1JNEA

Crystal structure of imaginal disc growth factor-2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Imaginal disc growth factor-2
publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
total genus 145
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jneA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jneA01
2YL5A 1NOUA 3O6AA 4TTUA 2E9LA 3L4YA 5CPTA 2ZWZA 5CZKA 3AIBA 3VDBA 1HKIA 4AIUA 2WSPA 3PTKA 5HNNA 4GXPA 5A2AA 4XX6A 3ZM8A 4IPLA 3ZO9A 3L4UA 2WZHA 3SIMA 5BXSA 1HL8A 2A3BA 3WBAA 2VQTA 2OSYA 4Z2JA 5A6JA 5I0DA 3T2OA 2IUZA 3ARXA 5AY7A 4C7DA 1ISWA 1E6PA 4E8DA 2WC7A 4GI6A 1VEMA 1W3HA 2OSWA 3ZT7A 2DT0A 1VB9A 4W93A 3WELA 1XCXA 2CHOA 3B9AA 3WMBA 1KQYA 4A3YA 1F4AA 2PBOA 1PX4A 1QI0A 5FL1A 4AISA 1HJWA 1E72M 3AYSA 2WNWA 3WIJA 2CITA 1CXFA 4JKMA 3BMWA 3UCQA 4OUEA 3II1A 1OM0A 1PEZA 3SCRA 4M82A 4GQQA 4XZBA 2ZX6A 3UESA 5DF0A 1OCQA 3SCWA 4P8XA 1GOWA 1EOMA 1VFMA 2QMJA 1V0MA 7CGTA 2FDMA 3ZR6A 3PZIA 8CGTA 4QP0A 3LMYA 1DWHM 4ZFMA 2WBGA 3MV01 4DWSD 3CHEA 4W7UA 1UD4A 1I1XA 5LA1A 3W81A 3AHXA 2VZTA 3TTSA 2X0HA 1JGIA 2VUYA 1J11A 1VFFA 1ZJAA 5EBAA 3W25A 1CGTA 2A3CA 2QHAA 4FMVA 2UY2A 3AMGA 4TVDA 4ACYA 2EXOA 5LYRA 2BY1A 3AI0A 5HPOA 4FLRA 4R5EA 2DH3A 1C92A 1EH9A 3GXMA 3CUIA 1TE1A 5D8WA 2W61A 2WVVA 1XH1A 3VM7A 3WH5A 3CTTA 4MB1A 4Z2HA 5JBDA 1H3GA 3OIHA 3UEQA 5D4YA 1ODUA 4M24A 4AD5A 2PWHA 3FY1A 3AHTA 1PIFA 3VGFA 2PWFA 5M5DA 1UD2A 1HL9A 4MNMA 2G4FA 4CD7A 2D20A 2V5CA 1E0WA 3RM4A 2W62A 7TAAA 3W37A 3M07A 4ACZB 1FHDA 2V5DA 4Y7EA 3OZOA 3BAIA 2J7EA 1KWGA 9CGTA 2XM2A 4CU8A 3QHOA 1WP6A 2VX4A 3NYDA 1BG9A 3EDDA 3RM8A 1W9DM 2ZUSA 1ODZA 1I1WA 2CIPA 5CGTA 3VGHA 1BVZA 5D9MA 1E6NA 2BNJA 5ABGA 1CENA 5A6BD 1WDSA 4MB3A 4ZEPA 4JFWA 4NRSA 3BAYA 4JKLA 3NJ3A 4N42A 3OGVA 2J62A 1DEDA 2YJQA 1ZBCA 4W7WA 3ARUA 1NARA 2YLLA 4UR9A 4JKKA 1NM9A 2WWCA 1OIMA 3W6MA 2V3DA 3CZJA 4AZBA 3SUVA 1B3XA 3GXIA 4W87A 4EE9A 3WQ8A 2BVYA 1UWTA 1HF6A 3OBAA 3OG2A 1VFOA 3GNRA 3SUWA 2J78A 3NSMA 2J74A 1J0HA 1ZBKA 2VURA 4UQBA 1R85A 2CBVA 3WN6A 1K6AA 4RE4A 3UR7A 1PX8A 3ZT6A 3TP4A 3IK2A 5A95A 4AZCA 3MMWA 1ZU8A 4KMQA 2ZIDA 4PN2A 1H4PA 4AIEA 4V2XA 2WKGA 4WK9A 3W0KA 5CLTA 4UQEA 2UWFA 2WBKA 5E9AA 4C7FA 1EDGA 1W3KA 1JZ6A 1TFVA 3RM9A 1E5JA 3U5YA 1JNDA 2BVDA 5IHSA 1HJVA 1X1NA 3A6OA 2G3IA 4CD6A 3OLGA 1JZ2A 1H11A 3CLWA 1US2A 4H7VA 5E0FA 4PMOA 1UKOA 3QR3A 2GDUA 1XSJA 3T2PA 3AFBA 5LA2A 3ZOAA 2VVNA 2JIEA 4PTXA 4ATLA 3SUTA 3WUBA 2XGIA 4J3UA 1W1YA 2E9BA 3FAXA 1VENA 1GOIA 2EPKX 2J4GA 3PBGA 3WD4A 3OLIA 3J7HA 2WHMA 2CBIA 2WHJA 1UKTA 2WCAA 1XYFA 3E1F1 2BY2A 4UQDA 3BAJA 1XH0A 3BH4A 2W92A 5C71A 1BVNP 1UQZA 2EQDA 1QNOA 3WDIA 4Q7NA 4W86A 1BHGA 2GK1A 1W1VA 1HIZA 3N04A 3ARWA 1UKQA 4AC1X 1XGZA 2BFGA 3GZAA 3MKKA 2WLYA 2DQXA 4E8CA 2VR4A 1QW8A 1CGYA 3ZIZA 3APGA 4F79A 4Q22A 1E4MM 2JE8A 3AMCA 4ATWA 2RGLA 1CNVA 1FOBA 4U33A 1MYRA 2DSVA 1D3CA 1GOKA 3VM5A 4RE3A 3I3EA 1K9EA 3WFZA 2ZWYA 4EK7A 4CCDA 3F5LA 1LL6A 2UY3A 3K8MA 2ZICA 4P7NA 1H2JA 1Q6FA 2WMGA 5BWFA 1HKMA 4PMVA 1HJSA 3M46A 1KQZA 3PTMA 1EDQA 2Y8VA 2VMFA 4UCFA 1AMYA 2EJ1A 1DWGM 4LX4A 1JDCA 3G6LA 1SMDA 2JFEX 2YDSA 2V3FA 3S6TA 4B9YA 2DT3A 2QF8A 4WIWA 3WDHA 4MNJA 1NWSA 1BYDA 4QCFA 2XVGA 2YDRA 5CSUA 1WZKA 2E0PA 1JG9A 2FH6A 1L8NA 3CHCA 1QI5A 5JIWA 2CEQA 2CYGA 3ZR5A 1FH9A 5FOOA 3BCDA 2DEPA 2XIBA 4DM2A 2WANA 5CXPA 4CUCA 1QBBA 1GORA 2CETA 2G8ZA 3ARYA 1O6IA 3NSNA 4XB3A 3VMNA 1V3HA 1FHLA 4MDOA 2IXUA 1W3LA 1GZJA 1UD5A 4HA3A 2JEQA 1HVQA 2W66A 2VTFA 4X0VA 3TTQA 4H2CA 1BSIA 1VEPA 4HOXA 1E73M 3AXHA 3EYPA 4LQ1A 2DSUA 1VIWA 5I77A 3ARSA 1QBAA 3VILA 4PMXA 1HP5A 2EBNA 1JIBA 3K46A 1GOMA 1QOXA 4JCMA 3MSGA 4D6IA 4K68A 5DT7A 4TX6A 1E4LA 1GW1A 1C91A 3VIKA 3MO4A 4D6EA 2WMJA 2XVPA 1NP2A 3WDQA 1CBGA 4CN1A 3SUUA 1X6LA 1W9XA 2DSWA 1UHVA 1E6RA 1E4NA 5ABFB 1UR4A 2J77A 3AS1A 3CPUA 2WPGA 3T0AA 1A3HA 2DSZA 1K9DA 5FIPA 1B31A 3NSXA 3KL3A 1KXVA 1G1YA 2E3ZA 3BLPX 2XVKA 2ESCA 2XGBA 3ZJKA 3WNNA 4PTMA 4J3SA 3AHZA 3CZGA 4W89A 4CN6A 5FL0A 1JZ4A 3T0BA 4AXNA 3AZSA 3VOCA 1JXJA 3VGBA 4HZ7A 4MJ4A 3ZJ8A 1YQ2A 3MUY1 3PZNA 3JUGA 1EXPA 1JYNA 1CZ1A 1OGGA 2G3JA 4UFMA 3W6LA 1LL4A 2AMGA 1H09A 1BPLB 2WLZA 1O7AA 3A3HA 1W9PA 4XUYA 3SCPA 2OYMA 3TOPA 3SUSA 4B3KA 5IXEA 5FKYA 2PWEA 4M56A 5LA0A 2WVUA 2EPNA 4MJ2A 4QDMA 5A6KA 4U31A 4LGXA 2GJXB 2VX7A 4FLSA 5BROA 4KWUA 2IXVA 2CCRA 1E6QM 1V3IA 4MADA 4NI3A 1C8XA 1UG6A 2Y4SA 3FHQA 1I75A 3GBDA 1W2PA 1J0ZA 4HU0A 1NH6A 4QLKA 3CHFA 1WCGA 3SCQA 1NQ6A 2O9OA 4LXFA 3W4RA 2V38A 3TTOA 4BQ3A 3MS8A 5GNZA 4JIEA 4CN4A 5BXTA 2E4TA 4PMZA 5D9PA 1ITXA 2WXDM 2JIWA 1W1TA 2C7FA 1Q6EA 1PX3A 3VD4A 3VDCA 4UFLA 3VO0A 3CGTA 4MB5A 2CERA 2TAAA 2PWGA 4KRUA 4B15A 4XV0A 3VMOA 5D8ZA 3WF0A 1VEOA 1JD9A 1V3MA 1Z32X 1E6ZA 1UYQA 5A8PA 1BLIA 4AMCA 4NF7A 1KCLA 3AIUA 5CG0A 3VX0A 3POCA 1G01A 4CKQA 3F5JA 3QHNA 3GM8A 4P7RA 5IFPA 4TTGA 1JYVA 1UH4A 5I24A 4QLLA 1LWHA 1TA3A 3T0DA 3FNDA 3WQWA 2GDVA 3VGEA 3IAQA 5CGMA 1LF1A 1VF8A 4D1IA 5M03A 2X0YA 1V6WA 1JL8A 4FLQA 4D6DA 1E40A 2Z1KA 4PYSA 2CPUA 3L4WA 4U2ZA 4WKHA 1J0JA 4DM1A 3WDPP 1JNEA 4PSRA 2PF0A 2XSBA 2VCBA 4GPNA 1B2YA 1OINA 3CIVA 1OSEA 1WO2A 1R7OA 2W67A 1WAWA 1E5NA 3PZGA 1ISZA 