1JNEA

Crystal structure of imaginal disc growth factor-2
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
400
Chain Sequence
SNLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKHQFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTYGFDGLDLAYQFPKNKPRKVIVDPHAALHKEQFTALVRDVKDSLRADGFLLSLTVLPNVNSTWYFDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIYHPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVATYGNAWKLTKDSGLEGVPVVPETSGPAPEGFQSQKPGLLSYAEICGKLSNPQNQFLKGNESPLRRVSDPTKRFGGIAYRPVDGQITEGIWVSYDDPDSASNKAAYARVKNLGGVALFDLSYDDFRGQCSGDKYPILRAIKYRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of imaginal disc growth factor-2. A member of a new family of growth-promoting glycoproteins from Drosophila melanogaster.
pubmed doi rcsb
molecule tags Hormone/growth factor
molecule keywords Imaginal disc growth factor-2
total genus 145
structure length 400
sequence length 419
ec nomenclature
pdb deposition date 2001-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jneA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1jneA01
3N11A 4H04A 4L4OA 1HXJA 1KB3A 1H4PA 3EDEA 1MFVA 3MSGA 1O6IA 3BGAA 3VPLA 2NT1A 1OM0A 4W5UA 1C8QA 1VEMA 5DEZA 2W92A 3W26A 4F9DA 2BFGA 3ZR6A 1JDDA 3VIMA 2W5FA 1E0VA 1UWTA 2J25A 3T2PA 3GYCA 4LXFA 2QF8A 2X1IA 3EMQA 5FOOA 4CD6A 2VQTA 4TXEA 3PHAA 2XVKA 4F79A 4JHOA 2VMFA 3GZAA 4ZFMA 9CGTA 2D24A 4S3KA 4UFIA 4D6EA 1V6WA 1CPUA 1SFSA 3AI0A 1PPIA 1LLOA 4ML4A 4UQBA 1C93A 4AZ5A 3CLWA 1LL7A 2FHCA 3FW6A 1CLXA 1MQRA 3WDPP 4WF7A 5A6MA 7CGTA 1UQYA 1VFFA 2XG9A 4Q22A 3AYRA 3A6OA 1ECEA 3WF3A 5CLTA 2EPKX 4PMQA 1UQZA 1E6ZA 1CWYA 2X8RA 1VBRA 4JHZA 2EPOA 1VFMA 3AHXA 3EMZA 5E0FA 1JD9A 1JYXA 2WYSA 4AEFA 2XVNA 2J79A 2J77A 1EOKA 1E56A 3LMYA 4GI9A 4ATWA 3QOKA 4S3JA 4L4PA 3UR7A 2EEXA 3UETA 3NSMA 4HA1A 3WDIA 4GPNA 2BHZA 1V3HA 1Z32X 3AIEA 5M5DA 3AS1A 1BFNA 2VC9A 3PZVA 1NARA 2YKKA 1LF1A 2ZX7A 3PZOA 4UFKA 5JH8A 2WMJA 5DF0A 1GVYA 2Y4SA 1KCLA 3MUZ1 1R8LA 4DWSC 1K9EA 2OYKA 2VR5A 2JIEA 2W67A 1C90A 3KWXA 1HF6A 4XZWA 4UQ9A 2BHYA 1QI4A 3W82A 3AHVA 5E09A 1AMYA 5I0DA 1EH9A 5A95A 3VIFA 3BCFA 4EKJA 3AIWA 2X2YA 1HKKA 4GZJA 4Z2KA 3B8SA 3PZQA 2CBUA 2CBVA 2WBKA 1V6YA 3AISA 2J7GA 4Z2LA 4DWSA 1UUQA 2O9TA 1SR0A 2OWWA 1J0IA 3T0DA 1F4HA 3U5YA 3WEZA 3MV11 3KE0A 3RJXA 2XFRA 1HL9A 3LPGA 1E6QM 4KRUA 4P7OA 5A94A 3QR3A 2G8ZA 3F5KA 1KR1A 2Y8VA 4GZEA 3WMSA 4W8AA 4OJYA 3PZIA 4TVDA 1IZKA 1C92A 2QV4A 3N9KA 2Y24A 4JKMA 1MW1A 2WMIA 1WB0A 3CZJA 3T09A 3I3BA 1UR1A 2PB1A 2YLLA 4WIWA 2QMKA 3ALGA 3MMUA 1J01A 1D7FA 2VVNA 4W87A 1JF5A 3K4DA 4C7FA 5C71A 2E0PA 2J62A 4E4PA 3VMPA 3ARSA 4C7DA 3ARUA 5GNXA 1G94A 3OIHA 1XSJA 1Q6EA 3GNPA 1GCYA 2ZOXA 3SCNA 3BXWA 1BYCA 4QLLA 5IXEA 1UYQA 1QNSA 2VX4A 2Y2WA 4W88A 1SYTA 2YA2A 1TMQA 4UR9A 2V3EA 4AIUA 3TTSA 1HP4A 2VI0A 1JXJA 1AVAA 1J11A 2XGBA 2WAGA 2CHOA 2VO5A 5GNZA 3T2QA 1RPKA 1FP8A 1EXPA 2FHFA 3QHNA 2UY2A 5DT5A 3U57A 1JNDA 2ZUWA 4PMOA 2WZIA 1R7OA 2J7EA 3MUY1 2ZWZA 1VF8A 2O9RA 2VJXA 1V03A 3GBDA 1E70M 1NP2A 3T08A 5A6KA 2E40A 5FCZA 3TONA 3WQ6A 4LGXA 3U7VA 4IISA 4AZBA 5BXSA 2VL4A 5BCAA 1QI5A 3L4ZA 3GNRA 4UFMA 1BLIA 3LPFA 5A2CA 4W86A 3T0AA 4MB1A 5EFDA 2WC4A 2DPEA 2XHYA 3BAXA 4B9YA 2YBUA 1CGTA 4BZYA 4PMDA 1FFRA 1EQCA 4D1IA 4AZ7A 4RE4A 4H7VA 3VGFA 4BQ5A 