1JNEA

Crystal structure of imaginal disc growth factor-2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
400
Chain Sequence
b'SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Imaginal disc growth factor-2
publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
total genus 145
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jneA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jneA01
4AZBA 4UZSA 4D1JA 3WSUA 1SYTA 1G94A 1MQRA 2QLYA 3MU7A 1BGAA 1W3LA 1B3XA 1OGSA 3UR8A 5HPCA 1FA2A 4B16A 3GXFA 5I23A 1U33A 1JI2A 3N13A 5I5RA 2GJXA 2BHUA 3W28A 4LYPA 1CZ1A 1Y7VA 3CHFA 4XV0A 1V3HA 2O9PA 3QHMA 1VAHA 1ZBVA 3UCQA 1MXGA 4ATLA 3FAWA 3FY1A 2ZICA 3I3DA 5EMYA 4Z2IA 2J7CA 4CU6A 4WKAA 5IHRA 3WIJA 4IUGA 5AYBA 4Z2LA 1CEOA 1GJWA 1O7AA 2YA1A 3K1DA 3HN3A 3W6LA 1W9VA 4RL3A 4BA0A 3IAPA 3WH7A 3W82A 3VDCA 3RO8A 3JUGA 2G4FA 2F61A 1VENA 2ZE0A 2CESA 1QNOA 4HZ7A 1FHLA 4K68A 4P7QA 3ZSSA 1KCKA 3AHVA 3VX0A 5A2AA 3ZJ6A 1G01A 1HVQA 2VZUA 3L4UA 5IFPA 5JIPA 1B9ZA 1JYXA 1PPIA 3BLKA 3EMQA 4JFSA 1SMDA 1C7TA 3N9KA 3AXXA 1UZ1A 1WO2A 1HL9A 1D7FA 3AIWA 4HMDA 3N04A 3WL1A 2PC8A 1C7SA 5IDIA 2Z1KA 4HPHA 4CGTA 3AS1A 4V28A 1E4IA 2GVYA 5BXPA 4LXFA 4F9JA 1E6RA 3F5KA 3IK2A 1GHSA 5CG0A 3ARUA 3A4XA 3CBWA 4UFJA 3MKKA 5HOSA 5D8WA 1JYWA 3WH6A 4W7UA 1QW8A 2ZWYA 3BC9A 1UKSA 4AD3A 4P8XA 2DIEA 4HU0A 4PYSA 4HA4A 3D3AA 1JZ5A 1UOKA 4FLQA 2WSPA 1K9TA 1V3LA 4JZ5A 3VDAA 5HPOA 5JBDA 2OYKA 5BRPA 4PCSA 1LJYA 4UOQA 4YPJA 4GI8A 4D71A 4UFKA 3ZSTA 2WVSA 4OOUA 4J7RA 4FMVA 4FLSA 1LQ0A 2OSXA 1VBRA 4CCDA 2GUYA 4LQ1A 2E9LA 1ESWA 1W91A 4OBSA 1JDCA 4ZXOA 1IT0A 5D9MA 5FD0A 1EGZA 7A3HA 1P6WA 4TVCA 2E3ZA 2XTKA 5D9NA 2WXDM 1JXJA 2EO7A 1GZJA 2Y8KA 2X09A 4AISA 4UQ9A 3VPLA 4OJYA 3CH9A 3FN9A 3DYMA 2WHJA 4NZCA 5A2BA 3RDKA 2JEQA 1EO5A 1E4MM 1KXHA 1B1YA 2QPSA 2YL8A 2DT1A 3WDPP 3RCNA 2GJXB 2W61A 3WQ6A 1V3IA 3IJ7A 3RJXA 1Q4NX 3PN8A 2EPNA 1E6PA 1EDTA 3WFZA 2XPKA 3BSHA 2WVVB 3MUAA 4LPCA 5JH8A 4B9ZA 5A8PA 2DT2A 4RE2A 1GCYA 2EPOA 3W0KA 4W93A 1ZU8A 4J3SA 3WH8A 1Q6GA 2OLHA 2G3NA 4FLRA 2MANA 1BG9A 1W9DM 2PWFA 4UZUA 4GXPA 4ZEPA 2G41A 4U33A 4HA1A 1V0LA 1HXJA 3ZJ7A 3LMYA 1C91A 3WKZA 2D20A 5D4YA 2VO5A 5A6SA 3CZKA 4X0NA 2CXGA 1E0XA 2WWDA 2WK2A 3ARZA 3NCOA 4UQCA 1VRXA 4X0VA 1UH2A 2E40A 5JIWA 3K8LA 3ZR5A 2WMGA 1GONA 2WNWA 5GPRA 4WSJA 2FHBA 1XH1A 3L4XA 5FOOA 1G0CA 1EA9C 5C8BB 2ZUSA 2V38A 1PX8A 3VIJA 2BV9A 3FAXA 3EMCA 3GH7A 1KQZA 2FH8A 3PZIA 1CXKA 5GNYA 5M17A 3SUTA 5A8OA 1KWGA 1W2VA 5IHSA 1HJVA 1HKJA 2J8FA 4HMEA 1ISWA 4BQ5A 1U2YA 2BVYA 3ARVA 3IANA 3EYPA 3MUY1 2HVMA 2VNCA 3E1F1 3WD0A 4JFWA 3NUKA 3AIVA 4IPNB 1K9FA 4YHEA 4MB3A 1AQ0A 1QPKA 4OBRA 4X9YA 1D2KA 1HP4A 3EBVA 1KGXA 2ZXDA 3AMKA 4S3KA 2YBUA 3AS2A 1HP5A 2VVNA 1VFMA 5F7UA 3L2MA 2XJ7A 1VFOA 4PUEA 1XRVA 3L4YA 1OGGA 2J7DA 4AZHA 2X2YA 4R5EA 2WVUA 1MW1A 1JDAA 2DT0A 3OGRA 2CNCA 2XIBA 3RILA 1OB0A 4UFIA 1NP0A 1J9YA 1W1PA 4N42A 1GORA 2EXOA 2XWEA 1RH9A 3WNKA 5C71A 2VX4A 2ZWZA 4HU8A 4EKJA 1V03A 3VM5A 2VURA 1ZBWA 3PTMA 5I2UA 1CGYA 1NM9A 3PHAA 5CSUA 4UTFA 1KB3A 2YLLA 1QI0A 3A4WA 4PMQA 2CITA 3N1AA 1FFQA 2XVKA 3VIPA 4AD4A 2JIEA 1RP9A 4E8DA 4L4PA 1VFUA 5A69A 3KL3A 1E71M 4P8UA 1PX3A 4AZ5A 3U5YA 3ZM8A 5C70A 2WB5A 4JHZA 2DQXA 2GDVA 2WBGA 1W1VA 4IISA 3TTSA 2EPMX 1Q6DA 5IXEA 3AJ7A 2YLAA 3M6DA 4JFVA 2ZIDA 1ECEA 4D72A 1CTNA 1ISZA 1KR0A 1GQIA 1TA3B 3S6TA 2ZXQA 2IXVA 5BYWA 4W85A 3M46A 1OT1A 3W26A 1V6YA 1UR1A 2W92A 3AQUA 5DEZA 1KXVA 4PRWA 4A4AA 4W7VA 1H2JA 4AD1A 3BAJA 1WP6A 2EEXA 1FHDA 1XH2A 1C8XA 1HIZA 4QCFA 5I6SA 1E9LA 3GXMA 3G6MA 4OUEA 1R85A 1UD8A 3CHDA 4U5KA 4OKDA 3KL5A 3WH5A 3N11A 2VRKA 4P7NA 4UQDA 3WNNA 3OGSA 4W87A 1BLIA 4R27A 4QDMA 1BVZA 2GJRA 3MMUA 1H3GA 3PZOA 3VVGA 4QFUA 3MV01 3O9NA 1SMAA 4J3WA 3T2PA 4PUDA 4PN2A 2F2HA 3WL0A 1OD8A 2C7FA 1FH9A 1J10A 2JEPA 3VKKA 3WY1A 3ARSA 3F4VA 4D6CA 1V6WA 1MWOA 1R87A 1ZJAA 1S46A 1TZ7A 3VGGA 4QLJA 3OB8A 1WZLA 4TX6A 1WNOA 4GZIA 5CGMA 3VTRA 4J27A 3CHCA 3THDA 4GZEA 4YHGA 4P7OA 1XGZA 4W84A 1AQHA 3CTTA 1PAMA 2VMFA 2XM1A 6A3HA 1HNYA 5CLTA 5DT7A 3VGFA 2J7BA 1KR1A 1TVNA 2CETA 1ODZA 3SCNA 3VNZA 3WNOA 3WUEA 1PX4A 2XVNA 1CGTA 1JFXA 1BYCA 3O6AA 5I79A 4ACZA 5DF0A 3VIOA 3SCQA 3OIHA 4AD0A 3ZT7A 3NDZA 2XM2A 1KXQA 4C7DA 1ZBCA 1HKMA 3LPPA 3K4AA 3DHPA 3GYCA 3OBAA 1UQZA 1QNPA 4AD2A 1TCMA 3CLWA 3AIUA 3VD3A 1E43A 1LWHA 3UG5A 2IUZA 2Y8VA 2WKGA 1V02E 5A6JA 1BVNP 2J25A 2WC7A 5ABFA 1SFSA 1JZ8A 1VJSA 4U3AA 3ZJ8A 1BYBA 2WMHA 2X0YA 3RM9A 3BSGA 1UQYA 1KBKA 2RGLA 5AC4A 2BXYA 1VEMA 3N15A 4UR9A 4ZE4A 1DWHM 2CBUA 4AY1A 1V3JA 1H41A 1W3JA 1CGXA 2D1ZA 4CUCA 4GI6A 2WMIA 1ZB5A 3EDEA 1X6NA 4GO8A 1UR8A 3AS0A 4W5UA 4MDOA 3WQ8A 1B31A 1JAEA 1W9BM 4YN5A 2ZUNA 3DYOA 1H09A 1CYGA 4M56A 4F8XA 1M01A 1HX0A 1E1FA 1GHRA 3T0AA 4EAMA 1JF5A 4ATWA 3AZSA 1DWAM 1MW2A 4UQBA 3SUUA 2QMKA 2CCRA 1BFNA 4CVWA 4KGJA 4TXEA 2VOTA 2NT0A 2VCCA 3CUJA 2WAGA 2ZX6A 2VC9A 3VGBA 4AZGA 4AZCB 4CCEA 1Q6CA 1QBAA 4AIEA 3VIMA 1E40A 3APGA 2UY4A 1QI5A 1UYQA 5IFTA 4W7WA 5CZKA 5BRQA 8A3HA 8CGTA 1XYZA 3A47A 3A4AA 1DHKA 5GNXA 3BLPX 2BY3A 4CD7A 2VRJA 5DFAA 5BXRA 2V3EA 3WEMA 4Y7EA 2FDMA 4B3LA 1HKIA 4DWSB 3BH4A 4J3VA 5A6LA 3EDDA 5A1AA 