1JNEA

Crystal structure of imaginal disc growth factor-2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
molecule keywords Imaginal disc growth factor-2
total genus 145
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jneA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jneA01
3WDIA 4UZSA 2XM1A 3ZJ8A 5GQBA 1H0GA 3MU7A 4FLRA 3NSNA 3CMGA 4W5UA 3CHDA 3WQ4A 1G0CA 3LPOA 1BFNA 1O6IA 1WDPA 3GXMA 4ZFMA 3VPLA 1W9XA 4UQ9A 2CXGA 4H41A 5M5DA 3DHPA 3GNOA 2O9RA 2J79A 4J3WA 1V02E 3WSUA 4K68A 3HN3A 4HOXA 2FHCA 4PYSA 2A3EA 4BQ4A 3VM7A 1CNVA 1CBGA 3PZIA 1VF8A 3ARUA 1WZKA 3HJEA 3UCQA 2XFYA 1R7OA 1WDQA 3BAXA 2WXDM 5BRQA 2FH6A 1VFMA 4JKKA 4PMZA 1G9HA 3F4VA 2XVPA 5A3HA 4D6HA 3BGAA 1C91A 3W29A 1HL9A 2J7CA 2YDRA 4B9ZA 1FH7A 3N11A 3MUIA 4M80A 1QHOA 3FW6A 4P8XA 1MW0A 2XWDA 5HXMA 3MUZ1 4UZUA 4FLOA 1MW2A 3N12A 3K4AA 2J7FA 4TVCA 2WSKA 4W89A 2W67A 1W9PA 1W1TA 5CLWA 3WH6A 5A6LA 4JKMA 4H7VA 3GNPA 2BNJA 4MNMA 2W91A 4OBSA 1PX4A 5EB8A 4E8DA 1IZKA 3FXYA 4NSBA 1J9YA 4J27A 3VVGA 1QBAA 4E2OA 3S6TA 4A3YA 1WDSA 1FH8A 2FHFA 3BAYA 2GJXB 1BSIA 1GQLA 2BHZA 3KL3A 2VUYA 4W8BA 2VTFA 4QAWA 1E6NA 4CVUA 2WMKA 3WDPP 1JZ7A 4X9YA 4Y7EA 2ZX6A 4X0VA 3VIOA 5CPSA 5BWFA 3WENA 1CXIA 3FHQA 1XYZA 5JUVA 2EPOA 1H09A 3QR3A 3CHFA 4C7DA 4B16A 1ZJBA 3VIGA 1ISWA 1E56A 4JZ5A 3W27A 3ARPA 3T08A 3GM8A 3PZUA 2VX7A 2GJXA 3PN8A 3OG2A 3PTQA 3GTNA 2FHBA 3I3EA 3VO0A 4HU0A 4L4PA 3N04A 3FHAA 5DEZA 3K8MA 2Z1KA 2ZUWA 4ACYA 3BAWA 2D22A 4JFSA 2G4FA 2WHJA 6TAAA 2BXZA 3VILA 3WF0A 3SIMA 1BYBA 1B1YA 4FK9A 1QVBA 1QI0A 2PB1A 1RPKA 4PTVA 3EMQA 2OSYA 2WBKA 2BV9A 1LJYA 1KXHA 1MYRA 5FKYA 3W28A 1UKQA 1E1FA 4S3KA 4IPLA 5A6KA 2EPKX 1JFHA 1MQQA 3GH7A 2XVLA 3FNDA 1QHPA 4AD2A 4IM4A 4ACZB 1I75A 5M3WA 1CGTA 3VMOA 1M03A 2JIEA 4D1JA 5HBFA 3B8SA 3WUBA 1JNDA 4PTWA 1ZBKA 4ZXOA 2Z1SA 4S3JA 4M56A 3AMCA 1CYGA 3SURA 4P7NA 2FH8A 2E9LA 2WCGA 2J7EA 2E4TA 1HKKA 2ZX5A 4W88A 1UD3A 2YA2A 3F5JA 5A2AA 4AWEA 1PX8A 4AZCB 1KBBA 1B3XA 1HN1A 5CPQA 4B15A 1TR1A 1EDGA 2VURA 4OIFA 4PRWA 3WDHA 1XD0A 4U2YA 1JAEA 3VKKA 3II1A 1H5VA 3MV11 3UG4A 4AD1A 4P8VA 1K9FA 1OD0A 3K8LA 1SR0A 3BAJA 3T2OA 3EDEA 4AZ6A 1J18A 4PUEA 1E6PA 3HMCA 3WBAA 2G8ZA 4UQDA 1WZAA 1UZ4A 2WB5A 2X05A 4CN4A 1HVQA 4V28A 2X1IA 5CPTA 1N82A 4IUGA 3PTKA 3AHVA 1VIWA 3WD1A 2ZUSA 2ZICA 2ZOXA 2WPGA 1W32A 2VMFA 3ZT6A 3M6DA 1NWUA 2VZVA 5D8WA 1HJVA 1X1NA 1UWTA 3WF2A 2FGLA 1OD8A 1BLIA 1Q4NX 4OOUA 3WNPA 1HF6A 1TA3B 1WAWA 2EEXA 4CKQA 4NI3A 3MSDA 4UOZA 3A47A 3UERA 3CLWA 5CSYA 2DT3A 3PZVA 3NDYA 4EK7A 4UFJA 6A3HA 3AS0A 2WANA 4J3TA 1J0IA 4N0RA 3VM5A 4H8HA 2V5DA 1W3HA 4D6GA 4ZEPA 1E70M 2DDXA 2EQDA 3AIWA 2BXYA 4GI9A 4AZBA 4GO8A 3VGBA 1YHTA 2EJ1A 1UH4A 1CXLA 3PZOA 2E9BA 1GHRA 4PMYA 1GPFA 5FCZA 1E5JA 4AD3A 1HT6A 2DIJA 3VDBA 5BXRA 3M7SA 3L2LA 1LL7A 1HJQA 3SCRA 2B31A 1UWIA 4R5EA 1G5AA 1KGWA 2FGZA 1AQMA 4CCEA 4GI8A 1PZ2A 3AQUA 4HMDA 2D2OA 4CU6A 4MAVA 3ARQA 2DSUA 2WC7A 2E0PA 4P7QA 4BQ5A 4AZ7A 4MNLA 5I78A 2BY3A 3WKZA 1XH1A 3ZSTA 2YKKA 2BY1A 1UYQA 1LG1A 4PMXA 2Y8VA 5AY7A 4D71A 3RO8A 3ZSSA 2A3CA 2WZEA 5EBAA 1UOKA 4W7WA 1HJSA 1V02A 4U3AA 2DSZA 3WDRA 1R85A 2BVDA 2D20A 3U7VA 3O6AA 1CXKA 2YL8A 4PMRA 4AZCA 5CSUA 4X0NA 5A95A 1F4HA 1EIBA 3DC0A 3KWXA 3N17A 2ZX9A 1LF1A 1QNRA 2ZUUA 5E09A 5A6SA 5LA0A 3AHXA 4JFUA 1OIMA 3MV01 1ECEA 3GXDA 4WKFA 2PWDA 3VNZA 5ECUA 1WPCA 1H41A 3BLPX 3VOCA 4PUDA 3ARSA 2ZXAA 5DT7A 4UQAA 4MTVA 2J7GA 4KWUA 2A3HA 1VAHA 4WK9A 4AZGA 3WUFA 5ABFB 3CZ8A 5A6JA 3UR7A 1BYDA 3RJXA 1DWJM 1VFUA 4TTGA 3VUPA 1R7AA 4CU7A 1PX3A 3KEHA 2X09A 5AC5A 3ARYA 2J77A 3ARTA 2RGMA 1E15A 2BS9A 3ZMRA 2JF6A 4ZE4A 2WVTA 1V0MA 3SCTA 1XH0A 2WLYA 1A47A 1UR2A 3VIKA 1H11A 1GCYA 1VJSA 3ZR5A 4D6EA 3VD4A 2XM2A 3DYMA 1CXFA 3VDAA 1EO5A 5AYBA 4YPJA 2DT2A 5HOSA 3OBAA 3OLEA 3VGGA 1L8NA 3WN6A 3WELA 1R87A 2QMKA 2QHAA 1DWFM 1M04A 5M17A 2OSWA 4CCDA 1CGWA 2CETA 4JAWA 4BF7A 2VZOA 4W5ZA 4HZ6A 3CHEA 2YDQA 3OGVA 3W0KA 3W24A 4DWSA 1TUXA 4HA4A 2V3GA 2PBGA 4CD8A 1GJWA 1US3A 5I2UA 1MQRA 3CUGA 2RGLA 1L0PA 1UR9A 2XTKA 4ATWA 5IHRA 2GJRA 4AYSA 1XSJA 1V03A 2DEPA 1GZJA 2BHYA 1J12A 1E4NA 1JF5A 3AMLA 1UR8A 2V5CA 1MW1A 5A8QA 3W38A 4JHOA 2AMGA 2C8NA 3AOFA 5TD4A 2VC9A 3BC9A 4WSKA 4Z2GA 1W2PA 4GXPA 1WNOA 1CGUA 2XGBA 1TA3A 4JHZA 3AMKA 3W26A 1GHSA 3MUAA 1VRXA 5A1AA 1KQYA 3ZO9A 3AZTA 3ZT7A 3K1DA 3CPUA 5JBDA 2PI6A 1Q6FA 4KH2A 2E40A 5A69A 2NW0A 3AHZA 3WQ6A 4TUFA 2DSVA 1EDTA 4U5IA 3EBVA 2VNCA 3VGEA 1LLOA 3L2MA 3MMDA 1JXJA 2WLZA 2VCBA 5E0FA 4BQ2A 3MANA 2ZUTA 1FFRA 1BVZA 1BGAA 3BSHA 3AS3A 4U5KA 3AICA 4LXFA 2XIBA 4AXNA 4LX4A 3UG3A 4D6IA 1C93A 1R8LA 2J47A 3ARRA 5I6SA 2YBUA 2WVVA 1KR0A 4DUVA 3NSXA 3FY1A 5A2CA 1Q6DA 2EPLX 2ZUMA 4P7RA 4FLSA 2QF8A 3B9DA 4UCFA 1JI1A 3WNLA 4QLJA 4JL1A 3QOKA 1MVYA 4OJYA 5EFFA 3W6MA 1UWUA 1PZ3A 1HVXA 3WUGA 1EOKA 1JL8A 1SFSA 1G01A 1HJXA 4JFTA 3W25A 3VTRA 4HU8A 3DHUA 3SCSA 3TTSA 4H8VA 1NH6A 4MPKA 2WMHA 5EFDA 2E3ZA 2F8QA 4HTYA 4QP0A 3BXWA 4H8UA 2G3NA 2WK2A 4YN5A 1CXHA 4GPNA 1JZ5A 1RD6A 4P7LA 1V0NA 2UY2A 1J0JA 2ZWZA 1QNSA 1BHGA 1QPKA 3VNYA 3NCOA 4W7VA 2YDSA 3L4VA 5IFPA 1JZ8A 1JYXA 5HPCA 4NZCA 4UFIA 1C8XA 4ATLA 4UQBA 2WYSA 1TVNA 1W1YA 