1JNEA

Crystal structure of imaginal disc growth factor-2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Imaginal disc growth factor-2
publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
total genus 145
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jneA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jneA01
2GK1A 1HVXA 2JIEA 1XSJA 1UA3A 1GVIA 3WL0A 5I0DA 1CEOA 4P7OA 3VNZA 1G1YA 1EHNA 1NWTA 5IFTA 3AIBA 2VT0A 2BY1A 3W24A 2WM0A 2EEXA 3GXDA 5FOOA 1RP9A 1CLXA 2G3NA 4BQ2A 5BRQA 2ZE0A 1BYAA 2NSXA 3OB8A 5I24A 4J7RA 3RILA 1KGWA 1E1EA 2E0PA 7CGTA 1V3MA 2E9MA 4N0RA 2WVSA 5I23A 3MMUA 3AZSA 1UR8A 1DHKA 1VAHA 2VMFA 1XV8A 2J7HA 4NRRA 1HJQA 4CN4A 3KL3A 3WMSA 3AIQA 5E6ZA 4E2OA 3VDCA 3AS0A 1BYDA 5C8BB 1DWJM 1KCLA 4P7LA 1W9XA 3VTRA 1LL4A 1TA3B 1QBAA 4AZHA 2VQUA 1TVPA 3NIYA 4CD7A 1FH8A 2XVGA 3PTKA 4TXEA 3U7BA 1UD5A 1BF2A 2E3ZA 1FH9A 2QMKA 4M24A 5GPRA 2GUYA 4UZSA 4EANA 1AVAA 4GXPA 4MJ2A 1XH2A 4PBGA 2W92A 3AOFA 2NW0A 4U5IA 1JD7A 3AFBA 2J7EA 4UQAA 5I3DA 2G3IA 3APGA 3CPUA 2ESCA 4CKQA 3OGRA 2Y24A 3MKKA 4BZYA 2WMIB 2ZXDA 2PWFA 4E8CA 3D3AA 4U2ZA 4B16A 5IHRA 1V0LA 4KMQA 1E6RA 2BY2A 3WF4A 4CCEA 2WBGA 4KH2A 4AWEA 2PBGA 1WZMA 3MS8A 3QR3A 9CGTA 1EOMA 1CXHA 1G5AA 1GOQA 2CCRA 4UQCA 3F4VA 3GH7A 2J8GA 5AY7A 5BRPA 4YHGA 3NYDA 4WJXA 2WK2A 2O9OA 1EA9C 2D0HA 3EDDA 5BXPA 3CHEA 1OM0A 1QW8A 1CGXA 4M29A 2YKKA 4GZJA 3MUIA 3MANA 3QGVA 1M01A 1OGBA 2Y2WA 3RM4A 1NQ6A 1NP2A 2WC3A 1LL6A 2VZOA 1UWIA 1FFQA 1W3HA 1UA7A 3W25A 4ATLA 3LPGA 4UFIA 1MFUA 5E09A 3A47A 4JFUA 3WNKA 2PC8A 1BSIA 2O9TA 3L4VA 3WD4A 2EPNA 1R87A 3K8KA 3CUFA 4HP5A 1DP0A 2WVUA 3ALFA 3GM8A 3AS3A 3WD2A 2YJQA 1V6XA 1V0NA 5E0FA 1QI2A 2CETA 3TTYA 3FHAA 4GO8A 1HT6A 2QPSA 2OWXA 1CBGA 2YA1A 2OLHA 2PF0A 1UKOA 2PB1A 2ZX5A 3B9DA 4AZCB 3BAJA 4L4OA 5DEZA 1DWAM 2WWDA 3WH6A 2Y4SA 4OOZA 2OSXA 4UNIA 3WNMA 1O7AA 4H8UA 5D8WA 2VZSA 3CZEA 3NUKA 1XHGA 2FHFA 5A8MA 1A47A 3DHUA 3ARSA 1A3HA 2BHZA 2JEPA 3ZJ6A 4CD8A 2EPLX 3EDJA 5BYWA 3FXYA 1GVYA 4GIAA 3NCOA 2Y5EA 1QW9A 2XUCA 2G41A 2DQXA 2OWWA 2CBJA 2FH8A 4DUWA 1MQRA 3A3HA 5A2BA 1XH1A 1CWYA 1Q6EA 2VCAA 2YLLA 3OG2A 4W86A 4QDMA 1D3CA 1JAEA 1HKKA 1QHOA 4WKHA 3BXWA 1CGUA 2IUZA 1B1YA 2YBUA 3K8MA 2XPKA 4WKAA 2ZXQA 4TVUA 3SUWA 5JUVA 3PZ9A 1WB0A 4MAVA 2BY0A 4TVCA 4GI6A 3VIGA 3CUJA 3CUGA 1US2A 1EOKA 2GFTA 5A69A 4Z2JA 1K9FA 3VX1A 1ESWA 1YHTA 2WMGA 4FK9A 3SCTA 1E4IA 1OBAA 1W91A 5D9OA 3VD9A 3BGAA 5JIPA 3ZSTA 4U3AA 4KRUA 1LF1A 1KQZA 4CD5A 2O9PA 3VGEA 2CNCA 1VFOA 2Q8XA 5A6LA 3OZPA 3DECA 2YBTA 3VX0A 5EMYA 3OGSA 1QI5A 4WF7A 2DH2A 1HVQA 1J0YA 3ZMRA 4PMZA 1LLOA 1GQIA 4C7GA 1CYGA 3UG4A 3UERA 2V5CA 1E3XA 1MWOA 1CXIA 2CPUA 4W87A 3T0AA 3RDKA 3AMKA 1KXQA 1I1WA 1W3KA 1VFFA 3TTSA 1H0IA 4W85A 1CENA 4AC1X 1MQPA 3ARXA 1BGAA 2BVTA 5BXTA 1C91A 4MNMA 5CPTA 2WPGA 1J0HA 1P6WA 1V3IA 3VGFA 2ZOXA 1H4PA 1JYXA 4M56A 3ZQ9A 1M53A 4RL3A 1XRVA 3WUFA 3WF3A 1JF5A 2XJ7A 5CSYA 2WXDM 4UQDA 4MADA 2Z1KA 3VINA 3QHMA 3AIUA 1NARA 3WDQA 4DWSD 1B2YA 1MYRA 3FAXA 3VDBA 2IXVA 1XYZA 3UEQA 1U2YA 3OLDA 1CGWA 4D71A 2E40A 3CZLA 3WNLA 3CZJA 3RMEA 1Q6FA 1UH4A 1BAGA 4AZIA 2ZX7A 2AAAA 3VIKA 2ZUTA 5EFFA 3QOKA 3IJ8A 3GDBA 4J27A 4HZ7A 5ABFB 1NWUA 1GHSA 4MB4A 2DGAA 2XFFA 4EAMA 1WCGA 3CH9A 1UR4A 5A6JA 3W81A 4S3JA 2X0HA 1QPKA 4KGLA 2D3LA 8CGTA 1XD0A 1V0MA 3A6OA 4JKKA 2F2HA 4ATDA 3AZRA 4U2YA 4BA0A 3WH7A 1MW0A 1J0IA 3WMCA 1BQCA 3WNOA 1JNDA 3EDFA 4URIA 1C7SA 4JL2A 3B9AA 3OLIA 2V3DA 3PTQA 1JYVA 1R86A 1EDTA 4OIFA 5TD4A 2EBNA 4PUEA 3LMYA 1SFSA 4WSKA 4BS0A 2DH3A 1E4MM 1KBKA 3FY1A 1UHVA 2O9RA 5DFAA 4AZBA 3AHVA 5D9MA 2J62A 3EBVA 4J28A 3WD3A 4JFWA 1E0VA 3AMGA 2JIWA 4AZ5A 3LPOA 4OOUA 1OGGA 4PN2A 3WMBA 1UWUA 4MNKA 2J25A 4ATWA 2WZHA 3ARZA 2C8NA 1UOKA 4P8UA 1X1NA 1W9VA 2VZTA 5A6KA 1JZ5A 1OD8A 1KR1A 3WELA 1B3YA 3WQVA 3FN9A 5BWFA 1W1YA 5FL0A 1V08A 4JL1A 1VRXA 3VOCA 2WVVA 1CGTA 2WMFA 1TE1A 1C8QA 2VX4A 2VTFA 3HU7A 3VILA 4JHOA 4UQBA 4CVWA 2ZX9A 4BQ3A 1W9UA 4XUYA 4J3SA 3AROA 1GONA 5A6AA 2WBKA 3W38A 1XCXA 2ZICA 3WF0A 3ARQA 3WDIA 3W4RA 1GOMA 2PWGA 3W6MA 3GNRA 5CZKA 3TONA 4QCEA 2OYMA 4NI3A 3ALGA 3SIMA 1GW1A 2XSAA 3NJ3A 1W1TA 1JGIA 2VOTA 1H49A 4MB5A 5ABEA 4GINA 2BFGA 1H11A 2OWCA 1R8LA 4HOXA 3OLEA 2ZUNA 3AYRA 5CXPA 3FW6A 3SUVA 3WH5A 3BLKA 5EBAA 1AQMA 2FHCA 5IDIA 1GJUA 3WQ6A 2PI6A 1UQZA 3M7SA 3VD3A 4A3HA 5E6YA 4H8VA 2CXGA 4WLCA 3NSNA 4QLKA 1F4HA 2V3GA 4X9YA 2BV9A 4WSJA 1G94A 3W0KA 1HNYA 2CHOA 3VIIA 3ZJ7A 3SUTA 1HKMA 4CGTA 1C90A 1VB9A 1OIMA 1UD4A 2WC7A 1YQ2A 4N42A 4AZ6A 2WWCA 2QMJA 4AISA 3PBGA 1HP4A 3PZVA 1NWSA 1E0WA 1JDDA 3VM7A 2XTKA 5GQBA 4QCFA 3VD4A 1E15A 5GNZA 5JBDA 4B15A 2RGLA 3VGDA 3L2MA 1XD1A 1LJYA 1E6ZA 2XFRA 1CXKA 4GI9A 4BQ5A 1NOFA 5CG0A 3NSXA 5A1AA 1E72M 4JFVA 3EMCA 4UCFA 3U5UA 1JIBA 1TCMA 1PX4A 4D6EA 2W67A 4DWSA 2XFYA 5CLWA 2GJXB 5GNXA 2CHNA 1JZ2A 1WKYA 1GQKA 1VFMA 3W29A 2WYSA 2CBVA 5IFPA 3L4XA 3AJ7A 1EIBA 5BXRA 3VGHA 2JF6A 1W3LA 4P7NA 5IHSA 3MO4A 1NOUA 4UFJA 5F7UA 3CZ8A 5I2UA 3UCQA 5I78A 2XYLA 2YA0A 3JUGA 1ZBKA 1HXJA 4P7QA 4PCSA 5JH8A 4UQ9A 6TAAA 4TTGA 2W91A 4PTXA 1UWTA 5HNNA 3MSDA 2PWEA 2CIPA 1CXLA 2VR5A 1HF6A 1XYFA 4OZOA 2VZVA 4CVUA 3ZIZA 