4W89A 2BS9A 1E6ZA 1OIMA 3VGDA 2BFGA 2VVSA 2QMJA 3W24A 1TFVA 1QI3A 2EQDA 2ZX8A 1WDQA 1H11A 2WC4A 1V6VA 4Z2KA 3AMGA 3TONA 1V6XA 5CGTA 2XSAA 1NQ6A 2JF7A 2DSUA 4PBGA 1XYFA 3WQWA 1XV8A 1GVIA 1F4HA 2BNJA 1WZKA 3GBDA 3PZQA 4TTUA 2ZX5A 2GSJA 2VJXA 2Y4SA 4M24A 4V27A 2DH3A 3WD4A 4WK9A 2DDXA 5DMYA 5JBFA 1LG1A 1QW9A 4DUXA 5A8MA 2ZXBA 2ZUVA 4GINA 2V3DA 2WLZA 3TA9A 2CBIA 3CHEA 2VX7A 3DHUA 4D6IA 3T08A 2E8ZA 4M80A 1Z32X 5DT5A 2J7FA 2XVGA 3CUGA 1J18A 1NOUA 1UR4A 5I3DA 2G3IA 5LA0A 5EBAA 2VI0A 3WD1A 2WCAA 4N0RA 4ZXLA 4ZE5A 4H04A 1DP0A 4P7LA 4UQAA 4FK9A 5D9PA 4U3CA 3U57A 3POCA 3FXYA 3NYDA 5BXTA 3SCRA 3GH4A 4WIWA 3WDRA 1CXHA 5LA2A 2ZUTA 3KEHA 3EDFA 5BWFA 2WZEA 1WAWA 2G3MA 2OWXA 3MS8A 1W1TA 3W27A 3ZOAA 3N17A 1W1YA 3PZGA 1J0KA 1H5VA 3AIBA 3PZ9A 4ZENA 1YQ2A 1VB9A 4M29A 3GNRA 2DIJA 4MNJA 2PBGA 1BHGA 4WKFA 1C8YA 4QP0A 4B9YA 1CECA 1QHOA 1XD0A 3HU7A 1DWGM 4PEEA 1E6XM 1MFUA 3WUBA 4PTXA 1GOIA 1DWJM 4CD5A 1FFRA 4M82A 2J77A 2AAAA 3NSXA 5EFFA 4CKQA 3W25A 2DSWA 3AROA 3WF4A 2A3EA 4PMXA 1GVYA 1B2YA 2ZX9A 2CBVA 1JZ4A 4PMRA 2YOCA 4P8WA 4JL2A 4NSBA 1MYRA 4Z2HA 3TP4A 3GM8A 4HMCA 3AICA 4QLKA 4M8UA 4URIA 4GO9A 1WCGA 1LL4A 1GUVA 1UKQA 1JI1A 1GOOA 3VMPA 1BSIA 3SEPA 1J0HA 3ARWA 3WDIA 5CPTA 2GK1A 3M7SA 2DPEA 4B15A 1B3ZA 4EE9A 3B9EA 2IXUA 4UFHA 1ODUA 2WZIA 3POHA 2QF8A 3ZT6A 5E70A 1WE5A 4NRSA 2XSBA 2NSXA 3B9AA 1V3MA 1PZ2A 2BY1A 5A6KA 3MMDA 4MJ4A 3WF2A 1HN1A 1UD3A 4LYQA 3BAKA 1U30A 5I77A 1PBGA 5HDRA 3CUFA 4GQRA 4MAZA 5FL1A 3WDQA 3VNYA 2EBNA 2V3FA 1ITXA 1G9HA 3CO4A 3KZSA 4F9DA 5M3WA 4DWSC 3ZIZA 4HPGA 1W9UA 2YL9A 1UKOA 4BCEA 4PMNA 1UWTA 4PMYA 2EJ1A 3LPOA 3CIVA 2E9MA 1HF6A 1EDQA 1JIBA 1JZ3A 3WQ4A 3BAIA 4D6GA 3L4ZA 2ZUMA 1NOFA 1NWRA 3UESA 3EMZA 1EIBA 2PF0A 1XCWA 3G6LA 2J7GA 3T09A 4PTWA 3RM4A 3D5HA 1EOMA 2CKRA 1ISYA 2WSKA 2CERA 2BVTA 2G8ZA 3MUZ1 4JKMA 5BCAA 1XSJA 3SUSA 3WMSA 3IJ9A 1OWQA 1VEOA 2GJPA 3K8KA 3BMVA 1C3FA 3NIYA 3WF1A 3W6MA 2XUCA 3VD4A 1JXKA 1E6SM 1QNRA 3CMJA 3WQVA 3AHZA 3GXDA 3NJ3A 4KWUA 3PZTA 1UD4A 1KCLA 1OCQA 4ZFMA 3ZT5A 2VX6A 5D8ZA 1NWSA 3AMLA 4MB5A 1E5NA 2ZUUA 1ZS2A 2E8YA 3QHOA 3UEQA 2WC3A 5E6YA 4MDPA 4D1IA 1VIWA 4XZWA 4XX6A 1ITCA 3BAYA 4GKLA 1EHAA 3OLIA 4E2OA 2YKKA 4M1RA 1FH7A 4C7FA 4ML4A 4AZ7A 3OLGA 2JALA 4PMDA 3MV11 1ISXA 4CN4A 3WDHA 1JF6A 2WANA 1J0YA 1A3HA 3HJEA 4H8UA 2W62A 1CNVA 1XD1A 2V5CA 1W3HA 1QBBA 1JD9A 3DECA 3OGVA 2O9RA 1JD7A 3VM7A 2VZSA 3W4RA 2Q8XA 2CPUA 4JCMA 3ARPA 1JZ6A 3W81A 1BYAA 5A3HA 2YDQA 1BYDA 1X6LA 2VUYA 2W91A 3SCSA 1BAGA 5KZ6A 1UH3A 2J8GA 1M53A 4AXNA 3VD9A 1VF8A 3WDJA 1BPLB 1V6UA 5AY7A 3W38A 3NDYA 1HKKA 1W3KA 4DUWA 4JL1A 3RJYA 1CWYA 7CGTA 1KGWA 2WBKA 2A3BA 4F79A 3CZLA 5A6BD 1E4NA 4KRUA 5A94A 3QHNA 4MNMA 1XHGA 1R86A 3LPGA 1UWSA 2V3GA 1XSIA 3I3BA 1OM0A 1VJZA 5ECUA 4BS0A 2PB1A 1N82A 3GNPA 4UNIA 3QOKA 1HJWA 5EB8A 1NP2A 2D2OA 2GDUA 1H4PA 2E9BA 3W53A 5AYIA 4XUYA 3S2CA 1XCXA 3L4VA 2RGMA 2VCBA 4AW7A 1ZL1A 3K46A 3J7HA 4H41A 1V0KA 4D6EA 2E4TA 3WENA 2WYSA 1GW1A 3TTOA 1UG6A 3THCA 1KXTA 1MXDA 3BCFA 4BQ2A 1MQQA 1GQLA 4JAWA 2AOSA 4U2YA 1H49A 1DTUA 2YJQA 3O2LA 1C8QA 3RPMA 5TD4A 5E09A 3SURA 3WNMA 3ZO9A 3W37A 3WMBA 1J11A 1JYNA 1E6NA 3SCTA 1H0IA 2O92A 3WMCA 3WNPA 1BG4A 4FLOA 4ATDA 1PIGA 1OT2A 2W63A 5KEZA 3OLDA 1LL6A 1TG7A 1UUQA 3WEOA 2WKLA 1PJ9A 1O6IA 7TAAA 2XFFA 3ALFA 5CXPA 4TTGA 2NW0A 1VEPA 1JL8A 2C0HA 4WF7A 2EPLX 4S3JA 4KH2A 1QI4A 3AHTA 4EANA 5E0CA 2A3HA 2XGBA 2PBOA 2VZVA 4W8BA 1E0VA 2WMFA 1WDPA 4B3KA 4W8LA 3BAWA 2V5DA 5E6ZA 3FNDA 1E72M 1CXIA 1OSEA 2YA2A 2Y2WA 3UETA 2D0HA 2PWEA 2HISA 2QHAA 2W67A 1UKPA 3I3EA 4CD8A 3MSDA 4JCLA 4QCEA 3VDHA 3N18A 1HJSA 4HZ6A 3ARXA 4GQQA 2XVPA 3AFBA 3WELA 2GFTA 1ZJBA 4LX4A 2OYMA 1NH6A 2X0HA 9CGTA 5A6AA 4CN6A 1OGBA 1K9DA 4BQ3A 3AZTA 3GXIA 5BXSA 1XSKA 1JZ2A 1E73M 2B31A 1F4AA 2X8RA 3AXHA 3HMCA 1I1WA 4H7VA 4WLCA 3CPUA 1I1XA 3PTKA 2DEPA 1ZBKA 4MTVA 2WVVA 3VO0A 4H8VA 3WD3A 1WB0A 2ZX7A 4NF7A 3FHQA 4AWEA 4HOWA 1V0MA 1J0ZA 1LL7A 2FHFA 2Y24A 2VQUA 5CSYA 4W86A 4CVUA 3OG2A 1IV8A 1EQCA 1UD2A 2FH6A 4H2CA 3MO4A 4J3XA 3F5JA 1GOWA 1CLVA 2J4GA 4OOZA 2XIIA 1GPFA 2WLYA 1GQKA 3OZOA 1IZJA 1M04A 4W88A 1E6QM 1UWRA 1CGWA 4QAWA 2O9TA 1B90A 4ACZB 3WBAA 5I0DA 2WPGA 5I24A 2CEQA 1VFFA 1RPKA 2D3LA 4WSKA 1XH0A 3QOMA 3GH5A 5ABHA 2UY3A 1HJQA 1QVBA 4CN1A 3K8MA 3BGAA 1US2A 3BCDA 5BROA 5CPQA 3EDKA 3VOCA 1B30A 1VBUA 4MNKA 1JZ7A 2YL5A 3ARQA 1E55A 1LLOA 1OBAA 2XG9A 1E5JA 5E0FA 4AIUA 1TUXA 1IZKA 5ABFB 2WW5A 1EH9A 1J01A 3IAQA 2DSZA 1EHNA 3CMGA 5JBEA 3KE0A 4D6FA 1K9EA 3M07A 1W9XA 2VX5A 2O9OA 2WHMA 3B8SA 4CD6A 1QNQA 3EDJA 4J3UA 2OYLA 4CD4A 1FH8A 1KQYA 3BAXA 1YHTA 1JG9A 2YL6A 1HVXA 3DC0A 4TOQA 1JNEA 2D0FA 4P7RA 1UWIA 1HJXA 4AZIA 5CLWA 3ZR6A 4PMOA 3AYSA 4JFTA 4AYSA 5I78A 3RMEA 2WMIB 3WF3A 2VZOA 2UY5A 3KWXA 4U31A 3VDBA 2JIWA 2WHLA 1MVYA 4MB4A 4D6DA 2WCSA 3VD5A 1FP8A 4NI3A 4CU7A 1UD5A 5ABEA 1CBGA 4AD5A 2XVLA 4PSPA 3T0DA 2WZHA 2J79A 1FP9A 2VQTA 3GZAA 5LA1A 1V08A 1WPCA 1UR0A 2YA0A 3GDBA 1V3KA 1V02A 3MUIA 3VIFA 1JDDA 1I75A 4UOJA 2BHYA 1M7XA 2ZXAA 3FHAA 1OIFA 1EOKA 4PMVA 1R7OA 3ZQ9A 3VMNA 1UH4A 1NOWA 4HP5A 4UOZA 2D24A 1US3A 1CENA 1JYVA 1BTCA 3TTQA 2D23A 2YDRA 3A6OA 1MW0A 3AIEA 