C7TA 1WYIA 1JCTA 2DZVA 2PCQA 5DRIA 3OEXA 3T2PA 2E40A 3MO4A 4JS3A 1VR6A 2E5DA 3ABSA 3PSVA 1KGXA 4A8IA 1GVYA 1Z44A 3K2GA 2V0TA 2G50A 1Q2SA 1MXDA 3AXKA 2GWNA 1E9LA 4ZPTR 1CXLA 5CPTA 4PGLA 2W61A 1JYVA 1JZ3A 2VVSA 4C7GA 5KTLA 1PX8A 1EYWA 3DECA 3S47A 4IMAA 3WJWA 2AMGA 2CYGA 2H9AA 1J0JA 3OP2A 2EXOA 3EZ4A 4WRHA 4FN2A 4JTGA 4NAFA 1U22A 1SR9A 3KAFA 2PGWA 1B3VA 4O2TA 3UCCA 3WMBA 5EMUA 3SCQA 2NLYA 3BW2A 4Q4RA 4UQ9A 3LHYA 4ZEPA 1HGYA 4LAYA 1S5NA 4BI6A 4TV6A 4PUUA 4PTDA 1YPIA 3C4UA 3COTA 3RLUA 1UOZA 4H7VA 2IF4A 4PC8A 1AVAA 1UWQA 4EE9A 4KEZA 4KEUA 4ZB2A 3EX1A 2INFA 4W7WA 3M5YA 2QPSA 1XYBA 4DZ3A 5M1TA 4C1KA 2VENA 4CQBA 2FJUB 4HQVA 3GG7A 4YWIA 3NA8A 2PV1A 3VKAA 5DCEA 1WAWA 5I5RA 2QLYA 4NP7A 3IV3A 3UCDA 1XCWA 3LLFA 3K30A 5G4EA 2PDKA 4DT4A 1WXZA 2PDMA 4LCQA 4CN4A 4Q4QA 4WZHA 3IRSA 2CETA 2NUWA 4D8ZA 4W9TA 3FXGA 4I9AA 3REQA 3WLPA 4AZIA 4IMDA 1RA0A 2PRLA 1FKSA 2YA2A 5DMMA 5E70A 3FLUA 1PWMA 3THQA 4NJGA 1KM2A 1VB9A 5K4ZA 3SQLA 5G1MA 5D2VA 2F6UA 3NQBA 4AWUA 2J6VA 5CXPA 1AH3A 2Y8KA 2QMJA 4UFKA 2CLIA 2GVJA 3KHJA 4LY4A 1UC5A 1IEWA 4KRTA 1OF6A 2WMIB 3FFSA 1GUVA 1YNQA 3W6MA 2JKAA 2B7QA 1RQHA 3DC0A 4QJ3B 1V0NA 4GXWA 4H19A 2VFGA 1B6CA 1TVLA 3ARWA 4GI9A 1XYMA 3P62A 4LUIA 1R9HA 4IICA 2PDCA 3MDWA 3TTOA 4MFEA 3S2NA 1AJZA 1PS9A 3AZSA 4DIPA 4FF5A 3BE7A 1CGVA 1FTXA 2C19A 3SM0A 2QDEA 3WQDA 4JNMA 3E0VA 4HN4A 2OELA 4J3XA 4W8LA 4X22A 2I5IA 2WSPA 4ZQPA 4GYKA 1Q7QA 4EP8C 2Y7EA 1KLYA 1E6ZA 1FFQA 4ZSUA 5FIPA 2PWEA 1CENA 2CW6A 1DIDA 5B7YA 3LHVA 2E77A 5E1QA 2CERA 3FW6A 2Q09A 1AG1O 5TNVA 2PI6A 3WEZA 3MBDA 5CSSA 1NDYA 1TTPA 3IAPA 1BRLA 2DG9A 3H9RB 1R3SA 2E28A 4GIVA 4G2PA 