3RCNA 2JEQA 2YA1A 2J74A 4CD6A 5KZ6A 1DTUA 2F61A 5ABEA 1XRVA 4LYQA 1TE1A 3CGTA 3LMYA 2CBUA 3I3BA 3AFBA 1E6RA 1E55A 4CU8A 2Y2WA 1E6XM 1XYFA 1HL8A 1TZ7A 4AEFA 3CMJA 3VU2A 1HKMA 1E0VA 2VX4A 4BA0A 3RILA 3TONA 3VINA 2VVNA 4UOJA 1B3WA 1BG9A 2CIPA 5LA2A 3WEZA 3CZEA 3GBEA 1JDDA 3JUGA 3VGHA 4D72A 5IXEA 1PIFA 2YL9A 4AMCA 1KGXA 4ML4A 3OGRA 1JF6A 4HP5A 3NJ3A 5A8PA 3WD2A 4GQRA 1CEOA 4W7UA 5BXTA 3KZSA 5GNXA 3O2LA 1GJUA 2V38A 4JCMA 1H2JA 3ZQ9A 5HPOA 3LPGA 4NRRA 4PSRA 4AD0A 3BH4A 2NT1A 1XH2A 2PWGA 4D6CA 3LPPA 1UD5A 4UQCA 5BROA 3SCNA 3ECQA 4E8CA 2CHNA 3THDA 1UG6A 5GPRA 4W86A 3SCWA 1US2A 1OB0A 4ZENA 1J0HA 3G6MA 2WMGA 2BHUA 3ARXA 3N1AA 5A2BA 3AS1A 4AZHA 1ISXA 1E73M 1V6UA 2VO5A 1GOQA 1B3ZA 1OWQA 2VZSA 4ATDA 1J0KA 2XJ7A 1ZB5A 1HP5A 5IFTA 4Z2JA 3WBEA 1PJ9A 2XVNA 3NYDA 1H0IA 1VB9A 3NIYA 2DQXA 2J25A 4HPGA 1UKTA 1KXQA 3AMDA 1C3FA 1PIGA 4AZIA 3RMEA 3RPMA 1HKIA 2WW5A 4PMDA 4UNIA 2J62A 5HDRA 3AIVA 1GOKA 3S2CA 1O7AA 4FF5A 4BZYA 1WE5A 1GQIA 1V3MA 4A4AA 3QHOA 2DSKA 2D0HA 2OWXA 3U57A 3SCUA 3AMGA 4AIEA 2CNCA 2CCRA 3PHAA 4C7GA 3IJ8A 1A3HA 1GNXA 4J3SA 4GZEA 4TX6A 2CITA 3U5UA 2UY3A 1Y7VA 1JYVA 4HA3A 4HA1A 3VIHA 1ISYA 1VJZA 1AQ0A 4WJXA 2O9TA 3MMWA 1Q6CA 3GZAA 1EDQA 4OZOA 2VL4A 1IZJA 4FLQA 4J28A 1ZL1A 2PWEA 1EGZA 1KFWA 2GSJA 1H3GA 2W61A 3KE0A 3POCA 1J01A 1EO7A 1ZBCA 2E8YA 2D24A 2DH3A 5FOOA 1V3LA 2YL6A 5ABGA 3WF1A 1JIBA 3L4TA 1LL6A 3VD7A 1X6LA 1JYNA 3TA9A 1UH3A 2CERA 3PTMA 2J7DA 4AZ5A 1HIZA 1B3VA 2DT0A 4URIA 3L4ZA 4HPHA 1CGVA 4F9JA 3PZGA 4LPCA 4QFUA 3RDKA 2VJXA 1X6NA 4R27A 3WQWA 1M53A 3K46A 3ARZA 1D3CA 3WY1A 1ISVA 1BG4A 3CZJA 5D9MA 4GINA 3M07A 1G1YA 3A4WA 1QW8A 3OZPA 1GOOA 1XCWA 2D3NA 1XSKA 3L4XA 3VDCA 2CPUA 4MNJA 2XG9A 2WMIA 1E3XA 1CXEA 2XVKA 3CO4A 2J75A 3N13A 3SUTA 4LQ1A 3VGFA 1LWHA 3W81A 2WZHA 1ISZA 3VD9A 2WKLA 3ARVA 4XZBA 3ZR6A 5AC4A 1B3YA 2OYKA 1H49A 2WC4A 4CUCA 2TAAA 1RP9A 3CZGA 1J10A 2X2YA 5D4YA 2Y24A 1OCQA 2GK1B 1E5NA 4CCCA 3OZOA 3ARWA 3EYPA 4EANA 3CIVA 1FHLA 1HNYA 3OIHA 1RP8A 3RM4A 3WNKA 4JL2A 1YQ2A 2WC3A 2IXVA 1KWGA 1M01A 1UR0A 5M03A 1Z32X 3OGSA 4PBGA 4MDPA 1V0LA 2VZTA 3PZMA 2A3AA 3QHMA 2YIHA 1W2VA 4KRUA 4XB3A 5IDIA 2D3LA 4MB4A 3DYPA 3GH4A 3B9EA 1VFOA 5AYIA 4LYPA 1V3IA 3EMZA 4F9DA 3F5LA 4QCEA 2WWCA 5BRPA 2CHOA 3TTQA 4N42A 3EMCA 2YBTA 5DFAA 3D3AA 1BQCA 4GZJA 1F4AA 4XZWA 4W85A 1W3JA 2XIIA 1UUQA 3UETA 4M1RA 3VMNA 4DUXA 5ABFA 1EA9C 3RM9A 3U7BA 5BYWA 3ALFA 1QW9A 3ZJ7A 3WIJA 1QNPA 3W6LA 1KR1A 1Q6GA 1HKJA 2PWFA 4CGTA 2XSAA 1JI2A 3WFLA 1OSEA 1CLVA 2GUYA 1UWQA 1ZJAA 5I5RA 4V27A 2WHMA 1E6ZA 3DECA 2WZIA 2JFEX 2QMJA 1XV8A 4M29A 3N18A 2XHYA 2G3JA 3EDFA 1UQZA 2PF0A 1UZ1A 1UR4A 2YLAA 5IHSA 3PZNA 4YHGA 3IAQA 3MKKA 1V6YA 4F66A 4KGLA 3WD0A 4CN1A 1G94A 2DSWA 3MS8A 3IAPA 1LWJA 4RE4A 1C90A 1GVIA 5I79A 3RIKA 2VRJA 1WB0A 2V3EA 1I1WA 2VRQA 2EBNA 1W3KA 4AIOA 2VX5A 3GDBA 5HNNA 4PCTA 2CESA 3UG5A 1B31A 2UWFA 1H1NA 4EAMA 2Q8XA 1WO2A 2PBOA 1BF2A 1U33A 1DP0A 2AAAA 1B90A 3N15A 1JZ2A 4J3XA 1E72M 3CUFA 1JDCA 1LL4A 1W9DM 4MJ4A 3ZOAA 4TOQA 5EMYA 3UEQA 1E3ZA 1TCMA 4PMQA 1KXTA 3DYOA 1UWRA 4KGJA 4M24A 2E8ZA 4OOZA 5FL1A 2XUCA 7TAAA 5CGMA 3IK2A 4Z2HA 3TTOA 5A8MA 5A6BA 1JYWA 3EDDA 2OYMA 3IJ7A 5I0DA 2PWHA 1XSIA 1NWTA 2JALA 4DWSB 3W82A 1WP6A 2WCAA 1ESWA 2VR5A 1JD9A 1V3HA 2Y8KA 1BAGA 2EPNA 5GNZA 5A94A 2ESCA 1UHVA 4KMQA 4HZ7A 3WH7A 1ZBVA 3D5HA 3VX0A 4W87A 2BVTA 2CBIA 4W8AA 3FN9A 4A3HA 5FL0A 3A3HA 2VOTA 3CBWA 1VBRA 1BYCA 1JG9A 4E4PA 1PAMA 4DWSD 3EDKA 2GJPA 1VBUA 4M81A 1WZMA 1OT2A 1V3JA 2EPMX 3WDQA 3WH8A 2W4XA 1HXJA 5JIWA 4AEEA 2DGAA 2VX6A 3AI0A 2WMIB 1PPIA 4MJ2A 4QDMA 5D8ZA 1ZU8A 4PTXA 5LYRA 3OLGA 3BMVA 1E1EA 4U33A 5A6AA 3CZKA 4JKLA 4PCSA 2GK1A 1UD6A 4PMOA 2CBVA 1NOFA 2ZWYA 1NOWA 1ITCA 1GONA 4J3UA 4QCFA 2CEQA 4AIUA 3VD3A 1ODUA 1PEZA 4MADA 4TXEA 2YOCA 3GBDA 2XFFA 2NSXA 3AS2A 1DWHM 1RH9A 1EXPA 1AMYA 2A3BA 1E4MM 1QNOA 2UY5A 1JAKA 2G3MA 4AD4A 4F79A 2J8FA 2G3IA 3WQVA 4HZ8A 5JIPA 4MB1A 3CTTA 3AIRA 3ZIZA 2VQTA 1W9BM 2JIWA 2CKSA 1V0KA 3KL0A 4D6FA 1HJWA 3AXIA 1KQZA 4J3VA 3AIBA 1MXDA 1UA3A 3SEPA 1V6WA 3L4YA 1MFVA 4L4OA 3F5KA 1WZLA 1DWGM 1OGGA 1TMQA 2EO7A 3QHNA 4TVDA 4JCLA 1C8QA 3E1F1 4CN6A 1GW1A 1UR1A 4XV0A 1XC6A 1NP0A 3AROA 1JFXA 3BMWA 2OWCA 4J7RA 1XGZA 5C70A 4UFLA 1CTNA 2ZUNA 5JBFA 3GYCA 1UWSA 4RL3A 5CLTA 3O9NA 4WLCA 2C0HA 1E40A 4PTMA 2OSXA 2WSPA 3VMPA 4U31A 4DM1A 2ZX7A 1UD2A 3GXFA 1VEPA 1JNEA 1K6AA 4QLKA 2ZIDA 3WDJA 3BSGA 1E9LA 2D23A 3MMUA 3OB8A 1I1XA 2XSBA 1AQHA 4Z2KA 1UKPA 3WH5A 3ZJ6A 1JDAA 3VIIA 5A6BD 3HU7A 1MW3A 1AVAA 4UTFA 1MWOA 1EOMA 1J11A 5BCAA 2VZUA 2WHKA 3T0AA 1B2YA 1E71M 2JE8A 5D9PA 1EQPA 2XGIA 4QLLA 3VDHA 4AISA 4D1IA 4WKAA 5CJ5A 1P6WA 1KCKA 3A4AA 4ZXLA 1QOXA 3FAWA 1XHGA 1MFUA 3TOPA 1BPLB 4CD5A 1D7FA 4PN2A 4OKDA 3WL0A 2IUZA 1FFQA 1KWKA 4XUYA 3WEOA 2G41A 4Q7NA 1WCGA 3RM8A 2XYLA 1FP8A 5D9OA 4BS0A 2ZE0A 4UFHA 2BFGA 1ZS2A 3IANA 1GVYA 3WNMA 2D0FA 1SMAA 1H4PA 3PZ9A 1DWIM 2YJQA 2W62A 2J78A 4M82A 3B9AA 1J0YA 4RE3A 1CGYA 5FD0A 1C7TA 2WKGA 4PMUA 4DWSC 3L4WA 3PZTA 4OBRA 4D6DA 1TFVA 3PZQA 2WMFA 1KB3A 3J7HA 1NWRA 2ZXQA 4C7FA 6CGTA 4RE2A 1U2YA 3AIUA 5E6YA 7A3HA 2D0GA 1J0ZA 1BGGA 1C7SA 2AOSA 