4PTMA 5M17A 3KE0A 1UG6A 4H8HA 3VMPA 1HX0A 3N17A 3UETA 4TOQA 1J12A 1O6IA 3O2LA 4PTVA 2DEPA 4MNJA 1TZ7A 3N15A 4IUGA 4ZFMA 1JG9A 4GQRA 1W9DM 4A3YA 1L8NA 1QOXA 1VEPA 4AZ7A 4Z2HA 4PTWA 4J3VA 1UQYA 2XVLA 4X0NA 1WP6A 3AMDA 5EB8A 1DWFM 1TA3A 2WB5A 3SCVA 1EDGA 1E6SM 1E0XA 3AIRA 3AHZA 3OGVA 1UH3A 2XM1A 5A95A 4CN6A 2D0FA 4QP0A 5CLTA 3DHPA 1QNSA 3N13A 3WBAA 1BYCA 1ZBVA 2VVSA 1UR1A 4ZXLA 1DTUA 3D5HA 4CD6A 3CHDA 1ZB5A 2UY4A 1B31A 4HPGA 1C8XA 3WUGA 1SMAA 4YHEA 4W8LA 3AHTA 2A3AA 4ZENA 1D7FA 2JFEX 4WK9A 2VCCA 3WDRA 2DDXA 1HIZA 1EO5A 4PSRA 3UG5A 3O9NA 1TR1A 4C7FA 5A8OA 3UESA 2XGBA 1J0ZA 2WANA 5HDRA 5C70A 3AIEA 2WLZA 1VENA 2WMIA 1OGSA 2VQTA 2A3HA 1VEOA 2DT1A 2Z1SA 4DUVA 1GOOA 1WZKA 1KBBA 2TAAA 3POCA 4AD0A 1V3KA 2DSWA 3WIJA 2WSKA 1GQJA 4ZE5A 1C93A 2C7FA 4NRSA 1CNVA 1E1FA 1ECEA 3AS2A 7TAAA 1GZJA 2ZWYA 1HJUA 1LG2A 3PZQA 4F79A 1ZS2A 1ZU8A 2D0GA 1CECA 3E1F1 1QNOA 4YPJA 3TTQA 3VU2A 2YL6A 3ZJ8A 4TVDA 4MNLA 1B3VA 3EYPA 3AI0A 1UH2A 2EQDA 1BVZA 4KRTA 5HPCA 3NDYA 3N1AA 1H5VA 1PZ3A 3SEPA 1EHAA 3CTTA 3IJ7A 2ZIDA 1BPLB 1E3ZA 3EMZA 4PMDA 4HA4A 2NT0A 2EO7A 4BCEA 3ARUA 4AZCA 2J7CA 5HBFA 1FA2A 4CUCA 4Z2KA 2VRKA 3TTOA 3VIOA 4ML4A 4W8BA 4KWUA 2WKLA 3RJYA 2E8ZA 2X0YA 5I5RA 1WZAA 3WEOA 3ZM8A 1WAWA 1GOKA 4PSPA 2J47A 2CKSA 2ZUMA 5D8ZA 3BCDA 5HOSA 3BC9A 2DIEA 4PYSA 3L4WA 5ECUA 2O92A 1JXKA 2J7BA 2J4GA 3W82A 3WENA 2JE8A 4HU8A 1UUQA 2WW5A 5A2AA 2DPEA 1MQQA 4QLLA 1I75A 3TP4A 2WHKA 5A3HA 2EXOA 1TUXA 2WCGA 2DT3A 1J10A 5KEZA 4PUDA 1SMDA 1W1VA 5AYBA 5E9AA 4PCTA 2QV4A 4R5EA 3WUBA 3PZUA 4XX6A 2YDQA 3DYPA 4D72A 4EK7A 3KEHA 2V3FA 1EQCA 4UR9A 1C3FA 2GJRA 1NWRA 2J79A 5C71A 2VC9A 4TTUA 4LPCA 4M82A 1OD0A 4M80A 1E55A 1J01A 3U57A 2VUYA 3B8SA 1K9EA 4Q22A 4V28A 2YL8A 4WIWA 4GO9A 3ARTA 1HKIA 1UD8A 4OJYA 1BVNP 5AC5A 5IXEA 1KQYA 4AD5A 1WDSA 4QFUA 1F4AA 2FHBA 4XB3A 2AMGA 1QVBA 3VUPA 1CZ1A 4AIEA 5AC4A 1FOBA 3AHYA 2CBIA 3RM8A 1V02A 1SYTA 1KXHA 2X1IA 4J3WA 1UZ4A 1IZKA 2ZUSA 5D9PA 3W26A 3BAIA 1ISXA 5FL1A 4FLRA 2FH6A 4UOZA 1JYNA 3CBWA 1EXPA 3M6DA 3L4TA 4IM4A 1NP0A 3WNPA 3KL5A 1G0CA 3WUEA 3N12A 1LL7A 1IZJA 4H2CA 2VURA 1PEZA 4FF5A 1PX8A 1U30A 4S3KA 4HA1A 2HVMA 1H2JA 2C0HA 1ISZA 2D22A 3K46A 4DM2A 2J7DA 4ACZB 2VL4A 1B3ZA 2VJXA 1R7AA 5FIPA 2GVYA 1AQHA 3O6AA 1D2KA 1V3LA 4MDOA 2QF8A 4PMYA 2XIBA 4W5ZA 4AIOA 4E8DA 1Q6GA 4CU8A 1OCQA 3BAKA 3VO0A 3WN6A 3PZOA 4F66A 3AHXA 5LA2A 4H04A 1E5NA 3QHOA 3L2LA 3PZTA 1GPFA 4HZ8A 3WNNA 5A8NA 3VGGA 4W7UA 1OINA 2ZXAA 2VZUA 4W7WA 3GBEA 4EE9A 2F61A 6A3HA 3T2OA 2YLAA 3UR8A 4M8UA 5A6MA 3WD1A 1VFUA 2E9LA 3ARPA 2G8ZA 5GNYA 4AD1A 1WNOA 3A4WA 1UKPA 1NM9A 3AYSA 3T08A 1Q6CA 5ABFA 1M7XA 3WEMA 1GQLA 3GH5A 1KCKA 2ZXBA 1G01A 1VBRA 3AISA 4OBSA 5A8QA 2MANA 1EGZA 4JCMA 3BAXA 3SUSA 2W63A 3BH4A 1MXGA 6CGTA 2BVYA 4V2XA 3KWXA 3VPLA 1K6AA 4AMCA 3RIKA 2VRQA 2OYLA 3L4UA 4NF7A 4JIEA 1TFVA 3PHAA 2X2YA 3MV01 1ITCA 1JDCA 8A3HA 3BSGA 1NOWA 1RH9A 4B3LA 1KGUA 3VD7A 1PIFA 4MJ4A 4D6DA 1KGXA 4HOWA 4FLSA 4Z2IA 4J3UA 3RM9A 1GOIA 1KB3A 1DWGM 3WKZA 1LQ0A 4L4PA 2AOSA 2WZIA 2WMHA 2WZEA 5A6BD 2BVDA 3IK2A 4WKFA 4MB1A 2DSZA 1UWRA 5HXMA 1MXDA 2ZUWA 1QI0A 2J7GA 1QHZA 3U7VA 4D6IA 4CCCA 2VO5A 3PZGA 1RD6A 3WY1A 1V6WA 2DT0A 3PZNA 1HJSA 4RE4A 1GHRA 4ZEPA 4MAZA 1BLIA 1HP5A 3AXHA 3PZIA 3ECQA 1FP9A 2GK1B 4M81A 1GOWA 1BFNA 2VX5A 5D9NA 1HN1A 1MW1A 1CDGA 1EO7A 2GDUA 3I3EA 1E70M 1WE5A 1ITXA 1B3WA 1UR2A 3AZTA 4TX6A 3HJEA 3CZGA 2J75A 4OKDA 5A2CA 2J78A 4NZCA 3RCNA 3VMOA 2QPUA 4PMOA 2NT1A 4PMNA 4D6CA 1KFWA 2ZX6A 2VCBA 3J7HA 4U31A 4J3TA 2Y8KA 1M04A 2HISA 3WFLA 3RJXA 1W1PA 2BXYA 1Y7VA 3SUUA 1BG9A 3AXXA 1VBUA 2QLYA 4HMEA 4ACYA 1AQ0A 1ZJAA 4E4PA 4Q7NA 2D1ZA 1VJSA 1J0JA 2OYKA 1XH0A 5EFDA 4CCDA 1JZ3A 1BGGA 2J74A 1W9PA 5CJ5A 2G3MA 1MVYA 1CPUA 1TVNA 4PMRA 1JDAA 3W53A 4B3KA 3KZSA 2XG9A 3U5YA 1UKQA 4W89A 2ZUVA 2UY3A 1JZ8A 1HL9A 2XVNA 4UOJA 1JF6A 3GTNA 2EPOA 4HZ6A 3AXIA 1PPIA 4W7VA 2X05A 1KWGA 2CESA 3T09A 1RP8A 1HJWA 1CGYA 4P8XA 1E4NA 4FLQA 3T0BA 5JIWA 4DM1A 1CGVA 4JCLA 3SCOA 3DYMA 3MMWA 3WBEA 1GORA 1GCYA 1W32A 2J7FA 1GJWA 1WZLA 3F5JA 4W93A 4D1JA 1NH6A 1BYBA 1VIWA 5CGTA 4W88A 1KR0A 3VD5A 2BHUA 1ZJBA 3FNDA 3OIHA 4QAWA 3WSUA 3GXIA 1FHLA 1PAMA 1E9LA 3WQ8A 5I79A 2WCAA 1US3A 1OIFA 3WDJA 3WFZA 2VNCA 3WQ5A 3FHQA 1W3JA 4XV0A 2J77A 4AXNA 3T2QA 4W5UA 3K4AA 1JXJA 3G6MA 5KZ6A 4IISA 2E8YA 1J18A 2GJXA 2VR4A 3VDHA 2CBUA 3GXMA 1XGZA 4AIUA 3WDPP 1UKTA 3QOMA 4HMDA 5ABGA 4HPHA 1WPCA 2WVTA 3ZO9A 4J3XA 3S2CA 1HJXA 1IV8A 1Q4NX 2OSWA 1FP8A 1UD2A 1GNXA 1UR0A 4W8AA 1GUVA 3N04A 2XGIA 3I3BA 2YDSA 4TUFA 2GDVA 1B3XA 3BAYA 2BY3A 2DSVA 4X0VA 5A94A 2CITA 2WCSA 4LQ1A 1MW2A 4PEEA 5DT5A 3ARYA 1B30A 3G6LA 2CEQA 1DWIM 1JAKA 3RPMA 3SCUA 3CHFA 4JFTA 1DEDA 2VVNA 1RPKA 4LXFA 2XSBA 3MUAA 4UZUA 3GNOA 3T2PA 1JI1A 1B0IA 4IPNB 4YN5A 1LWHA 4V27A 2PBOA 3N9KA 2FGLA 1B90A 4AEFA 1CXFA 3QHNA 2JEQA 4MB3A 4LYQA 3LPPA 1UD6A 3RO8A 1R7OA 1HL8A 1WDQA 4H7VA 4QLJA 1C92A 4AEEA 5M5DA 1CLVA 1ZBWA 1KXTA 3B9EA 5A6BA 3CLWA 4JHZA 3GNPA 2WMKA 4JKMA 5DF0A 5LYRA 3PZMA 4B9YA 1FH7A 3SURA 3AS1A 3GYCA 4D6FA 1V6YA 3BCFA 2WLYA 1V03A 1BHGA 2CERA 2W62A 4LYRA 1E43A 3M07A 4UFHA 2IXUA 4MPKA 1FHDA 2UY5A 4RE3A 