3WUFA 3VU2A 1LG2A 1CGVA 1E0WA 3K4DA 3WH9A 4IPLA 5A8NA 5D9OA 1X1NA 3L4TA 3RM8A 1TA3A 3FW6A 4MJ2A 3UR7A 1RP8A 5A95A 3PBGA 4D6JA 3VGEA 1K6AA 1QI2A 2ESCA 2A3AA 2VR4A 3UG3A 4PMZA 1E15A 2WHKA 1HJUA 4MNLA 4UCFA 1WDRA 5A8QA 3AZRA 3CZ8A 1C92A 4GPNA 1ISVA 1CPUA 5GNZA 2WMJA 2ZUWA 4BF7A 4PTVA 3SIMA 5A2CA 1PEZA 1PZ3A 1B3VA 2WCGA 3F5LA 4Q22A 3CZEA 5GQBA 1CLXA 4HA3A 1NWTA 4HTYA 4UFMA 3VIGA 4GIAA 5CJ5A 1M03A 3NSMA 4CCCA 5CPSA 2UY2A 4JKLA 1AMYA 3GBEA 3ARTA 3VINA 1L0PA 1LWJA 5FCZA 3ECQA 1QNSA 2DSKA 1JNDA 3QR3A 2VR5A 3MANA 4WKHA 4MPKA 4BQ4A 4KMQA 4Q7NA 5CQ1A 2CKSA 3AXIA 4DM1A 3WFLA 2XWDA 1CGUA 1UA3A 3OLEA 2BVDA 2WM0A 3MSGA 1MW3A 2QV4A 2XFYA 4JFUA 4W5ZA 1C93A 4IM4A 3MMWA 5A6MA 1E4LA 3SCVA 1WKYA 2J47A 1GOQA 2AMGA 1NWUA 4HZ8A 3L2LA 3AMCA 4U5IA 1H0GA 1WZMA 2Y5EA 2J7HA 2PWGA 2FHCA 2VCAA 3AOFA 2VL4A 3PTQA 4TUFA 4V2XA 2ZOXA 3TTYA 2WVTA 1L8NA 3IJ8A 1E1EA 1WZAA 1OINA 3U7BA 1UD6A 4HOZA 1CXLA 3II1A 2D0GA 1DWFM 6TAAA 1G1YA 5HXMA 1GOKA 4TX8A 4A3YA 3L4WA 3UERA 5ABGA 2XFRA 2PWDA 3PZMA 1UHVA 3BXWA 3AIRA 1CIUA 4UFLA 1QOXA 1J0JA 2NT1A 2XGIA 1LF1A 3GTNA 4PCTA 4AEFA 4M81A 3VIIA 2WMKA 1DEDA 2BXZA 2W66A 3AS3A 1UR9A 4J3TA 1GOMA 4F66A 4MB1A 1J0IA 1KWKA 1TVPA 1UA7A 2CYGA 1H1NA 3B9DA 4GZJA 4OZOA 5EFDA 3ZJKA 3T2OA 2PI6A 1QHZA 2OWWA 3VIHA 1BF2A 4AZ6A 2UWFA 2GK1B 1UKTA 3QGVA 3RIKA 2CHOA 4Z2JA 2JE8A 4C7GA 3TOPA 1UWUA 4RE4A 2C8NA 1PIFA 2W5FA 2W4XA 1B0IA 4ACYA 4EK7A 3WD2A 4J28A 1Q6FA 4AEEA 1C90A 4LYRA 3CZGA 4DM2A 3AIQA 4WJXA 5M5DA 2D22A 3AYRA 2Z1SA 4BZYA 1B3YA 3WQ5A 1TMQA 6CGTA 1KGUA 2J78A 1Q6EA 3VMOA 1JAKA 3OA5A 5A6BA 1J12A 2JF6A 2J7EA 4DUVA 3PZNA 4RE3A 3NSNA 1TR1A 3T0BA 4XZBA 2BY0A 1JGIA 1GJUA 4AC1X 5FL0A 4AZCA 4XB3A 2JFEX 1DWIM 2VT0A 4GI9A 1KFWA 3WBEA 3WUGA 4MADA 1CDGA 5JUVA 5M03A 4TVDA 3GNOA 1HT6A 4JKKA 4U2ZA 1G5AA 3U7VA 4CU8A 1R8LA 4JHOA 2VTFA 1JFHA 1MFVA 3CUHA 4AMCA 3N12A 2BY2A 3WF0A 3SCOA 3LPFA 3U5UA 2FGLA 2YIHA 5AC5A 1E56A 3AHXA 1TE1A 2TAAA 2WWCA 2A3CA 1CXEA 5DO8A 4MAVA 1AQMA 3VD7A 3CGTA 3AISA 3T2QA 4H8HA 1KBBA 3BMWA 2J74A 3OZPA 2VRQA 2DGAA 1CXFA 4OIFA 4DWSA 3AMDA 2OSWA 4P8VA 2EPKX 5HNNA 5LYRA 4DWSD 1AVAA 1W32A 1WDSA 4D6HA 3UG4A 2G3JA 4NRRA 4AIOA 4L4OA 1XC6A 1W9PA 2DH2A 1A47A 4PTMA 2CBJA 4W8AA 4HOXA 2OSYA 4PSRA 2PWHA 1D3CA 1HL8A 2E0PA 1E70M 1NARA 1BGGA 4QLLA 3ARRA 3VILA 1SR0A 2X05A 2CIPA 2YDSA 2FGZA 3KL0A 1E3XA 2OWCA 2XHYA 3SCWA 1BQCA 3CZJA 3CUIA 1OD0A 4PMUA 1V0NA 4UQEA 1EO7A 3AI0A 5HBFA 4E4PA 4FF5A 1R7AA 3SUVA 3A3HA 2DSVA 3WN6A 3ZMRA 3WNLA 1B3WA 2D3NA 3DYPA 3WEZA 1EDGA 1UR2A 1GQJA 3PZUA 4KRTA 1EXPA 2YBTA 1E3ZA 5E9AA 2J75A 4TVUA 3VGHA 4LGXA 3AHYA 2VZTA 2F8QA 4KGLA 5FKYA 1FOBA 1W2PA 2J62A 3W29A 4A3HA 2DT3A 4Z2GA 3PZVA 1RD6A 3SCPA 2BHZA 1EQPA 1GNXA 1MQPA 3ALGA 3SCUA 3ARYA 3VX1A 4E8CA 3VUPA 5FIPA 2QPUA 3VIKA 2X1IA 3SUWA 1UWQA 1UZ4A 4JIEA 2CHNA 2XYLA 1QHPA
chains in the Genus database with same CATH superfamily
4CEUC 3C5QA 1MQRA 1XF0A 3B8UA 4FOJA 4HHLA 4FNRA 4DRPA 2CHRA 3KCOA 3SQMA 1B3XA 2PDXA 3GXFA 1SFJA 2CXEA 3L21A 3T1GA 3N13A 1KT0A 2GDQA 2JQXA 1CZ1A 1E1CA 3CHFA 1R9HA 1QFEA 1ECQA 4M3PA 3IK4A 3IRDA 1VAHA 2NVCA 3FAWA 5EMYA 3CYJA 3WIJA 1BXCA 2HK1A 5HUOA 3KAOA 1KBJA 3GLCA 5MHBA 3W6LA 3BLDA 3DKJA 4RL3A 1WXYA 3WH7A 3NEVA 2BGQA 1FHLA 2P5NA 3ZSSA 1FKXA 1KCKA 5A2AA 1PDZA 1TPEA 1OC7A 4KWWA 5JIPA 3RCMA 1ME8A 4PODA 3LCHA 1SMDA 4Q7BA 1UZ1A 3AIWA 3WJSA 3IARA 1C7SA 3H7VA 4O11A 2OT1A 2GLKA 4TX0A 4QEHA 1E6RA 2Z1WA 3G8EA 1G6CA 3CV7A 1Y5VA 3MKKA 1YYAA 4ZA0A 3SQLA 1QW8A 4K7VA 2DIEA 4HU0A 4UDMA 3IV3A 3QBUA 4I9AA 2LLEA 1VLIA 3W02A 3MP4A 4LS0A 2EG8A 4FLQA 3DOPA 1RSCA 1V3LA 2ON3A 2FDSA 5JBDA 3L9CA 1P7TB 1LJYA 3GE7A 4GI8A 4D71A 5FJRA 4ODPA 3DG3A 2Y7DA 1ICPA 2GPTA 2XP4A 2GUYA 2EHHA 1RBOB 4ICNA 2TRSA 5FD0A 4RZBA 3NRKA 4O13A 3O15A 2E3ZA 4DO5A 3VOJA 1TSIA 2X09A 3H53A 4K1WA 5LIKX 2C91A 1YLVA 2F23A 3FN9A 3DYMA 5A2BA 2JEQA 5C55A 5I3FA 1KXHA 4C6PA 2QPSA 2QCFA 1FKSA 2NUYA 3WDPP 3P67A 3WQ6A 4KFOA 5KTLA 1SW0A 3WFZA 2QCEA 3VA8A 1K77A 1WYIA 2ZR5A 3TYEA 3MUAA 4C1NB 1CI1A 5JH8A 2DT2A 5HUAA 1T8QA 1OFAA 5LIXX 4M5PA 2FB3A 2VEGA 3W0KA 2Q01A 3DXIA 1R46A 4W93A 1ZU8A 1EEXA 5DRCA 4D2JA 1TJPA 2IQDA 3NDOA 2Z24A 5U7SA 4LNCA 3RO6A 1ME7A 3NO3A 4FAMA 4GXPA 4LC8A 4ODOA 4Q4KA 3TU9A 3ZJ7A 7REQA 5HANA 3CASA 3UP8A 3IIOA 3E0IA 5D2TA 3JYJA 4N7QA 3IV8A 3B03A 1UH2A 4Q6JA 1FHUA 2QS8A 4L72B 1K8YA 2NV1A 5GPRA 4IPIA 4LBUA 5FOOA 3OYXA 2ZUSA 3I6RA 2V38A 1PX8A 3VIJA 5AVNA 3FAXA 3SM0A 1H51A 1DYSA 2FH8A 5GNYA 5M17A 1SJAA 1W2VA 2VN1A 1KBIA 1HKJA 1LROA 1IT8A 1GW9A 2ZC1A 4BQ5A 3KTCA 5AHEA 2PUZA 2YCIX 3IANA 3MUY1 2EG7A 4JFWA 5HWCA 3AIVA 2CWXA 3O16A 4YHEA 4I5RA 3HQPA 1AQ0A 4JGDA 4GVFA 2ZZ3A 2INEA 1ZZMA 4CQDA 3QM3A 1SUXA 2FPVA 3EBVA 4ZODA 2FZ9A 3G1RA 3URAA 3F4CA 4NZ3A 1XRVA 3L4YA 3LV6A 1BEUA 1KRCC 2J7DA 3RRAA 5I3JA 4G1NA 2WNNA 1Z44A 3R0KA 1JDAA 4DIPA 2Z1BA 2XPBA 3TYAA 1GYMA 4UFIA 1J9YA 4N42A 2DG4A 2ZZ2A 5G5IA 1ZBWA 1CGYA 1R3TA 4KKXA 1VCGA 1E9ZB 5FEXA 4M6QA 5CSUA 3FSTA 4DY1A 1QI0A 4IP4A 3BLOA 2XVKA 4Q6XA 4AD4A 3EOEA 1RP9A 4WY0B 4E8DA 2PDLA 4N9BA 4U86A 1E71M 5C70A 1OCBA 1YPFA 2HSAA 5HNUA 2WSYA 3PG8A 4KBXA 1SM9A 3F2BA 2ZVRA 2EPMX 1JNTA 4LAOA 