3CO4A 1FHDA 3WF0A 1V3MA 4OKDA 1W3KA 3M6DA 4OZOA 4Z2GA 1TR1A 3MO4A 4U31A 1UWIA 4TUFA 5A6JA 1E1EA 3ZOAA 4OOZA 1TE1A 1ESWA 3WQ4A 2DSVA 1J0JA 4CKQA 1KQZA 1XH1A 1GOKA 3WY1A 1QI0A 5ABEA 4PTXA 3WD3A 1BVNP 1PZ2A 3B9EA 1GQIA 2D2OA 2WC7A 1HVQA 4XX6A 4HMCA 1XH0A 4PN2A 1B2YA 3B9DA 4M81A 1KGUA 4GZIA 3PZMA 1JDAA 3GXMA 1HJUA 5HBFA 4UZUA 1JG9A 1VBUA 1ISZA 1E4NA 2WHJA 1UOKA 7TAAA 5IHRA 3VNZA 1FHLA 2DGAA 5JUVA 3EMCA 3VGGA 4UQCA 4GQQA 5BXTA 3DYOA 3ARTA 1GUVA 3N12A 1KXQA 2W66A 3SUSA 2CHNA 4CUCA 3VTRA 2CEQA 3FHAA 5BXRA 1W9UA 2OLHA 4WKFA 2BXYA 3MMDA 5I23A 8A3HA 5D9NA 1UD2A 3M46A 1LG2A 4PMNA 3VDCA 1B3YA 4BF7A 1E71M 3IAQA 1W9XA 1CXIA 5JBFA 3NSXA 2E8YA 1JYVA 3VD9A 3RM9A 1JI2A 1V6XA 2F2HA 3CUIA 1HKIA 1PX8A 1XRVA 2ZUNA 1ISXA 5HPCA 2X09A 2ESCA 1GOQA 2HISA 3GTNA 3MUAA 4JFVA 1QNPA 4HZ7A 3WD1A 2CXGA 5BXPA 4AD4A 2IUZA 1JD7A 1CGXA 4UQEA 5IDIA 5D4YA 3PTMA 1E15A 4PMVA 2BVDA 4JFTA 1H2JA 1KXHA 5EB8A 4CU8A 1GHSA 2D3NA 3NDYA 4FMVA 2YLAA 1CLVA 1ZJAA 3CHFA 4DWSD 3PZTA 5DO8A 2BXZA 1GONA 4E8CA 4BCEA 3WUBA 2WC3A 2C0HA 2VNCA 1WNOA 1EHAA 4A3YA 1UZ1A 4FF5A 1R87A 3VILA 1W9DM 3ZMRA 3UEQA 3N1AA 4U3CA 2AMGA 1UR2A 4W89A 1BHGA 3RO8A 4ATLA 3AMLA 1NWRA 4PEEA 1R7AA 2JE8A 3M07A 1EA9C 3K8MA 5BYWA 3CZKA 4ZXLA 3WL1A 1PZ3A 5A8OA 4AZIA 3UERA 3SCWA 1Q6FA 4CD7A 5I3DA 3WQVA 1J0HA 3A4AA 4M82A 3TTYA 3BMVA 4H2CA 3WUGA 3NJ3A 4CCEA 1UR8A 3BSGA 5CPTA 5A6LA 2NW0A 4B15A 1MW0A 1JFXA 2OSYA 4HP5A 3WF2A 1J0KA 4V27A 4PSRA 3SCOA 4AZGA 4GKLA 2QLYA 1C7TA 2UY3A 3BLPX 3ZT7A 2XYLA 4F66A 5GPRA 4PMUA 4URIA 4YN5A 1HL8A 2WHLA 2YOCA 1XYZA 1RH9A 3UR8A 4AZCB 3ARVA 2YA0A 1UR4A 3KL0A 4J3UA 3VIJA 5C8BB 5HDRA 2WCGA 3L4TA 5E6ZA 1GOOA 1XV8A 1JF6A 3WKZA 4J3XA 5CPQA 4EAMA 1EOMA 1CGWA 2WMKA 2ZX9A 5A8PA 4W85A 2VX6A 4XZBA 4TTGA 1HX0A 3BAYA 3U7BA 1E6NA 3THDA 4D6FA 3VIKA 4P8WA 1B1YA 1CDGA 1VRXA 2J7CA 1UKQA 1HKJA 2YL5A 1W1TA 2E4TA 2FHBA 2BV9A 3CUHA 1UA7A 3W24A 2ZIDA 1GQKA 4PMXA 3WDHA 1BF2A 4J3SA 5CQ1A 2D22A 1UKTA 4AMCA 3VO0A 3ARYA 3MKKA 3VD7A 2WSPA 1M7XA 2JF7A 2VQUA 4BQ4A 4V28A 3VDAA 3NUKA 1JZ6A 1VEOA 5DMYA 1JL8A 3VVGA 2XSBA 3TA9A 3T2OA 1A3HA 1WCGA 4AY1A 1KFWA 4MB5A 4D6DA 4TOQA 3CZ8A 2XJ7A 2Z1SA 4LQ1A 4JFSA 1M03A 5A3HA 4HPGA 3EDDA 1LJYA 3W28A 3ZR5A 3B9AA 1UKOA 4UFHA 1U33A 3L4YA 1BYBA 4Q7NA 2E9BA 1HIZA 3OLGA 4HOZA 4DWSB 2CCRA 2Z1KA 1TG7A 2NSXA 2E9MA 3A4WA 1CENA 3FXYA 4NZCA 1XHGA 2GVYA 3LPPA 1J9YA 1D2KA 1LL4A 5FD0A 1NQ6A 1NP0A 5LA2A 2XGIA 1JAEA 2DT0A 1QHPA 4H8UA 4R27A 3TTOA 1WDQA 3PTKA 2VCCA 5HPOA 2GJRA 5DT7A 3FNDA 5IFPA 1H3GA 1Q6GA 1A47A 5F7UA 1ZBCA 5GQBA 1QBAA 3TTQA 3SCRA 3OGRA 2ZWYA 4JCLA 1AQHA 2DSKA 4NRSA 3I3EA 3FHQA 2J7FA 1UWUA 2UY4A 2G4FA 1G0CA 3AROA 2YBTA 2XVPA 2VCBA 3CZEA 1W32A 3L2LA 1ZBKA 1K9DA 1PX3A 2ZUMA 2C8NA 5FIPA 4P7QA 4GO8A 2CERA 1QNRA 1UG6A 1E4MM 1VFUA 4ZE5A 1PAMA 3N15A 2G3JA 2BY3A 1I75A 3NIYA 2BY0A 3AOFA 2WMGA 1E5NA 2Y8KA 1UH3A 4TX6A 4JCMA 3O2LA 3VD4A 2CBJA 1BGGA 1WKYA 1HN1A 1WZMA 3CHEA 2J7BA 4PTVA 4UOZA 1C3FA 1V3KA 1GPFA 2EPLX 2VX5A 3BMWA 3CBWA 4PTMA 1WP6A 4MTVA 3W53A 3VNYA 1G9HA 4C7GA 1PIGA 4P8VA 2VZTA 1QI3A 3WNNA 3OGVA 4QCFA 5AYBA 1MYRA 1HNYA 1FA2A 3KL3A 3WENA 8CGTA 1W91A 1W9VA 3OB8A 1B9ZA 1CGVA 2DT1A 2ZICA 3N13A 4OBRA 2VX7A 3AS3A 4P8XA 2XWEA 4AZHA 1KWGA 2D0GA 1E40A 2MANA 2BVTA 1QI2A 2WCSA 3FN9A 1K9TA 3DECA 3RPMA 4UQDA 2NT0A 