4P8UA 3F5KA 4EANA 4U3CA 2X05A 4GO9A 1BYBA 2J8FA 1VAHA 2DSKA 1E56A 1E1EA 2BHZA 3RCNA 1XRVA 2D0GA 1UWIA 2OSXA 3AMDA 4OOUA 4D6JA 2WZEA 3VIJA 4DUXA 1VBRA 1JDDA 2J7GA 1GQIA 2XWDA 4NRRA 3SCNA 1FP8A 5JBEA 1HKJA 3M6DA 5AC5A 1EO5A 3NDZA 1OT2A 3W24A 2WW5A 4Z2IA 3CUFA 3PHAA 3AJ7A 3WH6A 1VRXA 3A4AA 4D72A 3LPOA 4JHOA 5AC4A 3PTQA 4M80A 5GQBA 1N82A 3BSGA 4S3JA 3KE0A 3FN9A 4JFUA 1V02E 1AQ0A 4H8HA 3WF4A 4GI9A 4IPNB 5A6SA 1H1NA 1CLXA 1ISVA 4CCEA 4CU6A 2PBGA 3I3BA 2WC3A 5HDRA 1P6WA 2WVVB 4HOZA 5CPSA 4CVWA 3L2LA 1BFNA 2A3AA 1TR1A 1KB3A 3GDBA 1XCWA 3SCVA 4M1RA 4W7VA 4UZUA 3AS0A 4P8VA 5JH8A 3WQ5A 1B30A 3GH7A 4AZ5A 3TTYA 2YBTA 2ZUTA 3WFLA 2J7HA 2VCCA 3ZSSA 1UKSA 2BHUA 3LPGA 1CTNA 4TXEA 1B3ZA 3WDJA 3KEHA 5A6LA 4LYPA 1UA7A 4AWEA 4PEEA 1E70M 2VVSA 4JL2A 2D3NA 4P8WA 1IZJA 2VCAA 3GH5A 4MAZA 3WL0A 1E3ZA 2VO5A 2WCGA 3WF1A 1B3VA 4F8XA 4MB4A 2VZUA 1FFRA 1TG7A 1CGUA 1MVYA 2AOSA 1V6VA 3MUAA 3VGGA 1C3FA 2UY4A 5BRQA 8A3HA 4ZXOA 3L4ZA 5E0CA 2XYLA 5E09A 2XFFA 5I23A 1WDRA 3A47A 3O9NA 1CDGA 1MFUA 2BXZA 2GJPA 2AAAA 3N17A 1ESWA 5I3DA 2YL8A 3FAWA 2CKSA 2CKRA 2E9MA 2D1ZA 3GH4A 4U3AA 3PZ9A 2QLYA 3NDYA 5A6AA 4ZXLA 1QHPA 1GVYA 5GPRA 3ZSTA 1DP0A 1EQPA 3MSDA 4GZIA 2OWXA 3UG4A 4OJYA 3WNKA 3WMSA 3VIMA 1QNSA 1J01A 1EO7A 2QPUA 4DWSC 4PCSA 1NOFA 1GJUA 3K8LA 1W9VA 1ZBVA 3HJEA 4H8VA 3RJXA 1V3KA 1CGVA 4UOQA 2VZVA 4AZCB 5IHRA 4KRTA 2J7CA 1EQCA 3AXIA 5EMYA 2WB5A 4AZGA 3AROA 2F61A 2WVSA 1C8YA 2HISA 3VKKA 5A8QA 5HPCA 1V02A 1V3JA 3PZQA 1EHNA 6CGTA 1BQCA 1TMQA 4MPKA 1GHRA 3EMCA 1DWFM 1HVXA 1M01A 2W63A 2FHBA 2ZUMA 4DUWA 1NWRA 2NW0A 2Z1SA 5JIPA 1TVPA 1OB0A 2BY3A 3VIOA 1AVAA 1K9FA 3CHDA 1XV8A 5HXMA 3WD2A 2DIJA 2EPOA 3ARQA 1LWJA 2DIEA 1QVBA 2O9RA 3WH9A 1HN1A 3DYMA 4DWSA 4H8UA 1GQKA 3VDAA 4ATDA 1UWQA 2XFYA 2VZSA 1NP0A 1MFVA 2XPKA 3VD3A 3VVGA 3QHMA 1JF5A 4UOZA 4W88A 4PMNA 1ISYA 1SFSA 3OZPA 3EDJA 3B9DA 1E6SM 4PCTA 5FCZA 2XJ7A 3BAXA 3GNPA 4W8BA 4DWSB 2G41A 1QI2A 4OKDA 1PIGA 1W1PA 2VRQA 2GK1B 2BXYA 1KWKA 4W85A 2OYLA 1VJSA 2WMFA 2DT2A 1ZB5A 2JEPA 1KR1A 1J0YA 3KZSA 1KFWA 3CUJA 1FH7A 1HX0A 1E15A 3AIVA 1W3JA 3RJYA 1RD6A 5DFAA 1KBBA 1LL7A 2PI6A 4WJXA 3WKZA 3W28A 5A94A 1GUVA 1Q4NX 5IFTA 4IISA 2CESA 3FXYA 2A3EA 2QV4A 1E71M 2ZX9A 4J3TA 3WY1A 4YN5A 1WB0A 3UERA 2VNCA 5CJ5A 4UQAA 1VBUA 4AEEA 5FD0A 4GZEA 1E4IA 4C7GA 1MQPA 1QHZA 2VQUA 5BXPA 4PMUA 3WD3A 1CGWA 4CU7A 2XIIA 2FGLA 3WNMA 3DYPA 4FF5A 2F8QA 4HOWA 1TUXA 4H04A 1UH3A 1ZBWA 2O9PA 3WD0A 1H49A 2BVTA 4W5UA 2Y5EA 5A6BA 3QOMA 1BTCA 1HXJA 4WKAA 2YKKA 4PBGA 1KGUA 1HP4A 3VUPA 1BF2A 2J25A 3AS3A 4HP5A 2WSKA 1UOKA 3LPPA 4OIFA 3RIKA 3WENA 3RMEA 4JZ5A 1K9TA 2X1IA 2CXGA 1X6NA 2WM0A 2NT0A 5DEZA 2XUCA 1PAMA 4YHGA 1KXHA 1BGAA 4HMCA 3VIPA 4H41A 3WEOA 1WZLA 2WMIA 1M03A 1UWSA 4KH2A 3D5HA 2E8ZA 1R8LA 4KGJA 3AZTA 4WLCA 1WE5A 3F4VA 3RO8A 1VJZA 5BXRA 4BQ2A 2QPSA 4S3KA 3OLDA 4M8UA 1JFHA 1PJ9A 1JI1A 2Y2WA 3RPMA 2V3EA 3BXWA 2W91A 2CBJA 1JZ5A 1V0LA 1SYTA 1KGXA 5I6SA 4B16A 1QI3A 2J7DA 4TVCA 5I2UA 4DUVA 2GJRA 4PMDA 2OWCA 4AD0A 4W8AA 4J3VA 1JZ8A 1HJXA 1GQJA 1JAKA 1H5VA 2YA0A 5KEZA 3DYOA 1LQ0A 3AHYA 1M53A 3EDEA 3CMJA 3NIYA 4QAWA 3N15A 1GJWA 1BAGA 3IJ7A 2D23A 1DWAM 4BQ5A 5A2CA 3AISA 4AW7A 3TONA 3MMDA 1B3YA 3AICA 3RDKA 3WUFA 1JXKA 1SMAA 3CZEA 4GIAA 4L4PA 1UWRA 1V6YA 3THCA 2ZXAA 1OT1A 4FK9A 3ALFA 4D6HA 5M3WA 1G9HA 2FGZA 3CH9A 2EPMX 3TA9A 5A8OA 2OLHA 4NZCA 3WEZA 1Q6CA 1KXTA 3N9KA 4AZHA 1CEOA 1CWYA 1XH2A 3WF3A 1J0IA 3CUHA 7A3HA 1C90A 5DO8A 1E0XA 3T2QA 3THDA 5GNYA 1Q6DA 2FH8A 1E3XA 3VINA 1FH8A 3U7BA 3MMUA 4LPCA 2A3HA 2VX5A 1YHTA 3HN3A 1CLVA 4B9ZA 4OBRA 1JD7A 4U5KA 2ZUUA 2DGAA 1XD1A 4AZ7A 4JFSA 1ZL1A 2X8RA 3KL5A 1DWIM 5JUVA 1GONA 5EB8A 1J9YA 1HJQA 4UNIA 1QNRA 4CD5A 3I3DA 2VRKA 2YL9A 3AXXA 3AMLA 4AY1A 2HVMA 5D9NA 2ZX5A 1LG1A 1MW2A 2NSXA 1U33A 4HZ6A 4PMQA 3WQVA 3WNOA 2VL4A 3ARVA 2BY0A 1JZ3A 1SR0A 1LLOA 4BA0A 1B90A 1J0KA 2DPEA 2WYSA 1E0VA 5E6YA 3O2LA 5E70A 5F7UA 2VZOA 5I79A 4X0NA 2VJXA 3UETA 4B3LA 4M29A 3WMCA 3DHUA 3WQ4A 3N13A 3VD5A 2E40A 4XZWA 3BC9A 3W53A 1GVIA 4UTFA 1V08A 4U2YA 2XG9A 5BCAA 3ARPA 4LYQA 5TD4A 1UD3A 3OGSA 2YIHA 3W27A 3WQ6A 4AD3A 3HU7A 5CLWA 1J18A 4ZENA 1RP9A 1V6XA 1GHSA 2J47A 2VR5A 2WK2A 1E9LA 1UUQA 2DDXA 2WHLA 4MAVA 4AIOA 1TA3B 2XVLA 4D1JA 2VC9A 1PZ3A 3D3AA 2WWDA 5EFFA 1XYZA 3CZ8A 3QGVA 4WSJA 5D9OA 2ZXBA 5DMYA 3SCOA 1WDQA 3SCUA 4HMDA 1FP9A 1XD0A 2YBUA 4L4OA 2J7FA 3IAPA 3VNYA 4JCLA 3U7VA 4PUEA 2JF7A 1QNPA 5AYBA 3N1AA 1BYCA 2D0FA 1KR0A 3AIQA 3MU7A 3PN8A 1G5AA 1OD0A 1WPCA 3T09A 2VI0A 1TCMA 3L2MA 3WD1A 1GOQA 1CXLA 4HZ8A 3WH7A 2WMKA 1W9BM 2XVNA 4BS0A 4AEFA 2EPLX 1HJUA 1UQYA 2YA2A 2YL6A 1Q6GA 1GCYA 1UH2A 4GKLA 4J27A 4AYSA 1DWJM 2JF6A 1D7FA 3N11A 1J10A 1MXDA 1TVNA 5HOSA 1E43A 5ECUA 3VIFA 1WZMA 1IV8A 4J7RA 2XWEA 3BGAA 3IJ8A 4J28A 3BAWA 2WAGA 2BS9A 2YOCA 2CBUA 1XSKA 4W5ZA 1PPIA 4Z2GA 2W5FA 3KL0A 1WKYA 2D0HA 4D6CA 1UKPA 3MUZ1 5A2BA 1AQMA 4W8LA 4ZE5A 2O92A 2PWDA 4M81A 3VD7A 3UG3A 2WKLA 2J8GA 3U5UA 4ACZA 4BQ4A 1MW3A 1V03A 1C7SA 4CD4A 2YLAA 4BCEA 4A3HA 4AD2A 4HMEA 4WF7A 4CD8A 3IANA 4QLJA 3ECQA 1KXQA 1PZ2A 2C0HA 6A3HA 4GQRA 1W32A 3AHVA 1F4HA 2GFTA 2YA1A 3VPLA 4E2OA 1EIBA 3VU2A 