3EA3A 1FJDA 3PBWA 1IXNA 2Y62A 4ZCWA 1U1JA 1XLFA 3ARYA 1EDGA 1TSIA 4HD5A 4O54A 5DANA 1XL9A 3IJQA 2PN0A 3CUFA 2NXHA 3GZAA 4ZBCA 2OLAA 2R1KA 2ISSA 1JXKA 4FXSA 2OKOA 3ES8A 3CWNA 2HS8A 2DUZA 3CNYA 1PXGA 3N19B 4Y9PA 1M7PA 3UBPC 3WUBA 4Z2HA 3UPWA 3VILA 2OLSA 3FXYA 4UFLA 3QOMA 5CPSA 5A8NA 1TUFA 2PTWA 3FJ6A 5A8PA 1R9ZA 1XSIA 3WF1A 2H8ZA 1F3XA 4QCEA 2R14A 1CB2A 4D2JA 3MUY1 1Y65A 2GGIA 3G6LA 1IIHA 1KNWA 5D8WA 3GIYA 2HVMA 3CQ0A 4NXKA 1KM6A 3D3FA 3N12A 4PB3A 3W7MA 3NQAA 3TYAA 4Y9NA 2M08A 1PO9A 4C02B 2NLIA 1A5KC 4LNCA 1I0BA 4O8AA 1XINA 4E0CA 1OABA 5EY5A 4QX4A 4AIBA 4D1IA 3GFYA 1EX1A 4PMJA 3B9EA 1XD1A 1P4CA 3EWCA 1TYGA 3CPRA 4RDVA 4ZQOA 3P14A 3GLCA 4C1LA 1NDZA 4O13A 1GORA 3D6NA 2HSAA 2X8RA 2YDAA 4QG8A 3OGVA 4ZOAA 2PWHA 8TIMA 1FWEC 5FEZA 1B3WA 4C6OA 1JD7A 1AA1B 2CXEA 3SQSA 4IFKB 3UYCA 3I68A 4CCZA 3SGGA 5HW6A 2AGTA 2Q8ZA 1JDCA 2H6RA 1TIWA 1RQEA 3ZT7A 3AMGA 3DN5A 3P6LA 1E5NA 3TIMA 3G1FA 4DO7A 4QT2A 1MI3A 4IP4A 2ZE3A 3RAOA 3V5OA 1JNEA 1YPFA 1BTCA 5F4SA 1TR1A 1UW9A 1WZKA 3UWQA 1H60A 3BMWA 1PTGA 1W9VA 1U5VA 3K1DA 2V6AA 3N17A 1XLDA 3BC9A 3QPZA 5C6MA 4LUYA 4ECLA 2WJDA 3RCMA 1EJUC 3SECA 2QNEA 1TX2A 4XG1A 5DCBA 4B92A 4U5IA 3HV9A 5A6BD 2ATSA 1R3WA 3CUJA 3QW3A 4FS9A 4JFWA 1DHPA 1US0A 4HMEA 3CZLA 1WP6A 1FY6A 3FJ4A 4J7RA 1E3XA 2EAWA 2BX7A 2HE8A 5CSUA 3BH4A 2Z1XA 3LERA 3KBWA 3WQ5A 4JOMA 1XS2A 4UTHA 2WJEA 3TLQA 3EWZA 2DW7A 1ZBVA 2Y61A 4H41A 3ES7A 3OHIA 2YL8A 3ONCA 3E96A 1UKTA 3LUOA 4C6IA 2YB4A 2PWGA 1Q13A 4NZ1A 1ZAHA 3CL7A 2OFJA 4DYEA 1TJ2A 4EAYA 3GXMA 4HCDA 4AD1A 1DQWA 2TRSA 3KAIA 1FWRA 2VR4A 3NSMA 4G1KA 3OU8A 5HR7A 4RZ5A 4W9QA 1SO4A 5DF0A 1BG4A 