1I1XA 1E72M 4HMDA 1M04A 1ZS2A 4MDPA 1E4LA 1OSEA 3AIVA 1L0PA 3SCVA 2WLZA 3O6AA 1KCKA 3PN8A 4X0NA 1E9LA 2DT3A 4D1JA 1GQJA 2A3CA 2ZUTA 4AD5A 1XC6A 2WHMA 3RILA 1M53A 1OGSA 1LWHA 4CU7A 4ACZB 3L4UA 4W93A 1E3ZA 4PCSA 2J74A 1GZJA 4IPNB 4NF7A 2J75A 1H41A 3PTQA 5CGMA 5CSYA 3I3DA 3NDZA 4PMRA 5I24A 1K9FA 3BAKA 4CN6A 3NCOA 4WKHA 5D9MA 2YDSA 5FKYA 4M8UA 5A6SA 1WDSA 2HVMA 2XWDA 1JZ4A 1W9PA 4MPKA 3K8LA 3QOMA 1UD5A 3VINA 5AC5A 2GJXB 1ODUA 1ZBWA 3AS2A 2DIJA 3UESA 4U33A 3E1F1 3ZM8A 2WPGA 2AAAA 2DH2A 1XH2A 1V6UA 1MQQA 1XSKA 1DEDA 4D6HA 2WKGA 5A2AA 1X6NA 2OSWA 4UFJA 2PWFA 2CNCA 4UZSA 5E6YA 2QHAA 2JFEX 5I78A 1HJSA 5A6BA 2E3ZA 3VGHA 4BQ2A 2ZXAA 3VIGA 3L2MA 1QW9A 4TTUA 1B0IA 3WH5A 4ACYA 1SMDA 3CHCA 1MWOA 2ZXQA 4UQAA 4QLKA 4P7NA 4AXNA 1XCWA 3WNLA 1V02A 1V0MA 1EDQA 2XFFA 4AZ6A 3DHPA 1BPLB 5M03A 2EJ1A 3APGA 5I2UA 1HJVA 4U3AA 3ARWA 4CD5A 3DYPA 1TA3B 1DWJM 2ZUSA 5A8QA 2EO7A 2PBOA 4PTWA 4HOWA 2GK1B 1UKPA 4EK7A 3F5LA 2BS9A 3N18A 3WF1A 2GJPA 1MW3A 4MJ2A 1W3HA 2RGMA 5I6SA 4M29A 4WSJA 1DWIM 4FK9A 1BAGA 3KEHA 2G3MA 1XGZA 2XVGA 1XCXA 2BNJA 5ECUA 1EDTA 3UG3A 3EBVA 2IXVA 2YL9A 1JZ8A 1GJUA 1VJSA 5FL1A 1CXEA 1E6XM 2J78A 4MB3A 2WB5A 4AC1X 1WZLA 1YQ2A 1B90A 1B3WA 3VX0A 1UR0A 5ABHA 4AD2A 4AIOA 2ZUVA 1CIUA 3OLEA 1V0LA 1JZ3A 3WF4A 1XD1A 4JAWA 1TZ7A 5D9PA 5M17A 5GNYA 5AC4A 3GDBA 2VVSA 1WPCA 2YA1A 4CU6A 2A3BA 1JYNA 3WNKA 2WNWA 1B30A 1E1FA 3RIKA 3CTTA 4H41A 4AYSA 2PC8A 1E4IA 1Q6DA 3EYPA 1WO2A 3VU2A 2D20A 5KEZA 1WAWA 5FL0A 3VIHA 2CIPA 3W38A 4D6JA 3K4AA 1IT0A 2WWCA 1VAHA 4A4AA 3DC0A 2B31A 2FDMA 5BRQA 3AMDA 3ZT5A 2YDRA 3UG4A 2PI6A 5AYIA 3NSNA 3ZQ9A 2VR4A 4GO9A 1V6VA 3WFLA 4CCDA 3AYSA 1EO5A 1HJXA 1DHKA 2ZX5A 3CMGA 3WBAA 2VZSA 5E0CA 3AIBA 1BVZA 4W8BA 1NOFA 4D6GA 4W7VA 1SMAA 3M7SA 1JDCA 4WK9A 5ABGA 3W4RA 4W5ZA 4PBGA 1MVYA 3ARRA 1QW8A 5JIPA 4CVWA 3L4VA 2D23A 3HMCA 3GNOA 3VD5A 2ZXBA 3F4VA 3RMEA 4KGJA 3VMOA 4FLRA 1KXTA 2WZHA 2WKLA 3IJ9A 4MNJA 4N42A 3ARPA 1BG9A 2WSKA 1I1WA 4J3VA 1F4AA 4KMQA 4UCFA 1UA3A 3N17A 3W29A 3ZJ7A 1OT1A 2CYGA 4J28A 1X6LA 1DTUA 3K46A 3CUFA 5C70A 4LX4A 2WW5A 4M24A 1J12A 1FH9A 1UWRA 3S6TA 1GJWA 1H1NA 3G6MA 2GJXA 1WDRA 4WSKA 4BQ3A 4HZ8A 4DUVA 1FH8A 3MSDA 4B9ZA 1CXKA 1R86A 3SUWA 1QBBA 4PCTA 4NRRA 2WWDA 1C91A 1ISVA 2JALA 4NI3A 3W27A 3WN6A 3FAWA 1UWSA 1B3XA 3MMWA 2W62A 1WZKA 2XM2A 3ZJ8A 3IJ7A 4Z2HA 3AZRA 2CETA 3K1DA 2GFTA 2XVLA 2V3DA 1OD0A 3PZ9A 5JIWA 1JFHA 4BA0A 1J10A 1KBKA 2PWDA 4KGLA 4ACZA 1KWKA 2VZUA 4B3KA 3AIRA 3CZLA 4HA3A 3KL5A 3WNMA 2JEPA 5A69A 1LQ0A 3BSHA 4J7RA 3RDKA 2Y5EA 1DWAM 2D0FA 6TAAA 2VT0A 3ARQA 4ATDA 1AQMA 3DHUA 4PSPA 5D9OA 4E8DA 2WXDM 4MAVA 1FFQA 1FOBA 2VCAA 4QP0A 4XB3A 3WUEA 4MNLA 4IUGA 2YDQA 4WLCA 3POCA 2CITA 1QPKA 1TA3A 4LYRA 4FLSA 4FLQA 5BWFA 1BYAA 1UZ4A 1EIBA 2J8FA 4LYQA 1JZ2A 5CXPA 4B3LA 1ISYA 3CZGA 3CMJA 3MS8A 4UFLA 4P7LA 4CCCA 4JKLA 4WJXA 3WH7A 4GI6A 1LG1A 1TVPA 4ZEPA 2FGZA 1JAKA 5E9AA 3OG2A 1KXVA 5CSUA 6A3HA 1DWGM 5M3WA 3VD3A 3EDJA 4IPLA 2PBGA 1GOMA 1UD3A 1H11A 1DWHM 2A3EA 3ZJKA 2W91A 2UY5A 2WBGA 3OA5A 2WMFA 5A2BA 4GI8A 1C7SA 1KQYA 3WFZA 3BLKA 3AIUA 1EO7A 1L8NA 3VGEA 3SCPA 1Q4NX 1ISWA 1H5VA 1CXHA 4ZXOA 2V5DA 3VGBA 1V02E 1PBGA 2WVUA 4J3TA 3GXDA 4HU8A 1BG4A 1AQ0A 4U2ZA 1TFVA 2BY1A 3HN3A 2OYMA 3ECQA 1H0GA 1MW2A 5LYRA 2JF6A 2IXUA 1JZ7A 4AD1A 5DFAA 1UH4A 1Y7VA 