4BQ4A 3VIPA 4ZXOA 4FLOA 1UWQA 4UTFA 1E40A 1QHPA 4MDPA 1JZ7A 1AMYA 3BSHA 1TG7A 3W27A 4B9ZA 1UKSA 3IJ9A 2G3JA 3N18A 4OUEA 3CGTA 2DSUA 3WH9A 3SCWA 3VMNA 4JFSA 1LWJA 5E0CA 1E6NA 1Z32X 1K9DA 1QNRA 2XWDA 4PMVA 1QI3A 1JD9A 4HMCA 1ZBCA 2WMJA 3WH8A 2PWHA 3MV11 1VEMA 4NSBA 4K68A 1XCWA 3TOPA 1G9HA 3SCQA 3OLGA 2A3EA 4R27A 1XSKA 3BAWA 1OB0A 5M03A 3AICA 5E70A 2BHYA 3BLPX 3WQWA 2WHLA 2YOCA 2D23A 3PN8A 2PWDA 3K1DA 4F8XA 4ZE4A 2BS9A 3BMWA 1JZ6A 4CU6A 3ARRA 1JFXA 4UFKA 4UFMA 1W2PA 3FAWA 2EJ1A 3ZT7A 5CPSA 1EQPA 1U33A 1J11A 4AD3A 1VJZA 3SCPA 1HKJA 2FGZA 3ZR6A 1MW3A 1V6UA 1E73M 1V02E 2XVPA 4M1RA 4MTVA 1JL8A 3HMCA 1JFHA 4AYSA 3DC0A 2CKRA 5CQ1A 2YL5A 3UR7A 4KGJA 2BXZA 3GZAA 4PRWA 4XZWA 1OT2A 1OSEA 1V6VA 2XVKA 3WDHA 4AY1A 1OT1A 4IPLA 3S6TA 1I1XA 3CHCA 1PIGA 3VNYA 1E6PA 4DWSC 1Q6DA 4FMVA 4PMQA 1WDRA 2YIHA 2W66A 5LA0A 2G4FA 4AD2A 3WEZA 2VX7A 4LX4A 5JBFA 1HJVA 1N82A 2WNWA 4Y7EA 2X8RA 5M3WA 5FCZA 1ODZA 3SCNA 1UWSA 2UY2A 4F9DA 4OBRA 5DMYA 3F5KA 4GZEA 3ZJKA 7A3HA 3VGBA 2D20A 5DT7A 3N11A 1E56A 2F8QA 2JALA 3UG3A 3BMVA 2YL9A 1KWKA 4D6GA 2ZUUA 2XM2A 3VIMA 4PMUA 1TMQA 2XWEA 3L4ZA 2DIJA 3GBDA 1JI2A 3GXFA 2GSJA 3MSGA 4W84A 1J0KA 4CN1A 3ZT5A 1UD3A 3NSMA 5A6SA 2WHMA 5DO8A 3SCRA 3CUIA 1R85A 1UYQA 2WKGA 1QI4A 3OBAA 1V3JA 1ISYA 5HPOA 1DWHM 3ARWA 4CD4A 1E6QM 1M03A 4Z2GA 2RGMA 3T0DA 3NDZA 1UZ1A 1H09A 5AYIA 3ZR5A 1PX3A 5FD0A 3ZT6A 5CSUA 1E6XM 5CPQA 3WF2A 1L0PA 3CIVA 4BF7A 3MUY1 4LGXA 1V3HA 2Y8VA 3AMCA 4DUXA 1WO2A 3W28A 3VKKA 3TA9A 1XC6A 2W61A 3K8LA 2D3NA 1JYWA 1UR9A 3II1A 1XSIA 2QHAA 2WSPA 1QBBA 3MU7A 1EDQA 1K9TA 2ZX8A 3IANA 4GQQA 4A4AA 1H3GA 3WQ4A 4RE2A 5D4YA 2YA2A 3OZOA 4HA3A 4P8VA 3W6LA 4U3CA 4GKLA 1C7TA 1X6NA 3EMQA 1QNQA 3POHA 3WF1A 2WVVB 4P8WA 2JF7A 3PTMA 2E9BA 1MFVA 3WD0A 1PJ9A 2A3BA 1LG1A 1EH9A 4PMXA 3THCA 3A4XA 2WHJA 4ACZA 1W9BM 3L4YA 3CMJA 2BNJA 1IT0A 1J9YA 2FDMA 1FFRA 5ABHA 4TX8A 4HU0A 3ZOAA 1S46A 2D24A 3F5LA 3VIJA 3IAQA 1W2VA 2J8FA 2W5FA 2X09A 4D6JA 2D2OA 1CTNA 1SR0A 3VIHA 4HOZA 4F9JA 1BG4A 5A8PA 2DT2A 3KL0A 2XIIA 3AQUA 2V3EA 3CUHA 2VRJA 2OSYA 1BTCA 3I3DA 3K4DA 2ZWZA 3ARVA 5FKYA 2UWFA 5BROA 3AMLA 4JAWA 4JZ5A 2VI0A 4AW7A 2A3CA 3HN3A 3OA5A 3ZSSA 3GH4A 1PBGA 2EPKX 1ZL1A 3A4AA 1CXEA 1C8YA 2YDRA 4P7RA 3SCSA 4EKJA 1JZ4A 3MMDA 2GJPA 1KXVA 4U5KA 5LA1A 2XHYA 5I6SA 1E4LA 3THDA 3M46A 3AIWA 1X6LA 5BXSA 2WC4A 1VF8A 3MUZ1 4C7DA 3WL1A 3CMGA 1H41A 1CIUA 1QNPA 2WAGA 4XZBA 4UOQA 5CGMA 3VDAA 3W37A 2V38A 2VX6A 3LPFA 1H0GA 5I77A 1B9ZA 1OWQA 4D1IA 1JNEA 4GPNA 2DSKA 2EPMX 2E4TA 4Z2LA 3AIVA 4GI8A 4GZIA 1ISWA 1WDPA 5BCAA 4D6HA 4DWSB 1ISVA 1PZ2A 3CZKA 2CYGA 4AZGA 4JKLA 2W4XA 3VM5A 4LYPA 1V0KA 1E5JA 3EDEA 4U33A 3VIFA 3EDKA 5JBEA 1ODUA 4AD4A 1H1NA 2B31A 4H41A 2V5DA 4CU7A 3IAPA 4UQEA 3CO4A 3VVGA 4UFLA 4HTYA 3DYOA 1E71M
chains in the Genus database with same CATH superfamily
2JIEA 4DLFA 1I4NA 1GVIA 3WL0A 1MSSA 3VNZA 2J88A 5ABTA 3W2UA 3A9IA 2HV5A 1RA0A 3TJXA 3RR4A 2WM0A 2EEXA 4LNCA 3Q67A 2G3NA 4N19A 2BTMA 3W6YA 5CEWA 3PB2A 3UXDA 4XAFA 2NSXA 4JTJA 2OFJA 3E96A 3G1XA 5I24A 3GU0A 3RILA 1K4GA 1KGWA 2VWTA 2ZZ7A 1J8VA 1JCTA 1Z6KA 5HMEA 2J7HA 4QR6A 4ENLA 4NRRA 3IJQA 4JD4A 3WMSA 3N2XA 3U48A 2AL1A 3KABA 4YJ5A 5C8BB 3KHJA 4BF9A 3W2LA 1DWJM 1KCLA 4IG2B 1ALDA 3VTRA 1TA3B 5HQEA 2GVJA 1XLIA 1QBAA 3QPZA 4DROA 5GJMA 5T9BG 4GCAA 4GI4A 4ZA0A 1TVPA 1FH8A 2XVGA 4S3CA 4FPSA 3FXGA 1FH9A 3RN6A 1VHNA 1I0DA 3TSDA 1KW1A 4UZSA 4EANA 1PBKA 2TMDA 1XIMA 3R8HA 3L68A 3LHYA 5I3HA 1XH2A 5C54A 4ZFCA 4U5IA 1JD7A 3VI2A 5D2WA 4LAZA 1O60A 5CC5A 1P1XA 4XAYA 3APGA 3LCIA 3CPUA 1UJQA 2P0OA 2P3ZA 3ABZA 3PB0A 1JNSA 2Y24A 1Q6UA 2C19A 4EF8A 1IIHA 1YATA 2ZXDA 3HF3A 5IHRA 4DRNA 3S5NA 4KMQA 4L6HA 1E6RA 2HE5A 5D33A 3RMJA 4TU1A 2PBGA 2PLKA 1FKIA 4XTDA 1EOMA 1GOQA 3T07A 3P5YA 1O5RA 2WK2A 2O9OA 1DE5A 1OQFA 2H9AA 3EDDA 5BXPA 1OM0A 3M0JA 1CGXA 3I6EA 4M29A 4GZJA 1XISA 3QV9A 3TCEA 3BLLA 2C0AA 3GFZA 3S4TA 3RLGA 4D8LA 2FTYA 3CUXA 2LPVA 2WC3A 2VZOA 1UWIA 3H2OA 4ATLA 4ICMA 3LPGA 3FOKA 3GVQA 2VOMA 4UFIA 4LRSA 3IUHA 3OBEA 1VGAA 3IIVA 3O0FA 3JYMA 3L4VA 4HZMA 2NLYA 3WD4A 2OOGA 2V82A 4RDWA 5HW8A 1BWKA 4HP5A 3ALFA 3AS3A 3WD2A 2YJQA 4QITA 4U10A 2OLHA 2PF0A 1UKOA 3BOFA 1DWAM 2WWDA 4XZMX 1F6PA 3U6WA 2ZFAA 3WNMA 1O7AA 1GYNA 2FPVA 5D8WA 3P3BA 4KEUA 4AC7C 1UBPC 1R38A 2WZTA 4GIAA 2NUXA 1Z7AA 1QW9A 2X41A 3C0SA 3KOYA 2CBJA 1V8EA 2QCEA 2FH8A 5FJRA 1WXZA 3TNOA 3A3HA 3KBSA 4EPBC 3UI5A 1XH1A 4MYXA 3OG2A 2YLLA 4QDMA 2BBFA 3WH0A 2RAGA 1QHOA 3A22A 3K4WA 6XIAA 2ISDA 1Q6LA 2IUZA 1B1YA 4U28A 2HNHA 2DV0A 3CIXA 2ZXQA 4Y9NA 3SUWA 5RUBA 3PZ9A 1XM3A 2PWVA 1WKFA 3CUJA 2ACSA 2PBCA 3CUGA 1BTMA 1K9FA 4PCNA 3VX1A 5CJMA 1YHTA 3KX6A 4XD3A 4MSPA 3UWVA 4KIEA 3GPKA 1TPFA 2YB4A 4XISA 2B7OA 4QEHA 1LF1A 3L7RA 2CNCA 5CC7A 2V5BA 4GLEA 5A6LA 4DB7A 1JUBA 2OZ3A 3HGJA 3VX0A 1NSGA 1QI5A 5C0QA 3N2OA 4BK9A 4JTAA 1YEYA 2DZUA 4WDUA 4NAFB 3ITGA 1LLOA 3N14A 1E3XA 1MWOA 5E0KA 4I8YA 1UASA 3AMKA 3GVVA 5FF4A 2VR2A 3CAWA 4G7EA 3TTSA 4PUJA 4AHQA 1FKFA 4MF4A 1E1CB 3RO6A 5I3FA 1PL9A 4AC1X 3BICA 2YSWA 1MQPA 1J5TA 2BVTA 3TW6A 2QUNA 3QY7A 5CPTA 5AZ1A 1P6WA 3VCRA 3YPIA 3C2RA 3HPSA 5L9FA 3VGFA 2ZOXA 2QJJA 