3KWSA 5AECA 2BWGA 3OBKA 4L6HA 3PNZA 2UY2A 1JCXA 2HE5A 4Q33A 3K8MA 5C9RA 4Q8MA 2YLLA 4GIAA 1UD8A 1OYCA 1YLVA 5EU9A 1E1FA 5CJ5A 3GS6A 2GQ8A 1V7AA 1TJRA 2VEMA 1A7XA 4F0SA 2M1IA 3EPOA 4KCUA 3M46A 3DX5A 1LCOA 2A7PA 4XK2A 1E6XM 5I3DA 4D6JA 3SGUA 2BODX 1KRMA 1DBTA 2J6XA 1W5NA 3CHDA 1D9EA 2C7FA 1NFGA 1DIEA 2OOFA 2HRWA 1W9DM 4JCMA 1AL8A 1U33A 3LCGA 1HXVA 1F3EA 1EEPA 1HN1A 2AOSA 2UBPC 3WQVA 2QCDA 4HK6A 3UZZA 3ZWTA 4WJ8A 3S8HA 1ISVA 2XZ7A 1JJKA 3W7PA 1MNZA 4UQBA 3VGHA 2HZGA 1FKXA 1QNQA 3DFSA 3H4GA 1P7TB 2PRHA 5BRPA 4PMZA 5D09A 3VIKA 1GVSA 2FJKA 2VVNA 4WY0A 3OHMB 3F1QA 2WHMA 4BF9A 3GUWA 4AFYA 1K9DA 1LYXA 3WO8A 3SRFA 4M29A 4CQDA 2XVNA 5K9CA 3H2OA 1IT7A 4LUTA 5HJLA 1JF6A 3QYSA 3DHUA 4DRMA 3KZSA 2XTKA 4O28A 3T09A 4NZCA 4IUOA 1T96A 3BAJA 1TPC1 3I6RA 3KRSA 3IGUA 4JY8A 4GJIA 3WQEA 5HATA 3JYMA 4ODNA 4ITZA 2CLHA 5C2CA 2HK1A 3TDBA 3BCJA 3BZJA 4JZ5A 3ARUA 5ABTA 1GTHA 3SRDA 2R9RA 4XZWA 1WDQA 1U5JA 3R8GA 3MY9A 2DQXA 5FOOA 2GSJA 4U4MA 3GB6A 2RHGA 4OV4A 2I9UA 2GJNA 3A4AA 4JTQA 2CBJA 5JIWA 1LLOA 2G3MA 3L4XA 4IPXA 2MLZA 1R3QA 2YGYA 1WDSA 1GVEA 1PIGA 3ELFA 3WZ0E 3S2CA 1UR4A 1XYZA 3GNNA 3S2LA 1ITCA 1KBBA 2P8CA 5RUBA 3ZT6A 4M7SA 2PTZA 5HWMA 2VFHA 3QPYA 2WC4A 3MHUA 3I7RA 1FWTA 5HNRA 2QGHA 1XKJA 3TTQA 5H1WA 3NRKA 5BWFA 5K7JA 3WUFA 1H3GA 1KKOA 4ORMA 4Q6XA 1OFAA 1WOBA 5AY7A 2PAJA 1WUFA 3T2OA 3VZXA 1PSCA 2VURA 4KGJA 5D2WA 4F3HA 4KEMA 1CW2A 3W0KA 2R1MA 4UTMA 1ZJAA 5HKGA 3VE9A 1XCFA 2ZVRA 2WB5A 3IGXA 3IGHX 1AMKA 2NWSA 4IG2A 1SM9A 3U7VA 4KQNA 1OC5A 3QYQA 3RITA 3WLIA 2E9MA 4M7TA 1E4IA 3EKGA 3T4WA 1J5TA 2C15A 3T0AA 4PB4A 2QW5A 5XINA 1JNTA 3G5EA 3JVAA 4PSRA 3U4FA 