3VIPA 2A3HA 4HOXA 4P7RA 3RM8A 2D3LA 5JBEA 5IHSA 5BROA 3OLDA 1W2VA 1XD0A 1OCQA 4U2YA 3WD2A 2VRKA 4W7UA 1E6PA 3ARZA 1V08A 1ITXA 5ABFB 3GXIA 4J27A 4UOQA 4D6CA 3GH5A 1BGAA 4H8VA 4ZENA 2G3NA 1W3JA 3BC9A 3VX1A 3THCA 2OYLA 3AXIA 4R5EA 1C8YA 1HJQA 3WH6A 1H0IA 4KWUA 5A1AA 4GINA 3WH8A 3OGSA 1W1VA 1EHNA 1KGXA 3SCTA 2BVYA 3IAPA 4AIEA 3FAXA 1B3VA 1JGIA 4KRTA 1UKSA 1UH2A 2WMIB 4IM4A 1O7AA 4MADA 1OIMA 5D8ZA 4TVUA 1EDGA 1LWJA 1HVXA 3L4XA 3AXXA 2EQDA 2YL8A 1TUXA 1UD8A 1VEPA 1US2A 3S2CA 3WNPA 3ZIZA 3CUGA 3WQ8A 4X9YA 2CPUA 4QLJA 4AWEA 1GVIA 2ZUUA 4M80A 4PYSA 3GH7A 2V38A 4D6IA 3WDRA 4JIEA 3WELA 1R85A 3ARXA 1W1YA 1OD8A 4PMYA 4Y7EA 1UR9A 3RCNA 5D8WA 4LPCA 3MV01 1CGUA 3J7HA 3PZUA 1B31A 3G6LA 2YL6A 1E0XA 4F8XA 1S46A 3L4WA 4B16A 2DSWA 2XUCA 3SUVA 1OGBA 3W25A 2PWEA 3PZGA 1JXKA 3ALFA 2JIWA 2EPMX 3A3HA 4DM2A 1EQPA 5IFTA 1UD6A 2PWGA 1OIFA 1LL6A 2X0HA 1PX4A 2V3FA 3SCSA 4Z2JA 2WMHA 2PWHA 1CNVA 3ZO9A 3SEPA 5CJ5A 1UD4A 1NOUA 5KZ6A 1V0KA 2OSXA 1E6RA 1H49A 3BH4A 4NSBA 2F61A 3SUTA 1D3CA 3TOPA 4AZCA 1W9BM 5EFFA 3WMCA 1CTNA 4MJ4A 3ZJ6A 4CD4A 2WM0A 5E70A 1HKMA 3U5UA 3IJ8A 3AMCA 5AY7A 4XUYA 4D71A 2CKSA 1WDPA 2WVTA 2CBIA 4PMZA 4OOUA 3AXHA 1E55A 2XM1A 2QPUA 3BCDA 4AD3A 4HZ6A 5CZKA 4QFUA 3VM7A 4HPHA 2ZX6A 3AS0A 4AD0A 3F5JA 5EMYA 1Q6CA 4MDOA 2TAAA 3CH9A 2O9OA 2WK2A 1JIBA 3FY1A 4UTFA 1ZU8A 2GUYA 4MNKA 3WSUA 1K6AA 5BRPA 1G5AA 1TCMA 2W61A 3AICA 1QHZA 4V2XA 3TP4A 4CN1A 4N0RA 2O92A 2WVSA 1C8XA 1DWFM 1NM9A 4PUEA 3SCUA 3VKKA 5HXMA 4GIAA 3VOCA 4W84A 2DH3A 2YIHA 2OWCA 2BY2A 1H09A 1YHTA 2AOSA 3RM4A 3W6MA 3A47A 1FP9A 3CIVA 3WQ5A 1QNOA 2XSAA 2OWXA 4TX8A 3AMKA 1J0YA 1ZBVA 4BS0A 4M56A 1PIFA 1VIWA 1GW1A 4OUEA 5EBAA 6CGTA 1V3IA 1OWQA 1M01A 2QMJA 2RGLA 1ITCA 1G1YA 5A8NA 2BHUA 3WNOA 3W0KA 4CD8A 4ZE4A 1BSIA 4JFUA 4CN4A 5HOSA 1U2YA 3AMGA 3O9NA 4CVUA 2VURA 3VDBA 2X05A 2DDXA 3POHA 4U5IA 1XSIA 2J4GA 2GDVA 2UWFA 1V0NA 4DUXA 3RJYA 4LYPA 1DP0A 1GNXA 4DM1A 3W81A 4RL3A 2F8QA 2FGLA 3VIOA 1HT6A 2YJQA 1MQPA 2D1ZA 4JFWA 5A6BD 3WDJA 2JEQA 4H8HA 1MXDA 2VZOA 4JZ5A 4AEEA 1JI1A 4D72A 2VOTA 2FH8A 4OIFA 3WEMA 1G01A 1E5JA 1NWTA 1CEOA 2J8GA 1QOXA 3JUGA 4TVCA 2W63A 2ZE0A 3II1A 3GXFA 3WIJA 1GOIA 2VRJA 4W8LA 2ZX8A 1E43A 2V5CA 5A6AA 5I79A 4UOJA 2WZEA 3WL0A 4A3HA 1HP5A 4RE2A 3NYDA 5A8MA 3AQUA 5CGTA 2J7DA 3GBEA 3N04A 4JKKA 4GQRA 1NOWA 2D0HA 4HU0A 2A3AA 3AZSA 1XYFA 3A4XA 1IV8A 3D5HA 4YHGA 2WANA 2DEPA 2EPNA 1KR0A 1OT2A 1CECA 3QHOA 3WMBA 4RE3A 2DSUA 4E2OA 1GOWA 5LA0A 1NWUA 4UNIA 3WH9A 1ZJBA 1HJWA 3GH4A 1UHVA 5I5RA 2ZXDA 2EXOA 3PBGA 3SURA 1VFOA 5CPSA 2WHKA 4KH2A 4MB4A 7A3HA 5CLWA 3KZSA 2V3GA 4F9JA 3HU7A 3OBAA 1NWSA 1E6SM 3AHYA 1VENA 2DQXA 4MNMA 2XIBA 2DIEA 4DUWA 3VIIA 1JZ5A 4YHEA 3IANA 1J18A 3BAIA 1ZB5A 1BYDA 1X1NA 1N82A 4X0VA 2XFYA 1VJZA 3AZTA 1OBAA 3QGVA 2G41A 1J0ZA 2EBNA 1CBGA 2G3IA 3W6LA 3IK2A 2CESA 1GHRA 1V3LA 3AHTA 1ODZA 4U5KA 1P6WA 3AHZA 1QNQA 1MFUA 3WDQA 3K8KA 3EDKA 2W4XA 1EGZA 3VM5A 4QAWA 1US3A 2DSZA 2E9LA 3WQWA 1OINA 2XIIA 3HJEA 4HMEA 1CYGA 1TVNA 4W7WA 2FH6A 4YPJA 1OB0A 3MU7A 4AW7A 2GK1A 3OLIA 4AISA 5LA1A 3PZNA 1V3JA 2WVVA 4EE9A 4QDMA 3ZSTA 4M1RA 3VMNA 4MAZA 1WE5A 3BAWA 1CGYA 4WKAA 2GDUA 2VUYA 3AIQA 3LPOA 4JL2A 4QCEA 3VUPA 3WD4A 1NH6A 5I77A 3ZSSA 1BQCA 4EANA 4FLOA 3D3AA 3WBEA 3AJ7A 3QHMA 1RP9A 3EDFA 3W37A 3UCQA 1IZJA 3CPUA 