1TIMA 1K7XA 1JYXA 3MHFA 4RL3A 5CSYA 4UQDA 2C13A 1XIFA 3UWWA 2BGSA 2YR1A 1BWLA 3M0IA 3R0KA 3TCZA 2WSRA 3FSUA 3TSBA 1U2YA 3U8GA 3WNLA 4KERA 1LWIA 4J40A 3T4WA 3VIKA 2ZRYA 1RSCA 3QOKA 1QJWA 4L5ZA 4J5NA 4PB5A 4A3UA 1U1JA 3GDBA 3AAMA 4J27A 3KCJA 3GLCA 5ABFB 3DBNA 2XFFA 5HUPA 3PJTA 1WCGA 1EP1A 1UR4A 5HJLA 1VLWA 2GGIA 4K8EA 4WDXA 2R14A 1YW5A 5G2HA 3BJSA 2A1YA 1QPKA 3BLFA 1KC7A 4GOAA 4HT3A 8CGTA 1XD0A 3S47A 3KVLA 3GU1A 4D2JA 1A50A 1FCUA 4ATDA 1W0MA 2ZC1A 4U2YA 4BA0A 4M3PA 3DG7A 2GYIA 5CZTA 4TW7A 3ITCA 1JNDA 3EDFA 1VS1A 1C7SA 4LU0A 2GQAA 4C6BA 3B9AA 2PDFA 1JYVA 2OQYA 3VFCA 4WJEA 2VDHA 1EDTA 4OIFA 4WOQA 1T8XA 4UNKA 2CWXA 4PUEA 3LMYA 2X40A 4BS0A 1D7IA 3CV7A 2PTDA 3W2MA 4Y8FA 4AZBA 5D9MA 1NJJA 2J62A 2MNTA 2FKEA 2VD9A 3EBVA 4J28A 4JFWA 4GY1A 4UTHA 4Z1BA 2AGKA 1OGGA 4L6DA 4H83A 3L9CA 4IIHA 1O68A 2VENA 3NPXA 1JPHA 2VP8A 5EMUA 4Q8WA 3NQEA 1W9VA 2VZTA 3DCPA 5A6KA 1B5TA 5HNTA 5AC7A 1WOBA 2BOGX 3UQNA 3QMRA 5HJYA 1H60A 1D6OA 2ZA2A 3ME3A 4IIFA 4JL1A 3VOCA 3MI6A 4MJMA 3TKFA 1M3UA 2VX4A 5DX7A 4UQBA 3WLLA 4NHVA 4CVWA 2ZX9A 4NASA 5D2VA 2IW0A 4BQ3A 1W9UA 3BW3A 4GXWA 3DEQA 3OZMA 4HMNA 3HG5A 2CLMA 1LYXA 1XCXA 2ZICA 4Z42C 1SO6A 5CBBA 4JNMA 3SIMA 3GD6A 1GW1A 3LXBA 1DQWA 2PRLA 3ZFHA 3BO9A 3UZZA 4Z1AA 1PZ1A 3A23A 1H11A 3UXKA 1W3IA 4HOXA 1O94A 4NJGA 2ZUNA 2ZC8A 5CXPA 3K30A 3BLKA 3BE7A 2Z7GA 3TVAA 1OFAA 2F9RA 1KTBA 1GJUA 2GPTA 4EACA 3M7SA 2VC5A 3ES8A 3QQWA 3LTPA 4XAGA 1TX2A 4JTFA 1QT1A 4WLCA 1VFHA 1F4HA 4BF8A 1HO1A 2OX4A 3USBA 4PCPA 1G94A 5HANA 3B8DA 1HKMA 1MEHA 1YBQB 4CGTA 1ONWA 2WWCA 1NQKA 4BHYA 4F2UA 7REQA 4QCFA 1E15A 4RK8A 3CWNA 1KFEA 4HHLA 3L2MA 2XFRA 3BK0A 1GKQA 4Z1DA 3U5UA 4ES4A 1HGWA 3O8AA 4D6EA 5E5CA 2ISVA 4DWSA 2XFYA 4WY0B 1XBXA 3A4JA 3FKKA 3PUOA 4CQAA 2CHNA 1JZ2A 1WKYA 2VFDA 3NA8A 3S5OA 3SR7A 2CBVA 4Q8QA 3HFTA 4JTSA 3EA2A 3TXZA 5AKQA 4OGZA 1W3LA 4WRHA 2QGHA 1RZMA 4YNGA 1O66A 3OBKA 3GSMA 4ROPA 1W1A1 3PFMA 2HZGA 3JUGA 3D0CA 1HXJA 6TAAA 5GJNA 5FA5A 1A7XA 4US5A 2AKMA 4HYVA 3I6CA 2V69A 3LI0A 2OJPA 4JX4A 3UR5A 1XYFA 4E4UA 5M17A 3KE0A 2OZTA 5F4XA 5LXEA 1O6IA 2PDJA 5AHLA 2BGQA 3OG3A 3PNZA 4MNJA 1MUCA 5DMLA 2WPBA 4B4HA 4IUGA 1W3NA 1AH3A 4IL0A 3S83A 2G37A 1L8NA 5KTLA 4Z2HA 4J3VA 3NFUA 3HIJA 1WP6A 4Q4KA 5EB8A 1DWFM 2LGOA 1TTJA 4EXQA 5FEWA 3KDNA 1EDGA 1OFBA 3AIRA 3PR2A 4PA8A 5CGQA 1ZUAX 2ZQSA 9XIAA 3MWCA 2D0FA 4NYYA 4UC5A 2F21A 1QNSA 3N13A 1GJPA 1BYCA 5T8GA 3MO7A 1NFBA 1UR1A 3BMXA 2MPHA 4MWAA 1ZB5A 1B54A 1SVDA 2H3DA 3ZWTA 3EA3A 3W83A 3SFKA 1ITQA 3FKRA 4ML9A 4O16A 3DFQA 2VCCA 3WDRA 4PSRA 1J93A 1TR1A 2HWGA 1N7KA 1J0ZA 3HJZA 2WANA 3PPGA 2WLZA 2WMIA 3GWQA 2NQ5A 2VQTA 3SY1A 4ZQMA 4IX0A 4A8RA 2Z1SA 3DFHA 4LUYA 1WZKA 4JTQA 2TAAA 1AUSL 1R5YA 3S9ZA 4AD0A 3WIJA 1GQJA 1F61A 1IE7C 1C9WA 2NXHA 7TAAA 2E5BA 3DFYA 3F4WA 3SADA 2R8WA 3PZQA 3ZLFA 4S1FA 4F79A 3IVSA 4AEOA 1G69A 3WQOA 1ZU8A 3JR2A 3UWYA 2D0GA 1CECA 2ACRA 1VIZA 3NL2A 3ZJ8A 3NI6A 3AI0A 3SI9A 1M7PA 2EQDA 4C1KA 1EUAA 3N1AA 2C3ZA 2IS7A 2RUQA 1EHAA 2ZIDA 3QGKC 1RQHA 4L1GA 4JTRA 4S3EA 4PMDA 3RCYA 4HSOA 1TCOC 2HQAA 2PTYA 2OKOA 3ARUA 1EJUC 1EZ2A 1PTAA 4DRSA 3TTOA 1V5XA 3PC0A 2G50A 2WJEA 1X97A 2FZDA 4GGBA 2F7FA 1TPUA 1WAWA 2J47A 4H1ZA 3V0TA 3GDMA 1P48A 3IGUA 5D8ZA 2NZLA 5HOSA 4QNEA 5CPOA 4H9ZA 4PYSA 1VBJA 5ECUA 2O92A 1X8FA 3QFWA 3W82A 3L23A 3NZ1A 2WW5A 2QJIA 3Q37A 3TR9A 5C5YA 1FKTA 3PPCA 4XVEA 2DPEA 2PPOA 3BG3A 4QLLA 1XRSA 2ZZ3A 2WHKA 1VRDA 2WCGA 2DT3A 4CCZA 1SMDA 1W1VA 3CQIA 3HG4A 5AYBA 1LM1A 4PCTA 2F2KA 4XX6A 1G7VA 3HQOA 1HUVA 3DYPA 1FKLA 1EQCA 5KZMA 4L9XA 1GPWA 3W73A 4RCXA 4LUJA 1H50A 1WX0A 1WA3A 4GBDA 4NJHA 1J01A 2IQTA 5DIUA 4ZB2A 4ROQA 2QV5A 4WXZA 4S3FA 1S1RA 3UXLA 4IMFA 1OC6A 3TLQA 2RUDA 1ZZMA 3N6QA 4IQLA 3QYSA 4EIVA 2FHBA 1K70A 3TDFA 6XIMA 4ZR8A 3W2JA 3WLHA 3HB9A 1CZ1A 4AIEA 3ABXA 3ITLA 3RM8A 4KCVA 1R3VA 3B9OA 1MUMA 2X1IA 4GJJA 4J3WA 5T26A 1UZ4A 1JR1A 2ZUSA 5D9PA 3W26A 4DXVA 4LFYA 1QXLA 1IEQA 3CBWA 3M6DA 2QDDA 3L4TA 3ABOA 3QFEA 3OPSA 1FWSA 3TFXA 1J4EA 3NVDA 4PB4A 4YWIA 4FF5A 2XP9A 1OF8A 2C0HA 3K46A 4DM2A 3EB3A 3O5QA 2VJXA 1R7AA 2LLEA 2GVYA 1V3LA 3I7QA 3MKCA 4PL2A 3CM4A 5K9DA 1D8CA 4GJ1A 1TMLA 2V6AA 2GZXA 1LOQA 4Q4SA 2A2IA 4C6CA 4NZ4A 3PZTA 3UXAA 4AY8A 5A8NA 4UTTA 4MYAA 5I09A 1OINA 2ZXAA 3ES7A 4DO7A 5C2CA 2OEKA 2E77A 2TPSA 2YLAA 1XW8A 4ZODA 4IZGA 1VFUA 5F4SA 1H7NA 2G8ZA 1WNOA 4FAMA 3PJWA 2I16A 4C5ZA 3T44A 2PN0A 3T08A 1M7XA 2QUUA 4GABA 2QUTA 2ZXBA 4C1NB 1VBRA 2PDKA 1JCYA 4OBSA 2MANA 3G1AA 4FNTA 2J66A 1F3XA 2OX1A 4JCMA 3BAXA 4FN2A 2ABAA 1ICSA 1MXGA 1PXGA 4LNYA 1XPGA 4V2XA 3VPLA 4Q8TA 4DXKA 4UTKA 2OYLA 1PHQA 3W7PA 4WVXA 3REQB 1XYLA 3Q4DA 1D8WA 3FGCB 3VD7A 4B3LA 2YCKX 1KGXA 1CB2A 4J3UA 3FJ4A 4DJDD 4AXKA 1ML1A 1KFJA 1Y65A 3PF3A 3CT7A 1Q8AA 3KBNA 3U4FA 4XQ6A 3FAPA 2WMHA 4A2SA 2NQHA 3SRDA 4XKYA 4MB1A 1W5MA 4IT6A 2DSZA 3OEXA 1UIPA 1QI0A 3W1NA 2J7GA 3N4FA 3BQ5A 4KFPA 1S2UA 3PZGA 2V67A 2ZA1A 3VNMA 3WY1A 4G2PA 1I2OA 3PZNA 2RQSA 2B7NA 4MAZA 1HP5A 4JTIA 1OK4A 1CI1A 1FDZA 4MMWA 1BFNA 3SQLA 4MY8A 4GKTA 3EWZA 1EO7A 1WE5A 3JVAA 2NLIA 1B3WA 2ZZ2A 3UGRA 1FUYA 3AZTA 4UMCA 1A5OC 3HJEA 1QZ2A 2ISFA 1EQ3A 4NI8A 3UPMA 2J78A 4NZCA 3LLDA 