4I90A 3FSUA 1ISXA 4QQUA 1M04A 4QSHA 3G77A 1I2QA 1YW1A 3P0XA 3O0KA 4M24A 2DORA 3BAKA 1D7JA 1ROTA 1Q5MA 3N3TA 1J6OA 4DRHA 1QOPA 1SW3A 3QMSA 3H4WA 1NIUA 2ATMA 4R27A 3VCNA 3VIOA 1RY8A 4CQCA 3A21A 3GNRA 4XWUA 1FHDA 2FVMA 4QJ4B 4UR8A 1X7IA 3UFYA 4BCEA 5FAJA 1KFLA 3LU2A 1FWHC 1ODZA 5LA0A 4JX6A 5I23A 1R3RA 3N29A 1TCOC 4AY8A 5C9UA 1WX0A 3W1TA 4K6AA 1PPIA 1SFTA 4N9DA 3LPOA 1B57A 3XIMA 1TVPA 1QPFA 4HMCA 2G95A 2Z6JA 2E6YA 2IXVA 1KLZA 1SJCA 1A49A 3LCXA 4MJMA 5DXXA 4NT0A 1EC7A 4MZ8A 1QK0A 3PK7A 1MO0A 3UXDA 1AZ1A 3QGKC 2PWFA 4QAWA 3DAQA 3WMLA 2PUZA 2RJGA 2JEPA 1DJNA 2PRMA 4H00A 2E68A 2DZAA 1NF0A 2DZWA 4IP5A 2F38A 3VNJA 3DDMA 3LV6A 4GZJA 4E38A 1N1AA 4QIUA 5GNYA 3N4FA 1CTNA 4KCVA 2ABAA 5DITA 3MMUA 3A22A 3CIVA 3N18A 3AS0A 4LEFA 4LWWA 2VKZG 2WKGA 3LB0A 5D05A 3LXCA 2F9RA 3F2DA 4RZ4A 3F5LA 3P84A 2AL2A 2PDGA 3N13A 4Z2LA 1PE1A 1E9YB 1G1YA 2VI0A 1W0MA 3F03K 1TR9A 1TRIA 2MLXA 3E0IA 3RM8A 1EIXA 3NQDA 1J10A 4ML9A 5LNRA 1FWJC 1R2RA 3GYCA 2ITKA 4AZCB 2C6QA 2WLZA 3TNOA 4WGHA 2J88A 1HJWA 3GY1A 2H90A 3O15A 1W17A 2A3AA 5BYWA 2Z25A 1GPFA 1D2KA 1TWDA 1EF3A 4QDPA 1W3TA 3TCSA 4IM4A 1X6LA 1BYAA 2O9PA 1L6FA 3LEPA 4YLWA 2VUNA 2VWTA 4OIFA 3CV6A 4DYKA 1S5VA 4IQ2A 4Y96A 4D1JA 5C9WA 1BQGA 3N6JA 3JUGA 3FOKA 4I5UA 4CD4A 1QNSA 4ODQA 3HF3A 4E4PA 3OTRA 2YDRA 3ARVA 1O5KA 2B81A 2VC7A 5IHRA 4MYAA 4DZ5A 2Q01A 2EF9A 2VCAA 4MG4A 1J93A 1KFKA 4AX7A 3TCZA 4Q8QA 1E9IA 3WMSA 1A3XA 2ZZ4A 2ZX5A 1L6GA 3G1XA 3MDUA 1QK2A 2WOQA 3C2FA 3M0VA 4J40A 3G0UA 1TWZA 4I7WA 3KE0A 1SSDA 4F9JA 2Y5EA 1T8QA 5D9MA 3W7EA 3PUEA 1F74A 3JXVA 3V75A 4DB7A 1GZGA 4GGBA 4B2DD 3AHZA 4CCDA 4GMEA 3H2FA 5L9FA 