3IJ9A 5F7UA 3VIJA 5BXPA 3WQ5A 5E0CA 4U3CA 3GNRA 2GDVA 5A6MA 5CG0A 4P8UA 2JF7A 3CUJA 4NRSA 1M7XA 2XFRA 4ACZA 1EH9A 9CGTA 3VX1A 2FDMA 2WVVB 3ALGA 4Q22A 3N9KA 3ZJKA 3BAIA 1NP2A 4NF7A 4W84A 4JFWA 3WEMA 2VR4A 4WIWA 2J7BA 3WF4A 1BVNP 3T0BA 3ZT5A 1R86A 1GOIA 3SCOA 1LG2A 3MUY1 4AY1A 1W9VA 1GORA 2CYGA 2ZUVA 4JIEA 2J7HA 1SYTA 2O9PA 1K9TA 3A6OA 3VGDA 1JD7A 3TP4A 8A3HA 1QHZA 4U2ZA 3ZM8A 5I77A 2HISA 1EHNA 4Z2IA 2QPSA 1CIUA 4GZIA 1GQJA 5JH8A 4B9YA 2GFTA 3W53A 4P7OA 5I24A 4H04A 3AHYA 1E0XA 4B3KA 3RJYA 3I3DA 4HMCA 1K9EA 3G6LA 3AXHA 1OM0A 4ZE5A 4UOQA 2W63A 1E4IA 2DIEA 3VIMA 1OGBA 3WUEA 3WL1A 5BXSA 1VEOA 4HOZA 3AXXA 1UH2A 1BYAA 2VVSA 5GNYA 4AD5A 1CWYA 3W37A 1B30A 1UA7A 2WM0A 4AW7A 4W93A 3M46A 2X0YA 1UD4A 4V2XA 1HJUA 2OWWA 3SUVA 3T2PA 3BCFA 1QI3A 1DEDA 3KL5A 3SCVA 2O92A 3POHA 4TVUA 2X8RA 4WSJA 2ZXDA 1B9ZA 1CECA 1CLXA 8CGTA 3SUSA 3VIFA 3CUHA 4BCEA 4DUWA 2HVMA 3AYSA 3SCPA 3OA5A 1UKOA 2QPUA 3QGVA 3THCA 1PBGA 3WFZA 3UR8A 4MB3A 1W91A 2DPEA 2BVYA 1DWAM 1CENA 3VIPA 1HX0A 4PSPA 1BTCA 2VCCA 5C71A 3AIEA 3CH9A 1CPUA 2XVGA 1GOMA 2WCSA 2D1ZA 3MSGA 2BY0A 4KRTA 4MNKA 2W5FA 5CQ1A 3AIQA 1W1PA 1WDRA 1MQPA 3VD5A 3AYRA 4PMVA 3FAXA 1LQ0A 2WMJA 3WNOA 3WD4A 1XCXA 2BY2A 1JZ3A 2C7FA 4W8LA 3CZLA 1IV8A 1E6QM 3GH5A 4GQQA 1TG7A 3AHTA 2DT1A 2W92A 3WH9A 2V3DA 1OBAA 4MB5A 4GIAA 4CVWA 4UFMA 2VI0A 1GUVA 1GQKA 1HP4A 2UY4A 1TVPA 2Y4SA 5E70A 1NWSA 5CZKA 4PMNA 1EHAA 1EQCA 1OIFA 1U30A 1ODZA 1VENA 2WWDA 4F8XA 4UR9A 2YA0A 3AISA 2OYLA 4CD4A 4XX6A 4B3LA 2VCAA 2J4GA 2V3FA 1MXGA 3QOMA 3WMCA 4YHEA 3PBGA 4UFKA 1JZ6A 2YLLA 2VT0A 2GDUA 1JZ4A 2Y5EA 5ABHA 4IISA 1VFFA 5DT5A 4LYRA 1FP9A 2J8GA 4P8WA 1GOWA 1Q6EA 3T0DA 3T2QA 4MDOA 2WNWA 1WKYA 2ZX8A 5DMYA 3NSMA 2XWEA 1V08A 1FH9A 1V6VA 1ITXA 2JEPA 5A8NA 3AZRA 3U5YA 4TTUA 1KBKA 4TX8A 2F2HA 1K9DA 2WVSA 1QI2A 3APGA 1KCLA 1W3LA 1JXKA 1OGSA 2CKRA 2YL5A 3BLKA 1DHKA 4DM2A 4D6JA 1E43A 1W1VA 4IPNB 1E4LA 1QI4A 2CBJA 3WQ8A 4GKLA 4HMEA 2IXUA 1OT1A 4WF7A 3LPFA 4OUEA 2NT0A 4UQEA 1C92A 2ZXBA 5DF0A 2E9MA 1QBBA 4GI6A 2DH2A 3L4UA 3EDJA 3K4DA 1NQ6A 2WHLA 1FHDA 4BQ3A 2QLYA 3K8KA 5C8BB 3SCQA 5A8OA 1KGUA 2WVUA 3CHCA 1B0IA 1KXVA 1NM9A 3MO4A 2PC8A 5E6ZA 2GVYA 3W4RA 4MAZA 1JGIA 4Z2LA 1SMDA 5CXPA 3OLIA 1CGXA 1UQYA 2OLHA 5LA1A 5DO8A 1IT0A 5E9AA 1W9UA 4JFVA 1CZ1A 1OINA 3SUWA 1UD8A 3CUIA 4H2CA 4WKHA 2VRKA 1D2KA 2EXOA 1S46A 5I3DA 3NUKA 3NDZA 1ZBWA 3AZSA 5KEZA 5D9NA 3OLDA 1C8YA 3BAKA 4EE9A 1VEMA 1UKSA 3TTYA 1QNQA 1CDGA 2W66A 2QV4A 2VQUA 4M8UA 4LGXA 4CD7A 5I23A 2WAGA 7CGTA 3GXIA 2MANA 3WMSA 1V3KA 4PEEA 2WBGA 1NOUA 3BCDA 1E0WA 1E6SM 1FOBA 5FIPA 1QI5A 3T09A 4HOWA 3WNNA 4EKJA 1FA2A 3AJ7A 1NARA 5CGTA 5JBEA 3SUUA 2O9OA 3WF3A 1V6XA 3WMBA 4GO9A 1XD1A 2X0HA 4AC1X 3WD3A 3A4XA 2XPKA 4FMVA 3UESA
chains in the Genus database with same CATH superfamily
4OHQA 3WDIA 4EF9A 4HSNA 3Q45A 2AQVA 2Z25A 1S2CA 2B7NA 3MU7A 4JTGA 3HGSA 2EGZA 3CHDA 2H8ZA 2ZE3A 1O6IA 2AGKA 3JZEA 4YTRA 2J9YA 5C7HA 4AWUA 5M2FX 3E02A 3LZ3A 6PTDA 4IPXA 3LTSA 4UC5A 1TX2A 2NUXA 2I1OA 3PJWA 4IGHA 4HOXA 4BQ4A 1CBGA 2Z7GA 1VF8A 2PLCA 3LD5A 2DUXA 2KX9A 3R43A 3BAXA 3ERPA 2QCMA 2WXDM 1A53A 2FH6A 3AU2A 1Q7ZA 4PMZA 1DJXA 2XVPA 1Q6OA 1UROA 4V1XA 3AC0A 1J93A 3W29A 2J7CA 3O5MA 1P1MA 3U4AA 3LRLA 3MUIA 4U85A 3SRFA 3UGVA 2DJXA 1U1HA 4O16A 4FO4A 1FWIC 3I7QA 2R91A 3EXSA 1LOSA 3MUZ1 4UZUA 4FLOA 3U3HA 4QROA 3SQLA 1SJCA 3WJSA 3N12A 4ZA0A 3T05A 2J7FA 3MKVA 3QXBA 2W67A 4AXKA 3A21A 1W9PA 1W1TA 5AECA 4JKMA 4H7VA 1EF3A 2NZLA 4MNMA 1XLMA 5I3IA 4OBSA 3KBJA 3BDKA 2E6AA 3FXYA 2XSXA 3W6YA 4LCQA 3NVDA 4ZQMA 4E2OA 4JN8A 4A3YA 1FH8A 1LOLA 4NX5A 1F2JA 1XFBA 2J66A 3GXTA 1FRBA 1M9HA 3BAYA 1GQLA 4ODNA 2VEPA 4IFOA 1JJKA 1R9ZA 1SW3A 1F3EA 2VUYA 1Z89A 2VTFA 4W8BA 4IQ2A 4QAWA 4CVUA 1JZ7A 2GOUA 4X0VA 3LM3A 1EJRC 2IKJA 4WXYA 1M5WA 5JUVA 1TJRA 2XIOA 2PDWA 3G1FA 3KOFA 3B06A 1W3NA 1PYMA 3C3UA 4DO5A 4C7DA 1PL9A 4B16A 5CPNA 3F2CA 1ISWA 1E56A 3HV8A 4JZ5A 1GRJA 4ADSA 4GUFA 1UWAA 3OG2A 3PTQA 3CL8A 3MP4A 3I3EA 1S2TA 2F7FA 1OX5A 1DJQA 3W7GA 1EP1A 1LRQA 1TE6A 3DBPA 1VLIA 5HNUA 5C54A 3G18A 3HPZA 2ZR5A 2ALRA 3HOJA 3MT1A 1YDVA 4AQLA 2WHJA 1GTHA 4JQ4A 3VILA 2PUZA 3M44A 3QV8A 2AL1A 1M65A 4XIAA 5DITA 1AMKA 3TN5A 1RPKA 4RDZA 5GVJA 1Q6HA 1TTQA 2WBKA 4NJGA 4PC8A 4ZZ9A 3CL6A 3ABXA 1P1XA 3IEBA 4KS0A 3SY8A 5A6KA 1TB3A 3S42A 4YWIA 4JX4A 1J4HA 3V18A 4FS9A 2PE4A 2VDHA 4JYFA 3UWQA 1I75A 3UI6A 3VMOA 1TV7A 3OZMA 4N6FA 3TWBA 3FSTA 3HURA 4NT0A 2Z1SA 3MSYA 4S3JA 1LWIA 4P7NA 1OCJA 2WSQA 4PODA 2J7EA 3PWIA 4MSPA 4CNPA 4M6UA 3WJXA 1UD3A 5BWAA 1EJUC 5I02A 1N8IA 2YA2A 4WVXA 3B0XA 1KNWA 3T1GA 5A2AA 4LOCA 2PDUA 1ZTVA 3UQAA 4AZCB 1B3OA 4F0HA 3DG3A 5AVNA 1HN1A 3CL7A 2PU1A 1J6PA 4YMZA 1ONRA 2GPTA 4PRWA 3WDHA 1XD0A 4H9YA 4U2YA 1W37A 2YXOA 1IWPA 3II1A 1CI1A 3V35A 4G1KA 2A21A 3K8LA 2P50A 2WQDA 1SR0A 3N19B 2EF9A 4AZ6A 4G6CA 4JNMA 3HMCA 2G8ZA 3LYEA 3OG3A 3UYIA 4CN4A 1FKWA 1HVQA 1X8CA 1N82A 4GIRA 3PTKA 1ROUA 3AAMA 3HFYA 1PB0A 3CAVA 3WD1A 2ZUSA 4O52A 3KOZA 5KZMA 4LW7A 4O15A 5B7YA 2QVHA 3W2MA 4JBRA 2C1IA 2WJDA 1KBJA 2EULA 2E28A 3S83A 4NAFA 1Q4NX 4WOZA 2VEFA 3N6QA 1HF6A 1A5SA 3WCZA 3E74A 2W0UA 4G7FA 2EEXA 3KCEA 