4IOTA 3AJ7A 4QT2A 4HNLA 2ZC8A 2ZIDA 5I7GA 1ECEA 3WJWA 4JY8A 2IXVA 1Q65A 2C1GA 1SJBA 5D33A 3KS5A 4O53A 2OODA 3SRDA 1FHDA 5DN1A 4C60A 1E9LA 3R25A 3STEA 1R85A 4RXGA 3RLHA 1Y5XA 1JCJA 3KL5A 1L1PA 1XQLA 1WBJA 1KFEA 1J6PA 1SZFA 3OGSA 3WQCA 1CT5A 3H70A 4W87A 4J9JA 4DWDA 2BXVA 2E68A 4QFUA 3T2PA 4ZS6A 4Y9OA 3WL0A 1D8WA 1OD8A 3GXNA 3P60A 4NNAA 3T81A 1A3XA 1J10A 2JEPA 4JIHA 3RU6A 1TCDA 3TYBA 3F4VA 3NVDA 1V6WA 3HPXA 4QX4A 2WOQA 1S46A 1SR9A 1EIXA 3OB8A 1WZLA 1FWAC 1XW8A 4TX6A 1WNOA 3WX7A 5CGMA 2HV5A 3GY1A 3THDA 5BOEA 3I6CA 4GVHA 1A5SA 4LCRA 3RGTA 3UZJA 5EMMA 2WJFA 5AYZA 3EWDA 2RURA 6REQA 1MUWA 1TVNA 3GG8A 2CETA 3V0SA 3DG6A 1VLWA 5AZ0A 4QJ3B 1CGTA 1QTWA 1J5TA 1JFXA 2HJPA 1RVKA 3MI3A 3OBKA 4C90A 4QG6A 5CPNA 2FGBA 3VIOA 2XP5A 5AFDA 2PDKA 4C7DA 3LPPA 4H6KA 3NOEA 3DHPA 4WCJA 4B5TA 1XRSA 3VD3A 4WRHA 3LCGA 1LWHA 3MB9A 2IUZA 2Y8VA 3GNDA 3WZ0E 3B05A 2J25A 2X30A 2RAGA 1R3VA 3LHZA 4PCFA 1A5KC 1JZ8A 3W1LA 4O16A 4U3AA 3ZJ8A 4FIQA 3IIPA 1NMWA 3FA4A 4GD0A 3KADA 1TPUA 4GYPA 3A21A 2INFA 2RGLA 1GG1A 2BB0A 3RFWA 3COTA 4JIRA 2PPPA 4ZE4A 2CBUA 4BFAA 4PH6A 1H41A 3A64A 1A0EA 1W3JA 1XLGA 4BF8A 2VR2A 5G2WA 4GI6A 4FXSA 4M6PA 2XH4A 1GKQA 3EDEA 1X6NA 2EG6A 4GJJA 1B31A 4YN5A 1W9BM 1TX2A 1H09A 3KHJA 4M56A 3WBXA 5A6TC 1XR2A 4AY8A 3WFAA 3MWCA 4O4VA 4F48A 1THFD 3SAZA 2QMKA 1BFNA 3EA2A 3WLIA 3DH7A 2NT0A 3WLTA 2MLXA 2VCCA 3CUJA 2ATMA 3T0CA 4JTRA 4XVEA 4CCEA 1R2RA 4R7JA 1DJGA 4XAFA 4A3UA 2VEMA 1ZPTA 3RPDA 4R9OA 3GXPA 3G24A 3APGA 1QI5A 3T78A 2PGFA 3NYZA 1XBZA 3ME3A 1S5MA 2CLHA 8A3HA 4HJFA 3MCNA 5GNXA 4CD7A 2VRJA 5DFAA 3WEMA 3WK2A 4Y7EA 4DWSB 3STCA 1OYCA 5LHFA 3T07A 3NZRA 3IGXA 2DUZA 4Q8QA 1YDNA 2XIJA 2QMJA 2P3EA 3C8FA 1WDQA 2IS7A 3AMGA 3TONA 3EPMA 1P43A 2J13A 4QG8A 1F4HA 5LNVA 2OQLA 2Z1VA 4DI9A 1WZKA 4NNRA 4V27A 2CLPA 1RQBA 4JFIA 2DDXA 3OYZA 4IUOA 5JBFA 1LG1A 2ZXBA 2V2DA 4PUKA 4KEZA 2CBIA 4YVXA 3CHEA 2Z4GA 3GG1A 3Q2DA 4FA3A 4G5DA 5DT5A 1J18A 5EBAA 5BRBA 4XBKA 1RD5A 3SBFA 3WD1A 2WCAA 4N0RA 4ZE5A 1LT7A 3GVGA 4DJDC 4P7LA 3D0CA 4LVBA 3UGVA 5T9BG 4HB7A 3H2OA 3SCRA 4JEQA 4WIWA 1DXIA 3CPGA 3TH6A 2KAUC 1RA0A 5LA2A 5MF5A 3O63A 1XLMA 1V51A 2WZEA 2OGJA 5LIYX 3Q58A 2OT0A 5EL1A 1XIDA 2G3MA 3W27A 4RR4A 3GDRA 2PC4A 3PZGA 5C54A 4ZENA 1YQ2A 4M29A 3NTPA 1TV5A 4MNJA 4IMDA 5F4XA 1W8SA 4WKFA 3G1SA 1C8YA 4N4QA 3S46A 4GBUA 4QP0A 4B9YA 1CECA 3BLLA 3HU7A 1DWGM 3WUBA 2FPYA 4PTXA 1GOIA 4X61A 3U0HA 5C9XA 1XLEA 4CD5A 1ZSXA 4RW3A 4OHQA 2X1TA 2DSWA 3AROA 1H62A 4C6MA 1GVRA 2ISSA 4ODNA 4DF1A 2ZX9A 3VOHA 5E0KA 2YOCA 4JL2A 5HT1A 2YZRA 4Z2HA 1E1CB 3TP4A 3QQ0A 3GM8A 1XX1A 3EWYA 1AJ0A 3W1NA 4KEMA 5D09A 2QF7A 2O7QA 4ADSA 1BSIA 5FAJA 3SEPA 3LNPA 3WDIA 5CPTA 1TRIA 4DJED 1HUVA 4EE9A 1EKOA 5FJIA 2IXUA 1XS2A 4UFHA 2WZIA 2QF8A 4QR6A 4MLRA 3ZT6A 1UC4A 2WNQA 4UMBA 4NRSA 1EGVA 1WUEA 2XSBA 1V3MA 4LY8A 4GC3A 1PZ2A 4N9EA 1VCVA 3UY7A 1F8AB 4N19A 2Z6IA 1U30A 4M7SA 3UWVA 2C16A 3GFYA 4RCXA 1PBGA 3K1GA 3FGCA 1OFEA 1T99A 1S1PA 4GQRA 4MAZA 1P0EA 4AX7A 2POTA 1D3GA 1SGJA 3BPWA 2EBNA 3DN5A 3KZSA 1E9IA 3B4UA 4LV9A 4HPGA 1W9UA 4ZO6A 1FKGA 4MGGA 2HRWA 4PUWA 3SFWA 4MJMA 3GTHA 3L4ZA 3QV7A 5FJTA 4LRTA 4NI8A 3TNBA 3N4FA 2PF0A 2D2GA 3G6LA 2OQHA 2VFHA 3RM4A 3D5HA 4NZJA 3W7NA 1QAPA 3U3HA 2CLLA 1HKVA 2PEVA 2G8ZA 4NJIA 4E0CA 3NI6A 1O5KA 1FWGC 4BI7A 3BICA 3PNUA 1I2PA 4HCLA 2OXNA 1O5XA 4QE1A 4O52A 1JXKA 4I7VA 1E6SM 2DJXA 3TTEA 2QZRA 4B2DD 2CZDA 1KCLA 4E4FA 2VX6A 3AMLA 2OKTA 2ZUUA 2E8YA 3V35A 2Y0FA 1W1A1 2ATSA 2VGGA 5EA9A 3QKEA 3H2FA 4L1GA 4A22A 4GKLA 3R6IA 1EHAA 1UZHA 1ROUA 1UWAA 1AZ2A 1IEQA 1FH7A 1IHIA 4ECLA 3M0HA 4EPKA 1QWKA 4FI4A 1C9HA 3MP5A 4IIHA 5GJMA 1SJCA 2G50A 3IK8A 4QE4A 2WANA 3TZFA 1J0YA 1EJWC 3DESA 4QG9A 3LD5A 2XH2A 1XD1A 4GLEA 4BEUA 5AECA 8TIMA 2FZDA 4IL0A 1DQXA 3TN5A 2I1OA 5AVHA 2Q8XA 3ARPA 3NM1A 4H83A 4K37A 3U2OA 4MM1A 2VUYA 1P5QA 3N6QA 4S39A 1BAGA 4AXNA 1YRRA 3JZUA 5GJPA 3QV6A 3P5YA 3WDJA 1BPLB 1ZCOA 1V6UA 1YXCA 1V6TA 3PTDA 3W38A 2DUAA 3FVDA 1X96A 3CL8A 4MZYA 1DQUA 1Z48A 2QCHA 1UP3A 4ODLA 4EF9A 7CGTA 3FS2A 5D38A 1U83A 5LXEA 2WQDA 1RY8A 2R1LA 2DZWA 2QT3A 2J8TA 4GFSA 4QJ1A 3MT1A 5DX7A 4MNMA 2FZMA 4US6A 3LPGA 1R3RA 3P6LA 3ITVA 5ECUA 2FVLA 3B40A 1HJWA 4GISA 1NP2A 1W8GA 1K1DA 1VKFA 4W9QA 3TSMA 2A7RA 5HW6A 4HPNA 1P5BA 4Q4RA 1OZMA 1ZL1A 3EEZA 2BBFA 4IJCA 2AQWA 4D6EA 3TLQA 1IX5A 2E4TA 2WYSA 2FJUB 5DY2A 1UG6A 3S9IA 1MXDA 3O3RA 4BQ2A 3MP3A 2I17A 3DERA 3O2LA 4NJGA 4WHBA 3MSRA 3WNMA 3K5XA 1Q8AA 2ZRUA 1H0IA 2J9YA 3YPIA 3E2VA 1OT2A 1PTAA 1UUQA 3LCWA 3O7UA 3TIMA 3MKVA 1PJ9A 2P4VA 2ZR4A 3D6NA 3LN3A 1REQA 1VEPA 1WOBA 5FF2A 5XIAA 3QSTA 4B5NA 4KH2A 4PR4A 3RUBL 1MUCA 5E0CA 2A3HA 2XGBA 5IRPA 1EQ3A 1WDPA 4W8LA 2V5DA 3T4WA 3FNDA 4A8NA 2ZQUA 1O5QA 1V77A 2YA2A 3AUOA 2Y2WA 3DC8A 3W85A 4CQBA 4QDPA 5FEPA 3TCEA 3QMRA 3VNDA 1UKPA 2OELA 4ZR8A 4M19A 1K6WA 3S83A 3MSDA 1K02A 5EY5A 4AXKA 4JCLA 2DZUA 3QZEA 2HVOA 3O6YX 4BK9A 4DVOA 3C61A 2PDPA 4HZ6A 4A05A 2XVPA 4RNFA 1LDCA 1XG4A 3WELA 1Q2RA 3O5JA 3BZJA 4FEZA 2I9EA 5F2IA 3G0SA 2OO6A 4ZPTR 3C2FA 9CGTA 4Q32A 4CN6A 1OGBA 2HBVA 4DNMA 3QSRA 1K9DA 1TTQA 1YW5A 5AYXA 2DZXA 4BQ3A 1POJA 3TW7A 5D32A 1WUFA 4DRKA 5BXSA 1XSKA 3C3UA 