4XV0A 1JNEA 3OZOA 1CZ1A 1WZAA 1PEZA 3VGDA 5JBDA 3SIMA 1MXGA 1E3XA 3VDHA 5CG0A 1ZL1A 1W3LA 2WVVB 4CGTA 4K68A 1GORA 4PUDA 3UG5A 5HNNA 2Q8XA 1B3ZA 4P8UA 2WLYA 4J3WA 2XPKA 3GM8A 2CKRA 4Z2IA 2J47A 1E0WA 3MANA 1GQLA 3DYMA 4GXPA 3T0BA 4HTYA 1FH7A 3CUJA 3ZT6A 3CGTA 1VB9A 3SUUA 1RD6A 2VRQA 1KBBA 1W2PA 1KGWA 1QHOA 3BAJA 1BTCA 2DT2A 2E8ZA 2VTFA 3SCQA 2GSJA 2O9PA 2X0YA 4OBSA 2XTKA 2C7FA 1PJ9A 2PF0A 4PRWA 3CHDA 3WD0A 1QVBA 1UWQA 2QPSA 4HA4A 1U30A 2WCAA 3MUIA 1OGGA 5TD4A 3WUFA 2J7HA 1CXLA 5ABFA 1JYWA 1W1PA 2VZVA 1CXFA 3OZPA 1E73M 3WEOA 3AFBA 4JL1A 1RP8A
chains in the Genus database with same CATH superfamily
3N11A 4L4OA 1O6IA 3EEZA 1VBHA 4GC3A 2ALDA 4JFIA 5M2FX 3B06A 1TUFA 2PP1A 1WKFA 3FSTA 5DEZA 1FCBA 5BOFA 1I0DA 4I7UA 3MVTA 2JGYA 3LUTA 3B0UX 2C15A 5CAHA 3CL6A 1LDCA 3EWCA 2QF8A 2FMOA 1SZNA 3EMQA 1JDEA 5FOOA 1MNSA 3PPGA 4AFYA 2YFOA 4PR4A 4F79A 5J6EA 1KCXA 3LLDA 1T0OA 3OEXA 2YXOA 3T8LA 1LL7A 3WDPP 4HBEA 3GAYA 3MUCA 7CGTA 1UQYA 5J8LA 1P0EA 1W3TA 2H9AB 1XLLA 3FJLA 5LXXA 4TR9A 1D3HA 2O7QA 4FNQA 5G1TA 3TIMA 3CWNA 1UQZA 1E6ZA 2EG7A 2PF8A 4BEUA 2EPOA 1JD9A 4LNYA 1EB3A 5LNWA 3G1FA 1WDWA 4TW6A 1KFEA 1TV4A 7TIMA 2N87A 2OELA 1E56A 2C6QA 2C1IA 3QOKA 4S3JA 2VWTA 3RLVA 1JCMP 3F03K 4YXGA 3V0TA 3LMZA 2ABAA 3T9PA 3DFHA 3GXTA 1Z32X 1G67A 1HTIA 4E2DA 3UPWA 1FWDC 1XF0A 3FK4A 2YKKA 3PZOA 4UFKA 5JH8A 4E5TA 1EZWA 1R3SA 3NQ2A 3FJ6A 2FZNA 3DHFA 2YW3A 4I3GA 3FA5A 3RPTA 4BJHA 1K9EA 2VEIA 2J9XA 1HF6A 1QI4A 3W82A 4UTIA 1ZK6A 5FEWA 1PCKA 3KLKA 4M6PA 3V5OA 3PBWA 1X97A 5AYZA 4P2VA 3WLKX 1OX4B 2VGIA 1FWEC 3PZQA 2CBUA 2CBVA 2ZKMX 4DJED 5TBOA 1XIDA 1U22A 4DWSA 3QGAC 1J0IA 8RUCA 2HS6A 2ZRVA 3IPWA 3WEZA 4NT0A 5FF4A 1J93A 1WV2A 3QW3A 3QXBA 1EP1A 4R88A 1L6FA 3WMSA 2W6RA 4BWLC 3JS3A 2QV4A 3N9KA 3SQLA 2RUCA 1NFGA 1WB0A 3MSYA 5AKQA 2YLLA 4YYCA 2QMKA 1D7FA 2J62A 3M0VA 1XSJA 1Q6EA 4L1GA 4O1AA 5TNVA 3SCNA 1E0TA 3EWBX 3OQEA 4DB7A 4RDYA 1GTEA 4ODQA 3QMSA 4QLLA 5IXEA 1UYQA 2OX4A 3QPYA 3S9IA 4S3AA 2ETNA 1MDLA 3CMFA 4UR9A 1EPVA 4MUPA 3LCWA 2OQLA 4AIUA 1HP4A 4GHRA 2VI0A 2PE4A 3BLLA 3IK4A 3LUOA 3TSDA 3WLNA 3EGJA 2ZVIA 2FTYA 3TR9A 1NQKA 1L2UA 4F48A 1RPKA 2ACQA 3MWCA 1L6SA 2FHFA 3QHNA 5CBIA 1N1AA 3U57A 2VCDA 1VPYA 4I7VA 2QUMA 2WZIA 2NQ5A 1IT8A 2CZVA 2VJXA 3KOYA 1E70M 1NP2A 1JCHB 5A6KA 1V79A 3U7VA 3TC6A 4IISA 4R85A 4RZBA 3LPFA 5I02A 4XKMA 2RUSA 3ZYZA 2KX9A 3P81A 1EQ3A 2DPEA 2XHYA 2RUDA 2YZRA 4D1IA 1WXJA 4H7VA 3MB9A 1FHDA 3WF0A 2Z7KA 1S5MA 3MO4A 1RBOB 4U31A 2ICSA 5A6JA 1A4LA 4R7JA 1O95A 1UUOA 3ZOAA 3RU8X 3STEA 3PR2A 3WQ4A 3PTDA 1FKKA 1QI0A 2ZA2A 4O19A 5DXXA 3QV9A 3SSZA 1J4IA 1VIZA 4PODA 1BVNP 4LAYA 2D2OA 1GQIA 3E9AA 1HVQA 4HMCA 1B2YA 3REQB 4LB4A 3HGOA 1FAPA 1VCGA 2F7FA 3RN6A 3A9BA 1DQWA 3W74A 3GXMA 1HJUA 4UZUA 2BXVA 3GO2A 3I68A 1VBUA 7TAAA 3V5CA 3VNZA 4QAIA 5C54A 3EMCA 4UQCA 1N55A 3F4DA 4DBWA 3QMRA 3N12A 2ZC8A 4TIMA 1DJXA 4HSNA 1S1PA 4DZAA 4JNMA 3SUSA 1TJRA 1OCJA 2FKEA 3FHAA 8XIMA 2DZVA 3U2CA 4IWWA 3VDCA 3HV9A 1B3YA 4C02B 3OVQA 1QPFA 1TPB1 3NSXA 1XIHA 2DUAA 5H8UA 2E6DA 1UBSA 3GW3A 4DZIA 1K8ZA 4LAZA 4FSAA 4R9XA 1IXNA 2YCJA 4H9XA 4Q7IA 4GWEA 2ESCA 3M0LA 2W79A 3KOWA 3GTNA 1QNPA 3WD1A 1FDYA 2CXGA 4QDWA 3Q94A 5IDIA 3U2OA 3PTMA 2AKMA 2BVDA 2HTMA 2Z2BA 3Q45A 1KXHA 3SFKA 3KAFA 3H12A 2WZTA 1GHSA 4JTHA 4G2PA 1CLVA 1DVJA 