4CNNA 3TEVA 4UOZA 4LAXA 1R3WA 5CSYA 4WSHA 1XLFA 1UP3A 3YPIA 2AGTA 2QCGA 1FKRA 4EK7A 4UFJA 4GIVA 2KGJA 1J0IA 3VM5A 2ASHA 4Y9MA 4D6GA 4ZEPA 3R7MA 4G7EB 2NVCA 5D09A 2M2AA 4PMYA 3PZOA 1GHRA 1TWIA 1BRLB 1MRAA 4JYEA 3EA3A 4HNOA 4B5WA 4E6MA 5CSRA 3L2LA 3ELFA 1RD5A 1UWIA 4R5EA 3FCPA 1KGWA 1G5AA 3QLLA 3RG6A 2CLLA 4GI8A 1W0MA 3BO9A 2CLHA 2Z27A 2DSUA 2WC7A 1RQHA 4GCAA 4KESA 3STFA 4MNLA 3NEHA 5I78A 2BY3A 1TWWA 3E0LA 4IIBA 1KM1A 4I7UA 3GNNA 3ZSTA 3W84A 1LG1A 1QO2A 2Y8VA 1N1AA 5G1YA 4EXQA 3UZ5A 3O5JA 4XZNX 4W7WA 3CQHA 4B3ZA 4JXCA 1JGMA 3SECA 3HFTA 2D20A 4TX9A 3CV6A 2OQLA 3CO8A 4IOTA 2PDBA 5LNSA 4HPJA 1TPB1 2C19A 2VD9A 3I7SA 4DAIA 2XH0A 1GG0A 2ZUUA 5LA0A 4BF8A 3AHXA 4Q7IA 3GXDA 5DCEA 4IP7A 4WKFA 2PWDA 3VNZA 3CWOX 3D47A 2RHGA 2MNRA 2O4QA 5FAJA 3UWZA 1ADOA 5DMNA 4JTRA 4PUDA 2VDGA 3DFQA 3G1XA 3M0VA 4HJFA 2IF4A 2Q3OA 3ENLA 3LQGA 4MTVA 2J7GA 5I3KA 3M0KA 1VAHA 4OTKA 2OU4A 3AYVA 4KWWA 3WUFA 3SRKA 1UUOA 2VGBA 3V5CA 2X09A 3PJXA 4DRNA 1XLGA 3GFZA 2RGMA 5DQPA 2JF6A 1B9BA 4JTKA 1XH0A 1A47A 4F48A 1H11A 1GCYA 3ZR5A 3LERA 3N2MA 5E93A 4JIHA 5IM51 4V33A 3SI9A 1UIPA 3E3HA 3OLEA 5LSMA 1XL9A 3QQ1A 4ALDA 1R87A 4MKNA 5D38A 2QMKA 3CU2A 1MEHA 4MHBA 3Q4DA 2Y7EA 1OYAA 1CGWA 5D2YA 2ZZ1A 4BF7A 2VZOA 2V30A 3UQIA 3QLDA 2QV5A 4LH8A 3OGVA 5FESA 2HSAA 2PBGA 4LVGA 1G7VA 4NILA 1GJWA 1MQRA 3KOWA 1XBYA 1NAL1 1L0PA 1UR9A 1FKJA 1B4KA 2CXEA 5IHRA 2GJRA 3K13A 1KFEA 1XSJA 1AW5A 4IIEA 2QCFA 3B0VC 2B7PA 3VAVA 1OABA 2GGJA 3O15A 5CH9A 3OU8A 3W38A 2AMGA 2C8NA 3RU8X 3AOFA 2CZDA 1W31A 1WBHA 3BC9A 3SGZA 2P3ZA 5CZTA 4AUBA 4GXPA 3NDOA 1CGUA 4DN1A 3W26A 3W7KA 1GHSA 3S1XA 4YTSA 3ZO9A 3FEQA 1QOQA 4RXFA 4KCWA 3ZFHA 3CPUA 5JBDA 2PI6A 1XLCA 2E40A 4TMCA 4MFEA 3TKFA 1EDTA 4U5IA 4DNMA 2VNCA 4PA8A 4N02A 2ANUA 2HS8A 4Y9OA 3TNBA 3B8VA 3ITLA 4XZMX 4E38A 4BQ2A 1MEIA 3NA8A 1DPMA 2QZRA 3HQNA 1OFBA 4FB7A 3BSHA 1D6OA 3AS3A 4U5KA 3AICA 4KW2A 4KF1A 5HQMA 4D6IA 3KCJA 3M5ZA 1TV2A 3W02A 2TSYA 4XBSA 3RXZA 3CAKA 3KAHA 4Q4KA 2GSEA 5A2CA 2YSWA 3I6TA 4WCJA 4YYFA 4FLSA 3BSMA 2O4MA 1EEXA 5I3HA 1JPIA 3TCZA 3A64A 3APTA 4QLJA 3N4AA 4OJYA 4IQEA 1UWUA 3H53A 1R3QA 1S2VA 4EPBC 5D02A 1EJ7L 3W25A 4K6AA 1K8XA 1FXQA 3KXQA 4MPKA 5EFDA 4GUGA 4QP0A 3KHDA 4H8UA 2VGGA 1XRFA 2DVXA 5HMDA 3IUDA 4KT2A 2BSLA 1JCNA 4LF1A 4IZGA 3L66A 4GPNA 1RD6A 3WK3A 1V0NA 3GC5A 4L65A 3VNYA 4GGQA 1JYXA 5HPCA 3UWYA 3IACA 4L1XA 1C8XA 3KM8A 2DU2A 4L1GA 3RCNA 3NQEA 4HJWA 2YA1A 4QNWA 4QBXA 2J74A 5C6MA 3GX9A 3L5LA 3I7RA 2N87A 2VFFA 2OGYA 4C6MA 1GK8A 4Q8UA 4QE4A 1NTHA 3LMYA 4F2UA 1REQA 4AVOA 3DC8A 8TIMA 1E6RA 3WBXA 3RR4A 5HWCA 1XYFA 3PSWA 5CCZA 4AEFA 2PDFA 1HKMA 1E0VA 2CLMA 3UZWA 4BA0A 4AFYA 4QJ5B 2ITKA 4ML9A 3KBNA 3ZZ1A 1BG9A 3GBEA 1L2QA 2INZA 3JUGA 4ITZA 3VGHA 1T41A 1NFPA 1V77A 3VUSA 4GIEA 1O5KA 1OY0A 4H9MA 1IT7A 1JF6A 4HP5A 1LUCB 2GUUA 3DXIA 1AJZA 4GQRA 4E3TA 2FPVA 3BG3A 3KZSA 5T91A 3VE7A 2V38A 3I6RA 1JCLA 3EXTA 4KEUA 4I5XA 4DJEA 4DRSA 4YCOA 1HG3A 2YFNA 3V1PA 2PWGA 3LPPA 1UD5A 1GYMA 3AXMA 4HPNA 4MY8A 5BROA 2CLEA 2YCKX 3WLLA 3USBA 2FIQA 4E8CA 4MLRA 2RFGA 2J27A 3BURA 3THDA 4DELA 3UVIA 4AHPA 1Q66A 4W86A 1FKIA 1OB0A 4UTTC 4ZENA 3DI0A 1J0HA 2PWVA 3LM7A 4S3FA 1H61A 1FKXA 2EHHA 2WOQA 4MSSA 4MYAA 1F9CA 3B03A 1V6TA 4AZHA 1BWKA 1Q1CA 3Q94A 1GOQA 1TIWA 3NQFA 3W2NA 3V1HA 1OX4B 4L6DA 4C65A 4Q33A 1OK6A 3ABOA 5U4NA 1R9YA 1HP5A 4OQVA 1U5JA 2J24A 1JULA 1YTEA 2XVNA 1AW2A 3BUVA 4S39A 1UKTA 3GO2A 2WNNA 4YTTA 3GK0A 3EWWA 3RMEA 2WW5A 3KDNA 4PMDA 1BWLA 3LSCA 2J62A 2OZ8A 1IIGA 3UWEA 2DSKA 3LENA 1TV3A 1FWEC 3UI4A 4AIEA 3B0PA 3STPA 2PAJA 1V79A 3UJEA 4J3SA 1A3XA 1SO5A 1ZZMA 1NY1A 5HWMA 3N6JA 4LVAA 4GFSA 5G2WA 1Y7VA 1JYVA 3W7JA 3EPMA 3MMWA 1Q6CA 4ORIA 4S23A 2F6UA 2ZR4A 4OZOA 4WDWA 1QPLA 1IZJA 5TNVA 3FJNA 1W1IE 4E2DA 3OEXA 4GA8A 3KE0A 4GYKA 1J01A 1G6CA 2AL2B 3FYOA 3NQ7A 2C15A 2WJFA 4I9JA 1ZQ5A 3DIPA 1JIBA 3WF1A 1JYNA 5C9RA 4G7EA 4DJED 1VQTA 3GVRA 3DFHA 4AZ5A 4IMAA 2ISSA 1QTWA 1CGVA 4QIUA 1DXIA 1W1ZA 1Z3NA 3QPZA 3O5GA 3RDKA 2VJXA 2VYOA 3JR2A 2QJNA 3K46A 1MXSA 3DHDA 2X1SA 1ISVA 1JVNA 2E09A 3VDGA 4S2BA 3P8IA 5HMFA 5CPMA 5DBUA 3OZPA 1XIEA 1XW8A 1XCWA 3VDCA 2R9RA 4J3ZA 3IK8A 3UBPC 1E3XA 1CXEA 1BL4A 4LQ1A 3OVPA 4GWEA 3VD9A 2E7FA 4XK2A 2WZMA 1B3YA 2L2SA 6REQA 5JMUA 2PDXA 5IBXC 1OCQA 1F6PA 4Z1CA 1E5NA 5KETA 3CIVA 4XKYB 2PBCA 1UBSA 3G1SA 5KZDA 3OW1A 4XSMA 1KWGA 5A5WA 4QRNA 3NQVA 3ITGA 3WBWA 1Z32X 1ICSA 3S2JA 4PBGA 3G5EA 3BTNA 3GXNA 4DY1A 4XIMA 1ALDA 4KRUA 4EXAA 3M5YA 3IIPA 2QDGA 1Q6IA 3FKRA 3QJAA 1A5MC 5LNVA 4D9PA 1VFOA 3EMZA 4HHMA 2DY3A 2Z2AA 1JUEA 2WWCA 1SGJA 3OQ8A 1Y5WA 2ISFA 1BQCA 4HQVA 1UUQA 4M7SA 3QC0A 3TCEA 1Z6KA 4M1RA 3UETA 2HPMA 4MWAA 4NYYA 1QW9A 1KRBC 5D2TA 1KR1A 1Q6GA 5F2LA 3KDOA 4RDVA 5FEPA 3WFLA 5I5RA 1AZ2A 3U4FA 1S1RA 3VCCA 2GGIA 4M29A 4PTNA 1GVQA 1K4GA 1T8QA 3W7MA 2VELA 4EAYA 5F2MA 1XIIA 3O6YX 4XAFA 4KGLA 1E9YB 1YATA 1NIUA 2HNHA 1XDMA 3G1YA 3ZLFA 2CLOA 3IAPA 3RIKA 3VZYA 5MHBA 1WB0A 2V3EA 1I1WA 1PWMA 1LT7A 2XPBA 2VRQA 5DY3A 2VX5A 3GDBA 4DZAA 3TYUA 3GTIA 5LKYA 2QCCA 4C6LA 2CESA 3TC6A 3UG5A 4DYKA 3QZ6A 4IQJA 2OOFA 4H8NA 1DJZA 1IXPA 1DP0A 3W70A 4L9YA 1B90A 3TJXA 1UP2A 