2B31A 1F4AA 2P0IA 2X8RA 4FNQA 1TTJA 4H7VA 2ZFAA 4WLCA 2WVVA 4Q4PA 3VO0A 2VC7A 1IEWA 4X9SA 1AL8A 5AHFA 3LK6A 1M68A 3APYA 3RK8A 3TEVA 1FWIC 3FHQA 2XZ7A 3M0VA 4B4HA 1V0MA 1RUSA 4QIUA 4CVUA 4UMAA 1UD2A 1ITQA 1A5UA 3OA3A 4NJJA 4IIEA 4J3XA 6REQB 2J4GA 4PL2A 3I6EA 3HB9A 4OOZA 5M2FX 2X42A 4KW2A 5SWUA 1G4SA 2XIIA 1M7OA 4OV4A 1WDDA 4ZPVR 1GQKA 1XIIA 1E6QM 5TBOA 2O9TA 2KFWA 3M0MA 3UYIA 2CEQA 1RPKA 3UPMA 1VRDA 5J5DA 2BTMA 4NZ1A 5C9UA 4KIRA 1TREA 3S0CA 3R0DA 1FAPA 4UMCA 3QLLA 3HQOA 1HQTA 1B30A 4YVPA 4Q8MA 4HHHA 4GZ7A 4MNKA 3WLRA 3N19B 3B9NA 5HK4A 3ARQA 3S5SA 4YYFA 4ES4A 1EH9A 1SJDA 3GR4A 4A21A 4GBDA 3KE0A 1K9EA 2PP3A 3IUDA 2WHMA 1GWJA 3NQVA 1JCXA 3CPRA 1FH8A 1FDYA 1EUNA 4GI4A 2YL6A 2Z27A 4TOQA 4W9OA 3MYOA 4P7RA 1PO9A 1NDVA 2DZTA 1G7UA 5I78A 3RMEA 2UY5A 3PG9A 4HJWA 4R7WA 2PDJA 1KD0A 2WHLA 4I8YA 4ROQA 1MVYA 4JIQA 3INPA 3KOFA 4B5WA 5HR7A 2E77A 2ASHA 4NI3A 2FTYA 4CU7A 1UJPA 5ABEA 3U4FA 3WLSA 1MEIA 3CL6A 4QQ3A 1ITUA 3CAQA 2R14A 3W2KA 3KX6A 3H2CA 3ZVHA 3BOFA 4DO4A 5D75A 1EGMA 3PRAA 2WM1A 4E5TA 3SY8A 1FCQA 2Y5JA 4XVDA 1K7EA 2HWGA 4UOJA 1M7XA 1F2JA 2ZXAA 5I3GA 2DY3A 4M51A 5DMNA 1K70A 3R0UA 4YIWA 4ZQNA 5EU9A 3QEZA 3RMJA 4UOZA 3LEPA 4LW7A 4B5XA 5IOBA 5DY3A 1US3A 3EOLA 2D23A 1MW0A 3QR1A 3E0WA 1E9YB 2Z7KA 1LG2A 2DZVA 3APTA 3V1HA 1R9XA 4PGLA 3SI9A 1YNYA 4F2TA 1FWTA 1X1NA 1P6BA 4I9TA 4LB4A 2GWGA 3CUZA 1DJHA 2NUXA 3G1DA 2VR4A 1QPRA 1SSDA 1E15A 2WHKA 3GU9A 3MQTA 2DW7A 3VABA 5JQ9A 2V81A 5HJYA 2REQA 2V5BA 1ONWA 2XU2A 3OVQA 4Z1BA 1T0OA 3KOXA 3DFHA 4TR9A 4HNUA 3SIMA 1ALDA 1PEZA 3CIWA 2GOKA 1PZ3A 1B3VA 3HZ3A 3SN4A 2BOGX 2WCGA 3F5LA 3B7XA 4NJHA 5CC6A 3CZEA 5GQBA 2R6OA 3L0GA 2H3DA 2HMCA 4UFMA 3O6DA 1KM3A 2V30A 3BG9A 4CCCA 2V0TA 3PR2A 4FX7A 1AMYA 2FAPA 2H6RA 1L0PA 3N2XA 3ECQA 3RYSA 1G69A 4J4KA 3NURA 1XISA 3FEQA 2H3BA 4QHRA 3IKDA 5H91A 4KMQA 2UZ5A 4Q7NA 2MPHA 5CQ1A 1CGUA 1Q1CA 2BVDA 2WM0A 3MSGA 4E4UA 3MMWA 2AMGA 4HVXA 3S47A 4S38A 4QSHA 3PRDA 2HXTA 1H0GA 2Y5EA 4C6OA 1VQTA 2J7HA 4ORIA 2PWGA 2FHCA 1HTIA 3JXVA 4JQ3A 1CW2A 1L8NA 1WZAA 3P93A 1YDVA 1N55A 3W22A 1UD6A 1VFHA 2FIQA 1B9BA 2HK0A 3SRHA 4DJDA 1RK5A 3L4WA 5ABGA 2XFRA 1XC4A 4DPQA 3E96A 3BXWA 7ODCA 1GPWA 3NOYA 1Q8JA 1JPDX 3S1XA 3T0TA 3WO8A 2FB2A 2C1IA 2XGIA 2C1HA 5EBUA 1LF1A 3TYCA 4L6OA 1UR9A 5HQMA 4AVNA 4O57A 2ZYFA 3C2VA 3A3XA 1J0IA 2P88A 1F73A 4HK6A 1R5YA 2PFHA 1TVPA 1IGSA 1UA7A 3D3FA 5IBXC 3CJPA 4RE0A 3OZMA 1SZNA 3E3HA 2R1PA 8RUCA 2QXWA 3UXLA 2XFWA 3RIKA 1P1XA 3QPYA 4Z2JA 4GJIA 3RF9A 3TOPA 1I2NA 3HMJG 2AL2B 3OVPA 4IWWA 2ZCGA 1Y0EA 1PIFA 2C8NA 5HUPA 4KEVA 4PUNA 3LLXA 1LBFA 4PL1A 4BWLC 4ZMGA 3IJIA 1EC9A 5CG7A 1Q6FA 4YJ5A 3W07A 4DM2A 3TJLA 2Z1SA 3AYRA 1AL7A 1OCNA 3U4AA 1EPVA 2XZ9A 2HEJA 1TMQA 2NQ9A 2PGEA 1Q6EA 3FGCB 3OA5A 2C19A 2PDGA 1PTGA 1MZRA 3WBWA 4TYOA 3HV8A 3PZNA 3NSNA 4FXFA 4EVZA 3HQNA 2PAJA 2ZTKA 4XB3A 4GI9A 4UNKA 3F2DA 1CDGA 1JPKA 2VUNA 3IHZA 1HT6A 4JKKA 3K4WA 1K03A 4UUIA 4CU8A 1IR1A 1DIEA 1U5VA 4TW7A 3CUHA 3TDFA 2HBXA 1WXZA 3U5UA 2FGLA 2KR7A 4H6QA 1FKJA 1IE7C 1CXEA 3VD7A 2AGKA 3WLNA 4WOZA 4UTLA 1KBBA 4CLMA 3BMWA 5DO2A 2F4EA 3LB0A 4O14A 4HD5A 2ZADA 2Y7GA 1SZGA 4ZOBA 4P8VA 3O07A 5LYRA 1IGWA 2AMXA 3LG3A 2X41A 4X2RA 4NRRA 3A5FA 1XC6A 5HMSA 2DH2A 2AWGA 2Z25A 4IX2A 2CBJA 3BW4A 4W8AA 3KVMA 1D3CA 3V0TA 1E70M 1BGGA 4QLLA 3QVQA 2G5WA 2FGZA 1UW9A 4IT4A 3DU0A 4UXDA 3TYDA 3CUIA 3LY0A 4INFA 5K4ZA 1LP6A 1RLDA 4PMUA 4AQLA 3E0VA 1J2WA 3LRKA 3PPFA 1V0NA 1Q7MA 3UVAA 2Y6ZA 5HBFA 3RITA 4YXGA 3GUWA 2IF4A 3VK5A 4IHCA 2PWVA 3W1RA 1B3WA 4R9XA 3LBMA 2EKGA 4KRTA 1GQJA 3PZUA 3QGAC 3O5EA 3TC3A 1OYAA 1E51A 4TVUA 4FR6A 4KGLA 4K8EA 3CB3A 1SW7A 1TJRA 3ITGA 5AHNA 2GSHA 3JRKA 2PLCA 4IZGA 1GNXA 1MQPA 1K4GA 4O28A 3ID7A 4H3DA 3QN3A 3FYOA 2C13A 1UIOA 2QW5A 1FD9A 1UZ4A 3W86A 5HQEA 5G2HA 4AWUA 3TWAA 4HKPA 5FSDC 3SB0A 3RR1A 5B7YA 3B97A 3CH0A 3UR8A 5HPCA 3EXRA 5I23A 3G1AA 4DPPA 5I5RA 3E2QA 1LOQA 2GJXA 3W7CA 1QNVA 1H50A 1YNPA 5C9RA 3ZR4A 1SO3A 4XZLX 3W28A 1Y7VA 3CIXA 1TTPA 3UW6A 1GOXA 3STFA 3BGGA 4XV0A 5F4WA 3UU0A 2O9PA 3S1GA 3A9BA 4H4IA 3M0YA 1OEPA 4PULA 4X2PA 4JNMA 3M41A 3RG6A 3GAKA 3UCQA 1MXGA 3I3DA 2RKXA 1ADOA 4WKAA 1P4CA 4IUGA 3T44A 1SSGA 1K8ZA 1WKDA 4L1WA 3HN3A 2VC5A 1HXVA 1S38A 4O17A 4MKVA 2QDDA 3JUGA 2G4FA 2F61A 2MNRA 2E5BA 2E7FA 2YR1A 2CESA 4DF0A 1A7XA 2L2SA 4XO6A 3VX0A 2P76A 3ZJ6A 3UI5A 3WJYA 1JCLA 2Z2BA 4XUGA 4R85A 4E2VA 5CBIA 4I5UA 4Y9NA 4MG4A 1QK0A 4MWAE 3AXXA 1KRMA 1D7FA 3N04A 1Y65A 2VDHA 1ZP4A 2PC8A 1DJWA 1KCZA 5IDIA 3B8VA 4C02B 3N73A 3NQMA 3AS1A 5LHEA 2X1RA 4LXFA 3EX4A 1GHSA 3M43A 5CG0A 5I98A 3A4XA 4UFJA 1REQB 2GUBA 4HK7A 4QXIA 1GZGA 5D8WA 3WLMA 3DCPA 4AH7A 3WH6A 1JYWA 3HGSA 1UP2A 1TB3A 1UKSA 4AD3A 3LTSA 4P8XA 5I3HA 3WLQA 5CCZA 3TDBA 1QK2A 1D3HA 4MWAC 2GQAA 1SFTA 4HA4A 3LRMA 3PULA 4JZ5A 3ORWA 4E2BA 2OYKA 5BRPA 4PCSA 4I9JA 2TPSA 2CZ5A 5H1WA 5FEWA 4GQ0A 4O1DA 3N9SA 1PL9A 3WQEA 2V9DA 4FLSA 2NVDA 1VBRA 4DYKA 4M0XA 4LQ1A 1ESWA 1W91A 3CL7A 4OBSA 2YB4A 1J4RA 1VH7A 5D2VA 1QR7A 7A3HA 3E12A 4GC4A 4FNTA 2DVUA 1P6WA 5D2YA 2OEJA 3QPZA 1MNZA 1GZJA 1TJ2A 2Y8KA 2R9RA 4F2UA 4UQ9A 1W3NA 3TC7A 3DIPA 3REQA 2QUVA 2ACUA 5K9DA 1XG3A 1EO5A 4QBXA 2YW3A 