4GO8A 4TX8A 5CSYA 3VTRA 4UFIA 3EBVA 1ISXA 3GYCA 3BCFA 4D6FA 3K4AA 1JZ7A 3GXFA 1V6UA 5IDIA 4Z2LA 1GQLA 3IJ9A 3M7SA 1WDPA 3W82A 4YHEA 1UZ1A 5EFDA 3ARRA 1ZJBA 2ZX7A 2OYKA 5A6MA 4QCEA 2OWWA 3OB8A 1US3A 1OGSA 1GPFA 1CXKA 1VFUA 4ML4A 3DHPA 3UG5A 3BAKA 3CZKA 4GI8A 3PZUA 4NSBA 3WNPA 5I78A 3W38A 3K8KA 4UQCA 3K1DA 4JHZA 1DHKA 1ITCA 1MQRA 2QMKA 1L0PA 2ZOXA 4TOQA 2J7BA 1MW0A 2WVTA 3N18A 1W9UA 3ZMRA 1UD8A 2J79A 1UR9A 3B8SA 3HMCA 1UD6A 3WSUA 1CXIA 4N0RA 3BLKA 4JL1A 2E8YA 2G3NA 2VRJA 2Y8KA 1FA2A 5DT5A 2G3MA 4BF7A 3ZQ9A 3VIHA 4IUGA 1CIUA 1R86A 4PUDA 1WNOA 3MUIA 1BYAA 1JI2A 2WC4A 1S46A 4P7LA 4IM4A 2VT0A 5A69A 3GXDA 1XHGA 1UR1A 3BMVA 4GZJA 4UFKA 4PTWA 3T08A 3CZLA 4PSPA 1C8QA 2V3GA 3WL1A 3WF2A 1TZ7A 3SURA 1NWUA 4D71A 3WH8A 1ECEA 1V0NA 2UY5A 1CXHA 2ZUVA 1JDAA 1BGGA 4PRWA 2XSAA 1Y7VA 2D24A 1E6XM 1CYGA 2F2HA 1QNQA 3VMPA 3PZTA 5BRPA 4F66A 3AS2A 4AD4A 1C93A 3AIRA 3WUGA 2EEXA 2WZIA 1V0KA 3ZJ6A 2ZXDA 1RPKA 1WZAA 3AOFA 3DC0A 4KGLA 4UZSA 1UR2A 3MV11 5CPQA 5AYIA 1E55A 1M04A 2WMHA 5C8BB 4LYRA 2Y24A 1UZ4A 1KBKA 1MQQA 1J12A 3MANA 4FLOA 1NOWA 1U30A 2FHFA 1JYXA 2ZX8A 1IZKA 1FFQA 1G94A 2GVYA 3GTNA 3FHAA 1AQHA 3CMGA 3SEPA 1G0CA 2BHYA 1EOKA 3B9EA 2X2YA 3WDRA 1CGXA 1XSIA 4MNLA 5A1AA 1CPUA 2PB1A 4J3XA 2D22A 3EMZA 3LPFA 4URIA 4JFTA 2W4XA 1JFXA 4BZYA 2ZE0A 3S2CA 4HPGA 1OWQA 3W29A 3CUGA 4OBSA 1QHOA 3VIGA 4CVUA 1E1FA 3UR8A 5GNXA 1LJYA 2EO7A 4OZOA 1B9ZA 3K4DA 4PMRA 3PZVA 3RILA 3G6MA 2ZUNA 3EDKA 3VD9A 4UFJA 3KWXA 4V27A 5A3HA 1QPKA 3VX1A 3SCTA 3SCSA 6TAAA 5ABEA 1RP8A 4F9DA 1GNXA 3WUEA 1W2VA 1EGZA 3OGRA 5A8MA 3ARTA 2D3LA 1BG4A 2WHKA 4R27A 4F9JA 2DH2A 4HA1A 1CXEA 1C7TA 3WNLA 1V3LA 1H41A 1A47A 2GUYA 1H0GA 1HT6A 4E4PA 4P7OA 3A4WA 1PBGA 2XM1A 1EDTA 1B0IA 1EHAA 5A8NA 5ABHA 2CNCA 3AYRA 4WKFA 4JFVA 3N12A 1UR0A 3AQUA 1HNYA 4J3WA 1MW1A 2O9TA 5JBFA 3NUKA 4UQ9A 2DT1A 1B1YA 4PMYA 3L4TA 1LG2A 3U57A 3EMQA 1H0IA 3ZT5A 5I5RA 1R87A 1UR8A 1JF6A 3OLEA 3WBEA 4HPHA 1EA9C 5ABFA 3A4XA 1MXGA 3L4XA 4P7QA 3VDHA 4UOJA 1QI4A 2WMIB 2VOTA 4HTYA 5HBFA 2C8NA 3WEMA 4X9YA 3AIWA 1HKKA 2NT1A 2XHYA 2FHCA 1B3WA 3OA5A 2WCSA 3PZMA 2CHNA 3PZOA 3VIIA 3ARZA 3QOKA 2ZUWA 2X09A 4EAMA 2MANA 3AIEA 2YDQA 2PC8A 5KZ6A 3NCOA 1XC6A 5CQ1A 1DTUA 3GBEA 1JAEA 2D2OA 3ALGA 4HU8A 1UWUA 4JAWA 2RGMA 4MDPA 5C70A 3FW6A 4ZE4A 2ZXQA 4OOZA 2VX6A 1OD8A 3EDFA 2XFRA 4U5IA 5M17A 4GINA 4UFHA 1ZS2A 5E6ZA 4Z2KA 3GNOA 4AZIA 4WSKA 1JYWA 4TUFA 4PTVA 2Q8XA 2GSJA 2GJXA 2XTKA 3BSHA 3AMKA 4W84A 1OGBA 5BYWA 3POHA 4AZ6A 4YPJA 1CECA 4CGTA 4D6GA 3L4VA 3DECA 3CO4A 2JALA 2BV9A 4A4AA 1OBAA 3VNZA 4RL3A 3VGDA 2J75A 1MWOA 1RH9A 1GOOA 3CBWA 4HA4A 3AZRA 1IT0A 2B31A 1W91A 1U2YA 4AD1A 4EKJA 1M7XA 1QW9A 1KCKA 4CCCA 1UA3A 4TVUA 3ZJ7A 1NWTA 1D2KA 4MNKA 1R7AA 4QFUA 4MTVA 1KGWA 4V28A 4RE2A 1OIFA 3W26A
chains in the Genus database with same CATH superfamily
4B5XA 1CB7B 1TIMA 3LZ3A 4ENLA 1F3WA 2VXNA 2E9LA 1DIKA 5HR7A 1K8XA 3TCZA 5CAHA 3ZM8A 3GIYA 3NOYA 4HJWA 3L4UA 5JXQA 4AMAA 3DFQA 4L61A 4XZHA 1M3UA 3WBAA 3CQJA 2VQTA 2GLKA 3R58A 2CLOA 5I0DA 4F0LA 5KITA 2VM8A 2HTMA 5HULA 1NTHA 3L65A 3NM3A 1ZCOA 1G67A 4GI6A 4JNZA 2OSWA 3BVJA 3O05A 1XCXA 4XIAA 3IRSA 4M0XA 1KQYA 2KR7A 5T9CE 5G1TA 3RU6A 4AHOA 1QI0A 4AISA 1ZP3A 5JVLA 5FJIA 1CXFA 3FJ6A 4O54A 3BMWA 6TIMA 1OM0A 3VNKA 2PZ0A 4N4PA 1W1B1 3SCRA 1OCNA 2VFIA 5DF0A 1YW1A 1R47A 4DPQA 4FXSA 2XP9A 1XLBA 3E2VA 5D32A 1LROA 4HGXA 4O17A 2FDMA 2V0TA 3ZR6A 3PZIA 1XI3A 4GBDA 8CGTA 2WBGA 2VEPA 4W7UA 1I1XA 1JQVA 3AHXA 3W81A 3TTSA 1MDLA 1JGIA 4DO6A 2ANUA 2QHAA 4BY3A 5TNVA 4TVDA 2V67A 5LYRA 2BY1A 2A3LA 3UI6A 3P62A 4E38A 2YB1A 4NQ1A 4FOKA 4EOUA 3KABA 1D8CA 5IOBA 1S3TC 4H01A 1C92A 4RUBA 3N6JA 2W61A 1LZOA 4R7JA 1XH1A 3VM7A 3NQAA 3DBNA 5JBDA 3UEQA 3G8RA 5D4YA 2X7VA 3GKAA 3GFZA 1FUYA 1PIFA 4LV9A 3VGFA 4IIGA 2PWFA 3U4AA 1GTHA 1R9HA 1PUDA 2YXXA 3VA8A 1ICPA 4L4MA 2G4FA 2D20A 4ZL1A 3T81A 2Y5JA 4TR9A 2WNNA 3OBKA 4HYRA 3KCLA 4Y7EA 2ATSA 3QLDA 3U2ZA 1ADOA 1LLZA 3BDKA 1XLHA 4F3HA 1KWGA 9CGTA 1KFEA 3JR2A 1WP6A 2VX4A 3EDDA 3URAA 3VZZA 5D09A 2ZUSA 1ODZA 3RRAA 2CIPA 5CGTA 5LKYA 1XRSA 3T07A 3W7HA 3G22A 2WJDA 1E6NA 2VEMA 1CENA 5A6BD 4MB3A 3BAYA 4AH7A 1PYMA 3A64A 2NQZA 3NJ3A 4N4QA 2YJQA 1JJKA 1ZCNA 1NARA 2YLLA 3QV9A 1NM9A 1TPFA 1NU5A 1OIMA 4Q8NA 3C86A 3QXBA 4ZS6A 2CHRA 4Y6GA 2BVYA 1HF6A 1NFGA 2Y7FA 1VFOA 3GNRA 5I98A 3SUWA 4O18A 2NQJA 4AVFA 1ZBKA 1DXEA 4XAZA 3FXGA 1K6AA 1UB3A 3LQLA 5REQA 3IK2A 5A95A 3EOLA 3JW7A 3MMWA 1ZU8A 4KMQA 1R3TA 5LIYX 3QGKC 3HQ1A 4DHGA 3SI9A 2FPYA 4V2XA 3T7VA 2WKGA 3M0VA 5CLTA 4UQEA 4UMAA 4GIRA 1BRLB 4GVFA 2WBKA 3W7CA 3TFXA 3ORWA 5C6MA 1F2JA 3O1NA 3DGBA 1JNDA 3RF9A 2FVMA 5IHSA 1X1NA 1XP3A 4ZBCA 3CWOX 3OLGA 1JZ2A 1US2A 5E0FA 3OZYA 5C54A 1UKOA 1DIDA 5I3IA 1QPLA 1PBKA 7ENLA 1DQWA 2BB0A 4XD5A 2VVNA 4NYYA 2ZZ6A 3SUTA 1S2UA 4YTQA 1TVLA 1W1YA 2E9BA 1Y0EA 2CFFA 4NZ1A 1W5QA 3OLIA 2NV1A 2WHMA 3DESA 1BXNA 1UKTA 1TX2A 2BY2A 4UQDA 4GUHA 3BAJA 1YRRA 3B97A 3BH4A 1BVNP 1QNOA 5I09A 4LT9A 3UR2A 1HIZA 3N04A 3ARWA 1SSGA 1UKQA 2DQXA 2QCHA 1CGYA 3ZIZA 1XUUA 4KETA 4ATWA 2C3ZA 1CNVA 2E68A 1GOKA 1OK6A 3ABZA 4KCWA 3QQ0A 1K9EA 5H2ZA 2XP5A 3UA3A 1XKJA 3O6CA 3GUWA 