3PAJA 3LEPA 1LL4A 3ANUA 4MJ4A 1FWGC 5CEWA 2VC5A 5EMYA 3WLOA 2HZGA 4KFNA 3DYOA 3QBUA 2PWUA 4WJ8A 4MWAD 5FL1A 5CGMA 5TAOA 2C18A 3LHUA 3SSJA 4Q4QA 4OV9A 3URBA 1EX5A 3DENA 2PWHA 4IIHA 1G4PA 1XSIA 1NWTA 4GKTA 1PDYA 2QXWA 3NQGA 2CHRA 3GHSA 1WP6A 5KITA 3L0KA 4JTQA 1I6NA 1JD9A 2Y8KA 4Q6JA 5GNZA 4NJJA 3O5IA 3GYEA 1L6WA 1UHVA 4HZ7A 1ZBVA 1UJQA 2V69A 2Z4GA 5K3VA 3Q37A 4W8AA 3FN9A 3UWWA 3LI1A 2EKCA 3A3HA 2VOTA 1VBRA 4E4PA 3GPKA 3ONCA 3LCFA 3M0HA 2GJPA 5T26A 1OT2A 3EB4A 3WH8A 1XXXA 4AEEA 1WOBA 2BP1A 3RR1A 4L64A 5AFDA 4FOKA 4LBUA 4DYJA 1FCBA 2DZVA 4QDMA 4IIGA 2OEJA 4PTXA 3ITYA 3IV8A 5A6AA 2OR2A 3CZKA 2X7WA 3SN1A 2C91A 5FEXA 4PMOA 3KAFA 2CBVA 1NOFA 1JPMA 1ITCA 2TMDA 1ODUA 3RLGA 2OKOA 2ZC8A 3ABSA 1VGAA 2PGWA 3R8RA 1ONEA 3GTHA 4BJHA 1RH9A 1EXPA 3GC4A 3UNTA 1JAKA 4ASTA 2J8FA 5JIPA 4G50A 3P67A 4UTLA 1MDRA 3CTTA 1W9BM 2CKSA 3F1QA 3KABA 1EJVC 1Q7QA 1K8CA 4UR8A 4JTIA 3P81A 1UA3A 1SZGA 3SEPA 3C86A 3TQPA 3U2CA 1MFVA 1WZLA 3F5KA 2GVLA 4RPQA 2XP9A 1G4TA 4TYOA 1GKQA 2XH2A 1XC6A 1NP0A 2HCVA 3C2FA 3BMWA 3M6YA 2OWCA 1XGZA 5EPDA 3A23A 3KVKA 5HMEA 4MWAB 5I00A 2E5BA 4ZB5A 4PTMA 4Q4PA 4S3DA 4AVFA 4GJJA 3MSRA 4S3BA 1I2OA 2QJMA 3E0VA 3EPOA 3SFWA 2QVNA 2ZIDA 3BSGA 2Y88A 3B8WA 3OB8A 2XSBA 4FN2A 3SSZA 1NQKA 4Q8OA 3R2GA 3SQMA 1J2WA 4IMGA 3HU7A 1JPHA 1MW3A 4QJ3B 2AWGA 1W5OA 3EA1A 3LBCA 4EOUA 1MI3A 3LCWA 4IJCA 4JQ2A 5BCAA 3T0AA 2JE8A 3L2IA 3IARA 3GWQA 3VDHA 4MKVA 4WKAA 2X30A 1BPLB 4CD5A 1D7FA 4PN2A 1TIMA 3OYXA 1RQBA 2QUTA 3P7YA 3SY5A 3GKFA 4X2RA 2RJHA 4Q7NA 3TC5A 1QMLA 4LAVA 2XYLA 4RDYA 4RKAA 4H3DA 2E6DA 3BG9A 2OO6A 4BS0A 2PTDA 2ZE0A 3CEUA 4JOMA 3THAA 4LUSA 1KFCA 3W7DA 2YYUA 1AZ1A 2FFCA 2W62A 1O94A 2SFPA 3UF8A 3PPHA 3REQA 1KBLA 4TW8A 4DWSC 3N4EA 3KVMA 3CXOA 1TFVA 5F4SA 2WMFA 2Y70A 4RZ5A 1KB3A 3RMJA 4C7FA 2ZXQA 2PDQA 3TLLA 3PUEA 3AIUA 4AHQA 7A3HA 1J0ZA 1W5QA 3M0IA 1C7SA 4AH7A 3ONBA 4GQBA 3QMTA 2VXNA 1EYWA 1V8EA 2A1YA 3VIJA 1XIHA 3MA8A 2QPXA 2JBMA 3HGRA 4IIFA 1T0OA 1KKRA 4FHAA 3W07A 5CJNA 2FDMA 3LHWA 2QIIA 3N9KA 4DXVA 2G0WA 3GD6A 2XP5A 4LUJA 3WLQA 4K2SA 4JFWA 3LMZA 3NPWA 1EXBA 4XAYA 4AWTA 1BVNP 2ZZ6A 4HN8A 1R86A 3GUWA 3P74A 4C02B 2RDUA 5SWUA 3CQKA 3UA3A 4QNEA 4XISA 1GG1A 2XN1A 3OHIA 1K9TA 4NHVA 2BDQA 2DV0A 3PY2A 1TZZA 4YCPA 3N34A 8A3HA 3ES7A 3IGSA 3ZM8A 5I77A 3MI2A 4S1FA 1EHNA 4Z2IA 1CIUA 1XIGA 1FHVA 1GQJA 2Z1XA 1ME7A 5I24A 1LLZA 4CEUC 4F3HA 3T4CA 1YXCA 4H04A 1KM3A 3HTWA 1E0XA 3H2NA 3I3DA 4HMCA 4HBEA 3VXGA 4UOQA 4HNUA 5HANA 2W63A 3WL1A 1ITUA 1XYLA 3MWCA 2OLSA 2WO5A 1T11A 4B5UA 3ZR4A 3P93A 2OX4A 4GOAA 2AQWA 1CWYA 4M5PA 3G24A 5HR6A 4IPIA 1YEYA 2JKEA 3M46A 2X0YA 1HJUA 3TR2A 5G2IA 4TVUA 3DFTA 1YW1A 1A3WA 3FJ6A 1CLXA 3VIFA 1XINA 4HIBA 3CUHA 2BMBA 4BCEA 2HVMA 3AYSA 3VOFA 1UKOA 3TDFA 2ZFAA 3O06A 3UR8A 1NSGA 1SZRA 1CENA 1Q85A 1RR2A 1CPUA 3M0XA 2WCSA 3TTEA 4RZBA 1HGYA 3TQ0A 4R7WA 2XH4A 3LSBA 3MSGA 2BY0A 4MNKA 2W5FA 4Z0SA 1W1PA 2NXGA 4D8AA 2HPIA 2ZTKA 3VD5A 4Q8MA 2QT3A 1LQ0A 8XIMA 4MWAE 4ZOAA 3I10A 2BY2A 1JZ3A 4N9BA 1FKFA 2C7FA 4W8LA 3CZLA 1E6QM 4EF8A 4GIAA 4NAFB 4H6QA 1HP4A 2C6QA 2OT1A 2CLFA 2Y4SA 1N7KA 2ACSA 4K8HA 1EHAA 1NJJA 3T4WA 1U30A 2P88A 1ODZA 1VENA 4AHOA 5DMMA 4F8XA 4RK8A 4UR9A 2YA0A 3AISA 5H8UA 1QWKA 3TOYA 3LHTA 3EAUA 4PUKA 5F4XA 4O11A 1A80A 4YHEA 5C0QA 4J35A 4UFKA 2FZBA 2YLLA 2F21A 3FS2A 1JZ4A 5ABHA 5HQLA 3EY6A 2PTWA 4N2YA 4H9TA 2VWTA 4B4FA 2J8GA 5C2CA 1GOWA 2QCDB 1Q6EA 5LHEA 4MDOA 4M0XA 1WKYA 4PEKA 4JNZA 3QY6A 2ZTJA 3P3BA 4DF0A 3QTPA 4GYFA 1FXPA 3C0SA 5DCBA 3APGA 1XLIA 1KCLA 3B8TA 1W3LA 2CKRA 4JHMA 1B6CA 4RV3A 2XP4A 1E4LA 2OZ3A 1OT1A 4DAFA 3ZLGA 1C92A 5DF0A 3QC3A 1QBBA 2DH2A 4IG2A 4PL1A 3PUOA 3R0KA 4MY1A 2QLYA 3K8KA 4QEEA 2R1PA 2PC8A 3ZXWA 4ODQA 2PTYA 3A24A 5CXPA 2PDJA 3OLIA 3GTXA 2IPGA 2HWGA 1FWHC 2JKAA 1W9UA 4JFVA 4RNJA 1S2UA 3NL5A 1BKFA 4H2CA 4K8EA 1TUFA 1D2KA 4IGSA 1KT1A 1S46A 3M4HA 1OC6A 4RE0A 1D9EA 3NUKA 1ZBWA 2Z2BA 1YXDA 4F4RA 7ENLA 4EE9A 1VEMA 4JS3A 1O68A 2WAGA 3LTPA 3WJWA 2MANA 3WMSA 1V3KA 1O4UA 4G8TA 3TR9A 3CGNA 2WBGA 1E0WA 1E6SM 1O5RA 5FIPA 3VNJA 2PCQA 2R6OA 1DHPA 1RVKA 1FWCC 1XR2A 4JEJA 4J4NA 3L0NA 3AJ7A 3WX7A 5CGTA 2O9OA 5DCDA 2YX0A 2MUCA 1V6XA 3WMBA 4GO9A 1AH0A 2GDQA 1A5AA 1S2AA 1XD1A 4KWOA 5EBUA 5C55A 4DRPA 3UXIA 4CQ9A 4NU7A 5LXXA 5GQBA 2O7QA 1R47A 3KTSA 3W87A 3LPOA 1WDPA 3GXMA 3C0JA 1UOZA 4IXXA 4QTGA 4E2VA 2NV2A 5M5DA 1DTNA 3SJ3A 1F3TA 4ZCWA 3GNOA 4JTDA 2O9RA 4N19A 1HKVA 5DBTA 3KHJA 1H7NA 1V02E 4QQ3A 5DELA 2A3EA 4BF9A 1KD0A 3VM7A 1K7FA 3DU0A 3ARUA 1WZKA 4WX2A 3UCQA 2XFYA 3RAOA 3HM7A 8RUCA 1KFJA 5BRQA 2F38A 1FWAC 1VH7A 5H91A 1XPGA 3M0ZA 4M6QA 5A3HA 1HZYA 3TH6A 1KCZA 1HL9A 1OX6A 2YDRA 4FNQA 1FH7A 2DZSA 3SBFA 3N11A 1J6OA 3FW6A 2QJGA 3T8QA 4H7CA 4P8XA 1F74A 1MW0A 3FYPA 1WDWA 4NXSA 4R88A 1F07A 3O5PA 3K4AA 1PE1A 4JFIA 2RSEA 2WSKA 3W7QA 1XC4A 1Z69A 4REQB 2OPJA 3GNPA 2I5QA 2W91A 5EB8A 3TSDA 4E8DA 3FVMA 4H19A 1IZKA 1W8SA 4J27A 4FP1A 1QBAA 3URNA 3VVGA 4NX0A 1PTGA 1RPXA 1TV5A 1WDSA 1TYGA 3BGGA 4LYKA 1XPYA 3HF3A 4JQAA 3GHRA 5D2VA 3WK0A 3KL3A 4GBDA 3S5YA 2WMKA 1RZMA 3SM0A 1JUKA 4X9YA 4Y7EA 2ZX6A 3VIOA 5CPSA 5BWFA 1CXIA 3FHQA 3W7OA 3QR3A 3CHFA 3I4KA 