4OVXA 3WDIA 5ECVA 3C0JA 3PSWA 5H6HA 3VIMA 3OVRA 3TXZA 3MI6A 2CZ5A 1E5JA 5DFAA 3WLHA 3ARPA 3BTNA 1V3MA 3LCLA 3W2MA 2E7FA 4Q7BA 2D2GA 3APTA 4HHLA 1GQJA 2J8GA 3UVAA 4QG9A 5E9XA 4IJCA 2RUSA 3E1F1 5DX7A 3J7HA 2WSQA 1YTKA 4KIRA 1AQ0A 1QVBA 5MF5A 5F1VA 4AISA 1A5SA 1ZUAX 4UOQA 3CQKA 1LBMA 4O16A 3XISA 1HKKA 3W07A 2V63A 3WIJA 2WKJA 3WQ6A 4HBEA 3IIZA 5ECUA 1UZDA 3EA2A 4Q7NA 3TR9A 4XZIA 2VFIA 3KS6A 3LTSA 1V3KA 4S2CA 2QJJA 1B0IA 4DROA 3SRHA 1VGAA 1X1ZA 2E3ZA 2VC6A 4FOUA 2E4TA 3ITCA 2D3LA 4JN7A 1UH4A 3VGEA 2F2KA 2CHNA 3VOCA 3UA4A 3VNLA 4TX9A 4EACA 3L5AA 4H8VA 3TOYA 3Q37A 4BI5A 1JUBA 3HB9A 4ROPA 3NEVA 3BLOA 2WMKA 4XAPA 3QSRA 4S2BA 4S3GA 5HW7A 1MFVA 4DJFD 2PCEA 2PV2A 1ESWA 3SUVA 1MQQA 4PUNA 2Z1VA 2PPGA 4Y90A 3O0FA 1QDSA 4CLMA 1NOWA 3TYBA 3MZNA 9RUBA 2PWDA 2AAMA 1RD5A 4HJWA 2VYOA 3WNPA 3G8RA 1NQ6A 3NZGA 4UDMA 2XIMA 3GXNA 4ZXOA 1XX1A 3VGBA 1DEDA 2EQDA 3OQEA 5D2TA 3QXBA 3O5DA 3H70A 4IMCA 1XGDA 2X42A 4O15A 1Q4WA 4EPKA 1OT1A 1XG3A 1R7AA 6ENLA 2F84A 5AC8A 3ZOAA 2HXTA 2F7FA 2HEJA 1A3HA 4W84A 3SR7A 3LRMA 1LWJA 1UASA 3HFTA 4J5NA 3PZOA 1XXXA 2CBIA 2JIEA 1XR2A 1K9TA 3R79A 4HJFA 4GIYA 1OADA 3LSCA 1GONA 1EYEA 1F6YA 2KZHA 5AHMA 3VD4A 1ONEA 1VJIA 3CQJA 4NKCA 1H7WA 4IP7A 1DORA 3N34A 2A6NA 1JPMA 1CGUA 5CBIA 1F7BA 4QISA 3W1LA 1NP0A 4Q7IA 3WMCA 4XUYA 2YZRA 3TQKA 1D3HA 4PUMA 4E2DA 5HWBA 1GKPA 3AZTA 3HU7A 2WWDA 2EJ1A 1X6UA 3UF8A 2VEIA 5A6JA 4H1ZA 4HK5A 4FNQA 5BCAA 4PUEA 3H12A 3FKKA 1MEWA 1T7LA 1QASA 3P0WA 1HO4A 3R25A 5D30A 4V33A 5M5DA 2Y4SA 3A9BA 4J2PA 3MANA 4UOJA 4IQCA 3CV7A 2QCCA 1PX3A 5AN7A 4K7YA 2E6AA 2P3ZA 3QGVA 4Q4MA 1GHRA 4C6DA 1OEPA 3B0VC 1JDAA 4PRTA 