3CHFA 1RXOB 1ZJAA 2ONEA 5HK4A 4GNKB 4K2SA 2OX1A 3VZZA 1O1HA 2ZFAA 3CUXA 2WC3A 3MTWA 2FTWA 5A5WA 1SJBA 4NNAA 1PDZA 1EHAA 1UZ1A 4C1NB 3SFWA 3ZMRA 1X1OA 4QZVB 4ODRA 3ABZA 2ZR4A 1Q8JA 4ATLA 4UR8A 3KOZA 2REQA 2NX3A 2VD8A 1F8MA 4PEEA 2YW4A 3IUHA 4YMZA 2JE8A 3ENLA 3OPSA 1A50A 1EA9C 3BQ5A 3T6CA 5BYWA 3PY2A 3CZKA 4IL0A 3MY9A 2QCHA 5G2IA 1PZ3A 1IEXA 3LHTA 3SCWA 4R9OA 4GISA 1XLDA 3W7OA 1S3TC 4LVGA 1DIKA 1T5AA 4JXCA 5I06A 3A4AA 1ZHAA 3HG3A 4I5RA 4H2CA 3KRSA 4GNJA 3QQ1A 2HROA 1Q7QA 4M1BA 3RR4A 1UR8A 3BSGA 5AHFA 2PRLA 1OYBA 1O5KA 2OSYA 3PG8A 1FDZA 4PSRA 2HMCA 3SCOA 4I9JA 1ML1A 3NPXA 3W87A 2QLYA 2UY3A 3BLPX 4E4UA 2XYLA 2Z1BA 3TJ4A 3CAQA 3EXRA 4HPNA 3UA4A 4DN1A 3TSBA 5EKYA 2FLIA 4YWIA 1K3UA 1RY8A 2HK1A 4FI4A 2Y61A 4HBOA 2EG8A 5E6ZA 5HJLA 4QTGA 3WKZA 1CGWA 2ZX9A 5A8PA 3MCMA 1P7TB 3M0YA 3KDOA 4DBDA 1FCQA 4G7FA 1HX0A 4CNSA 1L1PA 4MLJA 3CEUA 3TYAA 5FF7A 1XRTA 3VIKA 4L1XA 4P8WA 4QJ4B 2WNZA 2YL5A 1W1TA 1DJQA 3C56A 1VYRA 3R11A 5JMUA 3GHRA 3UXDA 1GKPA 4AMCA 3DENA 2W27A 3SBFA 3ARYA 3OIXA 1FVPA 1K8XA 3PVFA 3H8AA 3EOEA 4R3UA 3SRDA 3IIPA 1VFTA 2GGGA 4V28A 5HWCA 1JZ6A 1VEOA 4LH8A 1JL8A 2XSBA 4Q4SA 4A05A 1TJPA 3KLLA 4AY1A 4D6DA 3CZ8A 4MWAE 1LJYA 3ZR5A 4ZVJA 1P6BA 2VENA 3E38A 3T40A 3W84A 5HR7A 1Y0EA 2Q3OA 1N8IA 3E2VA 3GB6A 4PBEA 1HIZA 2QKFA 1VFSA 3GHSA 3NQCA 3PBYA 2PDMA 5TF0A 4HOZA 2TPSA 4GMEA 2E9MA 4Q8PA 2DJLA 2I9EA 1NEYA 1XG4A 3A4WA 1WKEA 4NZCA 2RJHA 3LG3A 4J3ZA 1SFLA 2GVYA 5GJPA 5E1QA 1D2KA 2FB3A 3PC0A 3LTPA 4GQBA 3RYSA 1FCVA 4LAMA 1US0A 1KNWA 2XGIA 2ACUA 4PFHA 2GUUA 2V30A 4R27A 3IJQA 1TCOC 3H53A 4ZFCA 4MWAC 5GJNA 5DT7A 1MRAA 4O16A 1H3GA 2NQJA 4GGBA 4GUHA 4XAPA 3MA8A 1AFSA 2Z25A 3AWOA 1YIXA 1U5VA 3OGRA 4A2SA 1A0EA 4KWWA 4NRSA 4O0KA 4FXFA 1W31A 4FPSA 4GUIA 1WXZA 4HGXA 4O15A 3LM7A 2VCBA 2CZ5A 4BR1A 1FHUA 2ZUMA 3B8IA 2C8NA 4ZGYA 5FIPA 4RZ5A 4P7QA 3V1HA 4NY2A 4QIUA 2CERA 1E4MM 4LUTB 3KX6A 3N15A 3M47A 2BY3A 3O63A 2DZSA 3LK6A 1E5NA 4TV5A 4TX6A 1P1XA 1GG0A 2P76A 3WJSA 1F9CA 3R6IA 4UOZA 2XDFA 1V3KA 1GPFA 1XBXA 2EPLX 2VX5A 3AYVA 3CBWA 1JPHA 1LRQA 4MYXA 4OU1A 1G9HA 3LHUA 4Q8MA 4C7GA 3GYEA 1PIGA 4P8VA 2V69A 2VZTA 3OW1A 1QI3A 3VFCA 3OGVA 3ABQA 4H9MA 3P82A 3WENA 8CGTA 3OB8A 1B9ZA 1TO3A 1CGVA 2ZICA 4E0CA 3N13A 5JU6A 2VX7A 1QPOA 4JQ3A 1N8WA 3EKGA 1A5OC 1QI2A 2BVTA 4J5NA 1K9TA 4Q4MA 3DECA 3IARA 3RPMA 4HMDA 4JTSA 1HZYA 2PPGA 4NXSA 4AWSA 1LROA 3GHUA 2PP0A 1IR1A 1IIHA 2DT3A 5F2LA 4XAZA 4AD5A 2WHMA 2VDGA 3RILA 1OGSA 4JTKA 4CU7A 4W93A 3L4UA 1RHCA 2ZDSA 1TTIA 3DKJA 4IIFA 1SJCA 4JNYA 1D8WA 2J75A 3KHDA 3PJUA 1ELSA 3ZVHA 4M6UA 4CEUC 1ROUA 2PDUA 2V8ZA 3LSBA 5T8GA 2D2GA 3ZZ1A 3LZ5A 4E3VA 2ZRZA 3ANVA 3CO8A 1HKVA 5HW8A 1K9FA 2Q09A 1F2JA 1KFKA 3IS4A 4WKHA 3MYOA 1TREA 1JZ4A 1MEWA 4IMDA 1W9PA 3K8LA 4DXVA 1TWWA 2GJXB 2IPFA 4QE1A 2DIJA 4RXGA 2XIMA 3TLLA 3DCPA 2FVLA 3GG8A 4XVDA 3NXFA 4M7SA 4DRMA 4YL2A 3UWZA 2QF7A 3ITCA 4S3FA 4IOTA 1EGMA 4MKVA 1AW1A 3AXKA 5HWMA 5A2AA 4WGXA 4ZQCA 3UJEA 4JYEA 2QHAA 3MPGA 2E3ZA 4QSHA 3M1ZA 3NQBA 3VOIA 4S3DA 1YYAA 3VIGA 4ZO8A 3RCMA 5RUBA 1UJPA 5TIMA 3D46A 3QLDA 1T11A 5C9ZA 2ZXQA 3PPHA 1ICPA 1DYSA 4P7NA 3YPIA 2QPXA 3WNLA 1V0MA 4YS1A 4AZ6A 3DHPA 3QKZA 2EJ1A 3S2JA 3UI6A 3IRDA 1HJVA 1S2WA 3RLHA 4QIBA 3OA3A 4C6KA 3GC2A 2ZUSA 3CTLA 4DQWA 2CZEA 3MO7A 4PTWA 4LTSA 4EXQA 3GLCA 4E3TA 