4QROA 3QPYA 3DHFA 1EBHA 3W9ZA 4WY0F 2WKJA 3WK3A 3LCFA 2Y70A 3G0UA 4H6KA 4D6CA 3J7HA 2ZX6A 3ENLA 4J3TA 1UWAA 3STFA 3LERA 3RJXA 1W1PA 2LJ4A 4LEFA 1AA1B 1BG9A 3KVMA 4HMEA 1AQ0A 5BW6A 4Q7NA 1VJSA 4J9JA 4GJIA 2WJZA 2I14A 5U4NA 1BGGA 4LCRA 1Q2SA 4IQCA 1TVNA 3VFLA 5HULA 3IIOA 3ZLGA 3HV8A 3Q45A 5B7ZA 3KZSA 3G1FA 4DZHA 4LH8A 1UKQA 2GUUA 8XIMA 1OCJA 4Z08A 1ZJIA 3L12A 1WV2A 1JF6A 1R3RA 2E7FA 3PM6A 1BVWA 4ZCWA 2Y89A 5DMMA 1O12A 7TIMA 4Q3MA 1RVGA 2EKGA 2CLFA 4GWEA 3R4IA 4A35A 3B0UX 4MGVA 3VD5A 3FNDA 4QAWA 1S3TC 2NWSA 2VFGA 2DU2A 4F40A 2OEMA 4K8GA 3WLSA 5I79A 3P14A 5DIVA 4GBUA 5JXQA 4IP7A 4XO7A 2VNCA 3WQ5A 3LX9A 3NGJA 3K4AA 3WLNA 4GRSA 4IISA 2E8YA 1J18A 2POTA 3HZ3A 3UZXA 3VDHA 1Q6QA 4OU1A 1XGZA 2PODA 1Q2RA 1XG3A 3GHRA 2V5KA 4IIGA 2B7PA 4R34A 4NNRA 4MKVA 4NNBA 2YGYA 1OYBA 3ZO9A 3QZAA 3E0WA 1I2PA 2QJMA 1FP8A 1UD2A 1XKJA 1UR0A 4A29A 4W8AA 2XGIA 4GUGA 4TR9A 3NEHA 3BAYA 3GYEA 2FQIA 1MW2A 3MMTA 3MBDA 3ZVIA 3H2CA 5FJUA 4OHQA 4JNYA 2AQVA 3CV1A 4UTLA 5HNUA 4AHOA 3C2FA 3LOTA 4UZUA 4YN5A 3O5OA 2ITKA 1A3XA 4V27A 3AU6A 1EJRC 4LAOA 1AJ0A 3UY8A 4WCJA 1H1ZA 3E2SA 4MB3A 1V6TA 2VN1A 1EA0A 3O5FA 2TYSA 4QLJA 5DY3A 3H23A 1KCZA 3V75A 2E25A 4AEEA 4AVNA 3INPA 3KXQA 1Q66A 1Y0OA 1P0KA 1ZBWA 3B9EA 5HKGA 3CLWA 4RNJA 2CHRA 5C7HA 4B9YA 3GYCA 4D6FA 1L6YA 5J6EA 3BCFA 1IZCA 1GVRA 4C6MA 1G7UA 3TSMA 2UY5A 1NMWA 5DN1A 1OADA 4A22A 1Q1CA 3TX9A 3R0DA 1AMYA 3WFAA 1JCHB 4QM1A 4JY8A 1TG7A 1UKSA 2QCCA 4L4MA 3CGTA 2IF4A 2DSUA 4JYDA 5HW6A 1ZJHA 3APTA 3OTRA 4OVXA 4DO4A 3N19B 1JGMA 3UI6A 1QNRA 5AC6A 3MV11 3CU2A 3OP2A 3KBMA 4TO8A 1ZQ5A 4DJFA 1XCWA 1E9IA 4AX7A 1MEIA 4R27A 4LVFA 5HQMA 5M03A 2CXEA 3AICA 5E70A 4M19A 3MI2A 4KQZA 4NVTA 3K1DA 4HYRA 3BMWA 1XIBA 3UJRA 3ARRA 1JFXA 2XP8A 1K1DA 3TH6A 1P0BA 3ZT7A 5CPSA 2WNQA 1DL3A 1AJZA 2C1GA 3WQFA 3C0LA 2FGZA 3SY8A 4MHBA 4QXIA 1XIDA 4N2YA 5TQLA 2IQDA 1K8ZA 2ZRVA 3R79A 1XDLA 1U5JA 3HMCA 4CNTA 3OHIA 3NDOA 3DC0A 5BMXA 3OVQA 3UR7A 2YL5A 3PWAA 1M41A 3GZAA 5I03A 4Y90A 2V8ZA 4XZWA 3WDHA 1OSEA 2XVKA 5JMUA 3BLDA 5FJPA 3Q65A 4CLMA 5MKGB 2ADAA 3FSTA 1BXCA 4DWSC 2V2DA 1Q6DA 3PVFA 3P80A 4O53A 1PTDA 3UI4A 4AD2A 4GUJA 5JBFA 4LX4A 1M68A 3R89A 1KLYA 2WNWA 3R12A 5G4EA 1W8SA 2OOFA 5C9UA 1S38A 3TW9A 4IFKB 3UZJA 3PBMA 4GZEA 4E2BA 3VGBA 1RCOB 1POKA 2C1HA 5DT7A 3QTGA 3W84A 4JTDA 4N7QA 2JALA 1KRCC 1M9HA 2ZUUA 1OEPA 2XWEA 3W7MA 1GQNA 2DIJA 2NQLA 4LSBA 2GJNA 2OGYA 1JRBA 1JI2A 4CN1A 3I68A 1R85A 2Z1VA 4XSLA 2WJDA 3NQMA 3KS5A 4HJFA 1TJ0A 5CCZA 3ARWA 3A21A 3T0DA 3QW3A 4HPNA 1XQLA 3G1DA 4JHMA 3EX1A 5AFDA 3ZT6A 2IQ0A 5D03A 4BF5A 3MKVA 1W5QA 1H7PA 1FCVA 1XLJA 3A5FA 3WF2A 1H1YA 4MVAA 4Q7BA 4BF7A 3IUDA 4O28A 2GJLA 2Y8VA 3Q94A 3IK8A 4M6QA 3SRKA 2FPTA 3WLRA 1NVMA 3NTYA 4ZO6A 3TA9A 3K8LA 2W61A 2P88A 3W74A 1XSIA 1REQB 3DC8A 4LUIA 3V0SA 2V2HA 1M7JA 3GU2A 3S1XA 2ZX8A 4LVBA 2BVWA 4DELA 3F1QA 1AL8A 4RE2A 3OZOA 4QE1A 4HA3A 3RRXA 1GTHA 1C7TA 1CLKA 3QN3A 3GNXA 1ZNNA 5G4WA 1O5KA 4O8AA 1W1B1 3UZYA 3O0KA 2JF7A 3PTMA 4PGLA 2PD5A 1W37A 1MFVA 5DANA 3WD0A 1PJ9A 2EAWA 1GG1A 1LG1A 1EH9A 5AHNA 4WEVX 3THCA 4UTWA 1FCQA 4H9UA 3KAHA 5LIWX 3VOGA 1ZGDA 2NQ9A 2BNJA 4PTDA 1J9YA 1RJRA 1Q7MA 3L2IA 3GR8A 4HU0A 1S46A 2D24A 2FIQA 2D9FA 2PZNA 4WDWA 4C65A 1A5AA 3QXBA 2G3FA 3TV8A 4PUNA 1HTIA 3ANUA 1PUDA 3P84A 2BGNE 5A8PA 2V3EA 1FWIC 2VRJA 3I3DA 1L1PA 1EX5A 1XDMA 5FKYA 2QQ6A 3AMLA 1VPQA 2NSOA 2A3CA 2W3ZA 5ENLA 1OFEA 2NV9A 1PBGA 4G56A 2JK2A 1RR2A 1ZL1A 3A4AA 3A5VA 4FHAA 3SCSA 5E1QA 1YPFA 1OC7A 4KPLA 4PFMA 3AXMA 1QO2A 1IXQA 3K13A 1N2VA 4B2DD 1UBSA 3CMGA 1CIUA 3CHVA 4UOQA 3RLHA 2D69A 4DBDA 3VDAA 4QG8A 2V38A 1V79A 4K37A 4EF9A 3O5KA 3VCNA 1W1ZA 3TUUA 1RD5A 2EPMX 2E4TA 3AIVA 4D8ZA 4IQJA 4HPXA 2HBVA 5BCAA 2JGQA 1ISVA 4E6MA 4ZO9A 1K4HA 4AZGA 4JKLA 2W4XA 1OYAA 3EDEA 3FYOA 4X2PA 4QS6A 4U33A 2VM8A 3N4AA 1ODUA 1H1NA 2RH9A 4M51A 2MLYA 2BX7A 3IAPA 1N55A 2FJKA 4J4KA 3URQA 4AUBA 2GK1A 1XSJA 5L6UA 1E51A 2QCMA 5I0DA 1CEOA 4H01A 1Q6IA 3STPA 4JYEA 2VEIA 5IFTA 7ENLA 3AIBA 2VT0A 2BY1A 2C18A 4NZ1A 1B4KA 3GXDA 1CLXA 4Z0JA 2R1MA 3MJMA 4LV4A 3I6RA 2F23A 3UZWA 2XPBA 3OB8A 2DZPA 1FBAA 3S2LA 4J7RA 3W1RA 4DBEA 5HWBA 2ETNA 3UJEA 5I23A 3N6JA 3M0LA 3AZSA 3G1YA 3XISA 2VMFA 3WK2A 1XV8A 4Y2WA 4CN4A 3WJZA 3KL3A 3AIQA 3W1TA 3OODA 3VDCA 2X7WA 4YYCA 1P0NA 2GQ8A 4P7LA 1W9XA 1IGWA 4AZHA 3BUVA 3DXIA 1UIOA 4TXEA 3H2EA 2QDHA 2KR7A 2Z25A 3VKBA 4M6UA 2E3ZA 3W7CA 4C6NA 3GHUA 4M24A 3GK0A 4QSFA 1BD0A 3VNJA 3W75A 4HNTA 4MIMA 2W92A 3LBMA 4ILSA 1EPVA 1ROTA 3QVQA 3W00A 3VYLA 2G3IA 4O54A 2ESCA 3ZVHB 3OGRA 2PP3A 2P8CA 2M2AA 5C9RA 3THQA 5HMFA 1EGVA 2PWFA 3CC1A 3NPWA 1PKNA 4JIRA 3JW7A 3WF4A 4CCEA 2XH7A 4AWEA 4ODMA 1WZMA 3MS8A 3UBPC 9CGTA 1X1OA 2UZ5A 1UC4A 4DT4A 2G0WA 3WJYA 5AY7A 4IHCA 3NRKA 4WJXA 1ROUA 3CHEA 2YKKA 1XIHA 1UJPA 3MUIA 1ZTVA 1BKFA 4OUIA 3QGVA 2AL2A 3WQEA 3H53A 1J96A 1EB3A 4ZMGA 4H9TA 4R85A 1MMFA 1SZFA 1W3HA 3S6DA 4CQDA 1LOLA 1UA7A 2HE8A 3W25A 1DIEA 3I7SA 3NOEA 1XI3A 2UV8G 3EOLA 3WNKA 4D9PA 1DVJA 1EF2A 4IWWA 2EPNA 1GT8A 1R87A 1KNWA 3B0PA 3K8KA 1T5AA 3GM8A 1XX1A 1X7FA 4H8NA 3KAOA 3DKJA 3M41A 3RX4A 3FHAA 4FF7A 4HB7A 1HT6A 2OWXA 3ZXWA 2ZX5A 1LOSA 2ANUA 