1JNEA

Crystal structure of imaginal disc growth factor-2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
molecule keywords Imaginal disc growth factor-2
total genus 145
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jneA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jneA01
4CN6A 2QPSA 2V3FA 3QHNA 2ESCA 3AIWA 3WD0A 4HP5A 2YDSA 2J74A 3U5UA 4OKDA 1MYRA 3NSNA 3O6AA 1Q4NX 3ARUA 1JZ2A 2EEXA 4AEEA 3VNYA 1ZJBA 3ARTA 1JZ4A 4R5EA 4TX6A 4UNIA 1KFWA 3K46A 1JAEA 4JKKA 1G94A 1C90A 3U57A 2OWCA 2JALA 4W93A 3SCOA 4AMCA 3WQ5A 3FHAA 1H4PA 1E1EA 1W3JA 2XVLA 4KRTA 1UKSA 2E9BA 4ZXOA 3WEMA 2Z1SA 3DHPA 4HMDA 5LA1A 4YPJA 5GPRA 1UWUA 3NSMA 1ZBWA 1K9TA 1V0LA 1UKOA 4CCEA 2QF8A 5CSUA 1JL8A 2FGZA 3S6TA 5HPOA 1M03A 2DGAA 5A69A 2VZUA 2ZXDA 3L2MA 3II1A 3M7SA 4DWSC 2D0GA 2PWFA 2V3GA 3AMDA 3VO0A 1SFSA 1TVPA 5EBAA 3PZNA 2F2HA 1QNOA 3WF3A 4PMVA 2VL4A 3U5YA 7TAAA 1BG4A 3U7VA 4WIWA 2ZWZA 5A6BD 3AS1A 2VURA 3AMCA 1B30A 1TE1A 2J7BA 4MB5A 5BRPA 4H7VA 4E4PA 3BAIA 4PTXA 1JIBA 5BXTA 4FMVA 3VIGA 4AZ6A 3A4AA 2VVSA 5I0DA 3VGFA 1H09A 1O6IA 1LG2A 5HOSA 4CU6A 2DPEA 3VIMA 3WMBA 2BFGA 4BF7A 2J7HA 3GH7A 1W3HA 4WK9A 1MW2A 2W4XA 4P7NA 1KXQA 3K4AA 1VB9A 2BXZA 5D9PA 1LG1A 1V08A 2DDXA 4BZYA 5AC4A 4HA4A 1LWJA 3VIPA 2BV9A 3W81A 1ZBCA 4ZEPA 2WVVB 4OJYA 3ARYA 4D6CA 5A2CA 1HT6A 5TD4A 4NF7A 1E70M 3TTOA 3WNMA 4MPKA 1E4NA 4P8XA 5DF0A 4JZ5A 3ALFA 1QNSA 3VIJA 2XPKA 4KH2A 4KGJA 2VX4A 2BHZA 4HU8A 1VIWA 3N15A 1CGTA 4D71A 2C0HA 4UQ9A 2WSPA 5E9AA 4W7VA 1CXLA 1J0HA 1B0IA 2ZIDA 2WCGA 4V28A 2G3IA 2YLLA 1M7XA 2DT1A 1QBBA 3HU7A 3MSDA 3CH9A 3AIRA 3PZOA 2CCRA 4GIAA 4J27A 3THDA 1FFRA 1J10A 1OD8A 3JUGA 2YJQA 3S2CA 1BF2A 2E8YA 1W9UA 5IHRA 4GI9A 5KEZA 3TP4A 2WSKA 3WFLA 2J75A 3KL5A 3SUTA 4HPGA 1Q6DA 4MB3A 1BYAA 2VZOA 3CIVA 5A2AA 1HKMA 1ODUA 2WHJA 1UZ1A 5I3DA 4GO9A 4E8DA 1UZ4A 4D1IA 1G0CA 1E0XA 1W1VA 1UKTA 3EDEA 3WMSA 2JE8A 4JAWA 3I3EA 1E5JA 3B9EA 1E6RA 1DWFM 1EO5A 2WMJA 4MNMA 1HL9A 3VD7A 3FAWA 4AZBA 2WMFA 4KWUA 2JFEX 1GZJA 4HOWA 1DHKA 4U2YA 3MKKA 1L0PA 1VBUA 2XFYA 5CG0A 3VMOA 3AFBA 4HPHA 3EDFA 1JG9A 1JXJA 3VVGA 1JZ3A 4RE3A 3AHXA 7A3HA 1HL8A 2QV4A 2J62A 4F8XA 1J01A 4WLCA 3VIKA 1HJWA 2XVNA 2CHOA 1DEDA 4MNKA 1OT2A 3WKZA 3DYMA 1WDRA 2GDVA 3KWXA 4A3HA 1WB0A 2O9TA 1JZ7A 3CZLA 3WDQA 2HISA 1UOKA 4TVUA 2XYLA 1DWHM 3L4VA 4R27A 2WC7A 4GZIA 4IPLA 4U5KA 5ABFA 3FXYA 4TVDA 1ZU8A 5A6KA 2CKRA 1RP8A 2VRKA 2HVMA 1GVIA 2VZTA 3A6OA 4C7FA 1G1YA 1OT1A 3ZOAA 4BA0A 1TUXA 1V3LA 2GJPA 2D0FA 1GNXA 1WCGA 1D2KA 2WANA 5C8BB 1B1YA 3NDZA 3OLIA 2VC9A 3WNNA 1SMDA 1H0IA 2Y8KA 3MANA 1ZL1A 4GZJA 1VFMA 4PSPA 1X6LA 3VU2A 4M56A 5DFAA 3ARXA 1CLXA 4EANA 4PTVA 1E55A 3BLPX 4ATDA 4A4AA 5LA2A 3G6LA 2J47A 3OB8A 2WPGA 1BYDA 1DWAM 2J7DA 4DM2A 1BFNA 3KL0A 4W85A 5A8PA 4AD2A 4HZ7A 3LMYA 4CN1A 1W9DM 4KMQA 1XGZA 2AOSA 2DSWA 1C8YA 1JDAA 1JI2A 1LL4A 4PN2A 4JL1A 4DUWA 1B31A 2XG9A 5DEZA 1QNPA 4PMXA 4PMRA 4XX6A 3VIFA 2UWFA 3WBEA 2DH2A 4AZGA 3WL0A 5JBFA 1JDCA 2IUZA 2DSUA 2PWDA 1V3JA 4QCEA 1RD6A 1PIGA 1HJUA 3A4WA 4UZUA 2W92A 3CUIA 5IFPA 2WMHA 3W53A 1XCXA 5M03A 2O9OA 3PTQA 1FHDA 3T0AA 3W28A 1UKQA 2FHBA 5A6JA 1HJXA 4UCFA 3DYOA 3AZTA 1CYGA 1XCWA 4WSJA 3IK2A 4V2XA 1Y7VA 3W4RA 3PZTA 3MUIA 3NIYA 2X1IA 1GW1A 5DMYA 2YA2A 4GI6A 1PX3A 2YOCA 5E70A 3RIKA 1MWOA 1PIFA 2XSAA 2D3NA 1AQHA 1TMQA 3RMEA 3W0KA 3WDHA 2WLZA 1ZBKA 1YHTA 3WQVA 1MQRA 1EDGA 4P8WA 1JF6A 2VX6A 2VX7A 1BPLB 4AY1A 3WF2A 1OINA 1SR0A 4U33A 4W88A 1VEPA 2EJ1A 2J7CA 4UFIA 1VFFA 2WHLA 4WKFA 1KR0A 1J0YA 2VMFA 5A95A 2BNJA 2XVKA 3EBVA 2B31A 3L4XA 3OBAA 1NP0A 5M17A 4A3YA 3VUPA 2XUCA 2GK1B 3BMVA 2PWGA 4JFVA 5D8ZA 2WBGA 4PCSA 3MMDA 1CGWA 1A47A 4PRWA 4UQEA 2E40A 5D4YA 1AQMA 3L4YA 5M5DA 2NW0A 1MQPA 1GVYA 2WVVA 1KGXA 3T0DA 5AYBA 3HN3A 3WUFA 2VJXA 2WKLA 3NJ3A 4UFHA 4FLRA 5EFFA 3VD4A 3N9KA 3AHTA 2EPNA 1DTUA 1QHZA 4M80A 5A8OA 3F4VA 2UY2A 2NT0A 2E9LA 1D7FA 3VPLA 2UY4A 2J25A 1NP2A 3FHQA 3DC0A 1WDSA 3M6DA 2XSBA 3RCNA 4PTMA 1ISYA 3PZ9A 1E4IA 4JFTA 3WY1A 3VGHA 3GXDA 4D6GA 4Q22A 4D6FA 5EFDA 3VGDA 3A3HA 1CWYA 1W2PA 1V6YA 3WH9A 4BQ5A 3EDKA 1XHGA 1V0MA 1HVXA 4TUFA 1BG9A 3UEQA 1UR1A 2A3EA 4UR9A 3IJ9A 1E72M 3WQ4A 4TX8A 1K9EA 4FLSA 1E71M 2DH3A 4AD1A 3OZPA 4JCLA 4X0VA 1JYNA 5E0FA 5ABFB 3W6LA 3TTYA 4DUXA 3CMGA 1HF6A 5CPSA 1HVQA 3BXWA 1QPKA 2VX5A 3CGTA 4IISA 1ECEA 3RM8A 1NH6A 4URIA 4AEFA 1PX8A 1BVZA 1W9PA 4OOZA 2WK2A 2VTFA 5CGMA 2Y2WA 3GBEA 1GJUA 1TR1A 1SMAA 5A6BA 5IDIA 1QNRA 2ZUSA 1E43A 1KWKA 3EYPA 3M07A 2WZIA 1J9YA 3KZSA 5A6MA 4P7QA 3QOKA 4MAVA 3WEOA 4OIFA 2WVUA 4H8UA 3NCOA 1V3HA 1OGBA 3SCQA 2YL9A 3ZT7A 4NI3A 3TONA 4U2ZA 4DWSA 3MUZ1 5BWFA 3VMPA 1PAMA 4PMZA 3BAWA 1FH8A 1B3WA 3BCDA 2XHYA 4WKAA 2XIBA 5LA0A 1NWRA 2YDQA 3WH8A 4J3TA 2Y24A 4D6IA 2V38A 2EQDA 1I1WA 3L4ZA 1BTCA 4PMYA 4ZE5A 3RM9A 4S3JA 2XVPA 2WYSA 3TTQA 2ZXQA 1MW0A 4H41A 3CBWA 2PB1A 3AZSA 3N12A 4QAWA 1HKIA 3IJ7A 3WDIA 4UOQA 5E09A 5DT5A 3NSXA 3MU7A 3ZJKA 4HOXA 3VX0A 3IAQA 4BQ2A 1UD4A 1W9XA 3GZAA 1EXPA 1EIBA 1CTNA 1WZKA 2WAGA 3ZJ6A 1LL6A 2PBOA 1M01A 3AYRA 1VBRA 2XGBA 8CGTA 1TA3B 3VDHA 1KQZA 1ZS2A 2JEPA 3ZT6A 1GOQA 1XH2A 3ZQ9A 3I3BA 4UQDA 4D6EA 1MW3A 1ODZA 2W66A 