1LL6A 2UY3A 1RVKA 4P7NA 1TPB1 5F1VA 4R85A 2I9UA 2XH7A 1KQZA 3KOFA 3E2SA 3VOJA 2EJ1A 5I3GA 3EZ4A 3TR9A 2V3FA 3C0LA 3QH2A 2NX3A 1OCBA 4MY1A 1NWSA 3WK3A 4MPQA 3KCJA 2E0PA 1JG9A 1VFSA 4A3RA 4MLJA 2CEQA 1KFBA 4MGGA 1O4UA 3N3MA 3UPMA 4RZ4A 2NXHA 5DY3A 3MWAA 3WLRA 3B03A 1OYCA 1QBBA 3SY8A 2ZQSA 3TLLA 2RDWA 4GNJA 1FQ0A 3GDMA 3QY6A 1L6WA 4XB3A 2HRWA 4HZMA 2WPBA 5CG7A 4JN6A 1YPXA 2JEQA 1HVQA 1H50A 2W66A 6REQA 1BSIA 1K77A 2QKFA 2LJ4A 3ARSA 4Q4OA 1LUCA 3LNPA 1HP5A 2YSWA 3K13A 4D2JA 2QCEA 5DT7A 3D3FA 3TSDA 2PDCA 1YDVA 1XG4A 3MO4A 5MF5A 2PDFA 3GDRA 1UHVA 1E6RA 5ABFB 4GACA 1A3HA 5AC8A 1K9DA 3B0XA 1E1CB 1VCGA 4HU3A 3R0KA 2ESCA 1A0CA 3QF0A 1R5YA 4ASTA 1FXQA 2OEMA 4AX6A 4AU0A 3RX2A 3CZGA 3TWAA 5FL0A 3T0BA 4AXNA 2MNTA 3PM6A 3FYOA 3JRKA 3L5AA 4JTRA 4ODOA 3EPOA 3MUY1 1TPDA 3W7OA 3NTPA 1IEQA 1CZ1A 1OGGA 2O55A 4H1ZA 3RR1A 1H09A 1OFEA 3S2NA 3TYZA 1KM4A 1GGOA 4BI7A 3WQPA 5J6EA 3W7DA 2PDLA 4XUYA 4NILA 3SUSA 2OEKA 3BV7A 1JNSA 3L21A 4QEHA 4MJ2A 1EC8A 4INFA 5A6KA 2GJXB 3O07A 2VX7A 5A8GA 4ERIA 4QGCA 1FKDA 2PLKA 1IGSA 4MADA 1UG6A 4GC3A 1I75A 3W01A 3FAPA 1B3OA 3GBDA 1MUWA 1J0ZA 4ZPWR 3LN3A 1NH6A 1UJPA 3VKDA 3OOQA 4US5A 3CO8A 4NHVA 2PPPA 4GLEA 3MCNA 2FVLA 4CN4A 4O50A 1T6MA 4KFNA 5D9PA 4MWAA 3BWWA 2RFGA 2JIWA 2YCJA 1Q6EA 4DJEA 3O5MA 3VD4A 3VDCA 3AWNA 2FYMA 4IMGA 2A0NA 2TAAA 3WBXA 3EY6A 3OOBA 5FAJA 4KRUA 4IGNA 3VMOA 1KFKA 4NZ5A 4ZTXA 4C1LA 1JD9A 1V3MA 1E6ZA 1MEWA 3VCCA 3VCRA 5A8PA 1P1XA 2C18A 3IHZA 3GU0A 3E9AA 3S42A 5IBXA 3AIUA 5TF0A 2Q09A 1OFDA 3QHNA 4P7RA 2VDHA 4XSLA 4UNKA 4Y9MA 2P88A 4DZIA 5XIAA 1S1RA 4PL2A 2FLIA 4DUOA 2F6XA 2GDVA 3R8HA 5CGMA 4IXHA 3I7SA 4HCHA 3R12A 4TQTA 4D6DA 4XUGA 4M6PA 5ENLA 4U2ZA 5LGXA 4R34A 3IJQA 3PJWA 2M08A 4HT3A 5I3HA 1D9EA 1KBJA 1R7OA 1KRBC 1WAWA 1A5UA 1EP3A 4FIQA 1EWEA 3PG8A 3LYEA 4GO9A 2DSKA 1V6TA 2OELA 1PWMA 4K3ZA 4A21A 3RCNA 1XRVA 2DUXA 3UVIA 3NL2A 3NGJA 3LI1A 3VIJA 3IEBA 1JDDA 2J7GA 1YYAA 1ZTVA 4NAEB 1AD4A 3SCNA 2V2CA 4F40A 2F2DA 5JBEA 2ZE3A 1U1HA 4BEUA 1QRQA 1S38A 2WW5A 4PTDA 1Q85A 3EA3A 3LA4A 3LPOA 4JHOA 3SY1A 1XBVA 3T1GA 5HMFA 4WGXA 3TMLA 4CNPA 2I5QA 5FF3A 5GQBA 1N82A 4QROA 1IX5A 2LPVA 4H8HA 1QXLA 4IPNB 5A6SA 1HFBA 1ISVA 3IK4A 3UXKA 4CU6A 3I3BA 1PZ0A 1F7BA 4RPQA 5AC6A 1X98A 5FJPA 4CVWA 2MPHA 3G1FA 3G0UA 3VNDA 3BG3A 3SCVA 4UMCA 4W7VA 2D9FA 2Q5AA 4UZUA 1SZGA 5JH8A 4XD3A 1WUEA 4KESA 3M0JA 1VYRA 3TTYA 3OVGA 1UKSA 4ONVA 1OF6A 4TXEA 1ALDA 3USZA 4LVFA 3KEHA 2QF7A 4V1XA 4AWEA 4WX2A 3SZ8A 3IIPA 4JL2A 4P8WA 4GNVA 4GH3A 4XAYA 1LORA 2VCAA 3GH5A 3WL0A 2NV2A 1MDRA 1AG1O 3WF1A 4MB4A 2GOUA 3UP8A 1TG7A 1CGUA 1MVYA 4ZPTR 3C0JA 1W31A 1YPIA 1EL3A 4IICA 5HJYA 3SJ3A 5BRQA 3FEMA 3MDWA 4ZXOA 5E09A 1W1A1 2WNQA 3O9NA 2RAGA 2WOQA 5LZLA 4YNGA 1MFUA 4L4LA 2Z24A 2AAAA 1UIPA 3M0ZA 3HG5A 4J2PA 5I3DA 2YL8A 3FAWA 2D1ZA 4U3AA 1WBJA 2J9ZA 1KKOA 3ZSTA 3SIZA 1GVQA 3UG4A 3UXDA 3WNKA 3TH6A 4KQZA 3UZZA 2EG7A 4PCSA 3S9IA 2BOGX 3GC4A 3GC2A 1GK8A 2HZGA 4J4NA 4WXYA 2GDQA 1CGVA 3ATZA 4AZCB 5IHRA 1EQCA 3GXPA 2WB5A 4DO4A 2BGQA 1C8YA 2OGYA 2HNHA 3DFYA 3R13A 3VKKA 5A8QA 1V02A 5EBUA 1P0BA 2GQ8A 3QV8A 3ES8A 5C9RA 4C1KA 2FHBA 2ZUMA 1GYLA 2AQOA 1TVPA 2BY3A 4WJEA 5HWJA 2BP1A 3HG4A 4CQAA 4LFYA 2DIJA 3NM1A 4C6MA 1YBQB 1LWJA 4FXRA 2YB4A 4E8GA 4O14A 3NDOA 2O9RA 4N02A 1HN1A 1W5PA 5GPGA 3WH9A 2F84A 3GU9A 3DYMA 1SJCA 4DWSA 1FCBA 4X2PA 3VDAA 1UWQA 2VD9A 2VZSA 3EX4A 3O8AA 3FJNA 2VELA 7REQA 3GG7A 3N9SA 2G41A 1QI2A 3EOSA 4GCXA 1ITQA 2GK1B 1LCOA 2OYLA 4DH0A 1KFWA 5AOUA 1FH7A 4AC7C 4TW6A 3QMSA 9RUBA 4HSOA 3ITYA 2PI6A 4WJXA 3WKZA 4ICNA 3W28A 1GUVA 1Q6RA 4IG2A 5IFTA 2A3EA 1FWFC 4LY8A 1E71M 2GYIA 1B4EA 2ACSA 5K3VA 1ZK6A 4FR6A 3UERA 1IIHA 2YCLA 3H2NA 4YS1A 3PPHA 4IP4A 4GZEA 4XTIA 1GPWA 1Z8AA 4DN1A 3QRHA 3HG3A 1TUXA 3T42A 1UH3A 4B90A 1ZBWA 1GKQA 3IPWA 1H49A 4W5UA 3M0XA 1J6YA 3HTWA 3R89A 2A7RA 1S5NA 1HXJA 5LIKX 3HB9A 4POCA 2YKKA 3G3MA 4JEQA 1V79A 3VUPA 3AS3A 4AX7A 4HP5A 2IW0A 4GGHA 5F2MA 2WSKA 3LPPA 1DIOA 2ABBA 4QE5A 3WENA 1K9TA 3SY5A 3CWNA 3JVAA 4W9TA 2EGZA 1S2TA 4YHGA 3LNMA 2NXGA 4XG1A 5FJRA 1AW5A 3WEOA 3H55A 1WZLA 2E5CA 2WMIA 3D5HA 1R8LA 2IF4A 1M6JA 3WYZA 1ZAIA 3F4VA 4YL2A 1FWBC 3HGOA 3CB8A 4LEQA 1AL8A 2WJZA 2QPSA 3AAMA 4S3KA 4M8UA 1XBYA 1JFHA 5CCZA 2Y2WA 1R3WA 4OBTA 1ICSA 2CBJA 1XLAA 2OT1A 4B16A 5AKQA 2PDQA 3O16A 4DUVA 3D6NA 4H9TA 3GG0A 1ADDA 4GNKB 3KP1A 3UYIA 4AD0A 1JZ8A 4K7VA 1SZFA 2X0SA 4O1FA 2FVKA 1U5HA 3DYOA 1M53A 1S2VA 2JQXA 4QAWA 4FNQA 1BAGA 6XIMA 1WKFA 1K03A 4FXJA 1A5SA 4S2BA 3AISA 3CHVA 1TV8A 3H2CA 1IT8A 2QCDA 3WUFA 3DFOA 4KWOA 1SMAA 2V63A 1UWRA 3LCLA 3ALFA 1QWKA 3TA9A 1KBIA 3N2XA 3WEZA 5JQ9A 1Q6CA 4NJJA 3GTXA 1A4LA 3W86A 4PGLA 1F9CA 2VN1A 3LX9A 1T8QA 5FSDC 3TJXA 1LBFA 1Q2RA 1E0XA 4LV4A 1F6KA 3T2QA 3THDA 5GNYA 1Q6DA 2FH8A 2BODX 3MMUA 3LU2A 4JQ4A 4YXGA 2XN1A 4M51A 3SRDA 1YHTA 4JS3A 4KWSA 4JYSA 4C6PA 2WZTA 3BW4A 2DGAA 4AZ7A 4TO8A 3F4CA 4MLRA 1DWIM 4QT3A 3LZ5A 2TPSA 1M5YA 1GONA 3HGRA 4UNIA 3QVQA 4CD5A 1WX0A 1P7TA 4AY1A 2ZX5A 4GX9A 1U33A 1FKKA 2C6QA 3SN4A 2DZWA 2EAWA 4ADSA 5HUOA 5CJNA 1SR0A 1W1IE 4KS0A 3V18A 3IIZA 4ZO8A 3ZVHA 5K4ZA 2DPEA 1QTWA 1EJRC 2Y88A 5D37A 1E0VA 1Y65A 3DXIA 