3EWXA 1OCJA 3AU2A 3RIKA 5A94A 3W7IA 1QATA 4W85A 5FL1A 1H51A 3FYYA 2SFPA 2EKCA 2A21A 2BY0A 1KFWA 1K7EA 5AYYA 4AHOA 4BF5A 4HU4A 3WF2A 1XH0A 2FFIA 1R87A 1E15A 5CKSA 5LZLA 1XIMA 1TE6A 2DZUA 4FR6A 2H3BA 1O94A 1FCVA 4RPQA 1MVYA 5EA9A 5I24A 5FF2A 4NILA 2PP1A 1HT6A 3AHYA 1GQKA 1A47A 4DUXA 1T5AA 2XINA 3KDNA 3UEQA 2HPIA 1RR2A 1B90A 5HPCA 1J0YA 3P60A 1TV2A 3DKLA 3LXBA 3M0HA 3BOLA 4GWEA 2FHBA 4GIEA 4KF1A 4WXYA 2O55A 2XZ9A 3O6CA 3HPZA 2OVLA 4LTSA 4GXMA 1A4MA 1EWDA 3RUBL 2R1NA 3OIHA 4MUPA 4HPNA 5LIKX 2WPBA 1J0KA 1M1BA 3SFWA 4KWVA 3LX9A 2PZ0A 1XLJA 3AHVA 3WNNA 4AW7A 1K8ZA 3B8IA 1JZ4A 3OVQA 2QZRA 3E2VA 1HL9A 1GZ1A 4AWTA 4C1NB 4FXRA 2ICSA 3I3EA 1EUNA 1LT7A 1RY0A 3KLLA 2FVKA 4H9VA 1FXPA 4IPPA 1ZAIA 1QPRA 2VO5A 1K02A 1IXQA 2JE8A 4HSHA 3W74A 2F4EA 3W72A 2YXXA 3BG5A 2RSEA 2GUYA 4DUWA 1B2YA 1EDQA 4NSBA 3TFCA 1VBRA 2G3JA 5LHFA 1LP6A 4RW3A 1HNYA 3R1ZA 2FZ9A 3NVDA 5ABHA 3R7MA 4UFHA 2PPNA 3S42A 3STGA 4XAZA 1NWRA 2DVTA 2VT0A 4FNRA 2ISDA 3WD3A 3EB2A 1PYFA 1BRLB 3AQUA 2XN0A 3BURA 3P7YA 1Q6EA 3HPAA 4DLMA 1UKSA 3SSZA 2YB1A 3CJPA 4JL1A 1H7XA 3MKCA 4JEJA 4ZPVR 3QQWA 3STEA 3U6WA 1M68A 1FXQA 4CU7A 3EDKA 4HHHA 1UWSA 4NZ3A 1F05A 1ME9A 2J79A 3T1GA 1GW1A 4MNJA 2OG9A 3WQGA 5A2CA 4L4MA 5HANA 1EF2A 3LS9A 2FGZA 1TRDA 4ZGYA 1TA3B 3HMJG 4GQ0A 2ZX8A 3P80A 4QNEA 3LBCA 3V5CA 1XBZA 3U5UA 3G3DA 1TPB1 2TAAA 1VF8A 4QZVB 2ZZ6A 1X7FA 2QIIA 3GIPA 1KFBA 2VC9A 1CGWA 2GWGA 2XFYA 4HBOA 3YPIA 2GVEA 2PF8A 4BFAA 1T8XA 1UR1A 1LLZA 3KUMA 1R9YA 1RXOB 3NQ2A 5BXTA 2V3EA 4C60A 3RX3A 4A8RA 4TW6A 3HPFA 4P8WA 1QRQA 4XZLX 3CT2A 4YNGA 2ETNA 2NQ9A 1L2UA 2ACSA 4XZ9A 3U7BA 3MA8A 5EMLA 3C56A 