4TXEA 5M3WA 1MFVA 3CHCA 3L4UA 3FNDA 1F4HA 1QI4A 1EDTA 2BVDA 1KGWA 4PTWA 3EMQA 1EOMA 5EB8A 1KR1A 3RPMA 1HXJA 3KL3A 1RP9A 2Y4SA 1CXFA 3UG4A 2BVYA 4Z2IA 2TAAA 3DHUA 1B3VA 3GH4A 4UQCA 3K8KA 1W3KA 3O2LA 4TOQA 3WNLA 3FY1A 1NQ6A 5C70A 2NT1A 2YA0A 3ZJ7A 3TA9A 1KCLA 4CCCA 3ZMRA 2CPUA 1UWTA 4FK9A 2PBGA 4CD7A 3WDPP 1UD2A 2E0PA 4PMOA 3VD3A 1GOOA 1BLIA 2WMKA 4PUDA 1F4AA 4CU8A 4P8VA 1R85A 2FDMA 1NOWA 1W32A 1E6XM 1CNVA 3AS0A 3AIBA 4UZSA 1GHRA 1V6XA 5E6ZA 3WF4A 3WUGA 3VGEA 3L4WA 1FHLA 2PWEA 3A4XA 4W5ZA 3WN6A 1KBBA 3APGA 2G4FA 2OSWA 5AY7A 2D23A 2DT2A 1HX0A 3SCTA 1EHNA 2JIWA 4MJ4A 5CPTA 1E5NA 3OIHA 4Q7NA 3VIOA 2ZUVA 1E1FA 4EKJA 1WO2A 5A6LA 3SCWA 4WF7A 1V02E 3PTMA 3NUKA 3VDAA 3W24A 1HKJA 1K9DA 2CKSA 1R7OA 4W84A 4P7RA 4BS0A 5HXMA 2GUYA 4MAZA 3BCFA 3GYCA 3AMKA 3VKKA 1PX4A 1NOUA 3SURA 3RM4A 3KEHA 4UQBA 1QVBA 3AXIA 1H41A 3TTSA 2WCSA 1GONA 3GM8A 3CUGA 2G3JA 3WF0A 1IV8A 4LPCA 2EO7A 4CGTA 2VUYA 1CDGA 4MADA 3T2OA 3ZT5A 4Z2GA 4JFUA 2YL8A 4MB1A 4YHEA 5JBEA 1H0GA 2VR4A 1L8NA 1V0NA 1KXTA 4OBSA 2FH6A 3AJ7A 4LYPA 1E3ZA 5BRQA 4MDPA 2VRJA 1US2A 1ZJAA 5ABHA 2GSJA 1R87A 3SUWA 4C7DA 4NRSA 2CERA 3ZR6A 3W27A 3WFZA 5DT7A 3OGSA 4IPNB 4X0NA 1CGUA 2O9RA 1QNQA 3SUUA 1EH9A 3POHA 1J11A 4M29A 1EDQA 1UR4A 2JF6A 1MXDA 1V6UA 1QW8A 1ZBVA 3POCA 3B9AA 1OCQA 5I2UA 2XJ7A 3LPOA 4JL2A 3AZRA 1XC6A 1B3YA 1N82A 1TA3A 2BHYA 2DT3A 1E4MM 3T09A 1Q6GA 1HJVA 1HIZA 1CENA 3QGVA 1CLVA 1K6AA 4LGXA 1UWIA 3UG5A 2ZXBA 3VMNA 4ZENA 5LYRA 1X6NA 3D3AA 4UFLA 1VRXA 4FF5A 3WBAA 2WVTA 3K8MA 2A3BA 3J7HA 1AMYA 1EQPA 4GXPA 3RJYA 1US3A 3CHFA 2ZX5A 2BY2A 2W67A 2F61A 1BQCA 1HP4A 4M8UA 2YDRA 3WD4A 1UR8A 5FL1A 1MXGA 3RJXA 1UR2A 4H8HA 3F5KA 1XYZA 3MUY1 5JBDA 2ZUTA 1R86A 1GJWA 1IT0A 2W5FA 3MO4A 1GOKA 1V0KA 1VENA 1CIUA 4CKQA 2ZX8A 3WH6A 6CGTA 1KWGA 2V3EA 3W82A 3ARSA 5ECUA 2FHFA 2VR5A 2ZUMA 1NOFA 1C93A 3VTRA 4C7GA 1E56A 3W6MA 2V5CA 3MV01 3AXHA 4JFSA 2F8QA 2J8FA 2ZUNA 3TOPA 4YHGA 3VIIA 4AXNA 3ALGA 3ZSTA 1PJ9A 3VM5A 4YN5A 1W9BM 1FP9A 3OLDA 3ZJ8A 4JFWA 4JKMA 2UY5A 5FD0A 1ISXA 1QW9A 8A3HA 5CLWA 3T0BA 5CJ5A 1JFHA 3K1DA 1BGGA 4LYRA 3QR3A 2YLAA 5GNYA 1RPKA 4F9DA 1J18A 2WZEA 4E8CA 1WP6A 3ZO9A 4D1JA 1UH3A 1W9VA 1MFUA 1LLOA 1LJYA 1IZJA 4GO8A 3CZEA 3MSGA 7CGTA 2W61A 3OGRA 1E6NA 4JIEA 3AS2A 2W91A 1BYCA 3AXXA 1E15A 1UD3A 2XGIA 4OBRA 1WKYA 2DQXA 4PMQA 4UFKA 1QHOA 1V3IA 5BXPA 1XD1A 2J79A 5I77A 2A3AA 3VINA 5F7UA 5FOOA 3AISA 1FH7A 3WUBA 3L4TA 5HNNA 1FFQA 3VNZA 3ZSSA 5BROA 1HJSA 5JUVA 1VAHA 4LYQA 3AICA 5IXEA 1V02A 3WF1A 2QMJA 2XVGA 3BAYA 2AMGA 1YQ2A 2CESA 1XSIA 1V3MA 4M24A 4P7OA 1VF8A 1PPIA 1JZ6A 4CD5A 2ZUUA 4GINA 1W2VA 1UUQA 3CUFA 2WLYA 4N42A 2YL5A 5GQBA 1UD5A 4Z2JA 3AMGA 4AC1X 4CCDA 3OG2A 5CXPA 3PZIA 3N11A 1E6ZA 1J12A 3FW6A 1QBAA 3NYDA 1LL7A 3AMLA 2GK1A 3EMCA 3GNRA 1CGVA 1G01A 1ISVA 3I3DA 1OIFA 1C7SA 3QHOA 1NM9A 4M1RA 4AD0A 3MV11 5D9OA 2J7GA 4JHZA 3WQ8A 4DM1A 1VFOA 1E73M 1PEZA 4WKHA 2ZE0A 5IFTA 5JIPA 4F66A 2DIJA 2QPUA 5JIWA 1LWHA 1ITXA 2XM2A 1JF5A 5AYIA 2CBUA 2BY3A 3CZGA 2MANA 1WDQA 2J77A 3GTNA 1HNYA 2ZX6A 1QI3A 4PMDA 2CIPA 1UD8A 3WDJA 2XWEA 5A8NA 1TFVA 1H3GA 3GNPA 5BXSA 3CMJA 3GXFA 3PZGA 1JYWA 4CU7A 2OWWA 2D3LA 1FP8A 3WMCA 2XIIA 3N04A 3VGBA 2WVSA 1W1YA 1W1PA 3OZOA 2WB5A 4TVCA 5GNXA 1UKPA 2RGMA 2WHMA 2GVYA 2BHUA 4K68A 3BH4A 2D0HA 4ML4A 3HJEA 2VZVA 1AQ0A 2DIEA 1E40A 1TCMA 4BCEA 1OBAA 2WMIA 1GQJA 3PTKA 1J0JA 3WENA 4ZXLA 4ACZA 3EDJA 4AZ7A 5I5RA 4OOUA 1NWUA 1X1NA 2G41A 5D9MA 4BQ3A 1JZ8A 5CZKA 2JEQA 3UCQA 4AIUA 4B9ZA 4FLQA 3SEPA 3SIMA 2BY1A 3K4DA 2J7FA 2WWDA 1EO7A 1GUVA 1S46A 3IAPA 1D3CA 2IXVA 1KBKA 1CPUA 1OGSA 4E2OA 4AZCB 1JDDA 2EPKX 3AHVA 3CO4A 1GOIA 4J3VA 4CN4A 1I1XA 4MDOA 1OB0A 4MNJA 2NSXA 1OSEA 2BY0A 1OD0A 3QHMA 4TTUA 3AHZA 2PF0A 1VEMA 1ESWA 4RE2A 4M81A 5A3HA 1FOBA 1E9LA 2G3MA 2XM1A 2YBUA 2GJXA 4ATLA 1UR9A 2CHNA 1V6WA 4XV0A 1JYVA 1JZ5A 3W29A 2E8ZA 4OZOA 4JCMA 2CNCA 1WZLA 2X8RA 1NARA 2VVNA 1XSJA 3IANA 2CBVA 1QI5A 4UOZA 1B3XA 1C8QA 2DT0A 1XD0A 3KE0A 3G6MA 2VCCA 3CTTA 5IHSA 3CZ8A 1BHGA 1CGXA 3CZKA 1Q6FA 3ARVA 1JGIA 1VFUA 3UR7A 4H04A 4B3KA 2YIHA 4ZE4A 2WKGA 1XV8A 1KCKA 1W91A 3WNKA 2W63A 2VOTA 4HMEA 1JI1A 5C71A 4AZHA 4DWSB 1WDPA 1UWQA 1KGUA 3OLEA 1AVAA 2XFRA 1H1NA 1XYFA 1QI0A 1CGYA 3PZVA 1EGZA 1CBGA 4GZEA 3AYSA 4PCTA 4J7RA 1E0VA 3VGGA 1C7TA 1RH9A 5E0CA 4AYSA 1CXEA 2VQUA 2OWXA 4AD4A 3BAKA 3ZR5A 2X05A 4AIOA 1EHAA 3B8SA 1M53A 2PI6A 1JFXA 1JNEA 3PZMA 4XZBA 2D24A 2DSZA 2OSYA 1GQKA 4ZFMA 1CZ1A 3NDYA 4GQQA 1C3FA 3PBGA 3AIEA 3DYPA 3AIUA 1VJSA 1DWJM 2O92A 2EPLX 1A3HA 2X2YA 5I6SA 4W89A 3WSUA 1EOKA 4GKLA 5A94A 3W38A 3AROA 2BS9A 4WSKA 2D20A 3E1F1 3AQUA 5HDRA 4AW7A 4F9JA 1JXKA 2WC4A 2VNCA 4NSBA 4XZWA 4D72A 1GORA 6A3HA 2J4GA 3GNOA 5GNZA 2QLYA 5D8WA 1UD6A 1WAWA 2CBJA 1XSKA 3N17A 1R8LA 5HBFA 2VQTA 2ZWYA 4W7UA 4XB3A 4HA1A 4PMUA 3ARQA 3SCSA 3T2QA 4EAMA 4GQRA 4W8AA 1JD9A 4L4OA 2PWHA 4QFUA 1K9FA 3LPFA 3SUSA 1SYTA 1B3ZA 4HTYA 1H2JA 5CGTA 2XTKA 5A8QA 3UETA 4GI8A 2GDUA 2WCAA 3VD5A 5A6AA 3PN8A 4AD3A 2JF7A 1ISWA 2OSXA 4J3XA 3UR8A 1WNOA 2XFFA 2RGLA 3ZM8A 3VIHA 3LPPA 2D22A 1E3XA 2VO5A 3UESA 3O9NA 2VT0A 3SCRA 1JAKA 2CYGA 4WJXA 3GBDA 1B90A 4HMCA 