3O3RA 5F7UA 1XLIA 5I79A 3IIOA 4QG8A 4L1WA 4QT2A 3WMCA 4AQLA 1G4EA 3VD5A 2XH4A 3WLNA 3PUGA 4JFLA 4UTFA 4O8RA 2XG9A 5BCAA 3ARPA 5G1MA 4LYQA 3UZYA 3NVDA 1OFAA 1EP1A 2YIHA 4AD3A 4DPPA 2TSYA 5CLWA 1KV8A 4C5YA 3WMLA 1CW2A 2V5JA 1E9LA 2YR1A 3TSMA 1UUQA 4MAVA 4AIOA 4DJFC 3STFA 3DN5A 1H61A 1AUSL 1PZ3A 2CLEA 3F1QA 5D9OA 5MKGB 1M9HA 2UZ9A 1KM5A 4L4OA 3QFEA 4ZOBA 2PZNA 3SRHA 1QAPA 1YTEA 1BYCA 3O7UA 2D0FA 1G5AA 1WPCA 3T09A 2VI0A 1TCMA 4S3CA 2DJXA 2D2GA 2DVUA 1SZNA 4HZ8A 1H7WA 4FXFA 4OQVA 1YNQA 1X1OA 2F38A 5AB3A 5LSMA 3UZJA 1Q6GA 3UQIA 3SR7A 3HPSA 4C1NB 4J27A 3ABXA 2ZR6A 4KCTA 5D33A 1FDJA 4NUWA 1DWJM 3IRDA 4DIAA 3VIFA 4ZFCA 4Q8TA 2XP8A 1Z41A 4W5ZA 3GD6A 3BO9A 4WCJA 4C6KA 5ECVA 1WKYA 1ITUA 2DZBA 3MUZ1 1AQMA 4LSBA 2O92A 4LVAA 3U5UA 2J8GA 4ACZA 4BQ4A 2W6RA 1ME7A 1C7SA 5FEWA 4QSHA 1YXYA 4A3HA 4HMEA 4YYCA 3IANA 3O6YX 1A4MA 3H23A 1YE6A 2QUNA 2C0HA 1X1ZA 4XZ9A 2XINA 4GQRA 3RPTA 2GVEA 3MI2A 2INEA 4CEUC 1EJSC 4E2OA 1EIBA 5CC3A 3LRKA 4RV3A 4RKAA 1ISXA 1KC7A 1HO4A 3CTLA 2R1LA 3CM4A 2XIQA 3GXFA 1V6UA 1GQLA 3IJ9A 3M7SA 3DG7A 4YHEA 1UZ1A 2PDMA 3ARRA 2VC7A 1FDYA 3KS5A 5C55A 4ORMA 3SGGA 3M41A 2V69A 4X2RA 4KEMA 4DF2A 3UG5A 3H70A 3VYLA 4GI8A 3PZUA 5I78A 3OVPA 3WLQA 3W38A 4UQCA 1AA1B 3C52A 1R9ZA 1DHKA 3UA4A 1GVRA 2FZBA 4DXVA 3I6RA 3C8FA 3UFYA 1SJBA 3ZVIA 3S9ZA 4K37A 4QJ5B 5C2CA 3URNA 3NPWA 3B8SA 4TX0A 5CPOA 2HBVA 1IXOA 3WSUA 1K1DA 4JIHA 2Y8KA 2G3MA 4RDZA 2OTDA 3B8VA 1OFPA 2F7FA 1WNOA 3VNLA 3BGGA 4RW3A 1S46A 3KX6A 1Z48A 4GUGA 5A69A 4MZ8A 1WDDA 2ZRYA 4RZ6A 4QS6A 4NI8A 1EX5A 1WYIA 3T08A 2E6FA 1RSCA 2Q71A 3WL1A 4H9MA 1PB0A 4JX4A 5AYYA 1RLDA 3WH8A 1V0NA 2XSXA 1CXHA 1JGMA 4R33A 1R3YA 4B2DA 1E6XM 1O12A 2PPGA 4DRPA 3VMPA 4AD4A 3OA3A 3R8GA 3OG3A 2R82A 1RPKA 2PDHA 4GE8A 3VABA 2TMDA 1QOQA 4KGLA 2UZ5A 1THFD 1UBSA 2Z27A 3O5FA 3MV11 4K1GA 2P3EA 2WMHA 4JTTA 5C8BB 3F2DA 1KBKA 1MQQA 4NJGA 1SPQA 3MANA 1GEQA 2AGKA 2ACRA 4US5D 4PB3A 6ALDA 4IIFA 1A50A 3FYYA 3V36A 1FWEC 1A0DA 5J8LA 1IYXA 3NXLA 5EYWA 3UVAA 3WDRA 1LOLA 1CGXA 2H90A 5A1AA 1CPUA 3QGAC 4KW2A 4DJED 3LCWA 4F2UA 2X7WA 1LQ2A 4GHRA 1JFXA 1KV5A 1IR2A 5HT1A 1OWQA 3CUGA 1QHOA 4KIEA 3PG9A 5FESA 1E1FA 4ZMGA 3QSTA 3RAOA 4KF1A 1ZAHA 5GNXA 1LJYA 4OZOA 5MHBA 4PMRA 3P14A 4ZB0A 3V35A 1Q3NA 2ZUNA 3HM7A 3MQTA 3F4DA 4ZTYA 3VD9A 2Z1VA 1QK0A 3BK0A 5A3HA 1OK4A 5HAOA 1Q6QA 2INZA 6TAAA 3QM3A 1OC6A 1G6CA 1W2VA 1OFBA 3SQLA 4IPIA 4BI6A 2FPVA 2Z6IA 4HA1A 4LUSB 1C7TA 4ZQMA 1V3LA 1H41A 1A47A 1QMLA 1TR9A 4DZ3A 3TJ4A 4R9OA 4C60A 3TN5A 2XM1A 3RK8A 3T40A 4JFVA 4O8AA 3N12A 3ANVA 4J3WA 5JBFA 2J6XA 4UQ9A 1KM2A 4JIRA 1TTPA 1LG2A 4FNTA 2FB3A 3GXNA 1XX1A 1KRCC 1H0IA 3ZT5A 1JF6A 2GSHA 4LCQA 1MXGA 3FCPA 3KWSA 3U9IA 4FPSA 1HUVA 3QY8A 4JQ1A 5B80A 4UNLA 3OYXA 3U4FA 4HTBA 5E9XA 3AIWA 2VKZG 3CS2A 2OQLA 1WAUA 4BFAA 1FWAC 5CBJA 2CHNA 2Y5SA 1OVDA 1RUSA 2CZ5A 3ANYA 4EAMA 2MANA 2E5BA 3LCFA 1TWZA 3NCOA 1VR6A 2Y70A 2J8TA 2ZDRA 1FKTA 2ZZ1A 4B4HA 3MUCA 1YW5A 3FW6A 4MDPA 5C70A 3O15A 4OOZA 2OT0A 3KACA 1OD8A 2ASHA 1J4RA 3PRBA 1XW8A 2XFRA 4BF8A 4C6CA 3JYMA 2X2GA 3N9RA 4Z2KA 5AVNA 1JYWA 4JQ3A 3R43A 3GNDA 3G0SA 2GSJA 3P61A 4GUIA 1FCQA 3N4FA 3LHYA 3HOJA 2B7NA 4K8HA 1MEIA 3BG5A 4EIVA 1UCWA 4JTQA 3UZ5A 5CBBA 1KM0A 5LNRA 3PP7A 3KRSA 3VNZA 2Z1XA 4GK8A 2NQLA 2JKEA 3NO5A 4XD6A 1RH9A 1GOOA 2NUXA 3CBWA 4ZQPA 1PL9A 2ZDSA 3AZRA 3HIJA 3TN4A 2GVJA 4LOCA 3B8IA 3MSYA 3W1XA 3VK5A 5FJJA 4QFUA 4MTVA 4I3GA 1X8FA 1KGWA 3DHFA 2AL2A 1RR2A 1IEVA 1MEHA 3MI3A 2KI3A 1GW9A 1OYAA 1PVNA 1UROA 1X7IA 3L4YA 4N7QA 4EXQA 1IXQA 1V7YA 3KOZA 3DZ1A 1I45A 4OUIA 5HNNA 5A2AA 4XX6A 3GLCA 4UB9A 3ZO9A 4LUJA 2X1SA 2WZHA 5B7YA 1VLWA 3HPAA 4JTGA 3M5XA 5K9DA 4Z2JA 1GOXA 4JXCA 3WQDA 5A6JA 5HJLA 3ARXA 2C0AA 4AY8A 1R2TA 4AF0A 1B4KA 1S5WA 4WRHA 4H4IA 3NRKA 4B92A 3V5CA 1ISWA 5F2IA 3LLDA 2WC7A 3MO7A 3HGSA 3ZT7A 5LNVA 2DT0A 3TYBA 3PNZA 4O10A 3WELA 2CHOA 3WMBA 4K7YA 3E5BA 3FIGA 4QS5A 1EXBA 3JYJA 4IFOA 1PKMA 3H6OA 1DJYA 4PCNA 5FL1A 4W9OA 3MYPA 3UZXA 2WNWA 4Z1CA 2P0IA 4ODLA 3II1A 1AH0A 4YYFA 2GGGA 4ODMA 2YCEA 4M82A 3TX9A 2CLMA 2ZX6A 4XK2A 1XXXA 4X9SA 1ZHAA 3SCWA 4P8XA 1GOWA 4I7UA 2GZXA 3E3HA 4NZ3A 7CGTA 1V4YA 4PEKA 1XKYA 4H9YA 3PPCA 4GBUA 3LMYA 1YATA 3W22A 3HG2A 1LBLA 4DWSD 3CHEA 3KVKA 4S2CA 4TNSA 2X0HA 4MFDA 4JTEA 2PDKA 2Z00A 1ZJAA 5EBAA 1R0MA 3W25A 1CGTA 2UY2A 4WSHA 3AMGA 2XFWA 4LUTB 5HPOA 2FQIA 4FLRA 4JIIX 3QTGA 4R5EA 1OX6A 3PB0A 3GZ3A 1TE1A 2DG9A 2GQ3A 3W76A 2WVVA 3W1PA 4PBEA 1F40A 3M6YA 2VEFA 3NR0A 3CTTA 4HD5A 1H3GA 3OIHA 2P50A 3PF3A 1G4TA 1ODUA 3FK4A 1EYWA 1OG6A 3PANA 4A8RA 4EAYA 3RPDA 1OABA 1O5RA 3C4UA 1BSLA 1RD5A 5I03A 4MNMA 4GVGA 4X3ZA 4REQB 2V5CA 4QHRA 2YW3A 3N4AA 3HA1A 2BDQA 3W37A 2J88A 3IVSA 4PB5A 2V5DA 5FF2A 3CU2A 3KUMA 2KZHA 3QHOA 2GOKA 4HHLA 1BG9A 3RM8A 2PGRA 1A7XA 1I1WA 2YXOA 2JKAA 5CC6A 2Z2UA 3CQ0A 4UMBA 2FKPA 2PDYA 2PV3A 4LRTA 4JFWA 3ZWTA 4YTRA 1WV2A 4NNBA 2J62A 1AL7A 4EPEC 3ARUA 4OVXA 3GUGA 1E0TA 1M5WA 4GISA 2WWCA 3EX3A 1C9HA 3W6MA 3CUXA 4KR0B 4ODKA 4GCAA 3SUVA 3S5ZA 1YMYA 2OFNA 5EY5A 3GXIA 3OBAA 5D38A 3JZEA 1VPQA 3N14A 2J74A 5M1TA 1LT7A 5FI8A 3STEA 2F23A 2VURA 4UQBA 3H53A 1R85A 1J96A 2I7GA 2YDAA 3BJSA 