4LC8A 3ORWA 1GOXA 3O5LA 4JY9A 3WH6A 2Y4SA 4OOZA 2E67A 3CZEA 4OWGA 3NUKA 2PDWA 3WQDA 3MYOA 3R1ZA 1A47A 2BHZA 3DHUA 1LUCB 1RBAA 2EPLX 3EDJA 4K6AA 4DY1A 5BYWA 1GVYA 5FF0A 3QTPA 2Y5EA 2XUCA 2DQXA 3QZ6A 2OWWA 4NP7A 4A8LA 1RBLA 1LBMA 1MQRA 4NAEA 2YB1A 4TIMA 1W6TA 2XSXA 1CWYA 1Q6EA 2PDIA 4KFOA 4W86A 3RX2A 1JAEA 4WKHA 3BXWA 1KM1A 2Z00A 2DQWA 4WKAA 3MP3A 3PY2A 2OQHA 3S2MA 3TW7A 3KVJA 1DJNA 4GI6A 3TU9A 4HBKA 3T8QA 1UZDA 1RXOB 1ZY9A 5A69A 4HHMA 4JGDA 1VYPX 1WBJA 4BKNA 1K8CA 2WMGA 1TTIA 4FK9A 4YMZA 1DPMA 5JU6A 1OBAA 4HN4A 5D9OA 3VD9A 4JS3A 1KT1A 3ZSTA 4KRUA 2O9PA 2Q8XA 4IPPA 3OZPA 3DECA 3S46A 3ZWSA 4QJ4B 1FKJA 4ODQA 3OGSA 3H7UA 4X9SA 1EC7A 1DHPA 3W2NA 1IWBA 3LY0A 4I3GA 1CYGA 3C3NA 4QRNA 3GG0A 2CPUA 5IM51 1KXQA 4MY9A 1VFFA 1H0IA 4JN6A 1A5NC 2QNEA 2G95A 2P8BA 3BZGA 5REQA 4KT2A 4PR4A 1ZCNA 1VKFA 2XH4A 1GRJA 1EC8A 3H22A 3GC5A 5BXTA 4ADTA 1EYEA 2F6UA 1B3OA 4DRJA 3VCCA 4LUTB 2A21A 1R9YA 4M56A 3ZQ9A 1M53A 2ZQTA 3M0YA 2UBPC 3WUFA 5I02A 4XAZA 3QHMA 5AN7A 3W7IA 3HMJG 3AIUA 3HO8A 4REQA 7PTDA 4DWSD 4JIQA 4S2CA 4ZPVR 3FAXA 3CEUA 1CGWA 3UF9A 1B6CA 1W26A 3VE9A 3WLTA 1BAGA 4AZIA 1VH7A 2AAAA 2ZX7A 3NURA 5EFFA 4Q8NA 1S2VA 3IJ8A 2BG5A 3MVTA 1VPYA 4MB4A 1S5WA 1MRAA 3WX7A 5HMSA 5EKYA 3I4KA 3GNNA 3C61A 1XLKA 3M5ZA 3RFAA 4KGLA 3MDUA 1C9DA 3DN5A 4MM1A 5I3KA 1V0MA 3A6OA 2YZRA 5K9XA 1HZYA 3GTIA 4GUFA 2DG4A 1FHVA 3RITA 1J0IA 1DIOA 3UJ2A 2OFNA 1JPDX 3CLMA 3FX4A 2A4AA 4JL2A 2V3DA 4RXGA 4C6EA 3M0XA 4C60A 1TR9A 2ZADA 4HNUA 5B8IC 1SFSA 4WSKA 3T81A 5PTDA 3E0VA 2NVDA 1KBKA 5DFAA 3AHVA 1ELSA 3CS2A 2NWRA 5D2TA 4YTSA 1D7KA 2JBMA 3AYTA 4AZ5A 3LPOA 4OOUA 1EWDA 3MT1A 4PN2A 1W8GA 1UWUA 4YTRA 4MZYA 4GYPA 1R9HA 4ATWA 4FNQA 2WZHA 4UBPC 4RNIA 1FWDC 1IYXA 1JZ5A 1OD8A 4LF2A 1KR1A 3B40A 3DFTA 3WELA 1P5QA 1B3YA 5BWFA 1TPDA 2QT3A 1VRXA 4DZAA 2WVVA 2P76A 1JRCA 2QVNA 2WMFA 1TE1A 3QKEA 3G77A 3VILA 1E9YB 4XUYA 4J3SA 5TAOA 1A5MC 1QUMA 1XXXA 4DQWA 2PU0A 1US0A 4LVDA 4M0XA 2PWGA 2Z27A 3W6MA 2Y5SA 1LTDA 2OYMA 3HGSA 4NI3A 3PK7A 2I9UA 2DJXA 3CV2A 4E38A 1W1TA 3LHZA 4POCA 1GW9A 5ABEA 4GINA 5TIMA 3OLEA 3QR1A 3G22A 3KAFA 1RCXB 1UPPA 1R30A 3GVRA 2QUMA 2MLZA 5EBAA 2NX1A 2FHCA 2YXOA 1IT8A 3WQ6A 2TSYA 2PI6A 4B5WA 4R53A 4AIBA 2CXGA 2DZWA 4JFIA 4QLKA 4IJCA 4RW5A 4HJWA 1X8CA 3VIIA 4BWLC 3IKDA 5HK4A 4OV4A 2WC7A 3WLOA 4N42A 4AZ6A 2H90A 1T99A 4AISA 3CQJA 3C6CA 3PBGA 1JDDA 3VM7A 1TELA 2OR2A 2HBXA 5GNZA 3S1WA 1ZP4A 2BWGA 1XD1A 1CXKA 2E6FA 3UWQA 2OTDA 4GI9A 5G2WA 1VFLA 5A1AA 3RFWA 1J6PA 3EMCA 4YXGA 1E0TA 4G50A 1NSJA 3FK4A 1PX4A 2Z29A 2W67A 5EYWA 5CLWA 4GC4A 3QV6A 2IKGA 1GQKA 2CLHA 1ZCCA 4N9DA 3UPWA 2MLXA 2PDBA 4DBWA 1AG1O 5HNRA 2JF6A 3VKCA 5TNVA 4P7NA 4RE0A 5HT1A 3CZ8A 5I78A 2XYLA 2YA0A 4YTUA 2VUNA 4U84A 1ZBKA 4DF1A 4UQ9A 5AVNA 3QQ1A 2W91A 5D75A 1EYWA 1UWTA 3H4XA 4RDYA 4YU1A 5HNNA 1TPH1 3MSDA 3W7EA 1HKWA 3KRBA 3VOIA 1CXLA 1YE6A 2CLIA 3O1NA 3FA5A 2QEZA 4LEQA 4C6LA 5XINA 4PTMA 1KCXA 4B5TA 1R3QA 1ZALA 4GYKA 1YLVA 3KBWA 3W85A 3O2LA 3ITVA 2DEPA 3HG3A 4JQ4A 1TZ7A 1TWDA 4ZFMA 1JG9A 4GQRA 1QPQA 3JXVA 8XIAA 1FAPA 3O3RA 4A3YA 4W9OA 3V35A 3M4HA 4IUOA 4X0NA 3S5ZA 4IG2A 2HEJA 1TA3A 1YNQA 2HS8A 3T0CA 2W9MA 1XBZA 1E6SM 4FR6A 1AFSA 1KFKA 2Q6ZA 3R2GA 2DJLA 1OX4B 3LRKA 1Q7ZA 1YTDA 1DV7A 2JZVA 1DTUA 1PS9A 1DJXA 1NMVA 3GG1A 3KCOA 2UY4A 1MNZA 3RG6A 1C8XA 3L5MA 1SO4A 3WUGA 5B80A 1SMAA 1OX5A 4UTUA 2A3AA 2QXWA 1A3WA 1D7FA 1EX1A 4TW8A 5KZEA 1ECQA 2ZRUA 4DZ2A 2CU0A 3M1ZA 4LCSA 1XFCA 3NR0A 3UESA 5JQ9A 2XGBA 1C9HA 2I9EA 2R82A 4O13A 5C70A 4XD5A 2Y0FA 3RU6A 2A3HA 1MI3A 5K4XA 3MA8A 2D2HA 2P0IA 1H7OA 5D2XA 4ZE5A 2E5DA 3GDLA 2A7PA 1E1FA 1VFSA 1ECEA 2KGJA 3AS2A 1IF2A 2YW3A 1GZJA 2ZWYA 1ZCOA 1H63A 4N6EA 5LGXA 1N8WA 1EFZA 2IPGA 1OHLA 2QCDB 4H6RA 1JPKA 1G4TA 3MTWA 4ASTA 2BP1A 2GDQA 3E1F1 3B0YA 2VFHA 3TTQA 3VU2A 4CNSA 1PIIA 1C8VA 3GS6A 4KETA 1LZOA 5F2MA 8RUCA 4TVDA 3F2CA 1IR2A 4GE8A 5HPCA 4FIQA 4GQBA 1H5VA 4QG9A 3WQGA 5KINA 3O5PA 3IJ7A 1YTKA 1FKBA 3EMZA 2CLLA 1U22A 2XP5A 2NT0A 1FWAC 2EO7A 3EWXA 2ISSA 4G2DA 1UR3M 4YVPA 4CUCA 4Z2KA 2Y7EA 4ML4A 2IPJA 4KWUA 2OU4A 2WKLA 3DESA 2E8ZA 3ZM8A 1GOKA 4MZ1A 2IPWA 3SM0A 2CKSA 4LS2A 3LTYA 5G1YA 2NX9A 1ZAJA 3A64A 1Z44A 2DIEA 3IACA 2FDSA 2E1WA 2J4GA 3BMBA 3FJ6A 3NGFA 1QATA 3SQMA 1UW9A 2PCEA 1I75A 3TP4A 1IQ8A 1PCKA 3B06A 4PUDA 3NQ2A 5E9AA 5BOOA 3PZUA 2OLAA 1DJHA 4PRRA 4EK7A 3B97A 3HPFA 5C71A 4TTUA 2DP3A 1OD0A 2ZR6A 4NG3A 4Y8EA 3UU0A 3U57A 4GY0A 4Q22A 4V28A 2KZHA 3NZRA 3C86A 5BMWA 4GO9A 4F2BA 3ARTA 1HKIA 1NIUA 1UD8A 4OV9A 1BVNP 1EEXA 1CX9A 4CNPA 2E28A 1XLEA 3MC5A 4KWWA 4LW7A 2IMRA 4Q8MA 5DMNA 1QVBA 3VUPA 5AC4A 2YYUA 4H9VA 3AHYA 2GQ3A 2CBIA 1M5WA 4NAFA 3ZS4A 2YYTA 3GTFA 4YVXA 2ZTJA 4UXDA 1IZKA 3BAIA 1ISXA 4UOZA 1JYNA 4Q8VA 4KWSA 4IM4A 2QF7A 3URAA 4N02A 1XYMA 2GOUA 1IX5A 3WUEA 1LL7A 1E1CA 1L6WA 1P43A 3LXCA 1PX8A 4S3KA 4HA1A 3LQGA 1H2JA 4GH1A 3MUCA 3SB0A 5IBXC 1JCXA 1QO5A 4C6KA 1B3ZA 3TJIA 5FIPA 3B8UA 4DF0A 2OKTA 4U4MA 1AQHA 3PJXA 2FAPA 2FB3A 2QF8A 4S3DA 3ATYA 3G3MA 2XIBA 4PMYA 1LRTA 1OCQA 3OYZA 1D3GA 2Z7KA 4X61A 3VO0A 4CNNA 1Z89A 3AHXA 4H04A 5G5IA 3QHOA 3NQBA 3NQCA 3L2LA 4PODA 4IIBA 1JULA 4HZ8A 3WNNA 5HW7A 