1FA2A 4XUYA 5DO8A 1OWQA 2VRQA 3CHEA 3N1AA 4ACZB 1UG6A 4LQ1A 4CUCA 1DWGM 3VD9A 4IM4A 2YBTA 2ZX9A 1H5VA 2Y5EA 3MMWA 2W62A 1J0ZA 2OLHA 3WH5A 3WEZA 1LQ0A 3WQ6A 1E0WA 1B9ZA 2OYMA 4D6DA 3VDBA 5I78A 2VCAA 3WL1A 2DSKA 3BAXA 4KRUA 1V6VA 4IUGA 1GHSA 4MTVA 4QLJA 1ITCA 4N0RA 5A1AA 1H11A 4D6JA 1H49A 5I79A 1GOWA 4W87A 3GH5A 2FHCA 3BAJA 3MS8A 2G8ZA 2CEQA 4DUVA 5A6SA 1EA9C 2GJXB 2JIEA 1B2YA 3T08A 1BSIA 1MVYA 2C7FA 1U33A 1Q6CA 2IXUA 4Z2LA 2WBKA 2WMIB 1GPFA 4MNLA 4ATWA 1I75A 2J7EA 4AIEA 2WW5A 2D2OA 2GFTA 3EMZA 3OGVA 4TTGA 1U2YA 1OGGA 3B9DA 1PZ3A 5CSYA 4J3WA 1BVNP 2WZHA 4JHOA 3GXIA 1OM0A 3WIJA 4UQAA 2EPOA 1WZMA 2ZX7A 4QCFA 1UHVA 1GCYA 4QDMA 2DEPA 2WM0A 2J78A 2X09A 4PMNA 4U3CA 4NRRA 4BQ4A 3T2PA 3THCA 1QHPA 3UG3A 1M04A 1EQCA 3F5JA 3CPUA 1Z32X 2EXOA 1BYBA 5E6YA 4PEEA 1KQYA 1W3LA 3WD1A 4J3SA 4U31A 3DECA 3WD3A 3SUVA 4B9YA 1PZ2A 5EMYA 3VX1A 4PUEA 2V5DA 3M46A 4J28A 2D1ZA 1UWSA 4CVWA 4M82A 1V3KA 2V3DA 3PHAA 2EPMX 2FGLA 5BXRA 4UTFA 3A47A 2C8NA 4Y7EA 1XRVA 2YKKA 3VOCA 4W86A 1UH4A 2E3ZA 4HA3A 4AISA 3VM7A 3ARWA 1FH9A 5FCZA 2E9MA 1C92A 2ZXAA 2XWDA 3AI0A 1JNDA 3SCNA 3WUEA 4AZIA 2VCBA 5A8MA 3SCPA 3OLGA 4P7LA 5FKYA 4UFMA 2CXGA 3LPGA 3CUJA 1IZKA 3ZIZA 2YL6A 5FL0A 4HZ6A 3BLKA 2ZUWA 3AHYA 2PC8A 4RE4A 2CETA 4QLLA 2EBNA 3CHDA 1MW1A 2WWCA 3W37A 3EDDA 5AC5A 2BXYA 3GXMA 1OIMA 1VEOA 2YA1A 4QLKA 2E4TA 1C91A 2BVTA 3VDCA 2VZSA 1CXIA 3FAXA 2FH8A 4ACYA 4RL3A 4AWEA 1HKKA 2AAAA 4U5IA 1WPCA 3BMWA 3ARRA 3RILA 3L2LA 2A3HA 3MMUA 1NWSA 6TAAA 1J0IA 1TVNA 2Y8VA 3AOFA 3AS3A 1CECA 1QOXA 1TZ7A 4P8UA 3K8LA 5CLTA 4W8LA 4NZCA 1UYQA 1E6SM 2OYLA 3SCUA 2CBIA 2WXDM 4PYSA 5BCAA 4S3KA 3BGAA 4AZCA 4FLOA 2G3NA 3WELA 3WDRA 1UA7A 4W5UA 2ZICA 5CQ1A 2WMGA 1HJQA 3QOMA 1XH1A 4CD8A 1W1TA 1E6QM 2CITA 4Z2HA 1WE5A 1JYXA 3WQWA 4D6HA 5HPCA 3ECQA 1DWIM 4MJ2A 3CZJA 4HOZA 2ZOXA 1HN1A 3BSHA 1UQYA 1J0KA 1KXHA 1UQZA 4B15A 3RDKA 3U7BA 1HP5A 1PBGA 2J8GA 3W26A 4J3UA 2Q8XA 3PZQA 2WNWA 4GPNA 1GOMA 4HZ8A 2GJRA 1GQIA 2X0HA 3UERA 3AIQA 1XH0A 2OYKA 1CEOA 3AIVA 4QP0A 1E6PA 5JH8A 1KB3A 1V03A 4B3LA 1GQLA 3ARZA 1UA3A 3F5LA 5A2BA 2UY3A 3WNOA 2VI0A 4PBGA 3D5HA 1TG7A 4H2CA 3HMCA 4W8BA 4DWSD 1KXVA 1UWRA 2QMKA 4UFJA 1BGAA 1LF1A 4B16A 5D9NA 1BAGA 5ABEA 1P6WA 1ISZA 2A3CA 1WZAA 3VILA 4W7WA 3CUHA 1G5AA 3OA5A 2X0YA 2DSVA 5BYWA 1U30A 4L4PA 4CD4A 3PZUA 4U3AA 5KZ6A 4CVUA 1CXKA 4CD6A 4Z2KA 2WHKA 4OUEA 1E4LA 3W25A 4JKLA 1JD7A 9CGTA 4F79A 4EK7A 3N18A 1UH2A 1G9HA 3WD2A 4V27A 3RO8A 2O9PA 1CXHA 4MB4A 4PSRA 5I23A 3BC9A 3MUAA 3GDBA 3WNPA 1Q6EA 3ARPA 4LXFA 3CLWA 3FN9A 1VJZA 4HU0A 1C8XA 1UR0A 3IJ8A 2QHAA 4KGLA 1NWTA 2Z1KA 4AD5A 2WC3A 4UOJA 5ABGA 1O7AA 3WH7A 5CPQA 4EE9A 5I24A 5FIPA 1QI2A 1ZB5A 3BSGA 3N13A 4H8VA 3SCVA 4LX4A 1R7AA 1DP0A 4AZ5A 4X9YA 1MQQA
chains in the Genus database with same CATH superfamily
4S3GA 1TUFA 1U5HA 1W31A 2QPSA 2ESCA 3WD0A 2XINA 2J74A 3U5UA 3HG5A 1EF2A 5D30A 1G4SA 3N4FA 4O13A 3VNYA 2YB4A 1EA0A 1ZJBA 4RZ6A 4R5EA 4TX6A 3SADA 3KBWA 2XP9A 4DRJA 1YNPA 1G94A 3U57A 1QO5A 2OWCA 4W93A 3SCOA 3SFWA 3XINA 4AHPA 1NMWA 1W3JA 4KRTA 2E9BA 4GY0A 2DZSA 3KBJA 4HMDA 4N6FA 1JCHB 5GPRA 1UWUA 1OG0A 1K9TA 1V0LA 3N6JA 3GTIA 4CCEA 3R79A 1JL8A 1SJAA 3XISA 5HPOA 3W87A 4LY8A 3BJTA 4M7SA 4KKXA 1KTNA 1M03A 3O0KA 2SFPA 7REQB 2ZXDA 3CIXA 3L2MA 3II1A 3M7SA 4DWSC 1AJZA 2PWFA 1U83A 3VO0A 4QBXA 2PV3A 3M64A 5DMMA 4DLMA 4GY7A 3PZNA 3PB0A 1TSIA 7TAAA 2VL4A 3W1NA 4YIWA 5LIUX 3I4EA 4ECLA 1A3WA 1F76A 3E2QA 1EXBA 1B30A 2X30A 5EU9A 4MB5A 5BRPA 4E4PA 4FMVA 3P6LA 3LY0A 3AYTA 2FPYA 2BGSA 3VI2A 3UVAA 2ON3A 3ABOA 3GU1A 4GYJA 1ADOA 1VGAA 3FK4A 1XYMA 3UJSA 2FZNA 4WD0A 1Q45A 2N87A 4CQ8A 1GYMA 4A05A 5G1YA 2J7HA 3AWNA 4H9MA 1XL9A 3REQB 2W4XA 2E6AA 5D9PA 1LG1A 3E0WA 2DDXA 3G22A 4BZYA 4FOUA 3E49A 4C6OA 2KI3A 1FWDC 1FDYA 4F0KA 4HA4A 5FJJA 1R30A 1LWJA 3VIPA 4JS3A 3S5ZA 2BV9A 4LH8A 1AD4A 5HWNA 2WQDA 1HT6A 5TD4A 5K9CA 4NF7A 1E70M 4Y9MA 2V5JA 1R2SA 2OKOA 2E77A 5IDZA 4P8XA 3ALFA 1KRMA 1E51A 4BEUA 5HJLA 2XPKA 1B54A 1X7IA 3UQBA 4CLMA 1TMLA 1BEUA 1E1CA 1BXCA 4H6QA 4UQ9A 4Y96A 4CQDA 1R3QA 2P0IA 4HQVA 1LOLA 3LV6A 1J0HA 3VOHA 4YTRA 3G0SA 4V28A 1YIXA 4ZGYA 2BVWA 2E5DA 1JUBA 1QBBA 3CXOA 1F8MA 2REQB 1YTKA 1XLGA 4DROA 4UC5A 4WGXA 5REQB 4J27A 1Q65A 1R47A 3CT2A 3JUGA 2YJQA 3L66A 4HPJA 4NIRA 2OZTA 3TW9A 4N9CA 1S1PA 4J9JA 2HDJA 2PEVA 2WSKA 3WFLA 3B0VC 4GZ7A 3G24A 2BSLA 3R4IA 1Q6DA 3BMBA 1BYAA 2CZ5A 3NWRA 2KX9A 4D8AA 5AVNA 2HPIA 4JHMA 2IQTA 5A2AA 1AUSL 1M9HA 3EA1A 3CV2A 2WHJA 4NQ1A 1UZ1A 4EOUA 1N7KA 3IGUA 3F03K 3GY1A 4DBDA 3EAUA 1TRDA 3WJWA 4D1IA 3IVTA 3C4UA 4HT3A 5CAKA 3UT0A 2QEZA 3QKEA 1OYAA 4KWSA 2D73A 1E5JA 3B9EA 1V5XA 5HW8A 4Y8FA 3CWHA 1IEWA 3Q65A 3S9IA 3GU9A 1C9DA 4HPXA 4KWUA 2JFEX 4DRMA 2YYTA 4ML9A 1SUXA 2XP3A 3DENA 5CCZA 4U2YA 4IXHA 5CG0A 3CS2A 1O1HA 3EDFA 4QGCA 4RE3A 2E68A 7A3HA 1TE6A 2GDQA 4CNUA 3VIKA 3OBEA 1PBKA 5I3KA 3W7NA 1DEDA 2FYMA 3L67A 1WDRA 3GWQA 3W71A 3NQBA 1W56A 3O3RA 5C7HA 3T78A 3SRHA 1JZ7A 3CZLA 2DQWA 1AQFA 1CI1A 2XYLA 3KX6A 1IT7A 1P4CA 3L4VA 2WC7A 3PTDA 3C8FA 3FXYA 5AFDA 2HVMA 2VZTA 4YNGA 2OQHA 5EY5A 4HNCA 4BA0A 1NF7A 1K1DA 3QMRA 1TUXA 2FGBA 3H24A 2D0FA 4IPPA 1D2KA 