3ZT6A 4FS9A 5CZTA 3TP4A 5DX7A 1F3EA 4KEZA 1Q13A 1UZHA 2X1RA 3TW9A 1LOSA 4PN2A 1REQB 4AIEA 3M9YA 3W0KA 1H1YA 3LS9A 1VCFA 5E9AA 1QK2A 4DY1A 3WG6A 1JZ6A 1TFVA 3KZ7A 1Q6LA 3U5YA 4KKXA 2BVDA 1B54A 2OR2A 4LC8A 5DMLA 1HJVA 3A6OA 2GWNA 4O2TA 3W3OA 1H11A 3PBUA 4RV8A 3RCMA 2Y62A 1FWHC 2Z2BA 5LA2A 3NWRA 2X16A 5DMNA 3MMTA 1ZCCA 1D7HA 3B8UA 1VENA 1GOIA 2EPKX 2J4GA 3PBGA 2CBIA 2KGJA 2WCAA 1XYFA 1M1BA 4ADTA 1VFHA 3V5OA 2W92A 1FCVA 1UQZA 1DOSA 2EQDA 3WDIA 4Q7NA 3M0MA 4W86A 1BHGA 1W1VA 1XIEA 2ZA3A 3VKJA 1XGZA 3MKKA 2DFAA 2Z6JA 2VR4A 5LXEA 2G3FA 1F8IA 4O15A 5DCDA 4F79A 1E4MM 4UR7A 2QJGA 2JE8A 2QNEA 2RQSA 1MYRA 3PWIA 4NT0A 2HSAA 4S3GA 3I3EA 5L9FA 3LUTA 3FGCB 4G7EB 4Z42C 1MRQA 1M41A 3F5LA 3WJSA 4AHQA 4S3FA 1TTIA 2B81A 2IKJA 4UTWA 3NURA 3M46A 4YVXA 3PTMA 1AMYA 1FTXA 3AU6A 1R2SA 5C9ZA 2EKCA 1IF2A 3AWOA 3UF8A 4B9YA 1K4HA 3Q58A 3P0WA 5CPMA 3EXTA 4X60A 4DF1A 1BYDA 2RUSA 1L6FA 1KTCA 1QPRA 3KRZA 2FH6A 3CHCA 1QI5A 5JIWA 4RNJA 1PCWA 2XIBA 4MZYA 5CXPA 4CUCA 3PA7A 1GORA 1UZDA 4KWVA 3CYJA 1AW2A 5CZSA 3T0CA 1GZJA 1XUZA 3HF3A 1PTDA 3PUEA 2VTFA 3GNXA 3TTQA 3KW3A 4IJBA 3ICJA 3C3NA 1E73M 3EYPA 3MDUA 3REQB 4MWAE 3SM0A 4A22A 3M64A 1GWJA 4DRKA 4UCGA 4GUFA 1TKKA 1NDVA 3K46A 2H3DA 3PUOA 4I5XA 4D6IA 2BGNE 4TX6A 4HNVA 4XKYB 4C6OA 5M2FX 1E1CA 2ZRUA 3FSUA 2EHHA 2WMJA 3QPZA 1J6PA 3WDQA 1CBGA 4CN1A 3SUUA 1QJWA 4DBSA 1E4NA 2J77A 4P61A 3AS1A 3M16A 5G4HC 3NSXA 3LRMA 3Q2DA 3KL3A 1EUAA 2I1OA 2E3ZA 4IH3A 4U85A 3ZJKA 5DCEA 1TRDA 1N55A 1OX5A 3W7IA 5T9BG 3SBFA 3QZAA 4W89A 1E44A 1G7UA 1EF2A 3LQGA 3C2EA 3VGBA 2ZRVA 4GXMA 4UWMA 4MJ4A 4JICA 1V51A 3PZNA 2VGGA 3Q45A 4MWAC 4MSSA 4L6DA 4FX8A 3GFXA 2Z7KA 4UFMA 3W6LA 4S1FA 2AMGA 3DEQA 1BPLB 2QVHA 3WLLA 1O7AA 3A3HA 4L9YA 5T91A 1W9PA 3TOPA 2OU4A 4NL1A 3HPXA 3NPVA 4L6OA 1EIXA 2WVUA 1RBOB 3CL8A 3Q4DA 4LGXA 4B91A 3TNBA 4JFKA 4FLSA 3TQPA 4PODA 2CCRA 1C8XA 2Y4SA 3FHQA 4ZOCA 5IBXC 1A5CA 1CCWB 3KOXA 3GK0A 4L7ZA 4HU0A 4QLKA 2JKPA 4GJJA 4AWUA 1F5ZA 3SCQA 2XH0A 4PUWA 1IR1A 4NX0A 3QZEA 1TWWA 4PTNA 4RNHA 1RA5A 3DG6A 4XAFA 3TTOA 4JIEA 5BXTA 2VD8A 1SFLA 3O63A 1P43A 4PMZA 3PBWA 1X38A 2OQHA 2GGHA 2HDJA 1OEPA 4O0ZA 3GNNA 1DJIA 4GX8A 1JPHA 1R3VA 4N19A 2KAUC 3W07A 2ZC1A 2CERA 4G2PA 4XV0A 4WDWA 3PFRA 2G95A 5TAOA 3LV5A 1H7RA 3WF0A 1VEOA 1UYQA 3G1HA 3OQ8A 4LUYA 3INPA 4FZIA 4AMCA 3JZUA 2R14A 1KCLA 3E0VA 1EJVC 2TYSA 3WK0A 5CG0A 3VX0A 3POCA 1G01A 4CKQA 2OMAA 3D0CA 3CT7A 2ISDA 1Y5WA 1JYVA 4XZLX 3PFMA 2JGQA 1K4GA 1TA3A 2XU2A 4GIVA 2NV9A 4N6FA 4Q8OA 1U79A 4D1IA 2J9YA 9XIMA 2DG4A 1T41A 4FAMA 1SM9A 5E0KA 2XP6A 1E40A 2Z1KA 5AYZA 2CPUA 3GVGA 1DPMA 3JXVA 1EPVA 3L7RA 3WDPP 4PSRA 2XSBA 4XZNX 4A3QA 3MP5A 4DBWA 2DZPA 3AJXA 2J66A 1QWGA 1ISZA 4EANA 4U3CA 3CV6A 1QO2A 3ITOA 1E1EA 4B2DD 3VZXA 4LS2A 4UTTA 4JFJA 3VOHA 2OSXA 5HWCA 2WZEA 4DUXA 3S2JA 3W7LA 3I6CA 3FOKA 3CV7A 3BW2A 2XWDA 3N2MA 4DLMA 1AK5A 1FP8A 4DZ5A 3M6DA 3CGNA 1TV3A 1V93A 1LM1A 3PHAA 4QNWA 3AJ7A 1Y8BA 1VRXA 2ZQ0A 3A4AA 3LSCA 2CWXA 2PDBA 4Q7IA 3PTQA 5CC7A 4UTHA 3CPGA 2FPTA 3ZYZA 1EGVA 4DJFA 1P0KA 4O16A 2ACQA 2PPOA 1V02E 5RUBA 4L3NA 4GI9A 1QPFA 1FKWA 1CLXA 3K4WA 1ME9A 4CCEA 3N2BA 1MNSA 1D3HA 3GTYX 1I8JA 1JEZA 3L2LA 2IKGA 2A3AA 1TR1A 3GDBA 2ONEA 2PGWA 3N29A 4M1RA 3C61A 1BWLA 4QJ3B 3LGGA 1QFEA 5D03A 4JYDA 1Q5MA 3LPGA 4OE7A 3IKDA 3WDJA 5H1WA 1WUFA 1UA7A 2VWSA 4PEEA 2VVSA 2D3NA 4TYOA 4FX6M 1FKRA 1N8FA 1QPNA 4UC5A 1R6WA 2WCGA 1B3VA 2GGIA 2PWUA 4F8XA 2VZUA 3SFKA 1FFRA 1YDOA 4ZO7A 2AOSA 1V6VA 1TV2A 4F2BA 1JCNA 1O95A 4IP7A 3AYTA 3LTYA 1K7FA 2ISFA 3S1XA 1JDFA 2TRSA 4IIBA 2XYLA 1MMFA 1OYBA 3A47A 4AB4A 4HNLA 1XG3A 5CEWA 3FSTA 3ITVA 1NQKA 3NPUA 2C91A 4XBJA 1JCJA 5DELA 4MYAA 1ESWA 4I7VA 3FDKA 2CKSA 2RUCA 2QXWA 1IWAA 1QHPA 1GVYA 2A4AA 3QR1A 2E6YA 3VIMA 1H51A 1QNSA 2GUUA 3BUVA 2E25A 2QPUA 3WQOA 1R3RA 4DWSC 3QMTA 4D9PA 1F74A 1GJUA 3DH7A 4QIUA 1W9VA 1TB3A 3RJXA 4B4FA 2YCIX 4PCFA 5REQB 3UY8A 2VZVA 4KRTA 2J7CA 1TWSA 3NO3A 2HPIA 3TQ0A 1VH7A 1I0BA 1YBQA 2HWGA 1V3JA 3PZQA 5I06A 6CGTA 1H60A 3WK1A 2P76A 1GHRA 1DWFM 2WV8A 3W2NA 2QV5A 1Z69A 4DUWA 1UASA 2Z1SA 2CLIA 5EMJA 1OB0A 1XLMA 1GG1A 1AVAA 3CHDA 1XV8A 2ALRA 3HZ3A 2NVDA 3RX3A 3EX6A 4S3DA 3ARQA 2DIEA 4PUUA 4GJIA 4UUIA 1XIGA 1K7XA 1MUCA 1QVBA 4FNSA 2FZNA 3KRUA 3FJLA 3SGZA 4AVNA 4IIHA 3EA1A 4H8UA 4GYJA 1GQKA 1TV4A 1NVMA 2XFYA 2FFIA 2OQYA 2XPKA 3RMJA 3VD3A 4CNNA 1SFSA 3OZPA 4RR4A 4ECLA 4KCUA 3EDJA 1UR3M 1Y5XA 1E6SM 3AC0A 4LWWA 2PLJA 4IT6A 4M3PA 3SSZA 1J2BA 4HCLA 2DUAA 3C8NA 4OKDA 1PIGA 4DYJA 2P5NA 3AUJA 2ZZ2A 4ZSUA 1VJSA 4JN8A 2JEPA 1KR1A 4Q32A 4RDYA 1H63A 4YIWA 1J0YA 4F0SA 1HX0A 1QDSA 1W3JA 5DFAA 5A94A 4Q4RA 1D7JA 1O94A 1T40A 5D2YA 2QV4A 1GEHA 2Q6ZA 3O5KA 3TDFA 1J5SA 3WY1A 1LDCA 1O68A 4JTLA 4YN5A 1POKA 3RLGA 1WB0A 3MBFA 1SJAA 4UQAA 4L56A 4AEEA 1FY6A 4C7GA 5H6HA 1MQPA 1QHZA 2LGOA 1SU5A 2NVCA 4PMUA 3R94A 1CGWA 4DO7A 3PSVA 5SWUA 3A3XA 3WNMA 1S5MA 4HB7A 1X97A 1TWIA 4HOWA 4H04A 1N8IA 4H8NA 4X61A 1GT8A 3KVJA 3QOMA 1CB2A 4P2VA 4WDTA 2MLYA 4WKAA 3C6CA 4G1KA 2VUNA 3SSJA 4AYGA 4PBGA 1KGUA 1HP4A 3CYVA 3EWCA 2ABAA 3DFSA 1UOKA 3P82A 4OIFA 3GU2A 3KVMA 4FB7A 2ZADA 1FWSA 1X6NA 4HVXA 2WM0A 1TIWA 2XPAA 