1B1YA 5I3KA 4EAYA 3RCNA 2W61A 3MDWA 1J96A 2EPNA 2XPKA 2ZZ1A 1V4YA 1R30A 2WVVB 1XLHA 1UCWA 1AZ1A 1W5QA 3VCCA 5A8PA 5CJMA 1F3EA 1GCYA 1XIFA 2ZDSA 3E02A 5HWMA 3KBNA 2ABBA 3V75A 1I2RA 3CB8A 3ABQA 4QE5A 3RX3A 2OEKA 1W9DM 3KOYA 4CNNA 1V0LA 1HXJA 1V79A 2G37A 3CC1A 3LMYA 1C91A 3WKZA 2VO5A 5A6SA 1EYWA 4QDWA 2P8BA 2R24A 3CZKA 1R6WA 4J4NA 2CXGA 3ABRA 2WWDA 2WK2A 3NCOA 4XO7A 4GA8A 4Q4QA 4JNYA 4X0VA 1ENUA 1YDYA 3NQAA 2WMGA 3G22A 4BF5A 3C0LA 5HATA 1IWAA 1DE5A 1R3QA 5AC8A 1EA9C 3LHUA 3SQSA 4BI6A 3UY8A 1CXKA 4QS6A 3ZWSA 5IHSA 3AUJA 2J8FA 1FWFC 4GVGA 1U2YA 2D2JA 3ARVA 3N4EA 2HVMA 2VNCA 3EA1A 4WD0A 3FJ4A 4LAZA 3W76A 3TXVA 3HIJA 1RBLA 1JQVA 4JFJA 4XD5A 1HP4A 1LM1A 2PDWA 3TCSA 3U2EA 3QV8A 4H9ZA 4MLJA 4OWGA 4JTFA 5HR6A 3U48A 2ZQ0A 2ZXDA 3AMKA 4GY0A 2AAMA 4S3KA 2YBUA 5CC7A 3JYMA 1LCOA 5F7UA 2W9MA 1OGGA 3QYSA 2FPTA 4B5VA 4JTEA 3B8DA 2X2YA 1HO1A 2BASA 3RHGA 1MW1A 3ZVHB 4H2HA 1GVQA 1ADDA 2O4QA 3MDUA 1W0MA 1YTEA 2XWEA 2XH0A 1FKFA 1W1IE 3EKGA 3NQGA 1EA0A 2B7NA 3S42A 1JCTA 1A5MC 1TIMA 3G1FA 3UYCA 5I2UA 3ZVIA 3SGZA 3NZGA 1L2QA 1Q7QA 3I4KA 2YLLA 5EMKA 5FI8A 2OLSA 4MGVA 5A69A 3W71A 3U5YA 1WA3A 3ZM8A 4AZ5A 2RDWA 3E2SA 3V4BA 4LAKA 2WBGA 2CLOA 4MSPA 3VAVA 3CS2A 2YLAA 3HGJA 4JFVA 1CTNA 1KR0A 3B0YA 2ZXQA 3M46A 1UR1A 2ZA3A 2W92A 1KXVA 2DZAA 3LUOA 4AD1A 5CC3A 3GKAA 2EEXA 1XH2A 2EPHA 1HIZA 4QCFA 3PFMA 2P3ZA 3G6MA 1B57A 2GGHA 4OUEA 5I02A 3CHDA 3AALA 4OKDA 3WH5A 1DBTA 4P7NA 3KBVA 3G0XA 1S3TC 1QRQA 3UWYA 2Y85A 3LCXA 1H3GA 2YYUA 4J3WA 4Z1DA 4G2DA 4ZCWA 4KIEA 4GXMA 3SGGA 2C7FA 4IQ2A 4W4QA 3MJYA 4JX4A 1FDZA 4E3TA 3PA7A 1YEYA 1MWOA 3TLLA 1ZJAA 2G3FA 1KM6A 4BY3A 1TZ7A 4QLJA 1XRTA 1AMKA 1UOZA 2OB3A 3CV6A 4GZEA 3OQEA 3W1UA 1S2VA 1XGZA 1AQHA 7TIMA 3CTTA 3O5OA 3BWWA 1PAMA 2VMFA 3SO7A 1HNYA 4WJEA 5DT7A 3VGFA 1FKIA 1RVGA 1KR1A 4DXKA 1R0MA 4REQA 1ODZA 3SCNA 3TZNA 3WNOA 3WUEA 2GL5A 2O7SA 1LRQA 3O05A 4IJRA 3ITYA 5DF0A 3OIHA 3TJXA 1EWEA 4JTUA 3ZT7A 1KXQA 3TYZA 5HMEA 3OBAA 3BMBA 1UQZA 2CWNA 3OP2A 3S6DA 2PS2A 3P2VA 1TCMA 3CLWA 4J3ZA 1O68A 4XD6A 1NSGA 2FMNA 1O5RA 3VFCA 3UG5A 1D6OA 2JKPA 1N8IA 3N29A 2QYGA 1BVNP 4AVFA 5ABFA 1C29A 1SFSA 3HQ1A 4J5NA 1VJSA 5LXXA 1PYMA 3PK7A 3R2GA 3S1WA 5HAOA 4F0MA 3RM9A 3DHDA 3LXBA 4QTGA 1UJQA 1UQYA 3NQ6A 1KBKA 4EWND 4ZO9A 2BXYA 2VYOA 2PDCA 3ISIX 1VEMA 2VD9A 5HNTA 1DWHM 3CAKA 3H4WA 3CV1A 4AY1A 1V3JA 2D1ZA 4QM1A 4CUCA 4GGHA 2WMIA 1W56A 1XLAA 2H9AA 5K9CA 2Z2AA 4GO8A 1UR8A 3HPFA 4MDOA 3WQ8A 2QCMA 1L6SA 1JAEA 3FYYA 3RCYA 5JH2A 1CYGA 2P10A 3EWBX 4ODMA 4YTSA 1JRBA 3T0AA 3UXKA 3BOXA 3AZSA 5T91A 4YTTA 3G1VA 4UQBA 4MHBA 3SUUA 4LF1A 3CQ0A 3MCMA 4TXEA 2VOTA 1EX1A 1P1MA 2W79A 5CPMA 2PWUA 1QZ2A 4FS9A 4BWLA 3BV7A 1Q6CA 1QBAA 1W5PA 3W7HA 4QNWA 1X8FA 3W1QA 4AIEA 1E40A 3P0WA 1RPXA 5I3IA 4US5D 3H2EA 4O0ZA 3VKCA 5IFTA 2B7PA 5REQB 5DCBA 3TC6A 4UTJA 4K3ZA 4G2PA 1HGWA 1R3SA 3W9ZA 2ZZ6A 4LS2A 3A47A 4XTDA 1GGOA 3CK5A 1HKIA 1TV4A 1J4HA 1KRAC 3PUDA 2IPFA 1VHNA 4A8RA 5HMFA 3E38A 1E6ZA 4NYUA 1F5ZA 1Z7AA 3SDOA 3KCJA 3W24A 1TFVA 2ZX8A 2WC4A 2WV8A 4JTAA 2PV2A 5CGTA 3A22A 1WDWA 2JF7A 2DSUA 3WQWA 3WK3A 1PS9A 3GBDA 3PZQA 4TTUA 1C9DA 2Y4SA 4Q8OA 4IIDA 4HU4A 3QTGA 1OC5A 4O15A 4WK9A 3W83A 1K8XA 4DUXA 2ZUVA 4GINA 1JUEA 2PF8A 4WSHA 2WLZA 3TA9A 3TJ4A 3L0NA 4R33A 2VX7A 4JDBA 4O2TA 1ZALA 4JY9A 2IMRA 4ORMA 3IJQA 4M80A 1Z32X 1UR4A 5I3DA 2KGJA 4ZQOA 3NQBA 2VI0A 4ZXLA 4N6EA 1PHQA 5D9PA 2R82A 1Z9AA 2FMOA 4HSHA 4LOCA 3PP7A 3ITOA 1CXHA 2PBCA 4UTTC 3KEHA 3SRFA 2OWXA 1QOQA 3AWOA 1W1TA 2VEPA 2D2HA 4XD3A 1VB9A 4F0LA 1KKOA 1RQEA 3Q45A 3LI1A 4MYXA 3UBPC 1M5YA 2PU0A 4WDTA 3NL2A 1DWJM 2POZA 1FFRA 4UTWC 2AAAA 3W7KA 7ENLA 3KTSA 1Z41A 4PMXA 2CBVA 1JZ4A 3F4WA 4MMWA 1H7NA 3C86A 1T8XA 4HMCA 3RXZA 3QMSA 3UI4A 3WJXA 3RGCA 5FEZA 1MDRA 2VWTA 2V5LA 1KNWA 4GO9A 6ALDA 3T9PA 2EKCA 1AJZA 4BEQA 4EOUA 3THAA 1FWSA 1GUVA 4Z08A 1WAUA 1GOOA 3VMPA 3MO7A 4TV6A 1FKKA 2PLJA 5BW6A 3GYEA 5GPGA 2DPEA 3GHRA 4B15A 1B3ZA 1JCHB 4L56A 5AC6A 5LNUA 2DV0A 4UTIA 3POHA 3B8IA 4LWWA 1IWBA 5DMMA 1OFDA 2HZGA 1WE5A 1H1ZA 3B9AA 2BY1A 5A6KA 3MMDA 1J8VA 3WF2A 1HN1A 1ZAJA 3QFEA 3NA8A 3T8LA 3UZ5A 1ONEA 4AC7C 3LI0A 5HDRA 2HXUA 3M0JA 3RLGA 3NVTA 4HCHA 4AHQA 3VNYA 1BWKA 4IX0A 1G9HA 4I90A 3NPXA 3CO4A 3MJMA 1DTNA 1UR3M 2XSXA 1U1JA 4DXVA 4BCEA 4PMNA 3R1ZA 3RRXA 5G1YA 1QUMA 4L64A 4KCTA 3GHTA 2PGRA 3W1PA 5I03A 4NHVA 1HF6A 1EDQA 1JZ3A 3WQ4A 3BAIA 2ZUMA 2D73A 1XLLA 1NOFA 4R0XA 2V63A 3UESA 4FNUA 2BSLA 3GB6A 2J6VA 4PTWA 4GYJA 5J04A 4Z0JA 2GVEA 2ZRXA 1W5MA 3U6WA 2WSKA 1LQ2A 2F6XA 1VFLA 2CERA 2PLMA 3MUZ1 4LAMA 5BCAA 4YWIA 3SUSA 3EB4A 3IJ9A 3RLUA 2A4AA 2YFNA 4GIEA 2JZVA 4MWAA 3B0VC 3NIYA 1C3FA 3W6MA 1EYMA 3UQBA 3N14A 1QNRA 3KRBA 3WQVA 3UA3A 4ZFMA 4TO8A 3ZT5A 5D8ZA 1TR9A 3REQB 5LSMA 1F3WA 4CNUA 3E5PA 4D1IA 3BAYA 3FSUA 1B3OA 4E2OA 1PV8A 3DBNA 3JW7A 2YDAA 2CZVA 3OLGA 4LVDA 2JALA 3TQPA 4CN4A 4WY0F 1A3HA 3HJEA 2VFEA 3JS3A 4C6FA 2F38A 4FOUA 4GXWA 3KRZA 1XIMA 1O95A 3DECA 3OGVA 4PB5A 3KABA 2O9RA 1JD7A 1OZQA 3PSWA 4JCMA 1BXNA 1BYAA 4N9CA 1FBAA 3CGNA 2A7PA 5KZ6A 2J8GA 1M53A 3SJ3A 5C9WA 1XLKA 2YSWA 3ERPA 4XAKA 3GW3A 4IIFA 1HKKA 1XBYA 4O1EA 4GH1A 4DUWA 4JL1A 5E5CA 3RJYA 5TAOA 1EXBA 