5FF3A 5G4HC 3NDZA 4HNOA 1FWIC 3ONCA 4E3VA 4N4PA 1X1ZA 3OLIA 1SMDA 2ZQVA 3NQCA 5T9CE 1H0IA 4K7YA 1EC7A 1X6LA 1UASA 4Z08A 5TQLA 2BDQA 4S2CA 3PUDA 1QCWA 3FYYA 2J24A 3CEUA 2NXGA 2YFOA 3EWDA 3FJNA 2J7DA 4DM2A 1H7OA 2FZBA 4W85A 1LROA 4KMQA 2AOSA 1C8YA 1J6PA 3KCOA 5CZSA 4CCZA 3ATZA 4DUWA 5EYWA 2XG9A 4PMXA 5DEZA 1QNPA 4PMRA 4TQTA 3WBEA 2ZVIA 4BFAA 4AZGA 5JBFA 2A6NA 1JDCA 2QCDB 3G1FA 1RBLA 5JQ9A 2W92A 3CUIA 3NPVA 5KZDA 3LBCA 5K2ZA 4IIFA 3TAKA 2WMHA 5M03A 2E6DA 3R12A 4LB4A 4AH7A 3T0AA 3M6YA 3W28A 2FHBA 3I7QA 3DYOA 1XKYA 5IBXC 1M41A 4EF9A 4WSJA 3IK2A 4MFEA 1Y7VA 3FIGA 3SW6A 3C2YA 4L7ZA 2Z1BA 2X1IA 3H7VA 4DRSA 5DMYA 4DPPA 4WY0F 2YA2A 4GI6A 5HMFA 2V69A 4XAZA 3CC1A 1T8XA 3NQGA 3RPDA 1TR9A 5FF0A 1AQHA 2V30A 3QPZA 3TC6A 1FKBA 3H4GA 4A2SA 2CLPA 4JN7A 1MQRA 1EDGA 2NVDA 1JF6A 1Y0EA 3F2CA 3XIMA 4I5UA 3ID7A 3TYAA 4U33A 1SVDA 4UXDA 4WR3A 2PRHA 2XGZA 4O10A 5CBBA 1OFAA 2XVKA 3HPZA 1ZFJA 1XLCA 2DZTA 4JN6A 4KEZA 3VC6A 4R53A 3PPGA 4KERA 2WBGA 3V7PA 5C5YA 1AH4A 2I5IA 4PRWA 2WO5A 1AQMA 5M5DA 2WVVA 1OF8A 3EA3A 4XBKA 3WUFA 4NAEB 4CQAA 3NJ3A 1R9XA 1OFDA 3WMLA 4B2DA 4IX2A 4UFHA 5EFFA 3VD4A 1FUYA 3GVQA 3FEMA 2OVLA 3GDMA 1QHZA 5A8OA 4O1BA 4V1YA 2FZMA 1D7FA 1ALDA 1XICA 3VPLA 3UYCA 5EMLA 3UA4A 4PTDA 5K3VA 2ZR6A 2Y5JA 5C54A 4TIMA 1WDSA 3IS4A 1K02A 1ICSA 2Z2UA 3W22A 3CUZA 9XIMA 3GXDA 1KV5A 4Q22A 2RSEA 2ZQUA 4UTHA 3A3HA 2O4QA 4LRSA 1GGOA 1W2PA 3AJXA 3W72A 4C6EA 4BQ5A 3EDKA 3DOPA 4GJ1A 1BG9A 1E72M 3SY5A 5BMXA 1E71M 4X0VA 4IMDA 1UP0A 3B03A 2DFAA 5E0FA 5ABFB 5G1TA 5JU6A 4QX4A 4DUXA 3CMGA 3LTSA 1HF6A 2VX5A 8TIMA 1QAPA 2G4JA 4URIA 4LAYA 4LAXA 1W9PA 4OOZA 2WK2A 2Y2WA 1WOBA 2YCLA 3GBEA 1TR1A 3TQKA 4A3RA 5A6BA 2I16A 2ZUSA 1E43A 3EYPA 2GGJA 3KZSA 3W6YA 3CWOX 3NCOA 1OGBA 4UCGA 2YL9A 1WAUA 4UTWA 1MI3A 4NI3A 3SCQA 3ZZ1A 4U2ZA 3S1GA 4AX7A 1FH8A 4NJGA 4QNWA 2RJHA 4DH0A 4WDUA 1D7IA 3G1HA 1XINA 3IJIA 3ONBA 3W7IA 4H9YA 5LHEA 4D6IA 2V38A 2OGJA 4ZQRA 3MP3A 4PMYA 2RURA 1EF3A 3E02A 4S3JA 2XVPA 3SIZA 3TTQA 4O14A 1AODA 2ZXQA 1TPFA 2ICSA 4C6CA 3AZSA 2PDHA 4H9UA 4IUOA 3ISIX 4XWUA 3MUXA 3IJ7A 4QM1A 4GBUA 4PRTA 1OX5A 3IAQA 3I6EA 1UD4A 1W9XA 3N6HA 1CTNA 4H19A 4GIVA 1N1AA 4NG3A 1M01A 2NV1A 1FKKA 3AYRA 2XGBA 2D2JA 2ZZ6A 3ZT6A 4WRHA 1GOQA 3ZQ9A 2NUYA 2Y7FA 3SGUA 4G8TA 4PUUA 3WLHA 3WQDA 3I10A 1F05A 2BVDA 3S5OA 4PTWA 1BKSA 1EOMA 4KPLA 5F1UA 1ICPA 4LALA 5LIKX 4U10A 4KRZA 3RPMA 3LSBA 3RPTA 3LHUA 3KL3A 4KWVA 1RP9A 1GVSA 3GR4A 1VH7A 1UOZA 2MNRA 1IGSA 2BVYA 1LRNA 3O5RA 3P84A 4QT3A 3N29A 3O2LA 4ZOEA 3LZ3A 3FY1A 2QCGA 1Z44A 4JIQA 4O15A 1NFPA 5BRBA 4KFNA 5CBJA 2NT1A 2ZQSA 2FMOA 3ZJ7A 1PV8A 3BO9A 1TX0A 1TV2A 1S3HA 4JX4A 4ZS6A 1KTCA 3E38A 1KRAC 4LS0A 4A6GA 2ACRA 1UWTA 3WK2A 2PBGA 3WDPP 4PMOA 3KHDA 1BLIA 3RCMA 2GWGA 4IFKA 1LP6A 1NOWA 5H2ZA 1OG6A 3AS0A 5BMWA 4ZB5A 3BE7A 1V6XA 4DZ5A 3WUGA 2E6FA 3QW3A 2HE5A 1FHLA 4JTCA 2PWEA 5FF2A 3A4XA 4W5ZA 7TIMA 2OSWA 1FKLA 1YBQB 2Y61A 1EHNA 2POZA 3SCTA 2OB3A 3OIHA 4YWSA 4JEJA 5A6LA 3S0CA 4BR1A 3VDAA 2FQIA 3ERPA 4GISA 4QE4A 1K9DA 4YTQA 3F2DA 2QJJA 2Y85A 3MDUA 1QPOA 3GNXA 8XIMA 4ZBCA 2GUYA 1SSGA 4R33A 1MDRA 3BCFA 5AB3A 2QULA 4X60A 1KM5A 3GYCA 1ZNNA 5J04A 4KQNA 3LM3A 3D46A 2A85A 3RM4A 2GYIA 3O06A 3KEHA 4L64A 2VCDA 4DELA 2QKFA 3DAQA 1D8WA 1FWNA 1R9ZA 3L68A 1A0CA 1GONA 4NXSA 4ENLA 4LUSB 4MVAA 1IV8A 4GGQA 2EO7A 4LPCA 1YDOA 4XO7A 2YL8A 4PRRA 1QATA 3K1GA 4O4VA 1LYXA 5JBEA 4JTDA 1PVNA 4MUZA 1TPH1 2REQA 1OK4A 1SJBA 1KXTA 2OQLA 2WNZA 4LYPA 4MDPA 3L65A 2E09A 4NRSA 3TSMA 3WFZA 5DT7A 2BMBA 4X0NA 3QV7A 4O1FA 4G5DA 4JGDA 3SUUA 1EH9A 3P5YA 4HNVA 4H2HA 3GDLA 2YZ5A 1V6UA 3POCA 1OCQA 5I2UA 4LOCA 4OV4A 1TA3A 1W5MA 3EPOA 1PXGA 1R5YA 1E4MM 3GHRA 4FNTA 4XZIA 4H9ZA 3MYPA 1NTHA 3EWWA 4W4QA 1O5XA 4GRSA 3LXBA 3GG1A 1UWIA 3KTXA 3R6IA 1LQAA 3QC0A 4XAPA 4UFLA 3UWYA 5I7GA 1VRXA 4IFRA 3K8MA 3PM6A 2PDWA 1XG3A 4GUGA 1WUEA 4MOZA 2P3EA 1BQCA 4M8UA 4B5UA 3BWWA 3DFHA 1TWWA 3RJXA 4H8HA 2DIKA 2ZUTA 3YPIA 3U3HA 4CKQA 6CGTA 1UIPA 3PP7A 4DJFC 3U4AA 2I56A 4DRNA 2ZUMA 3LV5A 4C65A 3AXHA 4JFSA 3TOPA 4YHGA 3VIIA 3KCLA 3EKLA 4K8EA 1IXNA 5G5IA 2QQ6A 3KDOA 3IGHX 4GC3A 4JFWA 1I0DA 4JKMA 1PYMA 4Z0SA 4W9PA 8A3HA 5CJ5A 1BSLA 1JFHA 4LYRA 1VR6A 3RFAA 5GNYA 1G67A 1RPKA 7ODCA 1XIGA 3ITGA 1VCGA 4JOMA 4E8CA 5AYYA 1UH3A 4GYPA 1Q1CA 1D7KA 3V16A 2W61A 2W91A 3AXXA 3LA4A 4JYEA 4JTUA 2DQXA 4WGHA 3O5IA 1QHOA 2PU1A 1WBHA 3V5CA 1UC4A 4EXQA 5F7UA 4UR7A 3AISA 3R7MA 4F3HA 1RQEA 1LUCB 4TV5A 2WJDA 3RLGA 1BXNA 3IACA 5D2VA 3V36A 4E6MA 4CEXC 4LYQA 2PLCA 3WF1A 3TOYA 1RV8A 2CFFA 2CESA 4MZ1A 4P7OA 3UWVA 1PPIA 3TSBA 1JZ6A 1TV5A 4CD5A 4IGNA 4HHHA 4GINA 4F40A 3CUFA 3QR1A 2YL5A 4TNSA 5GQBA 3AMGA 1SQ7A 1T0OA 3OG2A 3RR4A 1QPFA 2OQYA 3N11A 1REQA 1J12A 4XZNX 4BJHA 1RVGA 4L61A 2NLIA 3UXKA 2C18A 2DVUA 1SSDA 2AGTA 3AMLA 2VYOA 1SFLA 4ROPA 1QOQA 2ZZ1A 4G2PA 1FHVA 4J2MA 1Z7AA 4NJIA 5AYXA 3QHOA 5F4XA 5HNRA 2H3DA 4A29A 2VOMA 1RPXA 4AD0A 1W1B1 5TBOA 1OC7A 3PRBA 3WQ8A 3GIYA 3AYVA 3UWUA 3EOLA 1PEZA 3VAVA 2XM2A 5AYIA 1M3UA 5AOUA 3CZGA 2J77A 2PP0A 3GTNA 3QZEA 1HNYA 3W7JA 3JXVA 2NUXA 4PMDA 2ZZ3A 1EYMA 2EG7A 4NZFA 4DAIA 3GNPA 2CC0A 3CMJA 3PZGA 4DIPA 3DFNA 