1AW1A 2FMOA 2XUCA 4LEFA 1PAMA 1T0OA 1KXHA 2R91A 4LBRA 4O12A 4Y8FA 3URBA 2E8ZA 1PKYA 1IEWA 4KGJA 3PTDA 1UPMB 4WLCA 4M5PA 4HMNA 2P8BA 2VP8A 3BLFA 1LUCB 3RO8A 1W5MA 3MKCA 1JI1A 4QJ1A 1OHLA 3BXWA 2PSNA 1SYTA 1KGXA 2CLPA 2J7DA 2VFGA 4ICCX 3KTXA 3VE7A 2QVNA 3T05A 1HXVA 2OWCA 5DIUA 4B5WA 4BJHA 1HJXA 1GQJA 1H5VA 5HJXA 2R1KA 4MY9A 3M0YA 3UXIA 4QSFA 1LQ0A 1HO1A 4IPXA 3C2RA 3IIXA 3TR2A 2KO7A 3S6OA 2V2DA 4S39A 3QPYA 5D30A 4FNUA 1QPQA 3IJ7A 3QY7A 5K7JA 1DWAM 4HKPA 4BQ5A 3TONA 3MMDA 2BG5A 1B3YA 1SO4A 2X1UA 2OOFA 1V6YA 2GQ9A 2XN0A 4D6HA 1WXZA 1BQGA 4U28A 5M3WA 2EPMX 2PS2A 1KXTA 3KBVA 3N9KA 2NLIA 1CEOA 3SO7A 1XH2A 3GWQA 1KM1A 4DQWA 1J0IA 7A3HA 3GAYA 5DO8A 2PTYA 1E3XA 3U7BA 3EWYA 4LPCA 4UXDA 1K7EA 1Y5VA 3PBYA 2VFDA 3HN3A 1CLVA 4Q6XA 4WOQA 2R94A 4GUJA 4NP7A 4JFSA 5JUVA 4PMJA 2V30A 3KCEA 3W84A 1J9YA 2PAJA 1QNRA 2XZ7A 1TPUA 4ZO6A 2VRKA 4Z1AA 3AXXA 2NSXA 2PDJA 2HVMA 2WKJA 4HZ6A 4HU4A 3ARVA 4O13A 1LLOA 4BA0A 2BTMA 2WYSA 1XIBA 5E6YA 1R3QA 4WY0B 3U6WA 1DJHA 5E70A 1TTJA 5FA5A 1VLIA 2FB2A 4B3LA 2PMQA 4M29A 3FA5A 2Q8LA 2RDTA 5BXJA 4PUKA 3BC9A 1Z3NA 3W53A 4GG9A 5AYXA 4U2YA 4XISA 3LM3A 5G2IA 4Q4MA 1FJDA 3W27A 3NA8A 4E2DA 5AECA 3T9PA 1FKLA 3HU7A 2ZYFA 3B05A 1GHSA 1V6XA 1LT8A 2VR5A 3W7MA 2HBXA 1P5BA 2DDXA 3AUOA 2I16A 4JX6A 3D3AA 1Q6HA 4WSJA 3C5QA 3NZPA 2W79A 4XVDA 4E3VA 5HNRA 3TYAA 3LXBA 3PWAA 1XD0A 2YBUA 2J7FA 3IAPA 3VNYA 3U7VA 2JF7A 4PH6A 1YKWA 1FRBA 3UNDA 4C1NA 2B4GA 5PTDA 5E93A 3L2MA 3EWWA 1RALA 1GOQA 2DW6A 3V0SA 1CXLA 4J3ZA 4H6RA 1PHWA 3G1AA 9XIAA 2Z1WA 4OGZA 4BS0A 1CT5A 3R11A 2G50A 1W6TA 3OBEA 1Q6OA 1JPMA 3KRBA 3TV8A 3UWYA 1Q45A 2YL6A 3GY1A 3BMXA 1DJXA 3KTSA 2R1NA 3I4KA 4GKLA 3EB4A 3P67A 3RITA 1D7FA 3E5PA 3BJFA 1MXDA 5HOSA 1E43A 2W9MA 5ECUA 1WZMA 3NQ2A 4EACA 2PWVA 3IJ8A 4GQ0A 1GG0A 2WAGA 4ODNA 2H9AB 3NEHA 1XSKA 3G8EA 1PPIA 3UXLA 1EF3A 2PDPA 2W5FA 3TZFA 4M81A 2DV0A 3V0TA 3FDGA 2WKLA 3CV2A 1XYBA 3B0PA 1V03A 3E0IA 3EOOA 5KSWA 2YLAA 4MYXA 3ZLFA 4PULA 4WF7A 5E5CA 3I10A 3WJZA 1NFBA 4CD8A 1EYMA 3ECQA 1KXQA 1TPEA 3KAHA 4DRQA 3APTA 2VFEA 4B5VA 1W3NA 4N9BA 1UWAA 3SN0A 1WOBA 2Y61A 1F4HA 2YA1A 5C9UA 4YWIA 2GSEA 1RY0A 3W85A 2I56A 3D46A 4MF4A 8XIAA 1TJPA 3LHZA 3TK7A 2QUUA 3H12A 3LTSA 3EBVA 1ZZMA 2DUZA 4ITZA 3BCFA 4YMZA 4ZPVR 1JZ7A 3BQ5A 1WDPA 4QR6A 3L12A 4WVXA 4PFHA 4Q3MA 3S5YA 1W56A 1TCOC 3GIPA 1US3A 1GPFA 1ML1A 3DHPA 4ML4A 3R7MA 5LHEA 4M7SA 4O19A 2OX4A 4IQ2A 4NSBA 2XZ9A 3K8KA 1S2CA 4E3TA 3K1DA 2J6VA 1IWPA 4QDWA 1MNZA 3G1SA 4Q8VA 1ITCA 3DU0A 1L0PA 2ZOXA 1OG0A 1MW0A 4KWWA 1W9UA 3ZMRA 3H2AA 1UR9A 1J4IA 4H9UA 2RKXA 2UBPC 1UD6A 2GQAA 1CXIA 4N0RA 4TMCA 3ITXA 2E8YA 3O5DA 1TPWA 2NUYA 4UBPC 2DVTA 2V82A 1UPPA 4BF7A 3ZQ9A 2Y7DA 1R86A 3QPEA 1UW9A 3MUIA 2MNRA 5DO2A 2HE8A 5H8UA 2V6AA 4P7LA 4V15A 2TODA 2VT0A 3UPWA 2IKIA 1XHGA 5I00A 2BXVA 4IL0A 3UF9A 3W73A 4H19A 2PV2A 1C8QA 1YEYA 3WF2A 1TZ7A 1NWUA 3DERA 3H26A 1ECEA 1SGJA 4H83A 4DXXA 5I3KA 2UY5A 5FSEC 2ZUVA 4WHBA 4YTUA 4PRWA 1Y7VA 5EMUA 4LAMA 2C14A 7XIMA 1NEYA 1QNQA 1A5AA 3PZTA 1XLGA 3AS2A 3WUGA 2CW6A 2WZIA 2ZXDA 2PP1A 3KBMA 3LI0A 3KBWA 4OECA 2FTWA 5F4WA 3T55A 5CPQA 1VZWA 3IGUA 1M04A 2D73A 3S5SA 1AQFA 3Q65A 1R9XA 2FTYA 3UWQA 1U30A 2FHFA 4QM1A 4Y2WA 1RCXB 1K8CA 5GJNA 3DKJA 1IZKA 4IP5A 2GVYA 2OO0A 5DRIA 3ODKA 4K39A 1AQHA 3E38A 3NTYA 1JPIA 4H9ZA 1G0CA 2BHYA 4YTSA 3CQIA 2X2YA 1UIOA 3PBMA 1XSIA 4MNLA 5GJPA 3GTFA 3QLLA 2WQPA 2PB1A 4DLFA 2PTXA 4AWTA 2E1WA 3S2CA 4EXBA 3NOEA 1EJTC 4DJDA 4MVAA 3W29A 1ZLPA 2ACUA 4PRTA 4AVOA 4TV5A 2FMNA 2AQVA 3RLVA 1BXBA 4OT7A 3K4DA 5D02A 3W2MA 3PZVA 4IJCA 4FALA 3NQDA 1DVJA 3I4EA 4V27A 5DY2A 4DNHA 2ATMA 4FX7A 3WUEA 5A8MA 3HPZA 2QUVA 3ARTA 3VNJA 1BG4A 3BTNA 4R27A 4O1DA 4F9JA 2BOFX 1CXEA 3WNLA 1N7KA 1OZQA 2L2SA 2XP7A 1D3GA 1H0GA 3AO0A 1HT6A 3H2EA 3HQPA 2A7PA 1D7IA 3LGEA 3W75A 4JIPA 1EHAA 4GD0A 5ABHA 2CNCA 2F9RA 3CEUA 3KBJA 3AYRA 4WKFA 3O5GA 1AD1A 3K1GA 1UR0A 1QNVA 3IJDA 1HNYA 1Z7AA 3CL7A 3NUKA 1B1YA 3T4CA 4PMYA 3U57A 3RO6A 1K70A 3M7WA 1FAPA 3BCJA 3NZRA 1RQEA 2HCVA 1EA9C 4IPPA 3LCXA 4P7QA 3VDHA 1QI4A 4E2VA 1YX1A 2WMIB 1TJ1A 2VOTA 1NSJA 4HTYA 4NY2A 3L5MA 4ZGYA 4ROPA 4GGBA 3WEMA 4X9YA 2Z25A 2RUQA 5I02A 2FHCA 3OA5A 3NPXA 2Q01A 3PZMA 4WDUA 3TN3A 3VIIA 4RNFA 3ARZA 3B8DA 4A8IA 2ZUWA 3IGHX 2X09A 1VYSX 1KLZA 4RNIA 4OV4A 3TSBA 2YDQA 4R7OA 3PR9A 1WA3A 2PC8A 5KZ6A 3UJSA 3PSWA 4DJFD 2VEGA 1R30A 2RGMA 1L9WA 3CQKA 5BW6A 2VDIA 2VX6A 3LV6A 1ELSA 2X41A 5AN7A 1QPOA 3WLSA 4U5IA 3PPGA 3LB0A 4KBXA 1HW6A 1ZS2A 5E6ZA 1KM6A 4WSKA 4TUFA 3LBCA 4OV9A 3W72A 2XTKA 3SFWA 3MSRA 5AHMA 1Q63A 4W84A 3BZJA 1OGBA 2NQ9A 4YPJA 1PO9A 4D6GA 3DECA 3QSRA 2JALA 3KBNA 4G1NA 2Y89A 3DAQA 1OBAA 4LTSA 3VGDA 1MWOA 3TYDA 2FZ8A 1DORA 1IT0A 4HNTA 1U2YA 4EX4A 2PF8A 1M7XA 1QW9A 2P8CA 4CCCA 3ZJ7A 1D2KA 4MNKA 1TJRA 5U4NA 1OQFA 2ODOA 4RPPA 4H6KA 3VFLA 3UGVA 3N25A 4HPNA 5TBOA 2HV5A 2YL5A 4FP1A 1NOUA 5CPTA 2VYOA 4O1EA 1FX6A 2V5BA 3BW3A 2YXGA 4S3EA 1HKIA 4AIUA 3PTKA 3ZLHA 3STGA 3I6TA 4IPLA 2OZ0A 4LRSA 2R6OA 6PTDA 3SIMA 3L23A 1P7TB 3R10A 2A3BA 3M5ZA 2BBFA 3S2MA 2GL5A 1DBTA 2SFPA 2OSYA 1RBLA 5JH2A 4HNUA 1X6UA 4UIOA 1FBAA 3VZYA 3T2OA 3ZVHB 1VD6A 2IUZA 5AY7A 4RLIA 