1A4LA 3VIGA 4K39A 1GEQA 5HTGA 1GVOA 4LS1A 3BV7A 3T08A 3GM8A 3F7JA 3G2GA 3V36A 4LUTB 3PN8A 4FNSA 2A85A 4HCHA 3G0XA 5AHNA 3V7PA 2FHBA 3THQA 3LCIA 4HU0A 1K03A 4O1AA 4DBDA 2NQ9A 3UU0A 4LAOA 3TX9A 2Z1VA 3FHAA 1RQEA 2UZ9A 3EWYA 4L6OA 3HJZA 1HO1A 3CAWA 2I57A 2ZUWA 3KOYA 4JFSA 3NOYA 1OX4A 6TAAA 1TZ9A 7XIMA 2PMQA 3PJUA 4FK9A 4GH3A 1YMYA 3WLJA 2DG4A 1IEWA 1YADA 4G1NA 2PB1A 2PDIA 2V8ZA 4UCGA 2BV9A 1GVEA 5FKYA 3HIJA 4KFOA 3W28A 1UKQA 4B92A 1PTAA 4S3KA 4JTUA 4AF0A 4B5TA 1RALA 2ZVIA 4QG9A 4RCXA 4AD2A 1XLHA 2QDHA 3VFLA 3T07A 5D04C 4LVBA 3PK7A 1YYAA 1CGTA 5M3WA 1F61A 2FTYA 2FZDA 4RLIA 2PDNA 3GR8A 1YPFA 3SZ8A 3U0HA 3GLCA 1JNDA 1IWAA 4ZXOA 1PWLA 1GKPA 4M56A 3NPXA 2WNZA 1CYGA 2FH8A 2WCGA 2OCZA 4Q8TA 1QRQA 4W88A 1J8VA 1E0UA 2XPAA 2QDDA 1LUCA 4PGLA 4J4OA 3LHZA 4HARA 1VFTA 3KCLA 1PX8A 4QS6A 1KBBA 3B3DA 5F1UA 4C6BA 5CPQA 5FJPA 2XINA 4OIFA 6ALDA 1BWVA 4GBUA 5LIWX 4I6KA 4XTIA 1PXGA 2IKGA 4MZYA 3VKBA 3AUOA 3MV11 4FNUA 3UG4A 4AD1A 4P8VA 1DYSA 2B7OA 1U83A 3PFRA 3FA3A 1L6YA 1E6PA 2P53A 4U28A 4NJIA 1EJTC 4UQDA 5DXYA 4UTUA 1UZ4A 2X05A 4V28A 3E6EA 4LC8A 1JCJA 3NURA 4PRTA 1OFQA 5AN7A 4HN4A 2WPGA 4FIQA 1W32A 4S3CA 1MRQA 2OMAA 4GVFA 3EWUA 3QN3A 1HJVA 3WF2A 4JTCA 2FGLA 4EWJA 3MDYB 3GC2A 1KC7A 9XIAA 1DIEA 1H7XA 4WDTA 3R4IA 3B0YA 4OFCA 1XBZA 3NVTA 4NI3A 3MSDA 4GVHA 2X1TA 3A47A 2V0TA 3H54A 1I60A 2DT3A 3PRDA 3G1VA 4N0RA 4H8HA 2V5DA 1W3HA 3CC1A 1D7IA 2DDXA 3AIWA 4GI9A 3MQTA 3UJ2A 4WDXA 4NNCA 3W7IA 2Y7DA 2EJ1A 3S1VA 1UH4A 3QF0A 2E9BA 1KRCC 3VCRA 4P61A 2ACUA 1PIIA 2Y1HA 1E5JA 3PNZA 1HT6A 1M68A 4GYPA 4Q3MA 1AJ0A 5BXRA 3M7SA 5EU9A 4NUWA 2ZRYA 1M3UA 1PZ2A 2NX9A 3TAKA 3ARQA 1EJXC 2XIMA 4P7QA 2ZC1A 4BQ5A 4E3VA 4KIEA 5BW6A 4FALA 3GHTA 1BF6A 1DIKA 5AY7A 2PPPA 2QKFA 2QR6A 1D3GA 3WBYA 3ZSSA 2WZEA 4YVVA 3TAOA 1QPFA 3S9ZA 4C6DA 1YW5A 4Y8FA 4U3AA 1R85A 2CZVA 5E0KA 2I5GA 5AC6A 2E5CA 5LNRA 4PMRA 2Y78A 1F6YA 4NI8A 5CSUA 5GJMA 3LG3A 4X0NA 3P60A 1F4HA 1EIBA 2ZYFA 2ZX9A 1S5NA 3W3OA 1QNRA 5E09A 2C1GA 1Q6LA 4JFUA 3W01A 2FZNA 3MV01 1OC7A 4V1YA 1AD1A 1NEYA 1H41A 4OECA 5GPGA 1H5YA 3ARSA 1JVWA 2ZXAA 4FZIA 4JX6A 2OX1A 5EMLA 4WK9A 3VNDA 4AZGA 3MP3A 1PZ0A 2ZZ2A 3CZ8A 5A6JA 3UR7A 3RJXA 4TTGA 2JZVA 3VUPA 4CU7A 1FWSA 4PULA 3LNMA 5AC5A 3ARYA 2J77A 3ARTA 4QT3A 1E15A 2BS9A 3ZMRA 4ZE4A 1GZGA 3ABQA 3VIKA 4D6EA 3OJGA 2XM2A 1SFTA 1CXFA 1J2BA 2PGRA 5AYBA 2DT2A 5HOSA 3ES8A 3O7UA 3VGGA 1L8NA 3E38A 4LEQA 4MFDA 4JTAA 3M64A 4M51A 3MMTA 2QHAA 1VFLA 4GH1A 4JAWA 4W5ZA 5B80A 3CHEA 3I4EA 4DWSA 1TUXA 3BOFA 3NQCA 4HA4A 3C2EA 1US3A 3WK2A 3FDKA 3JW7A 1BXBA 2RGLA 3MB9A 4ZB0A 1S5VA 3IIZA 4I9TA 4Y2WA 3W1LA 4ZL1A 1J12A 1KRMA 3NZQA 3TMQA 1K77A 2Q8ZA 5A8QA 2DJLA 1QASA 4JHOA 5CBIA 3S5OA 5TD4A 5C7VA 3U6WA 3UPBA 1W2PA 2CZEA 1WNOA 2XGBA 4JHZA 3AMKA 2ZR6A 1ICPA 2V82A 3ITCA 1TRIA 1UW9A 3ZT7A 3K1DA 2PV1A 4ENLA 3NR0A 2PZNA 3QV6A 2BZNA 3PPCA 4MVAA 3WQ6A 1MDLA 1BXCA 4TUFA 3EBVA 5REQB 3L2MA 3EZ4A 1JXJA 3FGCB 2IKIA 1FFRA 2AL2A 1BVZA 1P0EA 1ITQA 4FAPA 1P7TB 4LSBA 5G2HA 4DJDC 1PBKA 1CW2A 3TYZA 1WQ5A 4RZ4A 3ARRA 5G4WA 3TJ4A 4W9OA 2QGYA 3E0WA 1V93A 3OIXA 3PUDA 2RUDA 3FY1A 4DO4A 4IX0A 1Q6DA 3O07A 1FDYA 2MLXA 2EPLX 2PP3A 5TF0A 5E5CA 2A79A 2TODA 3T42A 3QEZA 5I3JA 3B9DA 2Q02A 3PG8A 1JI1A 4DLFA 1GVFA 4JL1A 3QOKA 2V67A 2INFA 5EFFA 3WJZA 1KFLA 2YZRA 4ZO7A 3WUGA 1EOKA 4HU8A 3TTSA 1EX1A 1GTEA 1NH6A 4UNLA 4UTWA 2J6XA 4E4UA 2F8QA 1FAPA 3BXWA 5FEZA 3LRKA 4NJKA 2C13A 5T8GA 3WQOA 1YDYA 2WK2A 2VEMA 4YN5A 1CXHA 1JZ5A 1UASA 4P7LA 1TV4A 1D3HA 2ZWZA 4EACA 1QNSA 1K8ZA 3GNXA 3TZNA 3CIXA 1R2TA 3L4VA 4NZCA 2BODX 3GS6A 1ME9A 5CZJA 1RK6A 4UQBA 1W1YA 2JEQA 4O50A 2Y5JA 5K4ZA 4H6EA 1SJDA 2VEIA 1LROA 3WK1A 2F61A 4DVOA 1XRSA 4K7VA 4LYQA 4LBSA 3CGTA 1OYCA 4FOUA 4Q8WA 2C0AA 2CBUA 3AFBA 4H2HA 4L1WA 2Y2WA 1HL8A 1XGDA 1GVSA 3C61A 2DW6A 3VINA 1TKKA 1B3WA 3DKJA 3GU2A 5LA2A 4L80A 4MGVA 3CZEA 3WEZA 4ODLA 1RCOB 1MNSA 1PIFA 1KGXA 3K2GA 4FNRA 3LXBA 3C6CA 1TSIA 3AO0A 3GKAA 3L5AA 3S2MA 3VCNA 3WD2A 5TIMA 3LCGA 4JEQA 1IE7C 4UDMA 1IIHA 1KA9F 3OYZA 4UR7A 3S5ZA 1LM1A 5DY2A 3CEPA 4NRRA 2NT1A 5HWJA 4D6CA 4J1OA 1VYSX 4O54A 4UQCA 4B5SA 3MKCA 1A5KC 3ECQA 1XQLA 5ECVA 1CB2A 4NQ1A 2BVWA 3H2EA 3NI6A 2X0SA 3QRHA 4K8GA 3SRDA 2XDFA 4TR9A 1OYBA 3PWAA 3N1AA 3AS1A 1I9CB 1V6UA 2KE0A 2VO5A 3B4UA 1I45A 1UP0A 4NYUA 1ZP3A 1XP3A 1KFBA 3HPXA 2VZSA 4E0CA 4DO7A 2HEJA 2REQB 3UPMA 4Z2JA 2BBFA 1C9DA 1PJ9A 2XN0A 4LCSA 3I6EA 3MWAA 1VB9A 3EKGA 3NIYA 5HK4A 3GTYX 1GPWA 2J25A 4HPGA 4ROQA 1DIOA 4YVXA 1A7XA 2WJZA 3UJSA 5AHEA 1PSCA 4FNPA 4UNIA 3AIVA 2H3DA 4ZQRA 2HE5A 1GOKA 3W71A 1O7AA 1RLDA 2J8TA 4BZYA 1GOXA 1V3MA 4C6CA 4ORMA 2D0HA 2Q09A 2OWXA 1RVGA 2FGBA 3AMGA 4KQNA 2GJLA 2H90A 2CCRA 1GWJA 1MO0A 4C7GA 4LWWA 1OZQA 3IJ8A 1R38A 3WLRA 4JIRA 3QSRA 3QKEA 1KTNA 3IJDA 1ADSA 5DRIA 3U5UA 3WG6A 4HA1A 3VIHA 4WJXA 4JNYA 1EDQA 5JXQA 2R1LA 1B54A 3L65A 3B04A 3KAOA 4FLQA 2PWEA 1EGZA 1KFWA 4DJDD 2W61A 2F6KA 4FEZA 1UJPA 1ZBCA 3VC5A 2X16A 2DH3A 1UC4A 4I6VA 3BLOA 4JX5A 1XS2A 1ECQA 3HGJA 4C90A 3L4TA 3UT0A 1Y0OA 3NL2A 3TA9A 3N73A 4QGCA 2UZ5A 4U10A 4HNVA 2IPFA 4X60A 2DT0A 3TYAA 5AYZA 2WQPA 4B4HA 3RHGA 4F9JA 1PHWA 3QY7A 3NWRA 