1DJQA 3GUWA 3MWAA 3NQ7A 1W0MA 1Q2SA 2Z7KA 4ZB0A 2WB5A 5AC7A 4N2YA 4PB4A 1W5PA 2JBMA 3GO2A 1GPWA 3LENA 4DYJA 1LZOA 4V1XA 2GVYA 5HUAA 4YXGA 4ML4A 2YCJA 1Q6IA 2AQVA 2C6QA 1AQ0A 2Y89A 2DZAA 3FVMA 2EGZA 4AZ7A 2ZQ0A 4LFYA 5FACA 3EB3A 4IQCA 1H62A 2YR1A 3GG8A 4OOUA 2I9UA 1X1NA 2G41A 4J4NA 3QFEA 1IEVA 4XUGA 4EVZA 1UCWA 2CLKA 5DRCA 4MFDA 1PYFA 1S2UA 2QDHA 4AIUA 4FLQA 4B9ZA 3SIMA 1RY8A 3B40A 2J7FA 2WWDA 3NG3A 4XD6A 3OBKA 1CPUA 1GKQA 2V68A 5HMDA 4PFHA 3QF0A 2EG8A 3UFYA 2EPKX 4WDTA 3RN6A 4GYKA 4J3VA 4PMJA 5BWAA 4IMEA 1I0BA 3WQGA 4J40A 4MDOA 2HVNA 1OSEA 3ITCA 4DI9A 1B57A 2TODA 3QHMA 4DI8A 1DJZA 1BRLB 3O15A 1ITQA 4GUJA 4FO4A 3PY2A 1F8IA 2OGYA 5A6TC 2CZVA 3DZ1A 3R10A 4LCSA 2E8ZA 4JCMA 2CNCA 3LB0A 4B5XA 2VVNA 5CBIA 3IANA 3THQA 3UF8A 1C8QA 4LC8A 3KE0A 3W1UA 2JGYA 4HNNA 3P81A 1KO0A 1VFUA 3EWBX 3UR7A 4ZE4A 3P60A 4MY1A 2VOTA 1FCBA 4AZHA 3RK8A 3O6DA 2HQAA 1WDPA 2OPJA 2Z1VA 3W7MA 3LRLA 1PKLA 1ZCOA 4JQAA 3CL7A 1XYFA 4ERAA 1SO3A 4K37A 1KCZA 3UPWA 3DFSA 1AL8A 1C7TA 5E0CA 4AYSA 2IPGA 1TO3A 2W27A 2WSQA 2X05A 3M0YA 2NUWA 3B8SA 2PI6A 4O0QA 1O95A 1YNYA 4XZBA 2PV2A 2DSZA 2OSYA 3U6WA 3G1VA 1AH0A 3NDYA 3BVJA 1DJYA 3PUEA 5I3JA 1VJSA 3IPWA 4DHGA 1A3HA 2PAJA 3HJZA 1XP3A 1NDVA 5AHFA 3HG3A 1KKOA 4GKLA 3RRAA 3AROA 2AL1A 3KTCA 4RPPA 2DORA 4NSBA 2Z00A 4UTTC 4RE0A 4D72A 4Y6GA 3WLSA 2GGIA 3WLKX 1QTWA 5LKYA 5GNZA 4NNRA 2CBJA 1XSKA 4XO6A 1DQXA 1F3XA 2VQTA 2ZWYA 4W7UA 4PMUA 4Q6XA 3LS9A 1DQWA 3LCIA 4QFUA 1EZWA 5B7YA 4JTAA 5DELA 2HS6A 4X63A 1H2JA 5HQLA 5A8QA 2PFHA 3LHTA 1EJTC 4CNTA 3A64A 4NILA 4AD3A 1ISWA 2Y7DA 5GPGA 2D22A 1E3XA 2VO5A 1RY0A 2PDKA 1MRQA 3UESA 1H7NA 4HYVA 3P74A 3SCRA 4EX4A 3LGEA 1VPXA 5F4SA 1POKA 4MPQA 1FA2A 1TPEA 4YVVA 3KAHA 3E0VA 1VYPX 5DRIA 3LD5A 3GB6A 2VRQA 3KW3A 2Q01A 2R94A 3N1AA 1UG6A 4LQ1A 3IGSA 1DWGM 3VKDA 1QUMA 4EPBC 3LZ5A 3LLXA 3R0UA 4DRIA 1NEYA 1RLDA 3ANVA 3DH7A 1DKWA 1VRDA 3GUGA 4JTEA 4DZ3A 3LCLA 1Q66A 1E0WA 3VDBA 4D6DA 3BG3A 2VCAA 4LYKA 1L6FA 4FNUA 3LTPA 4D8LA 4LNYA 3AXMA 3M16A 1F2JA 5A1AA 4JFKA 4B3ZA 1H11A 2QUVA 3GDTA 5L6UA 4JTIA 1GOWA 3EZ4A 3KBSA 2FHCA 4ODPA 4MWAE 3OQ8A 4IX0A 2PDYA 2ALDA 3QQWA 2XIQA 3LBOA 3A4JA 1LCOA 2I7GA 2Y7GA 4Y8EA 5EMUA 4IFOA 2C7FA 2IXUA 3TU9A 5DY2A 1LTDA 2WBKA 4L80A 4MNLA 1I75A 7PTDA 1XXXA 1GOXA 2KE0A 4US5D 2D2OA 5I3FA 2ZE3A 3OGVA 4Q4MA 3JYJA 3ZVIA 1BVNP 3GXIA 4UQAA 4YJ5A 4LB3A 4QDMA 5T26A 2X09A 2P0OA 4BQ4A 4K1GA 1H1ZA 1FKWA 1WDWA 4GYPC 1EQCA 2CLMA 4MSPA 2EXOA 1BYBA 2VKZG 1QASA 2HS8A 2ZZ4A 4PUNA 3DECA 2YCIX 2DW6A 2NVAA 1RA5A 5EMYA 3VX1A 3EXRA 3UZ5A 5DY3A 3GU2A 2Y62A 1B4KA 1ONXA 4E38A 2D1ZA 3PHAA 2R1NA 5BXRA 4I9MA 3KADA 3WQCA 2C13A 4HA3A 4AISA 5FCZA 2R14A 3L21A 1EJRC 2XWDA 4KWOA 3H12A 1M5WA 2PD5A 3LM7A 4UFMA 4MMWA 4S3DA 1H5YA 4JFIA 3IJQA 2YL6A 5FL0A 4HZ6A 2B7NA 1OC6A 2PGFA 3CK5A 1PTDA 3VOFA 3PSVA 3F4NA 4XTDA 3L9CA 4G6CA 3W37A 3EDDA 1L8PA 3MI3A 3KUMA 2GOKA 3B0PA 4GH3A 2E4TA 1C91A 5FJOA 3KAIA 3VDCA 2PDXA 3EXSA 1ADDA 2AAAA 1U1HA 1WPCA 3SN4A 3LCXA 3MMUA 4YCOA 3WLQA 4MYXA 1A5LC 1CCWB 4W8LA 4NZCA 4GC4A 4HCDA 4IIBA 4PYSA 3ORWA 3UXLA 5BCAA 2YCKX 4FX8A 3BGAA 1IIGA 4FLOA 4PR4A 3S5SA 5DO2A 1ROUA 3GR8A 2WJFA 4Q8PA 4Z1DA 2ZADA 4B4HA 2WMGA 3G1AA 4OUIA 3W75A 1S5TA 1WE5A 4D6HA 2BGNE 1DWIM 2Q09A 2I5QA 1ONWA 3BARA 3CNYA 4NHVA 2ZOXA 4KWWA 3FA4A 1UQZA 3GFYA 3RDKA 3U2CA 3MHGA 2Z6JA 3I65A 4DRPA 1OF6A 1PBGA 4ZOAA 3W26A 2XISA 3EEGA 1GVRA 5AHNA 3FAPA 4DUOA 4OU1A 2PDUA 2GQ8A 3PZQA 1J96A 1HFBA 3W00A 1P0BA 1GQIA 4ZFCA 3TWBA 5G4EA 3UERA 3OHMB 2X0SA 5FI8A 1XS2A 1JJKA 4QP0A 3G18A 3M41A 3PFRA 3P14A 1NU5A 3TROA 2I57A 1V03A 3W23A 1NELA 1DE6A 1ZP4A 2V81A 3F5LA 1YRRA 3UQAA 3M43A 3WZ0E 3U2ZA 3UCDA 4PBGA 3LBMA 3D5HA 1TG7A 4H2CA 1VYRA 3FVDA 3QQ1A 1Z9AA 3M7WA 1LF1A 4XD3A 5D9NA 3F1QA 4HKPA 4HGXA 3EOEA 1BWLA 2DZPA 3VUSA 3OA5A 3W86A 2DSVA 4Q4PA 3GQYA 3SQLA 4U3AA 5KZ6A 1HO1A 2WHKA 4HHMA 1E4LA 3W25A 3N18A 2Y5SA 3WD2A 2H9AB 1RD5A 2V2DA 2O9PA 1CXHA 5EMKA 1ME7A 4CEUC 4EACA 3MUAA 4Z1CA 2G95A 1VFSA 3GDBA 2ZRYA 4N19A 4NVTA 4B91A 3SQSA 3S9ZA 2F84A 4KESA 3NO1A 1VHCA 1Z42A 1OZMA 1NWTA 3N25A 2R82A 1TMHA 3WH7A 3FYPA 5DMLA 5I24A 5FIPA 1QI2A 4LBRA 3SCVA 4LX4A 3SRDA 1R7AA 2C1HA 4CNNA 2VFFA 1SZRA 1RZMA 2FKEA 3NI6A 2V3FA 5I3IA 3F4WA 4HP5A 2YDSA 4OKDA 1MYRA 5EL1A 2EEXA 1N55A 3QC3A 2YDAA 2IKHA 3HBLA 2JALA 1I45A 3WQ5A 3T0CA 3QM3A 4NAFB 5F2IA 3ZXWA 2QVNA 4ZXOA 3V5FA 2Z1SA 1S2WA 3DHPA 3FA5A 3TDBA 1U22A 4OFCA 3I6RA 4NZ5A 3OJGA 1Q7ZA 3GDKA 1EP2A 4HHLA 3N3TA 3W73A 2FGZA 2C91A 3S5YA 4FNRA 1QRQA 3RNDA 4KS0A 3BLIA 3MY9A 3IARA 3MDWA 4IIHA 3W1AA 1TVPA 1B6CA 1QNOA 3WF3A 3U5YA 6PTDA 1GEHA 3N9RA 1BKFA 3VNLA 4WIWA 2OFJA 2HEJA 2VURA 3S42A 3AU6A 1TE1A 2FB3A 4PTXA 1JIBA 5BXTA 3VIGA 4AZ6A 3A4AA 2VGGA 3VGFA 1H09A 1LG2A 3PRAA 5HOSA 2DUXA 1MNZA 3VIMA 4LCRA 4BF7A 2AMXA 3GH7A 4FOKA 1U5JA 4WK9A 1MW2A 2X1UA 4P7NA 1VB9A 1FXQA 2BXZA 1O60A 1V08A 3GAYA 3PBYA 3GAKA 4PEKA 2A7PA 5AC4A 4MKSA 4QG9A 3KS6A 1GZ1A 1YKWA 4FOJA 1O5RA 1ZBCA 1DQUA 4DYKA 3BOLA 4IG2B 9RUBA 1KCXA 2E5CA 1REQB 3LCGA 1PL9A 4K3ZA 3VYLA 5A2CA 3VKAA 1JCNA 1DYSA 3MSRA 3WNMA 1RBOB 4OV9A 4JEQA 1EEXA 3NL3A 4DBWA 4KH2A 3MBFA 4JNYA 6TIMA 4HU8A 