3UNTA 4B5NA 4EE9A 6A3HA 4HVXA 1NDWA 3DIPA 1EWEA 5I00A 2P3EA 2E9LA 2I7GA 2XIMA 2P50A 4AD1A 3XIMA 4XTIA 3PG8A 2PLCA 1FWEC 1NM9A 2M1IA 3DFNA 5EPDA 2CLOA 5ABFA 4AF0B 3TN5A 3GH5A 5LNUA 3M7WA 1NFGA 3AISA 1RV8A 2NV2A 1Q6OA 3CAVA 1DQUA 2YZ5A 4HCLA 2W63A 4I5XA 3O5GA 1OZMA 1V4YA 3E0IA 1K6AA 3OVRA 1DIKA 2VRQA 3TOYA 1B4EA 3CAQA 3TN3A 4JPGA 3PHAA 4QISA 3MV01 4RNFA 4Y9AA 8A3HA 1OCNA 3OZYA 4GVGA 1NF7A 1KGUA 1PIFA 1EGMA 4HOWA 4QEEA 2JKPA 3B0XA 1KB3A 1DWGM 1GYMA 1XLDA 3OIXA 1LBFA 3COTA 3EZ4A 4WKFA 5AVHA 2AGTA 1I45A 4O50A 2PU1A 1SW0A 1U1HA 2I5QA 4DRMA 3MP5A 2VO5A 3OQ8A 5T9CE 2FZBA 3DKLA 4O4WA 4RE4A 4ZEPA 4K1WA 1TZ9A 3PZIA 3ECQA 1J4HA 2QR6A 1HXVA 1AJ2A 4FIRA 2VX5A 1MW1A 1I6NA 1ITXA 4ZPWR 4ORMA 1W5PA 2QUVA 2C6QA 2XZ9A 4AG0A 3LTSA 1R47A 5A2CA 1RBOB 5A8GA 1A0CA 4IP5A 4KQNA 1KFWA 3P0XA 3H21A 2Y8KA 3V7PA 1M04A 1W17A 3WFLA 2ZVRA 2DZSA 2XFWA 4HBOA 5KSWA 3E5PA 1YKWA 3R58A 2QCNA 2QLYA 3MI3A 1VP5A 1ZJAA 2GOKA 3B9NA 4ODRA 1YMYA 3IJ6A 3R8GA 1J0JA 1GWJA 5BOFA 2JQXA 3LN3A 1MVYA 3BL3A 4I9AA 3BJTA 3LRMA 4B3KA 3U5YA 1JZ8A 3U9IA 3UVIA 1HL9A 1S5MA 4QG6A 1ZPTA 1POJA 4LAXA 1KBJA 3EAUA 1KWGA 4ZQCA 3RYSA 5K9CA 2PMQA 4XZLX 1YBQA 1D3HA 3NAVA 1RP8A 1HJWA 4FLQA 4P8XA 1E4NA 3T0BA 3LM3A 3MMWA 2ZCGA 2NVCA 3VUSA 1WZLA 1NH6A 2PZ0A 3S42A 3PAJA 3B05A 5CGTA 5F2GA 3ELFA 1ZJBA 4LAVA 3GZ3A 3OIHA 3GXIA 1XIJA 1F3EA 1KM6A 1TWIA 1PAMA 1E9LA 5C2XA 3WQ8A 2YDAA 3CK5A 1U5HA 3WJSA 1OIFA 3WFZA 5LIKX 2F6KA 3BPWA 1A80A 1W3JA 3B04A 2V63A 3G0SA 4G1NA 3T2QA 4LAYA 3E3HA 3O05A 5KZ6A 3G6MA 4WY0A 4JICA 3B8IA 3GXMA 3NQDA 4O1FA 1TRIA 4PBFA 4HPHA 1OC5A 1K77A 3S2CA 1IV8A 3EPMA 3O5IA 2F2DA 3M6YA 2OSWA 1GNXA 4DYKA 3DG6A 3BLEA 2NVAA 3M16A 2GDVA 5A94A 2QCLA 4LQ1A 4PEEA 5C9XA 2CLKA 3G6LA 3H70A 1DWIM 3RPMA 1UUOA 3A13A 1SU5A 3CHFA 3SCUA 3WZ0E 1ADDA 4M5PA 3WLPA 3U2CA 4LXFA 4O11A 4FA3A 3GNOA 1JI1A 3V0UA 1IGSA 1JPIA 3TYAA 2EG8A 4JIIX 1ZK6A 5CSRA 1TJ2A 2PGFA 3PRAA 4IQ2A 4QQUA 4OTKA 3K1GA 3H9RB 2YCIX 4H7VA 4GYPC 1Y5XA 1CLVA 2IKHA 4JNZA 1T8QA 3TQPA 1RJQA 4ZOBA 2IKJA 2E5CA 5FACA 2PCQA 1FH7A 1HW6A 4YTTA 2ZBTA 3AWOA 4HK6A 3AS1A 4ICNA 3A3WA 1V6YA 4V33A 2WLYA 1V03A 2Z1XA 2D2JA 2W62A 1E43A 3M07A 4UFHA 4XBKA 2PDQA 1FHDA 3QV8A 3GUGA 5JH2A 1DJZA 2O4QA 3F4CA 1E40A 1KLZA 1QHPA 3HQ1A 1Y5WA 3W27A 4JX5A 4OUEA 3IJ9A 2G3JA 3N18A 3T9PA 4XZ9A 3TN6A 4IFRA 1W56A 4ERGA 4LBSA 1LWJA 5E0CA 3BCJA 1K9DA 3ABQA 1FX6A 4PMVA 1JD9A 3AWNA 4OBTA 4MUZA 3CWHA 3IARA 2PWHA 4C02B 1VEMA 3SCQA 4I90A 3CJPA 1XSKA 4IMCA 4GCXA 3BARA 1JQVA 3WQWA 3MP4A 3KUMA 3CV6A 1Y0EA 2INFA 2BS9A 3GHSA 4FALA 3PBYA 2KO7A 4HD5A 1W2PA 3FAWA 5AECA 3GQYA 4DNMA 2PRMA 3SCPA 2PDNA 5C6MA 1R2SA 2QIIA 1E73M 3L65A 2XVPA 3DX5A 1JL8A 4NZ3A 5J04A 1ZENA 1QPRA 4DAFA 3FV9A 3UA4A 3P2VA 3QBUA 3U2EA 3KOWA 4PRWA 4IJRA 1TE6A 2Y6ZA 3S6TA 4KWOA 1I1XA 3CHCA 1IXPA 1E6PA 3NYZA 4FMVA 2ZZ4A 4PMQA 3N2MA 1TQXA 5LA0A 2G4FA 2VX7A 4QBXA 4XG1A 4UTMA 4NL1A 3M47A 2X8RA 2M08A 2X42A 4RV8A 5HUOA 3PS7A 3KP0A 4C6OA 5DMYA 3F5KA 3HBLA 7A3HA 3EB2A 2D20A 1E56A 2F8QA 3G3DA 1QK2A 3UG3A 4OE7A 4O2TA 3C2OA 3L21A 4PMUA 1TMQA 1ME7A 1NAL1 1VYSX 3L4ZA 3MZ2A 3ANVA 1R3YA 4ZTXA 1J0KA 2C14A 2PDMA 4OFCA 4JIPA 2CZEA 1QI4A 3OBAA 1XKYA 4Z2GA 1ME8A 1TWSA 2BODX 2HXUA 5D09A 4CNOA 5FD0A 5CSUA 1JJKA 4KW2A 1JQXA 3DBPA 2YCLB 1TREA 4IMGA 1H7RA 3CIVA 3MUY1 4LGXA 4DIAA 4W4QA 4WJ8A 1PTGA 1GEQA 3PRBA 2HS6A 4UWMA 3VKKA 2MNRA 1QCWA 2C91A 4O12A 1F3TA 1QBBA 1UP0A 3P61A 1EDQA 1K9TA 1GZ1A 2L2SA 5F1VA 3IANA 1YPXA 1OFRA 4WR3A 3WQ4A 4KEVA 2Q8ZA 2YA2A 4ZB5A 3NO5A 2G97A 4QJ3B 2PV3A 1X6NA 4H00A 3FYYA 4WZHA 3SBFA 2R1KA 3QMSA 2WJFA 5DCBA 2X16A 7XIMA 3QRHA 1P0DA 4OECA 5AHIA 3L0GA 4P8WA 4XAKA 3ZZ1A 4DJDC 2WHJA 2HPMA 1W9BM 4UR8A 4WUIA 3CMJA 1GEHA 2PTWA 1R0MA 4AVOA 1OG0A 3AUJA 2H8ZA 2KI3A 3RLVA 1XS2A 3VIJA 4GUHA 2J8FA 2E1DA 4QZVB 1XIGA 2W5FA 2XDFA 2X09A 3NQ7A 3EB4A 4HOZA 3PSVA 2G96A 3CUHA 2OSYA 2Q09A 1EJVC 3ATZA 2UWFA 4JAWA 2VI0A 4AW7A 3CQKA 3PP7A 3VKAA 4DN1A 4BI5A 3GH4A 3PFRA 1WUEA 2PP1A 4DZ3A 3ITTA 4XD4A 2NUYA 2YDRA 1OK6A 1CCWB 5H6HA 1JZ4A 2CLPA 3MMDA 2PGWA 4J1OA 4PMJA 4XZHA 1KXVA 4MG4A 4S3GA 5LA1A 3NZQA 2XHYA 3BDKA 3PBUA 3UJFA 5I6SA 4ZQNA 3EOOA 1E4LA 4C1NA 4K39A 1PKMA 3KTSA 3G1RA 3AIWA 1X6LA 2HDJA 3I65A 1VF8A 3STEA 3FJLA 3WL1A 3P8IA 1XC4A 2YXGA 1QNPA 3W7LA 4AH7A 1PYMA 3LZ5A 1YDNA 4QDWA 4Q8UA 3S2NA 5G1MA 1B9ZA 2BDQA 3RR1A 4AVFA 1HKVA 4GPNA 1PE1A 2Z1WA 3E0LA 4ZPTR 3REQA 1F74A 2PGEA 4Z1CA 1P7TB 1D7JA 4Z2LA 1ISWA 3FGCA 2P10A 1XQKA 1DXEA 2QCGA 3MQTA 1PZ2A 4UMAA 2Z6IA 4GNJA 4L1XA 2QULA 1UPMB 1WXYA 3L66A 4UTIA 5KETA 3C8NA 3VIFA 3EDKA 3KOXA 1EIXA 1FQ0A 1ZFJA 4H41A 1JDEA 4WGXA 5H8UA 1W54A 4UQEA 4H4IA 3NL6A 1E71M 1QPOA 3T1GA 3USZA 1DE6A 1HVXA 4NNAA 1UA3A 2RURA 1G1YA 3CAKA 4EX4A 1YADA 2Q3OA 2QYGA 2Y7GA 4E8GA 5HTGA 3W86A 3BGJA 3G24A 3LM7A 4QDPA 3KOZA 3QLLA 1H62A 5BRQA 1LDCA 1XWYA 3BURA 4I5UA 3C0QA 2E0PA 1PKLA 1RHCA 1V3MA 2E9MA 4N0RA 1UR8A 3S9YA 1XLMA 3SSJA 3D47A 5EMMA 3RU8X 4XK2A 5E6ZA 2DVTA 3DENA 1JCJA 3V5CA 3VC5A 2VC6A 3AS0A 2BSLA 1BYDA 4FS9A 3B8TA 3EWBX 3V5FA 4TV5A 3VOHA 1LL4A 3T40A 3L67A 3UVAA 1JNTA 2KAUC 3W7QA 1ICQA 4LBRA 3NIYA 4CD7A 1P6CA 4TV6A 3PTKA 3W70A 3U7BA 