4LPCA 4R27A 3WQWA 2XISA 4GCXA 1M53A 3L0GA 3H9RB 2PURA 3RF9A 2QUUA 1H1YA 3CZJA 1EP3A 1YTDA 5D9MA 4GINA 4GK8A 4WGXA 1QW8A 1GOOA 4ZB2A 1K02A 1TTPA 2D3NA 4YTQA 1WKFA 2XG9A 2WMIA 2XVKA 3SUTA 3CO4A 2J75A 3N13A 5HATA 3NRKA 3VGFA 4DRMA 4ICMA 4R53A 4XG1A 1Q6QA 2B4GA 1TJ0A 2Q3RA 3BLFA 2GYIA 2FAPA 2WKLA 3ARVA 3N6HA 3DFPA 4FR6A 3H4GA 1WAUA 3FFSA 2OYKA 4Q4RA 2WC4A 4CUCA 3O5LA 3CZGA 2HK0A 2Y24A 3LCHA 4QG8A 4CCCA 3OZOA 1AL7A 2O55A 3ARWA 3EYPA 1FHLA 1HNYA 3LGEA 1X39A 4C6NA 4ZPVR 2VEGA 2WC3A 2IXVA 2K8IA 3OBEA 2J9ZA 1UR0A 1H7WA 2VZTA 3MCOA 2ZDRA 2A3AA 2JGYA 2D9FA 3QHMA 1IR1A 5HINA 1KV5A 3SIZA 4XB3A 5IDIA 1WKDA 4IMDA 2D3LA 5U7SA 2EG8A 3O5FA 1PINA 4G9PA 1OADA 2XGZA 4GUHA 1T96A 1V3IA 3LV5A 4BY3A 3F5LA 1OEPA 3FX4A 4RUBA 2CHOA 3DN5A 2YBTA 3USZA 3D3AA 4GZJA 1IX5A 1EWDA 1W3JA 2XIIA 1OFOA 4W85A 3R0UA 1R6WA 1B57A 2GGHA 1EA9C 3ALFA 1T6MA 3C2YA 3WIJA 3LK6A 4NKCA 3W6LA 3ZJ7A 1NDYA 3LLDA 4J2PA 2OKTA 1TPVA 3OA3A 3G77A 1Z42A 4XZ9A 2PWFA 2XSAA 1OSEA 2OZ0A 1CLVA 5G5IA 1KM4A 4V27A 4ADUA 1KT0A 2JFEX 5FJRA 3DERA 2PA6A 4MGGA 2XHYA 2G3JA 1FKDA 4RJEA 3RLHA 1UZ1A 1S3TC 3RNDA 2D2JA 3MKKA 5IBXA 1V6YA 4F66A 4BWLC 4OU1A 2QULA 2W6RA 3RRXA 1RY8A 4R9OA 1PS9A 1GVIA 1R46A 4GHRA 1EBGA 2NWSA 1A5BA 1BD0A 2EBNA 5HUAA 4R34A 5CC3A 4JIQA 4PCTA 4WXZA 2UWFA 1TCOC 2HS6A 4ZQOA 2Y61A 3RCYA 3MUCA 1WO2A 2PBOA 2AAAA 3BZGA 5HNRA 1JZ2A 2WZTA 2R1NA 1E72M 3MYPA 4MWAC 3P84A 4HPXA 1Q45A 1TCMA 1K4HA 3GDMA 1HTIA 2V5KA 3GRIA 3W2LA 4XZLX 3GG1A 5A6BA 1R5YA 3TVAA 2OYMA 4O17A 4ZOBA 1S5MA 3IJQA 2JALA 2R8WA 1QPOA 4DZHA 2WCAA 3W1AA 3PS7A 4FIRA 3CGMA 8XIAA 2EPNA 3T44A 5A94A 1LQ2A 1EC8A 2IQ0A 2XIQA 3WH7A 3D5HA 4HNLA 4W87A 2BVTA 2CBIA 4H01A 3QGAC 4IUOA 4N9EA 1M6JA 1WXZA 3EDKA 4M81A 1WZMA 1R0MA 4PZVA 3CMFA 4AU0A 1V3JA 2EPMX 3WDQA 2BGNE 2W4XA 1HXJA 2A3LA 4LUSB 4B90A 3P0XA 4CQAA 2NXIA 1IEIA 3PG9A 4AVNA 1QNVA 4KWSA 4C5YA 4G56A 3BMVA 3OLGA 4Z1AA 1E1EA 4U33A 4UTKA 4DRJA 4GNKB 1R2RA 1F6KA 1JR1A 2ZWYA 4S3EA 1NOWA 4DZ5A 1GONA 4J3UA 2FYMA 4ZPTR 3HG3A 2F2KA 4H4IA 3GBDA 3AS2A 1DWHM 1P6BA 3UXKA 1AMYA 3PPGA 2Y85A 1QNOA 1O1HA 2UY5A 3WQVA 2VKZG 3ZIZA 1SSDA 3AIRA 2VQTA 3U2EA 4I7VA 1V0KA 3KL0A 3H4XA 1HJWA 2HVNA 1MXDA 1YNQA 3NZGA 3DOPA 4ADTA 3BANA 2EO7A 3QHNA 2CLPA 4CN6A 4RNHA 4XV0A 4O13A 1JFXA 1VLWA 1G4EA 3EX4A 4NVTA 5C70A 1W54A 1CTNA 3LS9A 4ZVJA 3D0CA 3GYCA 2QDEA 1BEUA 1W26A 2HMCA 5CLTA 3O9NA 4UIOA 2WSPA 4MJZA 1MZRA 4U31A 3TFCA 2ZX7A 3MCNA 2RJGA 3CM4A 1K6AA 5FF7A 2F84A 4LAZA 2Y7GA 3BJFA 1GGOA 2AMXA 3UGRA 1AVAA 1EOMA 3QPEA 1OK4A 4ZPWR 3IK4A 3WLKX 3XIMA 3R10A 5D2XA 4Z42C 2WHKA 1B2YA 3APYA 5D9PA 4K37A 2GVEA 4AISA 1DE6A 3SQSA 1U5HA 1P6WA 4C1LA 5KMYA 1P0BA 1QOXA 4ZXLA 5C9UA 1XG3A 2WV8A 2NV9A 1DJYA 5LXEA 2NLIA 3GTFA 2CLIA 3WEOA 2J6VA 2G41A 3P14A 1TWDA 1EEPA 1FP8A 2L5HA 4GVGA 5D9OA 1TPEA 2DVTA 4DF1A 1ZS2A 4NNBA 3W7RA 4FX7A 4NAEB 2VWSA 3LRMA 3WNMA 4NY2A 1ONWA 5D03A 3R1ZA 2MLYA 3PZ9A 2HTMA 3KFTA 2GQ3A 3CLMA 2J78A 3QY8A 2XIJA 1J0YA 1JPKA 1CGYA 4UTHA 3B97A 1R30A 3PZTA 3STCA 5C2GA 5KZEA 4D6DA 2V68A 3TU9A 3OBKA 1NWRA 2IMRA 1NF0A 2YW4A 5DXXA 2XU2A 1GT8A 1FKKA 2QUVA 4XKMA 3MC5A 1BGGA 1FWJC 3UI5A 3KP0A 3ITTA 2PLMA 3IJ9A 5F7UA 3T6CA 5BXPA 1FUYA 4FXFA 4US6A 3UJFA 4JDBA 3BJTA 3REQB 2JF7A 4NRSA 4A8LA 1P6CA 5FACA 1KM0A 3ALGA 1M41A 3O5QA 4Q22A 5BU9A 3N9RA 3NO3A 1IEXA 3R0DA 3WQCA 1MSSA 3EOLA 3N9SA 2J7BA 2QW5A 3VK5A 3PUGA 4F0RA 3WQFA 3IIXA 3G1HA 1OCBA 1LG2A 3MUY1 4PB3A 3CV2A 2ZUVA 4JIEA 4O4VA 2J7HA 2O9PA 4H9ZA 2BGQA 5HULA 3UG8A 3A6OA 3VGDA 3C8FA 3I65A 1VD6A 1JD7A 3KBMA 5FJIA 3TP4A 2DIKA 1QHZA 1PDZA 1VJIA 3UNDA 4YS1A 2QPSA 5E9XA 1ZRQA 3H24A 3GZ3A 1FCQA 3E2SA 1QATA 1NMVA 4ICNA 1OM0A 4ZE5A 3DBNA 1TJ1A 3IVTA 2HXUA 2IQDA 3NNTA 1OGBA 2E6FA 4HOZA 4PCNA 3OTRA 3DAQA 1DIDA 5D33A 1K70A 3DFYA 1AQFA 2ADAA 2WM0A 4AW7A 4DZ2A 1EA0A 3T2PA 3BCFA 1DEDA 5JQ9A 3SCVA 2O92A 1FWFC 1X38A 2INEA 2PLKA 1PKNA 1F8MA 4A22A 1QDSA 3QGVA 4F2TA 1PBGA 1RJPA 3UZZA 2DG9A 3GVQA 5MKGA 2RKXA 2BVYA 5BMWA 4QEHA 3WLHA 1DWAM 1VPYA 3IVUA 3LHYA 1HX0A 2YBVA 2VCCA 1O5XA 2I9EA 3CH9A 2XVGA 3U2ZA 2D1ZA 5CQ1A 3AIQA 4DPPA 3CB8A 1XIMA 4O18A 1EF2A 1MQPA 3LLXA 4JTHA 4I5UA 3CAQA 1WYIA 1VKFA 1VBGA 3LLFA 3WNOA 4XSLA 1R2SA 1IV8A 2DT1A 3WH9A 1KO0A 1POJA 4UFMA 4FXRA 1VFSA 3VKCA 3C4UA 2PDPA 1I0DA 5E70A 5CZKA 1D7KA 1XRTA 4GYJA 3LXCA 3TMLA 4PMNA 5JH2A 1UB3A 3M43A 1OIFA 2QCDA 1JCXA 2WWDA 4CD4A 3WLTA 3PBYA 3O3RA 2V3FA 2LJ4A 3JYJA 3H22A 3LB0A 3E0IA 1SU5A 1QCWA 2EKGA 4E4FA 4GIYA 1YNPA 3UA4A 3WZ0E 3B0UX 3M41A 4ODMA 4LALA 1DKWA 3T0DA 3E5PA 3PB0A 4DZIA 2QJJA 1JQVA 4PH6A 3NSMA 2XWEA 3NQAA 4GXWA 1FH9A 4XZHA 5D32A 4IX2A 3NTYA 3R6IA 2QAPA 3NM3A 4ZS6A 1DQUA 4C6QA 4IG2B 1J6YA 1W17A 4TX8A 2F2HA 4G5DA 1K9DA 2WVSA 3EEGA 2C1HA 4B2DD 5J5RA 2VEKA 3BLKA 4DM2A 4IPNB 3W75A 2Y5SA 1QI4A 3UF9A 4GKLA 3E49A 3VC6A 1QO5A 2PPGA 5K4XA 1IZCA 3TN6A 4WF7A 2ZKMX 5EMUA 2I5IA 3QGKC 3T0TA 2ZXBA 4GI6A 2TYSA 3L4UA 1HXVA 5LHFA 2DUAA 2WHLA 4L61A 1ZGDA 3P6LA 3SCQA 5A8OA 2WVUA 1B0IA 4BR1A 2BG5A 1UBPC 3BVJA 3W4RA 1JGIA 2QCNA 1IEVA 3FVDA 1UQYA 2OLHA 1IT0A 1W5PA 1QPQA 1ZCCA 3W1XA 3EX3A 1CZ1A 1UD8A 1K6WA 3CUIA 4TX0A 5FA5A 1KV8A 7ODCA 1RUSA 4XAKA 