2F38A 3N15A 3PAJA 5HKGA 1OJXA 4TW8A 2WSPA 4W7VA 2QUUA 1CXLA 1B0IA 5E9XA 3PBMA 1ZY9A 2G3IA 4X22A 2YLLA 1M7XA 4C6MA 3HU7A 2CLOA 2B0MA 2EF9A 4GIAA 3THDA 1CX9A 1FFRA 1H60A 1I2NA 5REQA 3LUTA 1Y5VA 1IZCA 4MSSA 1KBJA 1X8CA 1BF2A 2W6RA 4DJDA 5CKSA 3TP4A 3JVAA 4HD5A 1K8YA 4A8RA 4HPGA 4G2DA 2ISDA 2VZOA 2MLXA 3W7KA 1U1JA 4DRHA 4BWLC 5HMSA 4GO9A 4E8DA 1UZ4A 4Y9PA 2ZC1A 3V18A 4M19A 1E0XA 1YBQA 4I7UA 3TJLA 3OQEA 1UKTA 2PTXA 1O94A 4PULA 3WMSA 1XUUA 3ZVHA 1WXZA 2OEJA 1OX6A 2GPTA 1XFBA 1HQTA 3QPEA 3O0FA 1V7AA 5FJPA 1FDZA 4Q4SA 3Q4DA 4QJ3B 1MEHA 2WZTA 1NSJA 1XJBA 2A21A 4RV8A 2C71A 3T81A 2H8ZA 4WY0A 3IJ6A 2JK2A 3MKKA 1L0PA 1VBUA 4R7OA 2QIWA 4FI4A 1W17A 1R3RA 3AFBA 4NNBA 4FA3A 4R7WA 1JPIA 1PDYA 5I98A 1W54A 1JXJA 3VVGA 1FHUA 3AHXA 4XAYA 1HL8A 2QV4A 3NL2A 3KVKA 1M7PA 4WLCA 1GW9A 4A8NA 2XVNA 1O68A 4YS1A 2MNTA 6XIMA 1A5MC 1OT2A 3HF3A 3DYMA 1I6NA 1LQ2A 5MF5A 1WB0A 2WSRA 1KV8A 2TRSA 3OEXA 4IT4A 4FXRA 4TVUA 5FSEC 3BOXA 4IIEA 2YX0A 3BQ6A 4TVDA 1ZU8A 2Z1XA 3T07A 3KRSA 1GVIA 2ZFAA 4WSHA 4C7FA 5T8GA 4K2SA 2PE4A 4L3NA 5AN7A 2HROA 3L0GA 1P0DA 3ZOAA 2GJPA 3RO6A 5CEWA 1XQLA 1GNXA 2DVTA 2GWNA 5C8BB 3BK0A 2X7VA 3S2JA 3WNNA 3COTA 4LJ3A 3PR9A 1ZL1A 3KZ7A 4GZJA 4N9EA 1VFMA 4PSPA 3VU2A 5DFAA 4EANA 5HUPA 1W5QA 4ZCWA 2VDHA 1NIUA 4ATDA 4A4AA 5LA2A 3TN3A 2J47A 4XBJA 2WKJA 3C61A 5A8PA 3IHZA 4IT6A 4H6KA 2HNEA 4DJFA 1YYAA 2DSWA 1JDAA 1LLZA 3FSTA 1JI2A 1LL4A 4PN2A 4A8LA 4JL1A 2QUNA 3LU2A 4IPJA 2WNNA 3V5OA 4M0XA 3VIFA 1GJPA 2UWFA 1TWSA 2A0NA 4ZQPA 2ZRWA 3CTLA 4PZVA 2VFHA 2PWDA 4U86A 1RD6A 4OT7A 1PIGA 5IFPA 4LAZA 1F5ZA 4XD4A 3W53A 3G1RA 3PTQA 2XN1A 1YDNA 4EIVA 2PTZA 2E28A 4GA8A 1S2AA 1XCWA 1HUVA 2GUBA 2J6VA 3IWPA 4YTUA 3AWOA 2YOCA 3RLVA 1MWOA 1PIFA 4JIPA 2D3NA 2TMDA 3W74A 2WM1A 4XG1A 2ISFA 1YHTA 3SDOA 3WQVA 4P8WA 2VX6A 2VXNA 3GNNA 3GW3A 3M47A 1WOAA 2ATMA 4RZBA 3OOQA 1V77A 3WLTA 3GK0A 2EJ1A 4JIHA 3SN0A 4UTLA 1YADA 3WYZA 2BNJA 2NVCA 2ZA2A 5TNVA 2ASHA 1S3TC 2B31A 1OZQA 5CGQA 1A5UA 4WX2A 4YVXA 2XUCA 2ZZ5A 4GNKB 2J27A 5D8ZA 3UI6A 4TMCA 4PCSA 3MMDA 4R9OA 1CGWA 1A47A 3H2EA 2E40A 3GTXA 4HJWA 4J35A 4UMAA 3NZRA 2NW0A 1K4HA 3FJLA 4W9OA 1KGXA 3G0XA 6ALDA 1US0A 4H6RA 3GFZA 5GJNA 1POJA 1TPUA 1P6CA 3N9KA 3AHTA 4F0MA 1WDDA 1T99A 2E9LA 3FKKA 4GVIA 4N9DA 1JCYA 3DI1A 4IH3A 3QV9A 4MWAB 5D2TA 3FHQA 1XIFA 1VFTA 1DE5A 3M6DA 2A7RA 1TCDA 3PZ9A 1E4IA 4JFTA 2OLSA 1Z3NA 1JNSA 4R34A 3PWIA 1TV7A 4D6GA 2QCMA 3VGDA 1TTQA 1M68A 1X8FA 1V6YA 1H7PA 1XHGA 1V0MA 2DY3A 3QGAC 3UEQA 2CLEA 1FKXA 4ZL1A 3L2IA 4TX8A 1AD1A 1XLJA 1C9WA 1LRQA 1K9EA 4Q33A 3WQ4A 4NJJA 3GG0A 4JQ1A 4O12A 4JIIX 3SI9A 2QDDA 1ZUAX 4C5ZA 4D8ZA 2XPBA 3B8UA 1RQHA 2ZRZA 4HB7A 4HPNA 5CPSA 3HGJA 3SM0A 3UYIA 1Q7MA 3F4DA 4IISA 5U7SA 2VC6A 3AC0A 3CAWA 1NH6A 4I9JA 4E4FA 2F21A 1BVZA 1YPXA 2QVHA 4AX6A 5CGMA 3KXQA 1XG4A 4H01A 3QYQA 4IL0A 1U1UA 1KWKA 3M07A 3P82A 3T55A 2GSHA 4AAJA 5A6MA 3OYZA 3N4AA 3KAGA 1F8AB 3JS3A 3WEOA 2WVUA 4HSOA 1VQTA 3GE7A 3L12A 3TONA 3TMQA 4DWSA 1OCNA 3BCDA 2IQ0A 4WKAA 3RF9A 2LGOA 5BU6A 4QNEA 1NWRA 1P48A 1XPYA 4J3TA 3NPUA 2Y24A 1I1WA 3O5QA 3TYCA 3TNBA 3L4ZA 4ZE5A 4ERIA 3RM9A 3MJYA 3PVFA 2TPSA 3CBWA 3PPHA 3THAA 4YU1A 4X2RA 4QAWA 4LCQA 4EXBA 4LAVA 5U4NA 4ZO8A 2DG4A 2H9AA 3BZGA 4LUIA 1EIBA 1EIXA 3LG3A 1HW6A 1XLMA 1LL6A 4OTKA 2ETNA 3VNJA 4FX7A 1WUFA 4DO5A 4FR1A 2CU0A 3I3BA 4UQDA 4LF2A 5BU9A 1DIOA 3REQA 4NL1A 1Q4WA 1XGDA 1MW3A 1ODZA 4JYDA 2W66A 4TXEA 1KM1A 3FNDA 3W2LA 2PLKA 1EDTA 3NGFA 3EMQA 5EB8A 1J2BA 4DJFD 2F6XA 3TMLA 4GVFA 1KR1A 1PSCA 1HXJA 3SQMA 5IBXA 2Y4SA 2OFNA 2G96A 2BP1A 4HYRA 3TC3A 3V1PA 4UQCA 3K8KA 4TOQA 2Q8LA 3WNLA 1NQ6A 3TNOA 1YNQA 4JTQA 2YA0A 3W83A 3H2MA 3NEHA 1RA0A 1KCLA 1J93A 4RCXA 3HURA 4IT1A 1X98A 5DX7A 1GG0A 4NUWA 3H21A 3TUUA 2WMKA 4PUDA 1R85A 2FDMA 1W32A 2Z25A 1E6XM 4KIRA 2BOEX 1ZJIA 3AIBA 4QDWA 5G1MA 3WF4A 3VGEA 1W1ZA 3OP2A 2F7FA 4NT0A 3WN6A 1KBBA 3APGA 5D33A 3M5XA 3B4UA 5FESA 1AW1A 5LNSA 1KFCA 2DT2A 1V4YA 1HX0A 3NL6A 5CPTA 1E5NA 2HJPA 2ZUVA 2WOQA 1E1FA 1T11A 1KNWA 2D2GA 3NUKA 4TX0A 5DCEA 3O07A 2FMNA 4MGGA 1HKJA 3S8HA 4N7QA 4N9BA 2CKSA 3S4TA 4IJRA 4U85A 1HKWA 1R7OA 1OADA 3GC4A 5K4ZA 2JKPA 4LAKA 2P1FA 4Y9OA 4BS0A 4QT2A 2VEKA 1FWCC 2JGQA 3QLDA 4MAZA 1J5SA 4E2VA 2QJMA 3IIOA 1PX4A 2PLMA 2X1TA 2Z4GA 3USZA 4XSLA 1JDFA 2WCSA 4L5ZA 5FJTA 2GGGA 4R3UA 3CHVA 4AWTA 4Q7BA 3JR2A 3ZT5A 2CLIA 5DXXA 3IIXA 1DXEA 2ABAA 2XPAA 4OBSA 4FNSA 2QDGA 5BRQA 2XH0A 1ZJAA 4B5TA 4XVEA 4C7DA 2CERA 3EWCA 4H4IA 3MVIA 4NZJA 4O0ZA 3DKLA 3O63A 3P3BA 2O9RA 5HUOA 1J11A 4O19A 4M3PA 3EPMA 2QT3A 3E0FA 3PNZA 2XJ7A 3QMSA 1XC6A 4IPXA 4UTWC 1YDVA 2EPHA 3QGKC 1Q6GA 3OA3A 4EP8C 4A8IA 1K6AA 3UG5A 2ZBTA 2G3FA 2ZXBA 1UR3M 4ZENA 2F6UA 1VBJA 3D3AA 4ORIA 3ODKA 1ROTA 3MZ2A 3R0KA 1QK0A 3N2OA 3S47A 2W9MA 1RJRA 4MJMA 1QR7A 2MLYA 1IE7C 1US3A 2BY2A 2W67A 4DPQA 3WD4A 4LUSA 1XF0A 1UR8A 3A12A 3L5AA 3F5KA 5GJMA 3MUY1 3B8DA 1GJWA 4ZVJA 1SW3A 3MO4A 4AEOA 4E8GA 4HNUA 4HNLA 2ZX8A 3WH6A 3W82A 3NXLA 2VEPA 1NOFA 3NZ1A 3SN1A 2R6OA 4J5NA 1E56A 3W6MA 1AW5A 4XIAA 2F8QA 2J8FA 2ZUNA 1KRCC 4IJBA 4AXNA 3ALGA 4WJEA 1FKIA 3KTSA 2RKXA 3VM5A 1LRTA 3EX3A 1FP9A 2F2DA 2UY5A 4LV9A 1QW9A 