1KCXA 1HKWA 2NUWA 5DBUA 4L1GA 4LF1A 1E6PA 1A5LC 4E8DA 3NQ6A 1VEMA 4W93A 1OX4A 1F4AA 4IHCA 2PBOA 4IPJA 1BWVA 1PX4A 3VAWA 2NSOA 1HJWA 5BRBA 3T8QA 3WIJA 2CITA 1AFSA 3OTRA 4OUEA 4ZQNA 3I6EA 3QV6A 1PEZA 3P81A 4GQQA 4XZBA 3UESA 3W7EA 2FJUB 3QQWA 3TFCA 1VFMA 1V0MA 2A21A 4K36A 5J04A 2CU0A 3U3HA 4LUTA 4LAVA 4JTKA 4LNCA 4GQBA 4S3AA 3KAOA 2PDIA 3G3DA 2VZTA 2VUYA 1J11A 3U48A 2C1GA 4UTUA 4XZMX 3WLJA 3H8AA 3OYZA 1OADA 2PDGA 3SGUA 4C6LA 4RW5A 1ZSXA 1I60A 1O1HA 1K8YA 2QAPA 4CQDA 4DAFA 1EH9A 1A49A 4QE1A 5B7ZA 5D8WA 3LCGA 4LW7A 2J24A 2YFOA 4REQA 4ERGA 1ZQ5A 3UJFA 1RK6A 4K38A 4MB1A 4Z2HA 1JCHB 3MJMA 2F4EA 5DQPA 1XIDA 3HFYA 4DO5A 1GVSA 1NSGA 2PWHA 4KEVA 1YXCA 2D2HA 2M1IA 5M5DA 3BLEA 1UD2A 3WLPA 4CD7A 1E0WA 4IGHA 4P5UA 3RM4A 4E4UA 4TW7A 1I2RA 3CAKA 7TAAA 5AVHA 2V9DA 3M07A 4ACZB 1FHDA 1UMYA 4ODQA 2E77A 3OZOA 4EPBC 3IKGA 3KVLA 1H7XA 3BAIA 3CK5A 4O53A 1PXGA 1FKXA 2XM2A 4CU8A 1US0A 4WOZA 4N9DA 3T4WA 3NYDA 2INFA 4JTDA 3GU1A 1W9DM 1FWIC 3VGHA 4CQ9A 1BVZA 4NU7A 4IMCA 3TKFA 2BNJA 5ABGA 1WDSA 3V1PA 5CKSA 4JKLA 4W7WA 4WDXA 4FOJA 3S46A 4GVHA 2RDUA 4H7CA 3RU8X 1XGDA 5HW6A 4MZ1A 1XLLA 3GKFA 3MHFA 3CZJA 3W7PA 1OC7A 4XSMA 1B3XA 1LP6A 3WQ8A 3RG6A 1IWBA 2QEZA 2J78A 1J8VA 4BK9A 4Y9PA 3W2UA 5JU6A 2CBVA 3WN6A 2A6NA 3KLLA 4MUPA 5KETA 3EEGA 4JQ2A 3GHTA 4YVPA 3UR7A 1PX8A 3B0UX 2BMBA 3W1UA 3UU0A 2ZIDA 4Y9AA 3EWZA 4LB4A 3P80A 1AH3A 4ZOEA 4WK9A 2UWFA 2OJPA 4FN2A 4JHMA 2NVAA 3MW7A 1H62A 4C7FA 5GVJA 1EDGA 4I9MA 2G97A 3CH0A 3RM9A 5EU9A 3EA2A 2OLSA 3TVAA 1J6OA 3L0GA 2GGEA 2DQWA 5HKGA 3CLWA 3DCPA 3R1ZA 1KNWA 4AHPA 3IV3A 4PMOA 1I0DA 3DI0A 3QR3A 3PB2A 2V68A 4OHQA 1AJ0A 3BE7A 3ZOAA 1IE7C 2ZA1A 1EWDA 1RAKA 3NEVA 4PTXA 1NFPA 4ATLA 3WUBA 3LBOA 2XGIA 4UTWC 4J3UA 3FAXA 5HK4A 3J7HA 4QQ3A 1T5AA 3L0KA 1DE5A 4GYPA 3OP2A 1D7KA 4KFOA 3BJTA 3IACA 4QNEA 4AC1X 3GZAA 2BFGA 2RH9A 3BANA 2WSRA 4NG3A 1EEPA 4E8CA 1QW8A 4GQGA 4LAKA 3IUIA 4ORIA 3GSMA 4JTJA 4Q22A 1EKOA 2OEJA 2XDFA 1FOBA 3VM5A 4KCVA 5FEPA 3WFZA 4LAOA 1FKSA 3VC5A 2ZWYA 4LCRA 3K8MA 2ZICA 2BWGA 1H2JA 2OGJA 1EBHA 1FWWA 1GTEA 3KHJA 2FZDA 4PMVA 1HJSA 2IS7A 3AU2A 5HWBA 1EDQA 2VMFA 2HS6A 4LF2A 3W7GA 1JDCA 3HV9A 3G6LA 2QGYA 5I7GA 3IUHA 4JFIA 1UJQA 5HQLA 3S6TA 2DT3A 2PV1A 4O4VA 4WIWA 3M0KA 3WDHA 4MUZA 4QCFA 1RV8A 2XVGA 2YDRA 3DFPA 5CSUA 1WZKA 4A8NA 3WBYA 4EWND 2CYGA 3ZR5A 1FH9A 5FOOA 3BCDA 3K2GA 5F2LA 5JMUA 3QW3A 5CSSA 3PBVA 4DM2A 5C2GA 3MB9A 3COTA 3MVTA 4Q4PA 4E4FA 2GWGA 1ZPTA 2CETA 2G8ZA 2V5KA 4EVZA 3REQA 1D8WA 1ZENA 5CC5A 4EF9A 1FHLA 4MDOA 2IXUA 1IXNA 2QYGA 1UD5A 2MLZA 3QEZA 4DELA 3GW0A 3I7QA 3U2EA 1E9ZB 4X0VA 4H6QA 4H2CA 1VEPA 3V16A 4HOXA 4R0XA 3AXHA 3GW3A 2DSUA 4LVGA 5I77A 1PWLA 3THQA 4PMXA 2EBNA 1JIBA 1GOMA 1QOXA 3MSGA 4K68A 1Z89A 4H00A 1PZ1A 1O5QA 2QCLA 3MHUA 3QYSA 1GW1A 1C91A 3UQBA 3VIKA 4D6EA 1LRTA 1GVFA 1NP2A 4XZIA 2PLMA 1W9XA 3HMJG 2DSWA 1TSIA 4CNSA 1UR4A 4DRMA 1XGEA 2WPGA 1VHNA 3Q94A 3T0AA 1PKLA 4XBKA 3G2GA 5FIPA 5DLCA 1G1YA 1JCXA 3BLPX 2XVKA 3NO1A 3UW6A 4D8LA 1NY1A 1F6PA 3TMQA 4J3SA 3CV1A 3LK6A 2CZVA 4CN6A 5EKYA 4DIPA 1JXJA 1PTGA 2HEJA 2DZAA 3SRKA 3W7KA 4HZ7A 3ZJ8A 3AALA 1YQ2A 3JUGA 1EXPA 1JYNA 3DFNA 2G3JA 1LL4A 3DUGA 4E5TA 2N87A 1DXFA 4Z1BA 3O5OA 1W26A 3SCPA 2OYMA 4QG6A 7ODCA 1EP2A 4W9QA 1T99A 2XIJA 4QDMA 3OZMA 3KOWA 1FDZA 1J5TA 4KWUA 2IXVA 4I6KA 1TO3A 1E6QM 4NI3A 1W2PA 4NXSA 3WK2A 2H8ZA 3WBWA 3L0NA 5F2GA 2O4MA 3CHFA 1WCGA 1NQ6A 4CNTA 2O9OA 3MA8A 5HNUA 4LXFA 3W4RA 4HPJA 4V1YA 4BQ3A 1SZEA 1PV8A 4UTJA 5HMSA 5XIMA 1ICQA 5IM51 2OKTA 4RCXA 3WLKX 3WJXA 1GKPA 5AHLA 1W1TA 2C7FA 1FD9A 3VXGA 2DZSA 3HJZA 4UFLA 2AL2B 4GIYA 3CGTA 1GKRA 3LERA 4AY7A 1OFQA 4B15A 1Y0OA 3EOEA 4XIMA 2PLCA 5IDZA 2WSYA 1OY0A 3B06A 3EPMA 1BLIA 3F03K 1KO0A 1MZRA 3DX5A 2R24A 1SUXA 1JQXA 4LVDA 4UTTC 3ME3A 3F5JA 2AMXA 3T0TA 3GM8A 3KOYA 4TTGA 2ZCGA 1AJ2A 1UH4A 2VOMA 5I07A 5I24A 4QLLA 1LWHA 3FNDA 3XIMA 3WQWA 4AF0B 3URQA 3IAQA 3VGEA 3UCCA 1VF8A 2ZVRA 1U1JA 2QR6A 2GPTA 4EWJA 3EAUA 4QEEA 1Z9AA 5M03A 1ZALA 1JL8A 4PYSA 1YDNA 2ZQVA 5DXXA 3L4WA 2REQA 4WKHA 4LS0A 1JNEA 3KLKA 2PF0A 4IQDA 3A23A 2VCBA 3NZ1A 5D05A 1B2YA 1OINA 3CIVA 1OSEA 1WO2A 1MXSA 2QPXA 2XN2A 3H2FA 4A29A 3PZGA 3IJ6A 4UTLA 4P8UA 3GDLA 4JY9A 1VAHA 3W2JA 4WEVX 1YDYA 1E56A 4GRSA 3W6YA 2GVGA 1C9DA 2MUCA 2BHZA 3UQAA 4DF0A 5E1QA 2D0GA 1UWIA 2OZ8A 4HJFA 4N9CA 4OOUA 2K8IA 3D47A 1VBRA 1OC5A 2IQTA 4RE0A 3LM7A 3UCDA 3GRIA 3ZLGA 3LGDA 3LOTA 5CH9A 4IFKA 4TX9A 5AC5A 3NDZA 1OT2A 3W24A 4Z2IA 2J27A 3SRFA 1OJXA 2VGFA 3WH6A 5DITA 5AC4A 3P6LA 4M80A 3E2QA 2HXTA 1XQLA 3BSGA 4S3JA 3E2RA 2OFJA 3FN9A 4JFUA 1AQ0A 2AKZA 3WF4A 2Z1BA 3B4UA 1DL3A 2IQDA 3RHGA 3GQYA 2A6LA 3ITTA 2WC3A 3N3TA 2WVVB 4NYUA 5TQLA 4HOZA 4LAWA 1BFNA 1KB3A 3A24A 5AFDA 4NKCA 3I68A 3ABOA 3GG1A 4DJDD 3OHIA 3AS0A 4P8VA 4HHPA 3WQ5A 1B30A 3W1NA 4OTKA 4IFRA 3W1AA 2Q02A 4AZ5A 4D8ZA 2QT3A 2YBTA 3CXOA 3ZSSA 2BHUA 2PRHA 2OX1A 5AHFA 1CTNA 3AYVA 1KTBA 4PUJA 4HNNA 3C56A 1TV5A 3TE9A 3KADA 5EMKA 4S23A 4LBSA 4NJHA 3T6CA 4QAIA 3U2CA 2VO5A 1VKFA 3BURA 5G2WA 3LBMA 3MUAA 3VGGA 1C3FA 3FV9A 4R3UA 2UY4A 4IGMA 4AIBA 4Q8WA 2XISA 3L4ZA 3Q67A 4JTHA 1H5YA 3OO2A 4N9EA 1FKJA 1QR7A 2BXZA 3P0XA