6REQB 1JCNA 2CC0A 2FVLA 2Y62A 4UR7A 3TAOA 5AHMA 2VFEA 5DY2A 5GPRA 1F07A 3GIYA 2GUYA 2X2GA 3TQVA 3KFTA 3P60A 4L65A 3AOFA 2OO6A 3AFBA 3NPUA 3PA7A 4HQVA 4UQAA 1S1PA 4LOCA 4M6VA 4O52A 5DBUA 1EL3A 1TV7A 1QPLA 3WLQA 1DIDA 3MKKA 4QIUA 3SN4A 3F4DA 4E8CA 4JYSA 2WSYA 4B16A 3WLMA 1PINA 2Z1BA 1LQ2A 1V0LA 1DXFA 4BJHA 2VWSA 1IEVA 4KH2A 1F8IA 1GTEA 4V15A 2QVHA 3N3TA 3QR3A 5LHFA 3TYEA 3KHDA 2CCRA 3F4VA 3GH7A 2J8GA 5CH9A 4E4FA 2RDXA 5BRPA 4YHGA 4ALDA 1LBLA 1OFDA 4PL1A 4NZJA 1T41A 2OODA 4DJEC 3MANA 4JOMA 1GVQA 1M01A 1OGBA 2KE0A 3PANA 1O1HA 3LENA 1UROA 4LUSB 1SQ7A 2PS2A 1FFQA 3Q58A 2A6NA 2NXGA 2Q5AA 2QAPA 1LT7A 5CSSA 1MFUA 5TF0A 1A5KC 4DUOA 2O9TA 4P61A 1RVKA 3CUFA 3JU2A 2I17A 2CETA 2QPSA 2YA1A 4L9ZA 2PB1A 4QS5A 3B9DA 4AZCB 1DORA 2DUAA 3BAJA 1XRTA 5DEZA 3LBOA 5KZDA 3OOBA 3URBA 1GVFA 2GVLA 2J9ZA 1PKYA 4IMAA 4H8UA 4NIRA 3DH7A 1H51A 2FHFA 4FXRA 4R7OA 3BOXA 3ARSA 2JEPA 3ZJ6A 4K2SA 1QK0A 3FXYA 4HTBA 3NCOA 3LCHA 1V93A 4GUIA 3T4CA 2G41A 1FWGC 2NQZA 3M44A 4EVZA 1TV8A 1FY6A 5CPNA 5A2BA 1HKKA 4IL2A 1A0EA 3TJLA 4F0SA 4HA0A 4JFKA 4PEKA 3K8MA 2XPKA 2HRWA 4TVUA 5JUVA 1WB0A 4MAVA 3MCNA 2BY0A 1L8PA 1G6CA 3VIGA 4IGSA 1EOKA 4PB3A 2GFTA 1L6FA 4GIYA 3EWCA 1XIEA 4Q4QA 1K03A 3SCTA 1E4IA 1W91A 3LGDA 3PUDA 1R3SA 4U3AA 4CD5A 3VGEA 3GG7A 1BQGA 1VFOA 4XZIA 3UT0A 5F2LA 1TJ1A 4NJKA 3ABRA 1XICA 4L4LA 2E09A 1HVQA 2E6AA 4ZB0A 1J0YA 1F9CA 1FKGA 1X98A 3ZMRA 3E2VA 4KF1A 2J24A 1GQIA 1CXIA 4FX6M 4W87A 2FZ9A 3PPHA 4GISA 1Q6HA 4CEXC 1XG4A 5D30A 4W85A 4INFA 4RLIA 4LBUA 4E2DA 1TYGA 4CQ8A 4GIVA 3ARXA 4ODPA 4AMAA 3O06A 4MNMA 3DI0A 3QJAA 2F4EA 1IXNA 3LSBA 1FTXA 1H4PA 1CT5A 2I5GA 3CPRA 2HMCA 1XRVA 3WF3A 2WXDM 4KEMA 3KDOA 4M1BA 4WSHA 3IVUA 1MUWA 5BOEA 5MKGA 1LRQA 3WDQA 1EPXA 3TYUA 5FAGA 1Z9AA 1MYRA 5HMDA 4PUWA 3UEQA 1A53A 3OLDA 1O1ZA 4QNWA 3CZLA 3WO8A 4FZIA 1VHCA 3PUGA 1Q6FA 2A3LA 3E6EA 4WXYA 4A3RA 1TJRA 3NQ8A 1RY8A 3W72A 4JFJA 4IFKA 5K7JA 3B3DA 4HZ7A 2DZVA 5B7YA 1GHSA 2OELA 5FEZA 2DGAA 2CFFA 4EAMA 5HATA 4ONVA 1NDYA 1N8IA 2PTXA 1NTHA 1Z41A 5BWAA 3W81A 6ALDA 4S3JA 1XUUA 3FVDA 4CQCA 4Y6GA 1YXYA 4JKKA 2F2HA 3LMZA 3RCMA 3AZRA 3WH7A 4MZ8A 1OFOA 2GSEA 1JCLA 2Y1HA 1DJYA 3V1HA 2YXXA 4Z17A 4MFDA 4URIA 3C5QA 3W7NA 2AQWA 1XIIA 2GGEA 1R86A 3LHVA 4JQAA 2Y88A 3TZFA 2OLSA 3ITXA 1E4MM 3TR2A 2O9RA 2DW6A 3W02A 3V4BA 3WD3A 2O56A 5DITA 1F8AB 1V51A 3EEGA 4JTGA 4FNSA 3V36A 1REQA 3CIWA 3RF9A 1VPXA 4JTTA 1KM3A 3WMBA 1LP6A 1PSCA 4IPIA 2FVKA 4B5VA 4LT9A 2J25A 2Z2AA 1SW7A 2GWNA 3ARZA 1UOKA 4P8UA 1IT7A 3CASA 3MUXA 1BRLB 3B4UA 3S9IA 4HK7A 3GW3A 3FN9A 2EKCA 4A05A 1W1YA 5FL0A 4B5XA 2PAJA 4X60A 2VTFA 1C8QA 4IJBA 2W0UA 1KKOA 1SSGA 1GONA 2WBKA 3GO2A 3F7JA 3W38A 1X1ZA 1TQJA 3WF0A 2DG9A 4BI7A 2CW6A 3W4RA 3GNRA 1KTNA 5CZKA 3VXGA 4QCEA 2PDHA 1FKXA 3GRIA 2XSAA 1EC9A 4YLWA 1SFJA 3NJ3A 2EG6A 4I6KA 3GR4A 4O57A 3HTWA 4MB5A 4Q4RA 1XFBA 2VELA 1R8LA 4ZL1A 5FEXA 3O7UA 4NQ1A 3S2JA 3UWEA 3NM3A 3AYRA 4O19A 3SUVA 3WH5A 1AQMA 2C71A 5IDIA 4LRTA 3IRDA 5EL1A 3AC0A 3P62A 4L61A 1OF6A 3VD3A 4A3HA 5E6YA 3GTXA 4YL2A 2OEJA 2EGZA 3NSNA 5BXJA 2PUZA 1FKKA 2V3GA 4X9YA 2BV9A 1TB3A 5FF2A 2KFWA 1HNYA 2QW5A 3B8WA 3ZJ7A 5H1WA 1C90A 1VB9A 4H7ZA 2XISA 5CPMA 2FYMA 4QT3A 3FYPA 3PZVA 5BRBA 3KRSA 1Y8BA 4JQ3A 4FNRA 2XTKA 1SFTA 3MVIA 4NILA 5JBDA 4B15A 2A0NA 2RGLA 3VGDA 3CB8A 3GB6A 2HVNA 3N29A 2CWNA 1E6ZA 3CNYA 4BQ5A 1NOFA 3EKZA 3NSXA 1E72M 4JFVA 3AALA 3SY5A 4A8NA 1AZ2A 1JIBA 1TCMA 3BVJA 2GGJA 4RPQA 2VDGA 2GJXB 4HSNA 3FEQA 1UOZA 2B0MA 3W29A 2WYSA 3GC4A 3GDTA 2QKFA 5IFPA 3L4XA 3AJ7A 3UCDA 4JEQA 3N6HA 5BXRA 4S3BA 3W2KA 6TIMA 5IHSA 3MO4A 4IMDA 1XDJA 3LD5A 2ZTKA 3UCQA 1K6WA 2C15A 2IKIA 4P7QA 5JH8A 4QGCA 3UF8A 4DRHA 4GXMA 4PTXA 1AD1A 4HHPA 3M0VA 3G18A 2H6RA 1W5OA 3LSCA 4HKPA 5CBJA 2YCEA 2VR5A 1HF6A 2DUXA 2VZVA 4KCUA 4B92A 4CVUA 3W1AA 3NO3A 4H8HA 3FDKA 3N9SA 3VMPA 3WQPA 1HX0A 3UETA 4XBJA 1A49A 1M5YA 3BG5A 4EWJA 4LS1A 3N15A 1XINA 1W9DM 1VEPA 1TIWA 4PTNA 4PTWA 1LORA 1YNPA 2PV2A 2X1TA 2AAMA 3AMDA 4EOUA 2WB5A 1TPWA 3IIZA 1E0XA 3OGVA 3G8RA 1OG6A 4X63A 2FZMA 3UW6A 1XCFA 3APYA 5A5WA 2JKEA 2OG9A 4QP0A 3DHPA 1ZBVA 2OMAA 2PE4A 2VVSA 4P2VA 1OVDA 3W7HA 3KOFA 1K8YA 4LWWA 4GQ0A 3QC0A 1EP3A 1B31A 3GXTA 4HPGA 2QPXA 1XR2A 3AHTA 3CL8A 3NQGA 5BZAA 4GACA 3O6YX 4WK9A 2REQB 1EO5A 3ZVHA 3O9NA 2HPIA 1TTPA 4K7YA 1Q8JA 4UTJA 2EULA 3S8HA 8TIMA 1X38A 1TJPA 5HDRA 4B2DA 1VENA 4NJIA 3SGGA 4N6FA 4XKMA 4TX9A 1Q65A 2QAFA 2UZ9A 2YBVA 1V3KA 2DSWA 2ACQA 4FNPA 4A2RA 2WSKA 4D8AA 1VCGA 3KVKA 2C7FA 1U5VA 1H5YA 1CNVA 4QJ5B 3KACA 1T40A 2XZ7A 3S6OA 4G1KA 3KTCA 2SFPA 1MNSA 1LG2A 1SZGA 2DUZA 3B7XA 4DJED 4KBXA 1ZS2A 2ALDA 3LZ3A 4AQLA 2F38A 5DLCA 1PHWA 5HR6A 3LLXA 3W87A 4M7TA 2YL6A 3PTDA 4TNSA 1ONXA 1PB0A 2PPNA 3EYPA 4GC3A 1UH2A 4KRTA 1BVZA 1Z69A 3SEPA 4JXCA 4S39A 2GVEA 3IPWA 1BPLB 1VLIA 2DFAA 1TV2A 2DW7A 4HA4A 3O07A 4J2PA 2OT0A 3LHUA 3SECA 1QWGA 1SFLA 2J7CA 3RLUA 1FA2A 2VRKA 1C29A 4Q8PA 1KBIA 1GVOA 3UJSA 2F84A 5IOBA 4QSHA 3FVMA 4W8BA 3RJYA 4GVHA 1MEWA 1M1BA 2INZA 1WZAA 2RJGA 3WEOA 1AL7A 4PSPA 3R94A 5D32A 2ZUMA 1LUCA 5FSDC 1XBYA 3BCDA 1V7AA 1P1MA 4DI9A 3I6TA 3L4WA 5CAKA 3WENA 4HU8A 1UUQA 2NX3A 4GNVA 5BU6A