4ICMA 2NQ5A 4DWDA 5CLWA 2JKAA 1Y0OA 4DVOA 1BGGA 5HK4A 1EZ2A 3G3MA 4ZSUA 3H4WA 2VR2A 2WZEA 3FGCA 3N34A 3ZS4A 1ZAHA 4EAYA 1W9VA 4F2UA 3E2RA 1LLOA 3VOIA 1LJYA 1IZJA 4GO8A 3CZEA 2G50A 4K7VA 2BOFX 1PCWA 1E6NA 4JIEA 1GYLA 4LEFA 3KACA 4OBRA 4BY3A 3NRKA 4PMQA 4JQ3A 3WJXA 1QWGA 3KBMA 1R46A 2J79A 1A0EA 1X39A 3GVRA 5FOOA 3R58A 4ZMGA 3VKJA 4F2BA 1FFQA 3VNZA 3G77A 4UNLA 2Q3OA 4UTKA 1HJSA 1VZWA 4PA8A 5JXQA 1B9BA 5IXEA 4IIDA 3UVIA 5MKGB 2ZTJA 1CB2A 3QR0A 1P0KA 1LOQA 1TJ1A 4DXKA 1DJWA 3CL8A 3VOJA 4LVAA 5C7VA 1FCQA 2GVJA 2ZUUA 1W5OA 1GYNA 4S3FA 1UUQA 2ZCGA 3VNMA 4RDYA 4AC1X 3I6CA 1YPFA 2JKEA 4Y9AA 1E6ZA 3FW6A 4K6AA 1QBAA 3VE9A 3NYDA 5D32A 1LL7A 4DBEA 4QQUA 1OK6A 3GNRA 3CB8A 1TZZA 3I3DA 3UG8A 2W79A 3IRDA 4NZ4A 4LNCA 4L9YA 4ZTYA 4GUFA 2AL2A 5D2WA 3R94A 1XBZA 2ODOA 4WZHA 1VFOA 2QZRA 3PK7A 3LXAA 2ZE0A 1GTHA 3AO0A 5K4XA 4RXGA 5IFTA 4F66A 3FJ4A 1ITXA 3A5VA 1JF5A 3WH0A 1LWIA 3CV6A 1EC8A 2CBUA 6REQA 4C1LA 1WDQA 1MEIA 4PH6A 4GY1A 1QI3A 1XYBA 1PWLA 3TEVA 1CT5A 2CIPA 1KT0A 2YGYA 1H51A 3GXFA 1JYWA 4CU7A 2XU2A 1K8XA 2D3LA 4JQ2A 4ZODA 5LIYX 1GRJA 2PPNA 5C9XA 2XIIA 4HYWA 1D3HA 3N04A 2PZ0A 3JRKA 3OZOA 3DDMA 4JY9A 2R1KA 3UQNA 1PKNA 2OCZA 2RGMA 2BHUA 2E25A 4K68A 3BH4A 3S9YA 3HJEA 2VZVA 3MHUA 2DIEA 3OYXA 5AZ0A 4BCEA 1OBAA 2WMIA 1GQJA 5T91A 4ACZA 3GTHA 3EDJA 5I5RA 3QEZA 5D9MA 2GVGA 4NJKA 3GDRA 1JZ8A 3KVJA 5CZKA 1IWPA 3UGRA 2C19A 3K4DA 1G4TA 3FKRA 1EO7A 1H7RA 4C6PA 1S46A 1D3CA 1XIHA 2IXVA 4E2OA 1T6MA 2NZLA 4DB7A 4ODKA 2PDCA 3AHVA 3CO4A 4HA0A 3VNDA 4M5PA 4CN4A 3I68A 3E12A 1XIJA 3W70A 3B0XA 4MNJA 3BW4A 3GR7A 4GVHA 1TELA 2DG9A 2PDNA 3E2VA 1VEMA 4RE2A 2PDLA 1E9LA 2GJXA 1PIIA 3MVTA 1UZDA 2HTMA 1FKJA 4QRNA 1GKPA 5PTDA 4MZ8A 4TX9A 1EL3A 3K13A 2ZTKA 5AHMA 2NSOA 4MLJA 2X8RA 1NARA 4JQ4A 2PP1A 3ZWTA 4K36A 1B3XA 2DT0A 4GFIA 5IHSA 3CZ8A 1LBLA 2X2GA 1CGXA 3CZKA 3ZWSA 3ARVA 4Q32A 3PF3A 1JGIA 1XV8A 3EX2A 2J66A 1KLZA 2PBCA 2XP5A 2NXHA 4DWSB 2POTA 1ZCCA 1UWQA 2C79A 3OLEA 3NGJA 2CLLA 2XFRA 2RJGA 4KF1A 2XFWA 3RG6A 1Y5WA 1CGYA 2PGRA 4O50A 4GZEA 3N2TA 3AYSA 3LRKA 1A53A 1E0VA 5BOOA 4FR6A 1DPMA 4J2PA 4DNHA 2VQUA 1XIIA 1VJIA 4AD4A 3BAKA 4AIOA 1RBAA 1M53A 1JNEA 1GQKA 1P5QA 1FDJA 4F0LA 4RLIA 3PBGA 2HRWA 3DYPA 3AIUA 2EPLX 4S3EA 4EF8A 4DXVA 5DITA 5I6SA 5KITA 1EOKA 1FKGA 4W9TA 2TYSA 3W38A 2BS9A 2EHHA 3E1F1 3MO7A 3AQUA 5HDRA 4DYEA 2ISWA 2FKPA 3GXNA 2PTWA 4HSHA 3C3UA 2VNCA 1FCUA 4ZQOA 3OVQA 3DFTA 2J4GA 3GNOA 2QLYA 5D8WA 3CV7A 2Q02A 1ME8A 4ZPVR 1R8LA 3P8IA 3R8GA 5I03A 4IL2A 4GQ0A 3SCSA 4EAMA 4L4OA 1RVKA 1QZ2A 2PWHA 3LK6A 3O16A 5J6EA 3STEA 3EY6A 4RNJA 1BVWA 3H4XA 5C0QA 4K39A 4NASA 3UETA 3MA8A 3N2BA 4PB5A 1L6WA 2GDUA 2WCAA 3VD5A 3M5VA 3PN8A 2OSXA 4TV6A 1WNOA 4RNIA 2XFFA 3ZM8A 3LPPA 2C16A 3HOJA 5D38A 3NQFA 4GQGA 4L1WA 3IJDA 1ITUA 4RPQA 3DI0A 4JTSA 4K8HA 1JAKA 3ANUA 4WJXA 2OG9A 1B90A 3NFUA 4HMCA 4BF9A 4XUYA 1VFHA 4RXFA 4PB3A 1S1RA 5CC6A 3TX9A 3D0CA 3DESA 3CHEA 3W2UA 4CUCA 1AZ2A 4FSAA 2YBTA 3ANYA 2Y5EA 3RLHA 2AKZA 4LUTB 1A4LA 2W62A 2J9XA 3P2VA 1J0ZA 1JEZA 1S5NA 1A3XA 3S2NA 4IQEA 1XKJA 1LQ0A 3WQFA 1OYBA 1P43A 1B9ZA 3EKZA 2OYMA 2ABBA 3WL1A 3LSCA 4F2TA 3EWYA 3NM1A 1SGJA 5CC7A 4QG6A 3W88A 1XQKA 4F0SA 1GHSA 4KCTA 4MTVA 1MUMA 1ITCA 4UIOA 1EJSC 3G1SA 1THFD 4HZMA 1H49A 2P53A 1XPGA 3MB9A 1FWGC 5I79A 3CL6A 3GH5A 2G8ZA 1RLCL 4RX0A 4DUVA 1FKTA 1BTMA 5A6SA 4JTGA 1EA9C 2JIEA 2OOGA 3QBUA 2XN2A 4AB4A 1BSIA 1MVYA 4ZPTR 2QCLA 1ZRQA 3DERA 5BOFA 1ZGDA 3KAFA 4KR0B 4B90A 1O4UA 1A49A 4MZYA 1GPFA 3M0ZA 2IMRA 2V63A 5I00A 4IGHA 4JTJA 2VELA 2WW5A 3A23A 1P7TA 3B9DA 3H9RB 1PZ3A 2PPOA 5KZEA 4Q6JA 2ZX7A 2PZNA 1GCYA 3JW7A 3S83A 3PNUA 3N2XA 2DEPA 2J78A 4PMNA 4DN1A 3CLMA 4NRRA 2HNHA 3THCA 5HR7A 4L4LA 3RUBL 1PCKA 1Z32X 5DANA 3OVRA 5E6YA 4PEEA 3M0MA 1KQYA 2NV2A 1RUSA 1XRFA 3C5QA 2X40A 4U31A 3WD3A 3CV1A 4B9YA 1KBIA 3DN5A 5JH2A 2OZ3A 3TDFA 4PUEA 1ICQA 4KEUA 3DGRA 4J28A 3M0KA 5T9BG 4JR5A 2EPMX 1SJCA 2FGLA 4UTFA 1KM6A 2G37A 1KKRA 4C90A 2C8NA 3Q94A 1S38A 1PDZA 2YKKA 4W86A 4AY8A 2C15A 1DORA 1UH4A 2VENA 3ARWA 5LGZA 4UMBA 1XYLA 1C92A 4L6HA 2ZXAA 3W2MA 3GG7A 3WLRA 1JNDA 1IWBA 2Y1HA 4FNQA 3AUJA 3UXAA 3CQIA 2VCBA 4BEQA 3SCPA 4HHPA 3SY1A 4P7LA 2JQXA 3QKZA 5FKYA 3PG9A 4B2DD 3SECA 3LHWA 2DUAA 4IP5A 3QRHA 3B06A 2CXGA 3LPGA 1ZK6A 3B8WA 3CUJA 3R13A 3ZIZA 3Q58A 3O1NA 1T96A 3BLKA 2ZUWA 3S2LA 3CQ0A 4QR6A 4QLLA 3WLMA 3CHDA 2WWCA 3RYSA 3ITVA 1W6TA 2ZZ2A 3BOFA 3Q2DA 4QLKA 2XIOA 3R11A 3EKGA 2BVTA 2G0WA 2GOUA 4PUMA 1FWJC 4ACYA 4AWEA 3P0WA 3S6OA 3RILA 2A3HA 4HU3A 5HWBA 5LGXA 3C52A 5FF7A 1EUNA 3GD6A 3K8LA 1JQVA 3FA3A 1S5MA 2PPGA 1UYQA 1E6SM 2OYLA 2CBIA 2WXDM 2P76A 2ZR4A 3EOSA 4WXZA 3G8EA 2XP4A 3WELA 3WDRA 1I2QA 1UA7A 4FXSA 5KSWA 4W5UA 5CQ1A 3IUDA 3QOMA 1XH1A 3IIZA 2CITA 1E6QM 4DRQA 2QJNA 2YXOA 2R1PA 4IP7A 4DAFA 3ECQA 4WXYA 1VBGA 1XX1A 3DC8A 2FZ9A 4HOZA 2FFIA 4QJ1A 3SR7A 1O1ZA 1J0KA 1KXHA 2NQJA 3DBPA 3MP5A 2J8GA 4J3UA 2EJAA 3TCZA 2R24A 2Q8XA 1DL3A 5HATA 4GPNA 1VD6A 1IEXA 2WNWA 1F40A 2GJRA 4IPIA 4R85A 2X0HA 4V15A 1ONRA 4WDWA 3PRDA 1VKFA 1SO6A 2NWSA 3UZXA 4XAKA 4X61A 1CEOA 3K4WA 1E6PA 1KB3A 3KLKA 2CZDA 3ARZA 3MT1A 4ZB2A 4UNKA 5A2BA 1DXIA 4H1ZA 1TV8A 