4IQJA 3GWQA 4DUOA 1A49A 2IQTA 3G5EA 1Q6RA 3WQOA 3UJFA 2VDIA 3I10A 4F40A 3USBA 2VCDA 5A94A 4WVXA 5CZSA 3E2RA 4NASA 1OYBA 2P1FA 3V5FA 1VJZA 2PB1A 1N82A 3GNPA 4WGXA 4IF2A 3GVRA 1H4PA 4WX2A 3IRSA 4GH3A 3W53A 4Q8TA 3E6EA 1F3XA 4XUYA 3L4VA 3N6HA 2RGMA 3G8RA 2A3LA 1JUKA 3FDGA 3J7HA 1YPXA 1KM4A 3DZ1A 4WZHA 1P0BA 5C0QA 2UZ9A 3C2EA 4Y9MA 3TTOA 2NWSA 4PBEA 1MQQA 1GQLA 4IP7A 4NX5A 2AOSA 2NQJA 4U2YA 1TPH1 4XAYA 3IVUA 1DTUA 4GX8A 2BGNE 1PCKA 2QQ6A 5D2XA 2VKZG 3SURA 3W37A 1J11A 1JYNA 3WMCA 1DJQA 4FLOA 1C8VA 2B7QA 3I4EA 3OLDA 1LL6A 1TG7A 3WEOA 4LJ3A 1L6GA 1VBJA 3MYPA 2DUXA 4TTGA 1IWPA 5T8GA 3VNJA 3N34A 1UBSA 3NQFA 1S2UA 3AHTA 4EANA 4W8BA 1E0VA 2D9FA 4E6MA 3BAWA 4GX9A 4KWSA 4FO4A 1OSEA 1YTKA 1BSLA 2D0HA 1Z8AA 1SZRA 5K3VA 2W67A 3W6YA 5CSRA 1A5NC 4CD8A 2QAFA 5TF0A 3E49A 4UTKA 4QCEA 1DJXA 2RFGA 3N18A 1QU4A 4HNVA 1HJSA 2BODX 4FZIA 3OJGA 3CYVA 2F2DA 3L23A 3AFBA 1N8WA 2GFTA 2YW4A 4J35A 1FCBA 1ZJBA 4LX4A 3BG5A 3F4DA 1R2SA 4MY8A 4IQDA 3M6YA 2CLIA 3GU0A 4AIBA 2ZBTA 1IIHA 4PCNA 3ZLFA 4A6GA 4US5A 3TVAA 4H1ZA 3SY1A 3GXIA 4R53A 3WMLA 3FCPA 2YYTA 1MDLA 1GTHA 1OF8A 3PTKA 2DEPA 4AEOA 3P14A 1VJIA 4MTVA 1D7KA 1WB0A 1NY1A 3RFAA 3EPNA 4DLMA 4HOWA 1LRNA 1VD6A 1LL7A 2NLYA 3GD6A 4W86A 3F1QA 3IUHA 4H2CA 3KVLA 4G8TA 2CZEA 1ZAHA 3S6OA 3F5JA 3IPWA 1UROA 4REQB 1RR2A 4P2VA 2OX1A 3LGDA 4MFEA 1GPFA 2WLYA 3HG2A 3VUSA 1IZJA 1M04A 2HROA 3HFYA 2XP8A 5I24A 4JTIA 1IQ8A 3GFXA 4D8LA 4WSKA 4POCA 4NQ1A 1OK6A 3QOMA 1Q63A 1HJQA 1QVBA 2DVTA 4CN1A 3GFZA 1LBLA 2CW6A 5BROA 4PFMA 1VBUA 4IFRA 2YL5A 3G1HA 4FP1A 3CUXA 1E55A 5H8PA 2E67A 4V1XA 1E5JA 3EX6A 2BOEX 3LXAA 4LTSA 5ABFB 5AZ1A 4DZIA 3GVQA 1EHNA 4JTGA 4UR7A 3HGOA 2I9UA 4NKCA 3LLFA 2OKOA 1XPGA 4XQ6A 4UIOA 3PVFA 4RLIA 2OYLA 1U5HA 5A8GA 3BAXA 3C4UA 1UASA 3L5LA 2D0FA 3I68A 4AYSA 3ITXA 3L12A 2WMIB 3WF3A 2H9AB 5CPOA 3L5AA 4Q8WA 2PDIA 2ZTJA 3EX1A 5DITA 4D6DA 5HTGA 5CSSA 1XBXA 1M7JA 1TJ0A 3GC4A 4LANA 2DZBA 1UD5A 3SJNA 3HM7A 2PTYA 2W3ZA 4LUIA 4AD5A 2BP1A 4RV8A 4F2BA 2NLIA 4PSPA 3P8IA 2J79A 3GZAA 1JULA 2NSOA 4XG1A 1V08A 4JTCA 4DAFA 4RPQA 1UR0A 2YA0A 2QVNA 1ZHAA 3GDBA 4GUIA 4H6EA 3VIFA 1I75A 1OHLA 2R1MA 1EOKA 4PMVA 1R7OA 4S3CA 4PRTA 1O4UA 1XGEA 3IS4A 3UT0A 4L3NA 3VMNA 1UH4A 2XP9A 6XIAA 1JYVA 1BTCA 3TTQA 3EPOA 2YDRA 3A6OA 4S1FA 1TV3A 4CQ8A 1CGVA 2PTZA 2DZSA 3HF3A 1XGDA 4HNNA 2OOGA 3UXAA 1XLIA 5CZ0A 2VFIA 3RM8A 1TA3A 4MJ2A 5A95A 3PBGA 2O56A 3GW0A 3EGJA 1ELSA 2G96A 3TMLA 4K1GA 4ADUA 4MNLA 3IIVA 4K8HA 5A8QA 1KM1A 5J5RA 3AZRA 3CZ8A 2B5UB 1CPUA 3KRSA 5GNZA 3ZXWA 3H9RB 4P5UA 3NL5A 3W23A 1NFPA 8XIAA 5A2CA 4IMCA 1CLXA 1V7AA 3VIGA 4GIAA 5CJ5A 1ZTVA 3NSMA 5D02A 4TU1A 3CQHA 3EWUA 2PA6A 1OFPA 3VINA 5FCZA 3TYUA 1QNSA 4MKNA 1FTXA 1TWSA 4I9MA 1ZY9A 3DFNA 1TTIA 3AXIA 4DM1A 2XWDA 4JYDA 2A21A 1MW3A 2QV4A 2XFYA 3W7JA 2RJHA 4RDWA 2QCLA 4I6VA 3GX9A 1C93A 4IM4A 1GVEA 1WKYA 2J47A 2VEIA 4LB3A 3R8HA 1NWUA 5CC5A 1DJNA 2Z7GA 4U5IA 3T7VA 4Q8VA 4O1AA 3GU1A 1WZMA 3LGEA 5I00A 1U1UA 2J27A 4Z42C 3VXGA 1PKMA 4RW5A 3PTQA 3TTYA 2ZOXA 3L7RA 3N3TA 1UPMB 4DRMA 1CXLA 3II1A 2D0GA 3AXMA 5HXMA 1GOKA 4A3YA 3UERA 3TAOA 3URBA 3C2YA 3UCCA 4DB7A 2PWDA 3CWHA 2R1NA 1TCOC 3G1XA 3HG4A 5G4HC 5G2IA 4A2SA 1JCYA 4UTTA 3MZ2A 4LY4A 3KLKA 2NT1A 1IYXA 1OFBA 1VYPX 1Z89A 4M81A 3VIIA 1JR1A 2W66A 3AS3A 1IXPA 4KT2A 5TQLA 4DT4A 2IW0A 4J3TA 1GOMA 1KA9F 3N4AA 3DFQA 7XIMA 2A2IA 4RZ4A 2W6RA 4A29A 3QZAA 3RU8X 1DJIA 7PTDA 4O1FA 1H1NA 3B9DA 3OU8A 4I5XA 3TN6A 5EFDA 4Q8UA 4TW6A 3W75A 2OWWA 4UTWA 3VIHA 3N25A 4DZ3A 3RLVA 3WYZA 4C7GA 3I65A 1ZNNA 4O19A 1B0IA 5HNRA 2V67A 4QJ4B 4AEEA 3O0FA 4GUJA 3JVAA 4WJXA 5E9XA 4BZYA 1JNSA 3B8TA 1B3YA 4G1KA 4DBSA 3JR2A 2V82A 4GY1A 5IDZA 2GJLA 2J78A 3S5OA 2X0SA 4H19A 3GNNA 1J12A 2JF6A 2J7EA 2Z26A 1TR1A 4XZBA 2BY0A 3P74A 1JGIA 4TMCA 4AC1X 3FJLA 5FL0A 4EXBA 3QR0A 4PUUA 4AZCA 2JFEX 3EY6A 6XIMA 3TN3A 3WBEA 3WUGA 1ZP3A 5JUVA 5M03A 3NEHA 3GNOA 1R8LA 4JHOA 3IJ6A 2PDYA 1OFQA 4AMCA 1R2TA 2YX0A 2BY2A 3LPFA 1VZWA 2YIHA 3SN1A 3AHXA 3VOIA 3H4XA 2PRMA 2A3CA 4FXJA 5DO8A 3CGTA 5EMUA 3ATZA 4NILA 1XFBA 3OZPA 4OIFA 2RDTA 3S1UA 5HNNA 1F3TA 5HWNA 4DWSD 1AVAA 4MKSA 4CNSA 1WDSA 4D6HA 1SW3A 2CLFA 3UG4A 1E0UA 2G3JA 4JX5A 4CQ9A 3KS6A 1VFTA 4MWAB 4R34A 3VFLA 5FSEC 1W9PA 3KHDA 1FDJA 5C5YA 2OSYA 4PSRA 2PWHA 2IKIA 4GIVA 2E0PA 1NARA 1QPNA 2CIPA 1LYXA 2YDSA 3MDYB 4Y9PA 4LVAA 3A3WA 3U2CA 2PV3A 2CU0A 2E5CA 3GTYX 2J88A 4DHGA 4JD4A 4M7TA 1OD0A 3CWOX 2PPGA 2NX9A 3KDOA 4C1KA 4IIGA 3KDNA 1R7AA 1UB3A 4JQ1A 4B5UA 2DSVA 4JPGA 2AKZA 1JQXA 5CKSA 3WNLA 2D3NA 3XISA 3GKFA 1EDGA 3FOKA 1EXPA 1QW7A 3WQPA 1R9ZA 2FTPA 3VGHA 1LQAA 3MTWA 3AHYA 1T11A 2F8QA 3EWZA 1RAKA 2HVNA 4GWEA 1XP3A 3VNIA 3W29A 3ANVA 5C9ZA 3QY6A 3FXGA 3QY8A 3GHSA 3QQWA 3PZVA 1RD6A 1AODA 1EQPA 3SCUA 1NDZA 1DJZA 3ES8A 3VX1A 4E8CA 3NO1A 1L6FA 3BLFA 5FIPA 2QPUA 3VIKA 3W1MA 3PWGA 3TJIA 4PTNA 1UWQA 2PDFA 3IJLA 3UZYA 2XYLA 3PJWA 2QAPA 3NL3A 3UWEA 1QHPA 4AZBA 2KZHA 1AK5A 3WSUA 1G94A 3ENLA 2I14A 1BGAA 1TPDA 1W3LA 4WUIA 1OGSA 3QV9A 4IQEA 4DJEC 4GIYA 1FA2A 4B16A 4Z1AA 1U33A 3FEMA 5DXXA 1TE6A 2GOUA 2E5DA 2IPWA 2CZFA 1ONRA 3EX3A 2BHUA 1V5XA 3XINA 2Y63A 1J2BA 3W7OA 4C1NA 3QHMA 3C2RA 2I5GA 