2PV2A 3ANYA 4A8IA 3KBVA 2GJPA 5AVHA 3UWUA 1K6WA 2ZQ0A 1FUYA 4GGHA 2ZZ6A 3P8JA 3TYDA 1VZWA 3QF0A 1XLBA 2HEJA 2XVGA 1XCXA 1AODA 1EDTA 1W56A 3FGCB 3PJWA 5AC7A 3PJTA 2YL9A 1VJSA 5FL1A 2Q8LA 1E6XM 1UCWA 2OZ8A 1IF2A 2F4EA 2HWGA 5HULA 3DKLA 3EX3A 1B3WA 4MGGA 1CW2A 5ABHA 2EKCA 4AD2A 3VCRA 2ZUVA 1CIUA 3OLEA 1VLIA 4CNTA 4JAWA 1TZ7A 5GNYA 1CB7B 2YA1A 4CU6A 1KV5A 4IH3A 2V68A 2WNWA 1UW9A 2TMDA 2GPTA 5H6HA 1E1FA 1QW7A 2PC8A 4LUTA 1J5TA 1WO2A 3N2XA 5FL0A 3W38A 1IT0A 2WWCA 1SQ7A 4ROQA 4JPGA 4L3NA 5AYIA 3U3HA 3ZQ9A 3RLUA 2VR4A 3LD5A 3PPFA 3ES8A 1IYXA 3WFLA 4CCDA 1EO5A 1R46A 4CEXC 1HJXA 2Z4GA 3TN6A 3CMGA 5GPGA 4PA8A 3AIBA 2PPNA 4IP7A 1W3IA 1BVZA 5F2IA 4C6JA 4D6GA 4KWVA 4W7VA 5LNRA 1FKHA 3F1QA 1Y0OA 4UTKA 1SMAA 8TIMA 4WK9A 2X1SA 3W4RA 1QK0A 4W5ZA 1F6YA 1MVYA 3ARRA 2O0TA 1PTGA 2VYOA 4JTFA 2WJDA 3CV2A 3NQFA 2ZXBA 1RQEA 4MHBA 2FPVA 4ADTA 3TR2A 1AUSL 1SW7A 5LGZA 2XPAA 1TTQA 1MI3A 2OVLA 5LIKX 2WKLA 2PP3A 3ARPA 1I1WA 1F4AA 4S3CA 3D0CA 4DRPA 3N17A 3VNLA 3CAWA 1DTUA 4ODPA 5C70A 2YXGA 5H91A 3IJIA 3MSRA 4X22A 1WDRA 4WSKA 2VC5A 1YPXA 1CXKA 1QBBA 4E38A 4PCTA 2WWDA 5IBXC 2B4GA 1EPXA 4ZO6A 1V51A 1EF3A 3ITGA 2PDXA 1OADA 2XM2A 3IJ7A 3N34A 4Z2HA 1Q1CA 1M6JA 1YX1A 3BJSA 2GFTA 3GWQA 1XW8A 2WZMA 3PZ9A 4ZZ9A 4BA0A 2ZYFA 3EX6A 3E96A 4GY1A 2PWDA 4PFMA 4Y96A 3EA2A 4B3KA 3P62A 3F2BA 2QCCA 1YE4A 4HA3A 3WNMA 3N2OA 4NL1A 1GTHA 4X60A 2WQDA 2NX9A 1DWAM 2OO6A 2VT0A 4QE4A 1J4HA 1FFQA 4QP0A 4XB3A 3KTSA 2IKIA 2PV3A 3W7DA 2FQIA 1H63A 4NJHA 3A3XA 2GDQA 1IXPA 4FLSA 4LYRA 1K8YA 3W7CA 1QNVA 1I60A 4HK7A 4JTLA 3E02A 2PDBA 4CNOA 1LT8A 5CXPA 3MS8A 3MHUA 3WH7A 2PGFA 2ISWA 3O5RA 1QPLA 1TVPA 2FGZA 5E9AA 3OG2A 3TU9A 2DW6A 4FX8A 1SUXA 4CLMA 4JQ4A 2BP1A 3ZLHA 2PBGA 3D6NA 1DWHM 4K1WA 5CGQA 2WBGA 3OA5A 2WMFA 3HG5A 4GI8A 5FEXA 1KQYA 5FJOA 3AIUA 1ISWA 5E0KA 1PBGA 1TJ1A 2ATMA 1J6PA 3R1ZA 3U4AA 3PUGA 2FAPA 2IQTA 4X3ZA 5LHFA 1I45A 1TFVA 2BY1A 4MWAD 4K7VA 4JOMA 1FKGA 3TOYA 5LYRA 1JZ7A 3ITXA 5DFAA 1RBLA 4C6FA 1YTKA 5BMXA 2A3HA 1AW5A 4LU0A 1AK5A 5LNUA 2HXUA 3GXNA 2PODA 4HNCA 1W2VA 1OCQA 3AU6A 3H4XA 1LQ2A 4W7UA 5H8PA 1A7XA 3GXIA 4UOQA 5IM51 4PB5A 3H22A 4JEJA 3GH5A 3SO7A 4H8VA 2G3NA 4KW2A 5HNTA 3AXIA 3PULA 3WH6A 1LBMA 3OO2A 4KWUA 5A1AA 3GXPA 1TZZA 3VCCA 2VFIA 4AIEA 3NNTA 1TWZA 4DO4A 1VBJA 2G95A 3HFTA 1TIMA 2OEJA 1IX5A 2FB2A 3W7PA 4KEVA 1V8EA 1O7AA 3QTPA 1DJIA 4MADA 5DXYA 4TVUA 4LS1A 3VFLA 2OQHA 3W2LA 4HU3A 3F4CA 2NZLA 3S2CA 1NIUA 1R2RA 5FJUA 3OP2A 1CI1A 4V15A 2ZUUA 2CW6A 4ZOAA 3WELA 3PM6A 1GEQA 2X0SA 1K03A 5D8WA 5D2YA 3BJTA 3S5SA 3O5DA 4K8GA 7REQA 4G1KA 1KM2A 4J9JA 3G24A 2XZ7A 1OGBA 3DOPA 2JIWA 1K7EA 3FYYA 2VDIA 1RD5A 1OFPA 4YTSA 1Q65A 2PWGA 3U6WA 4L9ZA 3NPUA 1PX4A 2I14A 3IEBA 3NOEA 1P7TA 4LVAA 3PWAA 3NXLA 5AYYA 3SEPA 1UD4A 4AHPA 1E6RA 5FF0A 3MQTA 1H49A 2QULA 2F61A 5KTLA 1D3CA 4PC8A 4GFSA 4GVIA 1M5WA 2VFDA 4MJ4A 2B0MA 3PR9A 2PD5A 3ZJ6A 4CD4A 1JUBA 1TB3A 3GDTA 3IJ8A 4OVXA 1PCWA 4TU1A 3I7RA 1DE5A 3LHZA 3VKJA 2CKSA 3WLJA 1WDPA 2NWSA 3LZ3A 4Y9MA 4P61A 2WVTA 1GK8A 3QVQA 1PE1A 4OOUA 4PMZA 1E55A 1WYIA 3BCDA 4OECA 2Y5JA 5CZKA 4QFUA 5EPDA 3AS0A 4WX2A 4AD0A 5CC5A 4N02A 5EMYA 1Q6CA 1F05A 3DG6A 4A3UA 3GU2A 2VEFA 3QLLA 4ZQMA 2E25A 3NFUA 2WK2A 3QFEA 3USZA 2QCGA 2V5JA 3GIQA 1K6AA 3HPZA 4U86A 2W61A 4QT3A 3GFZA 5REQB 3AICA 1QHZA 3TP4A 3WK3A 