3GVGA 4ZO6A 4B4FA 1SZFA 4W8BA 2QMKA 4GUIA 4UFJA 2GLKA 3WLNA 2X16A 1U5VA 2X0YA 5J8LA 5BYWA 4L4PA 1JCTA 1T41A 1CXKA 3BMXA 4OUEA 3OVPA 3BUVA 4JKLA 4GABA 3FEQA 1HGWA 3DHDA 1XRSA 1G9HA 1ONEA 1JCJA 4V27A 1NSGA 1QK2A 5J5RA 4DNMA 4I7WA 4MB4A 3FSUA 3RX3A 5BOEA 5I23A 3M5YA 4GGBA 4S3BA 1JNTA 1R6WA 3BZJA 5HA7A 3ARPA 4LXFA 3CLWA 4H9XA 1UR0A 3U48A 1FY6A 1Q5MA 3N4EA 3TE9A 4KGLA 1Z69A 2Z1KA 4AD5A 1XR2A 4LAWA 4GBDA 3CAQA 2IKIA 1TTJA 3HGSA 3FYOA 4RNFA 1AL7A 2Y8UA 1MQQA 5HR6A 4DBUA 3QHNA 2LJ4A 3R89A 1DV7A 1IHIA 3MCNA 1JPMA 5HJYA 1Q4NX 1SZNA 5TAOA 4AEEA 3BLFA 1JZ4A 1EYWA 2A4AA 4UNIA 1KFWA 3V0UA 3K46A 1JAEA 2ZDSA 5LXEA 3T1GA 1N8FA 3UXDA 1H4PA 1E1EA 2XVLA 2HE8A 2A1YA 3WEMA 1J4RA 1Q6RA 3UI4A 2XH7A 3RU6A 4IGMA 4YPJA 3WG6A 1UKOA 3N19B 1BF6A 5EGRA 5CSUA 1RCXB 1VCFA 4JFLA 3SGZA 1YMYA 2X1RA 3N2MA 1Q6QA 2DGAA 5A69A 4ZOBA 2Z26A 5G2IA 3C2RA 4QHRA 2D0GA 4XVDA 5FJUA 4UR8A 1I2RA 3IJLA 5AVHA 1DHPA 1BWKA 1KFKA 1M7OA 2PV1A 5EBAA 4QQ3A 2F2HA 3NQEA 4PMVA 1BG4A 4CQ9A 1OC5A 1W1IE 3AS1A 3AMCA 1XM3A 4ADUA 3CAVA 3TLQA 5D37A 2GQ3A 1FVPA 1D6OA 4XAFA 4ZQCA 1MXSA 1O6IA 4CU6A 3A5FA 3WMBA 4R7JA 1L6YA 4LS1A 1KXQA 3H7UA 4O1CA 3V0SA 5SWUA 1OFEA 4C1NA 3F2BA 5IM51 4GWEA 3P7YA 4OBTA 4G7FA 3H8AA 3V3WA 3W81A 3KOYA 2V2HA 4CNSA 2WVVB 1XUZA 4H00A 1H50A 4OJYA 4GLEA 1DOSA 2B5UB 3BGGA 1YXDA 1Z41A 3TTOA 4C1KA 2QS8A 4XKYA 1JCMP 3P80A 2FAPA 2PGWA 3IKDA 1QNSA 3VIJA 3TN5A 4QE5A 3HV9A 5LNVA 4KGJA 3AALA 2VX4A 1VIWA 3O5EA 2GSEA 2C0HA 3H2NA 3UGVA 1P0EA 3B04A 3UWWA 2O56A 3UZJA 1XW8A 1BD0A 3WLJA 5H8UA 3MSDA 3CH9A 4EPEC 2PGEA 4O8AA 4O16A 3NVTA 3R25A 1T7LA 3S2CA 2HVOA 1TQXA 3INPA 2E8YA 3CAKA 5AC6A 1W9UA 1TJ0A 3HFYA 3LHYA 2DZBA 2LPVA 3SUTA 4PBEA 3S1VA 4CQBA 3LN3A 3KZPA 2Z2AA 3JYMA 5CSSA 4JTRA 5I3DA 2YCLB 5DXYA 4GCAA 3C2EA 1G0CA 2HWGA 3GTFA 3N73A 3EDEA 2DP3A 4DQWA 4K8GA 1ELSA 2FJKA 1TPC1 2RDUA 3NEVA 2JE8A 4JAWA 2VM8A 3H55A 3L7RA 1E6RA 1DWFM 1EO5A 1I2OA 5TF0A 1HL9A 3FAWA 1XLDA 5CPOA 2WMFA 1JULA 2FVLA 4DT4A 4JX5A 1GZJA 3L0NA 3KCEA 4HBEA 4DXXA 2XFYA 3QY7A 4KCUA 3C2VA 4HPHA 1E9IA 4RZ4A 1GVOA 1JZ3A 3LI1A 4NAFA 3T44A 4UUIA 3B7XA 4F8XA 3S5NA 3STGA 2E1DA 2IPJA 5F2LA 3H26A 1UROA 4A2RA 1C8VA 4MNKA 3KS5A 2VFGA 3G3DA 3WKZA 2GDVA 4FXFA 3W07A 2YB1A 3TJ4A 3KWXA 4A3HA 2O9TA 3AUOA 1FQ0A 3NZQA 4S1FA 3PSWA 3WDQA 4MWAD 1UOKA 1UB3A 3BPWA 1DWHM 4MG4A 2R1MA 4TR9A 4IZGA 4DLFA 3ABXA 4U5KA 4DF2A 1NDZA 1JUKA 1XISA 5A6KA 1JDEA 2CKRA 1RP8A 2GUUA 4O0KA 3A6OA 1EJ7L 2E1WA 2HBVA 1FKSA 1I8JA 1G1YA 3EA2A 1FWSA 1TB3A 5C55A 5ABTA 1WCGA 2WANA 5E0KA 3ZR4A 2FPTA 4C6QA 4DX3A 3TXVA 5XINA 2VC9A 2KO7A 3IK8A 3C6CA 2VEFA 2Y8KA 2AGKA 4UTJA 1GVFA 4M56A 2PP3A 1F6YA 2GGHA 2D69A 3CPGA 3M44A 5EBUA 4ODMA 4C6BA 2XIMA 3NZGA 1XIDA 3OB8A 4C5YA 2WPGA 3I6TA 1DWAM 1EUAA 3DBNA 5C2CA 4AD2A 3W1XA 4HZ7A 3LMYA 3ES8A 3LYEA 4US5A 4PUKA 1W9DM 1XGZA 3GXTA 3S1UA 1D9EA 2GJLA 2ZRVA 3TV8A 1B31A 1L1PA 3W85A 2YYUA 2DH2A 2VGIA 3H23A 2OODA 3WL0A 3A13A 1KC7A 4H3DA 3QZAA 2IUZA 3N3MA 1W8SA 4QJ4B 1HJUA 3A4WA 4UZUA 4IHCA 2DZXA 1ZLPA 3PUGA 5CPMA 1TWDA 4Q8WA 1I60A 2V6AA 1K7EA 2HZGA 2WJEA 7REQA 1FHDA 4FIRA 1L9WA 4UCFA 4WJ8A 1CYGA 1MNSA 4L6DA 2O7SA 3W7QA 3T9PA 3WBYA 1PX3A 4AU0A 3RIKA 1ZENA 1C9HA 3RITA 3GKAA 2CZEA 4FEZA 3RMEA 3W0KA 4IMCA 3R8RA 2NQLA 2WLZA 4LTSA 2BASA 3MBDA 2FTWA 3SBFA 2HSAA 1BPLB 4AY1A 1OINA 2ISVA 1TIMA 1Z6KA 2OMAA 4Q4RA 1VEPA 2J7CA 4UFIA 1VFFA 4E4UA 2WHLA 2ACQA 1J0YA 2I17A 2VMFA 5A95A 2XP7A 3CASA 3EBVA 4BF8A 4H83A 3CYJA 5M17A 4ZOCA 3VUPA 2V0TA 4A3YA 2GK1B 4I8DA 4AHOA 4UDMA 3IRSA 4JFVA 4QE1A 2W0UA 3P67A 1SFJA 4UQEA 5D4YA 3KHJA 5K9DA 1GVYA 2C14A 3T0DA 5AYBA 5DLCA 2VEMA 3HN3A 2WKLA 2V5KA 3BANA 1EKOA 4ZQMA 5CAHA 3KM8A 3UNDA 4FLRA 3MUCA 4ZA0A 4LUTA 3OPSA 1GVEA 3VFLA 1DTUA 2UV8G 4M80A 1IWAA 2NT0A 4QZVB 1V51A 1DJIA 3HV8A 4PC8A 2UY4A 4HNTA 5FA5A 2J25A 1NP2A 3DC0A 4G56A 4UWMA 3A21A 2XSBA 4XSMA 3W3OA 4PTMA 1ISYA 2XP8A 3WY1A 3TSDA 4ZZ9A 2XP6A 3KP1A 1A5CA 5EFDA 2FB2A 4D6FA 1CWYA 1AH3A 1WKEA 4QTGA 3WH9A 1HVXA 3E0LA 2HK0A 4UR9A 2VEGA 3RGTA 1P1XA 3N9SA 4AD1A 3OZPA 2H90A 4AVFA 3CQJA 5LNRA 3W6LA 3THUA 4F0HA 5HINA 1HVQA 3BXWA 5A5WA 1QPKA 1S39A 3LRMA 4O1DA 1TPDA 4P2VA 4QITA 1PX8A 1RCOB 2VTFA 1EYEA 1GJUA 1TZ9A 1GG1A 3QPYA 1QNRA 7XIMA 3TFCA 3BSMA 1TQJA 1J6OA 2QUMA 2WZIA 3EEZA 1QO2A 3JZUA 4P7QA 3QOKA 4OIFA 3CH0A 1V3HA 3ZT7A 4S23A 3OIXA 3C3NA 3MUZ1 3MI2A 4QAIA 1XRTA 1R3TA 1O5QA 2ACUA 1EP1A 4DJEA 5J5DA 1KA9F 4IMAA 1GK8A 4RDZA 3CIWA 3PFMA 1JGMA 5HW7A 3DEQA 4B92A 2WV8A 4LC6A 1BTCA 4QSFA 2Y88A 1ADSA 1MW0A 3MQTA 3OTRA 2LLEA 3TK7A 1JPHA 3H54A 3N12A 3B8VA 4RW3A 5E09A 3BJSA 2ITKA 2RUQA 3MU7A 3WLIA 2I5GA 1Q8JA 4HOXA 5EMJA 4BQ2A 4D9PA 1UJPA 2OX4A 1EXPA 3W7EA 2WAGA 3ZJ6A 4AWUA 2PBOA 3IK4A 4ZR8A 3QY8A 3VOGA 5G2WA 2QPXA 3PWGA 3IV3A 1KQZA 1ZS2A 1XH2A 2PCEA 2I14A 1Q2RA 2Q3RA 1UBSA 3CHCA 3H70A 1F4HA 4Q8UA 4Q8MA 3UJEA 1EGVA 4G7EB 3I7RA 4IMFA 1CXFA 1H1YA 3UG4A 1LDCA 1KFBA 3P93A 1B3VA 4J3ZA 3GH4A 4LUJA 1W3KA 4OVXA 5H8PA 2OO6A 1LT7A 4FZIA 1ZALA 1VS1A 2ZYFA 3TA9A 3EOOA 3UPMA 1S2VA 4CCCA 3ZMRA 2CPUA 1XCFA 4V33A 2P3ZA 1FWTA 2E0PA 4XISA 4GX9A 3USBA 2YCEA 1AK5A 2BOGX 5I3HA 2QAPA 1F4AA 4HCLA 1QPRA 4CU8