1DIDA 5EMJA 1KC7A 5CAHA 1NTHA 2FYMA 2V68A 4KQZA 4ATLA 2ZICA 4OUIA 3OW1A 4Z2IA 1Q6LA 5IHRA 3TW9A 5AYBA 3NG3A 1CEOA 5EYWA 4JDYA 1GJWA 1JJKA 1MSSA 2Y70A 3GVWA 3MMTA 1W9VA 3M4HA 4BA0A 3IAPA 3O5GA 3QMTA 4MZ8A 3VDCA 4ASTA 3PB0A 3PC0A 1BRLA 2ZE0A 3ANYA 4G50A 1FKTA 1X38A 4HZ7A 4P7QA 1ZENA 4WEVX 3MI6A 3VOFA 1T96A 2VZUA 3L4UA 3HPSA 3PBUA 5IFPA 4C6DA 5JU6A 3BZGA 5EGRA 3VC6A 3BLKA 4JFSA 1RXOB 1C7TA 3FA5A 3PBMA 4YVVA 1HL9A 1A80A 4HMDA 4WDXA 3WL1A 4NX0A 4KF1A 4C6NA 3DEQA 4HPHA 4PA8A 3KM8A 4V28A 3NZ1A 2GVYA 3QW3A 3F5KA 4JXCA 1EFZA 3L0KA 5G1MA 3NPVA 2NX3A 3L2IA 4ONVA 1CLKA 2W0UA 1TJ1A 3TFXA 3NQCA 1B4EA 2ISFA 1IXOA 1W5OA 4AHPA 1J79A 2HTMA 4Q4OA 3D3AA 3C3NA 5F2MA 9RUBA 1K9TA 2Q8ZA 5HPOA 1F7BA 1PB0A 1KT1A 4ODKA 4DELA 4X22A 2WVSA 1QO5A 4OOUA 4W9TA 4XAZA 2ODOA 5CH9A 4J7RA 3GG7A 4FMVA 2A1YA 1TPC1 2OSXA 2E9LA 1G7VA 2J6XA 1TYGA 3VNKA 1JDCA 4ZXOA 4QITA 1XKJA 1OX4A 4K6AA 4EWJA 3BCJA 1EGZA 3KRUA 4FOKA 1EJ7L 5I06A 1JPIA 2XTKA 5D9NA 4J4OA 2WXDM 1JXJA 4AISA 2YCEA 1XBVA 3NQ8A 1LRTA 1P48A 4OJYA 8XIMA 3CH9A 3BQ5A 3NFUA 5HW8A 2WHJA 3S2MA 1NAL1 3RDKA 1U79A 5K9XA 1E4MM 4JOMA 2YL8A 3BUVA 4XSLA 1AG1O 1GKRA 3NQ2A 5DBUA 4DEFA 4ZTXA 4HCDA 5HULA 3TNOA 1Q4NX 2G95A 3PN8A 4S23A 1EDTA 1Q45A 3C0JA 2PDBA 4B9ZA 2E28A 4RE2A 5DCDA 2ADAA 4IXXA 1AW5A 4N9DA 1FWDC 4N4PA 3STGA 3BL3A 2HS8A 1AH3A 1PHWA 3T4CA 1WBHA 3WH8A 1L6YA 1Q6GA 3P7YA 2YB1A 2OLHA 3T6CA 2MANA 5DCEA 1BG9A 3CAWA 3KW3A 4DH0A 2WJEA 2GQ8A 2X7WA 3OIXA 3DUGA 2PWFA 4AVOA 3TQ0A 3A23A 3ZZ1A 4ZEPA 2G41A 2CLEA 1Q85A 4U33A 4HA1A 3EEGA 1QJWA 4NUWA 2YCJA 3UF9A 1F40A 1E0XA 1K3UA 5DMLA 4AMAA 1XL9A 5F1UA 2E40A 4MFDA 3ZR5A 4IPJA 1TQJA 2KI3A 1GONA 4DRNA 4WSJA 2FHBA 5CGQA 3L4XA 3HFTA 2QJIA 1JPMA 3BANA 1G0CA 3UWUA 1VS1A 2V69A 5C8BB 2BV9A 3GH7A 1KQZA 5ABTA 4PCPA 3LHWA 5A8OA 3PRBA 2O4MA 4AY7A 4NY2A 4HMEA 3NR0A 4FN2A 1ISWA 2VGBA 3WCZA 3EYPA 1XIHA 3E1F1 4Y2WA 3WD0A 3NUKA 4YTUA 1G4TA 2FKPA 4MB3A 1QPKA 1NMVA 2LKNA 4OBRA 1D2KA 4I8DA 1W3IA 2Z2UA 1KGXA 1R3WA 2HS6A 1SO4A 3AS2A 3AU2A 3QRHA 1S2AA 1V8EA 1VFMA 1FRBA 2GYIA 3L2MA 1Y0OA 3Q94A 2JGQA 3NZPA 1Q6IA 1MUMA 3BG3A 1A5OC 3V7PA 4R5EA 3VC5A 2WSQA 4TV5A 3W7IA 1XINA 2WVUA 4LAWA 2DT0A 1F6YA 4FIRA 3E0LA 4LALA 3B0UX 1P0DA 3RILA 3GG0A 1NP0A 3PFRA 5BWAA 1F61A 1SQ7A 4Q33A 1RH9A 2ZWZA 2QGYA 1V03A 2PD9A 2VURA 2VOMA 3PTMA 3AAMA 1GK8A 3HV9A 1NM9A 3PHAA 3NO5A 3THUA 3EA3A 1KB3A 2GJNA 3A4WA 2CITA 3VE7A 1FFQA 2JIEA 1J4IA 2PCQA 3KL3A 2WB5A 4JHZA 2GDVA 1DQWA 3R13A 4IISA 1W1VA 4ZQMA 3TTSA 1Q6DA 4LCQA 4BJHA 1H61A 2FFCA 4J2MA 1EPXA 2EF9A 4D72A 3KFTA 5HW7A 3B4YA 3CV2A 3BJFA 1GQIA 1TA3B 3S6TA 3QW4B 3V16A 4HA0A 4W85A 2YCLA 1A53A 4Z17A 5DEZA 3BW2A 4PRWA 4A4AA 4W7VA 2YPIA 3C2OA 2OO0A 2VENA 1F6PA 1WP6A 2OZ0A 1NFBA 1C8XA 4RJEA 1GJPA 5I6SA 4IP5A 1W6TA 3GXMA 4RDVA 4HPXA 1UD8A 3F7JA 3FDKA 7REQB 2QULA 4O54A 1BQGA 1U1HA 3IVTA 2W27A 2VRKA 3EOOA 4UQDA 4Q8NA 2Y8UA 5BNKA 1BLIA 4TX9A 1BVZA 2GJRA 3G3MA 3GHUA 3O9NA 1SMAA 4WJ8A 4PUDA 4NJKA 4LS1A 2Y7FA 3IIZA 4A3RA 5I09A 3ARSA 4D6CA 3L65A 1PE1A 1BXBA 4OTKA 4Y8EA 2M1IA 4DBDA 1UMLA 3CHCA 5DIUA 3G3DA 1QO2A 3QFWA 2Y7EA 4YHGA 4L5ZA 4W84A 4XK2A 2XM1A 5CLTA 3V18A 4DRQA 4LSBA 2E6YA 3MW7A 2QIWA 4OVXA 5DANA 4ICCX 3KAIA 4WGHA 4ICMA 5G4WA 4ZOCA 4E3VA 5DIVA 3H7UA 1SVDA 1BYCA 3O6AA 1XWYA 2UBPC 1TQXA 4AF0A 2ACRA 4HT3A 5C7HA 4AD0A 2QJJA 2OX4A 4JTSA 2QCCA 4MIMA 4JN7A 1ZBCA 1HKMA 3T42A 3GYCA 4DRSA 1QNPA 4AD2A 1S5NA 3AIUA 2N87A 4A8IA 5CJNA 1E43A 5C6MA 1V02E 3C0SA 3OVGA 3LXCA 2WC7A 3FV9A 1L2UA 2WMHA 2X0YA 4IT1A 5BOFA 5KZMA 1TELA 3HOJA 5AC4A 1YX1A 5HWBA 3N15A 3OQ8A 3F03K 1ONXA 3RR4A 4C6IA 4BHYA 3S3GA 1YATA 1QPQA 1JDFA 5FF4A 3UJRA 1ZB5A 3VKJA 4Z0SA 3GU2A 4DZ2A 4IICA 2GZXA 3CWNA 4ZSUA 1WQ5A 3DYOA 4JTDA 1SPQA 2WJZA 4GRSA 1A3WA 4F8XA 2ZZ7A 1HX0A 2PTWA 4FX8A 1E1FA 1GHRA 4H9XA 1EJTC 1JF5A 4ATWA 2E6AA 3W7MA 1MW2A 5EKYA 4CVWA 2Q3OA 4KGJA 1H1YA 3WLLA 1F05A 4PB4A 3PR9A 4JNZA 4AZGA 2A5HA 4IGNA 4AZCB 3UD6A 2WKJA 3EB3A 1PUDA 4IMGA 2QVHA 2RHGA 2NX1A 4LCSA 3W84A 2OQYA 1M5WA 3LCFA 3OPSA 2UY4A 1UYQA 4JFMA 3Q37A 3LHYA 4E2DA 1Q5MA 2ZDRA 8CGTA 4Q4SA 3UJ2A 5BMXA 1PYFA 1DHKA 1RQHA 2XIOA 3BLPX 2ZZ4A 2FDMA 4FR1A 3LQGA 4J3VA 3BH4A 2XPAA 4FPSA 4IGSA 4W89A 1DXEA 2BS9A 2ETNA 1X6UA 5ECVA 1VFSA 1OIMA 4JYSA 2QGHA 4RNIA 4IXHA 4K38A 4L9XA 3IUIA 2V8ZA 2EQDA 4H00A 5AYYA 1H11A 1VP5A 1I0DA 1V6VA 4Z2KA 4GGQA 1KFCA 1VPXA 1FKLA 1MO0A 1NQ6A 3UCDA 3CQIA 3ITLA 2LPVA 3ZWTA 4PBGA 1XYFA 4CQCA 1XV8A 1GVIA 2ZX5A 2GSJA 1HFBA 1VCFA 4M24A 2Y78A 3C6CA 2DH3A 2TSYA 2BZNA 1S5VA 5BXJA 1AD1A 1QW9A 4GG9A 4JFKA 2V3DA 1BKFA 3ONBA 4S2BA 3CLMA 4L4MA 3DHUA 4GUGA 4D6IA 2QJHA 4KESA 2ALRA 3T08A 1BKSA 3PWIA 3EXTA 2J7FA 1NOUA 4DZ5A 2G3IA 1DP0A 1W31A 3A9IA 4FK9A 5T9CE 3U57A 3DX5A 3POCA 3FXYA 3NYDA 3BURA 4DNHA 3GH4A 3KVKA 3WDRA 3SSJA 1X98A 1HW6A 2PP1A 2ZUTA 4AWSA 4V15A 3MHUA 1I45A 3MS8A 5AB3A 3GRIA 3N17A 2L5HA 3LOTA 1J0KA 5T26A 1GTEA 2PBGA 1BHGA 4RPPA 1IR2A 1QHOA 1XD0A 4PEEA 3KBSA 1RJRA 1HZYA 4HZMA 3PF3A 5D30A 4TMBA 1D8CA 4KPLA 3R4IA 2J77A 5EFFA 3H12A 3HA1A 3W25A 3WF4A 2A3EA 1KRBC 1EP1A 3GXTA 3ITCA 4GYFA 4P8WA 4NSBA 1GVFA 3CT2A 3VNLA 3WLOA 4C6QA 4F4RA 2EJAA 3QYQA 1I9CB 3AICA