5EMKA 3NDZA 5KEZA 2G95A 1C8YA 3BAKA 4NNRA 1XLLA 4M8UA 1JCTA 2QUNA 3FIGA 3GXIA 1Q4WA 4A3UA 3R13A 1RSCA 2RDWA 2FKPA 3W1NA 3T09A 4KRZA 4YNGA 1GKRA 4W9QA 1NARA 4A21A 2NQ5A 3SUUA 2XP6A 2BLEA 2UV8G 2X0HA 4AC1X 2V9DA 3PP7A 3S2LA 2DZAA 3LOTA 3ZJ8A 1XLAA 1I2NA 2G37A 1KM5A 3CMGA 5AC8A 1FWRA 4HGXA 3WQ4A 1BFNA 5HR7A 4JFJA 1AJ2A 2P8BA 2PGFA 2X40A 5G4EA 4BI7A 3VPLA 1W9XA 3PNUA 4E5TA 2CXGA 1A5CA 1XDLA 1V4YA 4J9JA 1WXJA 1Y0EA 3PULA 1TREA 3KRSA 2J79A 4JYDA 3CB3A 4B2DA 4J3WA 5LIKX 4QDPA 2FHCA 2NQHA 4PYSA 3UXLA 1Q3NA 3HJEA 5TQLA 4GISA 5C9WA 3GG0A 4GD0A 2GQ9A 4TMBA 2VOMA 3KLLA 3C0LA 4JKKA 4GRSA 2RAGA 3PR2A 3F4VA 1FWTA 3BQ5A 1FY6A 3V4BA 3BLIA 4B91A 4LUIA 5AHIA 4B9ZA 5CZ0A 3VA8A 2RURA 2CWNA 4Q4OA 3M47A 1QHOA 4IMCA 2VC6A 1EIXA 1TPC1 4UTJA 3LZ5A 4AY7A 4N7QA 4NL1A 2QUMA 2KR7A 1IQ8A 3QFWA 4TVCA 2OQYA 3WH6A 5A6LA 1LZOA 3KADA 4JGDA 4R33A 2BNJA 5HW7A 4J5NA 4PFMA 3EOSA 1J9YA 3AWOA 4RPPA 4RW5A 3FSUA 1U1JA 1X8FA 4L72B 4HBOA 3WYZA 4DRHA 2GJXB 3L9CA 3KZPA 3LQLA 2BHZA 1E6NA 4UUIA 3S9YA 3ICJA 4H00A 3WENA 4ICCX 2EPOA 1H09A 3GB6A 3V0TA 1XCFA 1ZJBA 1ZCNA 3T78A 2B81A 3W88A 3KS6A 3F03K 3PZUA 2ONEA 4ZTYA 3VNLA 4UMAA 1HW6A 3WFAA 4FNTA 2FKEA 1EGVA 5D37A 1ZFJA 4KBXA 2DZBA 1KLYA 1TMLA 3QMSA 5ENLA 3WO8A 5DEZA 4ACYA 3BAWA 2D22A 1ADDA 4WOQA 2BXZA 5K9XA 2BWGA 3BW3A 1BYBA 5CKSA 1B1YA 1QVBA 3H23A 3HO8A 4PTVA 3EMQA 2OSYA 3G1AA 4XVDA 3DHFA 1LJYA 1MYRA 3KP1A 3HV9A 1E1FA 3VAWA 3AALA 2NUWA 1FKTA 3AU6A 1JFHA 3GH7A 2XVLA 3F4WA 3M16A 2I14A 4IM4A 4GG9A 3A9IA 2JGQA 2ZZ5A 1EPXA 1DJWA 2JIEA 4D1JA 2YCIX 2FDSA 3WUBA 1M7JA 4U84A 1ZBKA 1SQ7A 1SZNA 3AMCA 3SURA 2ZQTA 2E9LA 2E4TA 3SRHA 2ZX5A 3IJLA 2WJEA 4N4QA 3NL6A 3BL3A 3KW3A 4H9VA 4LU0A 2ZRZA 4AWEA 2V5LA 1EJSC 3GIYA 3IPWA 5D2WA 1B3XA 3O6DA 3EWXA 1TX0A 4B15A 4R3UA 4IMEA 2VURA 1FKLA 5CSSA 3ITXA 4HK7A 3O5DA 1TTIA 1YX1A 1X97A 1JAEA 1OFRA 4JN6A 3NL3A 1J4RA 4Q8PA 2Z24A 1F7BA 3GNDA 3BAJA 4LY8A 4PFHA 4ES4A 4LAUA 3EDEA 1J18A 1TVLA 2PRLA 3LCXA 3WBAA 3WLPA 1WZAA 2WB5A 3BG5A 2X1IA 4XD3A 6XIAA 1VIWA 2E1DA 1UC5A 5LIYX 1X98A 3E0FA 2ZICA 3KLKA 2ZOXA 3O1NA 1TJPA 1NWUA 2HNEA 2VZVA 1P5BA 4QT2A 1ZJIA 3CYVA 2RDTA 1UWTA 3L67A 4I7WA 1OD8A 4MJMA 4OOUA 1H62A 3WNPA 2VC7A 5I7GA 4ZR8A 4MUZA 5C9ZA 3UERA 3CLWA 3S5NA 1F40A 2PRHA 1TTJA 5CJMA 5DN1A 3W1TA 4LVDA 6A3HA 3AS0A 2WANA 4J3TA 4UXDA 4IPJA 4BI5A 1E70M 4FX6M 3E2QA 1XM3A 2BXYA 2VGFA 4WRHA 3VGBA 5HAOA 2WNQA 5IRPA 4FXSA 1GPFA 5FCZA 5EGRA 3PRAA 3GU9A 2DIJA 1QT1A 4DNHA 1Z8AA 3SCRA 3R94A 2FGZA 4O0KA 1AQMA 3AQUA 4HMDA 2D2OA 3GHUA 1VS1A 4CU6A 4MAVA 2YZ5A 4LB3A 1QW7A 3UZXA 4YYCA 4RDWA 3W1UA 3EIPA 2A7RA 3KOXA 3S6DA 3V0SA 2BY1A 1UYQA 4PMXA 2Y89A 2QCLA 3RO8A 1CCWB 3VOIA 2WKJA 3URAA 1HJSA 4JPGA 1V02A 1NFBA 3FAPA 2DSZA 1YLVA 1BKSA 3IUHA 1ML1A 3F4DA 2YL8A 5F4WA 3FDGA 1N55A 1L6GA 3UR5A 3N17A 2X7VA 3IGHX 5A6SA 4AWSA 1AODA 3MO7A 1QPNA 4DT4A 1ECEA 1LRTA 3TQVA 5ECUA 4AC7C 1WPCA 1T7LA 4DRKA 4YXGA 3E5BA 1IGSA 3IVSA 1S39A 5DT7A 4UQAA 3VZXA 2ZBTA 4EPDC 2A3HA 2C14A 1S38A 2A4AA 3QPYA 1R7AA 5EMJA 1PX3A 4QAIA 1L8PA 3QR1A 1REQB 3OOBA 4GABA 1V0MA 3SCTA 2AKMA 1W5MA 5LGXA 4N9CA 3DYMA 1FKGA 5CBBA 1EO5A 4YPJA 1PCKA 3WELA 4EXBA 1I0BA 1DWFM 1M04A 4CCDA 3CK5A 2CETA 3KACA 4QX4A 3QR0A 1OJXA 2YDQA 3W0KA 3ISIX 1VHCA 3W86A 4ERGA 4CD8A 3PAOA 4X2PA 1RLCL 2FQIA 1X6UA 3CUGA 1NSJA 4O8RA 2H8XA 2XTKA 3NYZA 4AYSA 5L6UA 2ZQVA 3R25A 4TO8A 2BHYA 4EVZA 1A5UA 1E4NA 1JF5A 1D7HA 3R79A 3DEQA 5DX7A 1MW1A 1S1PA 3KX6A 5T9BG 3N2TA 3S6OA 5HNTA 4S38A 4WSKA 4QXIA 4Z2GA 4GACA 3AJXA 4A6GA 2A5HA 1THFD 1LQAA 3NGJA 3TUUA 5A8GA 4IF2A 2A6LA 2PP1A 5A1AA 2Z6JA 3G0SA 3BJSA 2ZA1A 5K9DA 1UZHA 1YKWA 3TDBA 4KH2A 5CPLA 1G69A 3AHZA 1T8XA 2DSVA 4O1EA 2ISDA 2PPNA 2DZPA 3R8HA 3TLQA 2MPHA 1LLOA 1V7AA 1MUWA 5E0FA 1FDZA 1O95A 4AB4A 3MANA 3SGUA 2QJIA 1VCFA 3WLSA 1F05A 1JUBA 4W9TA 4LXFA 2XIBA 4GNVA 4AXNA 4LX4A 2ZRVA 1C93A 4M6VA 4L56A 2OEKA 2J47A 3KVLA 4XD5A 1DBTA 2YBUA 1H7OA 2WVVA 4W4QA 4DUVA 1ZALA 3N3MA 4EIVA 1TELA 3NO1A 4DRIA 3G8EA 2ZUMA 4P7RA 2GL5A 1T99A 3L7RA 3P61A 4S2CA 3RGTA 4UCFA 3GDTA 1MVYA 1PZ3A 1HVXA 3PSVA 1JL8A 2REQA 1G01A 4X9SA 1HJXA 4GY7A 4A05A 2P76A 1T40A 3M1ZA 3SCSA 2VFDA 4Z1BA 2WMHA 2E3ZA 5L9FA 5PTDA 2EG6A 2G3NA 3GAKA 4DBUA 2PODA 1DQWA 4Y9PA 4KQZA 5MKGB 4GNJA 5CC7A 4FXJA 1QPKA 3IGUA 4W7VA 1CX9A 1LBMA 2YDSA 3W72A 4UFIA 1SZFA 3VNIA 3W7HA 1TVNA 5D05A 1I4NA 4JY9A 2OOGA 1YXYA 4O14A 2XP3A 2VR2A 3TQKA 1DTUA 3I6CA 3GFXA 3PJTA 3UY8A 3VABA 1TCDA 1EGMA 5ABEA 2FJUB 5BOOA 1PKMA 1R3VA 1TE1A 3HGOA 4LY4A 1F8IA 5KTLA 5BNKA 3PBUA 1WDDA 4R9XA 1TZ7A 4GGHA 3VU2A 2VX4A 2VVNA 4REQA 4UOJA 2XZ9A 3UVAA 2CIPA 4C60A 3QM3A 2OVLA 2IKHA 5A6TC 3G22A 1JDDA 3R58A 4CNOA 4D72A 5IXEA 3JZUA 4AMCA 2OGJA 5FJOA 4IT4A 2P0IA 4ZOEA 3LGDA 3NXLA 2CZFA 2ZQUA 4HT3A 3TZFA 4W7UA 5HMSA 5GNXA 3NQMA 2O7SA 1Y5VA 1W1B1 4NIRA 3BH4A 3NG3A 3EKLA 3W85A 3LUTA 1L9WA 1UR3M 3S5SA 2Y62A 4O19A 3S2NA 1A0CA 3LY0A 2CHNA 3MUXA 1UG6A 1DL3A 2Z0IA 3SCWA 1WV2A 3TYBA 5C9XA 3G6MA 4IQCA 4LAWA 4L6HA 3SADA 2BHUA 3COTA 5A2BA 5H2ZA 1ISXA 2QF7A 3QKZA 4AG0A 4QSHA 4GMEA 5G4HC 1ZHAA 4HBKA 3FJ4A 1OWQA 4RNIA 2ZCGA 4ATDA 4F0MA 2XJ7A 4Q32A 1H50A 4TW7A 1C29A 3LUO