3AIVA 1CT5A 1M9HA 3JZEA 1RALA 1Z32X 4QT3A 1J2WA 3CAQA 1HO1A 2VJXA 2XPAA 4OFCA 3SB0A 1GVRA 2OKTA 4W9OA 4NYUA 4PMDA 3EDDA 1OX4B 4UFMA 1XYLA 2GFTA 5JIPA 3NQ7A 3UJEA 4ODKA 4R5EA 2W63A 4XBKA 3WLSA 4YHGA 3EIPA 1ZSXA 1Q8JA 5D75A 3GK0A 2X7WA 3GHUA 2GGGA 3GHSA 5DMYA 3G6MA 4UXDA 4J1OA 1IEVA 1XFCA 1K9FA 1V3LA 4X9SA 3WQCA 1X38A 4S3DA 3BW4A 3MYOA 1LF1A 2WZEA 4FSAA 5A2AA 3KTSA 3UG3A 5CG7A 1UP2A 2GK1A 3TN6A 4JFSA 1VPYA 5DIUA 1JNSA 2ZUSA 3U5YA 3L0GA 2DJLA 4NUWA 1JCMP 4H8HA 3MV11 4H2CA 3GXPA 5HJYA 2B0MA 3N04A 3A3XA 5K9DA 3O05A 5I3KA 1EBGA 5IFTA 4UTJA 3AYRA 2EPOA 1JGMA 2QS8A 1C93A 1C8QA 2QJHA 3B0PA 5ABFA 2EG8A 3GNOA 1N2VA 1J6PA 3UF9A 4XTIA 2C0HA 5CEWA 1QW8A 1Z7AA 5CG0A 4R53A 4LV4A 3T7VA 3NDYA 2IUZA 4N9BA 4S38A 4PBGA 3AWNA 3CK5A 4RPPA 7TAAA 1E40A 5DBTA 3MUZ1 3BAXA 3V36A 4XAYA 1XP3A 5DY2A 3TLLA 1YPXA 4OBSA 1NMVA 1F61A 1OC6A 4S39A 3S9YA 1KM3A 4U33A 3F5KA 4HPGA 1UUQA 4UQEA 1FQ0A 4RJEA 2CZVA 1DWFM 4K36A 1JFXA 1GK8A 4IT1A 3H4XA 1KRCC 4IG2B 5CZJA 4WDXA 4HNOA 1G67A 3UXIA 4AB4A 2NQ5A 1LDCA 1VEMA 4QS6A 2C14A 1TPH1 2J7DA 4ACZA 2ACUA 2PD9A 2NVCA 3KCLA 3VAVA 1Q63A 1V93A 5BROA 3NZ1A 5HW8A 1B54A 3QFEA 3F4NA 4P7NA 1NMWA 4AG0A 3UCQA 4HNUA 4XUGA 4NI8A 3SUTA 4ATWA 2GUUA 3QY7A 3L2MA 5EMJA 2PDUA 5HAOA 2NWRA 3WDJA 3MT1A 4EWJA 3T05A 3WQOA 2R91A 4ZXLA 4QEEA 1IZJA 2V5JA 4CNUA 1XUZA 1EYMA 1G69A 4AZ6A 1DVJA 4Z42C 1LL7A 2XPKA 3WDQA 5A5WA 2G5WA 3R10A 3E2QA 2G8ZA 1OG0A 2R94A 4HOZA 1O1ZA 4W89A 3UT0A 2WC7A 2YYUA 3S1WA 3M1ZA 5I0DA 3BW3A 4LVDA 4WUIA 3H2EA 1QU4A 3KCJA 2KFWA 4LH8A 4DJEC 5JVLA 2A6LA 5FAGA 4XAFA 1GQLA 1T0OA 3RCNA 2PLCA 3CPUA 3QR3A 2ZQSA 1H5VA 1E1CA 5I79A 4DH0