2O92A 4MUZA 3RITA 1NF7A 3GUGA 1NM9A 2YYUA 4QEHA 3IVTA 5ABTA 4S3BA 5HXMA 1T7LA 4W84A 4AHOA 2AQWA 1FHVA 5KZEA 3TNBA 4AXKA 2BOEX 3VOHA 1W1A1 5JH1A 3HQOA 5BW6A 3MI2A 4BS0A 3TJLA 1C9DA 3CUZA 2Q01A 5AZ1A 5D05A 6CGTA 5KZMA 4EF8A 4GOAA 5HKGA 2QMJA 4K7YA 1SSDA 2RGLA 3LRKA 4IPIA 4JFUA 4CN4A 5HOSA 1U2YA 2I9UA 3GW0A 3AMGA 4WUIA 3SQMA 1XFBA 2INFA 2HQAA 2BGQA 3VXGA 1A5AA 2VURA 3CQ0A 1VFHA 3GDKA 4U5IA 4PUMA 2DZBA 1G7VA 3UR5A 1V0NA 3GVWA 1BWKA 3RJYA 3W81A 2NVCA 4TX9A 2F8QA 2YDAA 2XISA 5J04A 3VIOA 2D1ZA 5A6BD 1G4TA 3WDJA 1XLCA 3STPA 2Y7FA 1SU5A 1AJ2A 4IT6A 1TVLA 4Y6GA 3ABXA 2FH8A 4OIFA 3PUOA 2F23A 3M16A 4XAGA 3IVSA 3R8RA 1OHLA 1XIFA 4TVCA 2PAJA 2ZE0A 3WIJA 3BCJA 2I16A 1GOIA 4YVPA 1QTWA 2ZX8A 3DXIA 5A6AA 1XIMA 2ODOA 5I79A 3FS2A 4ZPTR 1A0DA 4A3HA 2ZRUA 5CGTA 4LYKA 3NVTA 3GBEA 3QYSA 5DLCA 4GQRA 5MKGB 2CZFA 3T1GA 4QT2A 2Z1VA 1XYFA 2RQSA 5EMKA 4YHGA 4YIWA 3LBCA 2EPNA 4IGMA 1KR0A 1UB3A 3C3NA 4B5UA 1O66A 1FRBA 1GOWA 3QEZA 3O6DA 1ZCOA 4NNBA 4UNIA 1SW0A 2F6KA 3UR2A 3G0UA 3KTXA 3B0YA 2ZXDA 3LLXA 1VFOA 2WHKA 7A3HA 1EXBA 3DAQA 1YDVA 4ZQOA 3KBWA 1M41A 2RUQA 3WQPA 1NWSA 5FJRA 1OABA 4MNMA 4M7TA 2DIEA 3KAOA 5D04C 3VIIA 3AAMA 4YHEA 3RXZA 1Z7AA 1J18A 4ILSA 3C86A 2ITKA 4X0VA 2XFYA 3D3FA 3CIXA 3IK2A 1V3LA 1ODZA 4U5KA 3SR7A 3GQYA 3U8GA 3NL3A 4GY0A 1QNQA 1MFUA 3IIVA 3HPXA 3H4GA 1SJDA 3PB0A 4H7CA 4NX0A 1TE6A 2E9LA 1WOBA 2DG3A 3SECA 2XIIA 5LKYA 1TVNA 3LLFA 3MKVA 2FH6A 4XK2A 1OB0A 2HJPA 1X39A 4AW7A 1DPMA 1TSIA 3PZNA 1TJ2A 3ZSTA 6ENLA 4M1RA 3STCA 3G8RA 3LXBA 1EBHA 1VPQA 5U7SA 2VUYA 1AMKA 4QCEA 4L9YA 2ZTKA 5I77A 3FKRA 3SSJA 2NXIA 1KRCC 1JCTA 3G3MA 3QHMA 1IZJA 3EY6A 1Z69A 1JNEA 1WZAA 3VGDA 5JBDA 2P0OA 3SIMA 1W3LA 4REQA 1GORA 1AW2A 3OTRA 3UG5A 4RNFA 3RCYA 2Z1XA 3MI6A 1ZRQA 1B3ZA 3AO0A 2ABBA 2WLYA 3K5XA 3E0FA 2HE8A 1E0WA 3R2GA 2IQDA 3T0BA 2Y7EA 1FH7A 4EF9A 5HT1A 3R10A 1KRMA 4US5D 4X63A 4YU1A 3WK1A 4PUUA 3VKBA 3SUUA 3EB3A 4YTTA 1BTCA 2E8ZA 2VTFA 2GSJA 3FA4A 2MLYA 1G6CA 4FZIA 3H21A 3HGSA 2PF0A 2YCIX 1QVBA 3WD0A 1UWQA 3LQLA 4GBDA 3T44A 3MUIA 3PAJA 1OGGA 3QR1A 4FXRA 5E9XA 3WUFA 3Q2DA 1JYWA 1W1PA 3TCZA 2VZVA 1CXFA 4I7WA 4F0RA 3OZPA 3GC4A 4JL1A 2OLAA 2XIBA 1ONXA 4PBFA 4H04A 3AUJA 5I3JA 3CT2A 3MSGA 3PNZA 5FACA 4HQVA 4W5UA 4UNLA 2BFGA 3ZR6A 3RK8A 2AKZA 5CPLA 2BOGX 3GYCA 4QG6A 2VQTA 3MCNA 2I7GA 2XVKA 4JHOA 3GZAA 9CGTA 4UFIA 1V6WA 3FFSA 2G3FA 1LLOA 1OFAA 2CLEA 4GYPC 1C93A 5AHNA 4JFKA 1ZUAX 2X1TA 4QR6A 4RNHA 4WF7A 4Q22A 4R0XA 3WMLA 1EIXA 5XIMA 2FVMA 2HPIA 3TTEA 2AQVA 1ECEA 4KIRA 2X8RA 5EMMA 4JHZA 1WOAA 3AHXA 2WYSA 2YCLB 3GD6A 2IKJA 4AEFA 1N7KA 2XVNA 3DBPA 1TYGA 2JKPA 4G50A 3WLHA 2J79A 4IFOA 2J77A 3P0XA 5D03A 1EOKA 4GIYA 4ATWA 2VEKA 1D9EA 4HYVA 4L4PA 3WYZA 3UR7A 7PTDA 1D6OA 2QCDB 2BOFX 4J4NA 3DEQA 4AIBA 3UWQA 4HA1A 1T41A 3PAOA 3WDIA 4DROA 4GPNA 2BHZA 3LA4A 4ZQNA 3TYBA 5M5DA 3KP1A 1OX4A 4G6CA 1LF1A 1J6YA 1UC5A 2ZA1A 3H2FA 4Q8WA 4JY9A 3KOFA 5ECVA 2PU1A 4DYKA 1O5XA 1EKOA 2QVHA 4I8YA 2JIEA 3ABOA 2W67A 3KWXA 5IDZA 1OFQA 3M5XA 1F07A 2BHYA 4JHMA 4GRSA 1GPWA 1JCNA 1VGAA 2H3DA 3O5PA 5I3IA 3KCLA 1AMYA 2Y88A 5I0DA 1EH9A 1MRQA 2G5WA 4GE8A 5A95A 2FZDA 1F8AB 3AIWA 2X2YA 1SFTA 4Z1YA 1HKKA 4RPQA 4GZJA 2Y70A 1PXGA 2VGFA 4L5ZA 1J5SA 2GQ3A 3UZZA 3W7NA 1SR0A 3RU6A 4G5DA 2QCMA 1F4HA 2CC0A 2ZZ1A 1EEPA 2XFRA 2C13A 3LPGA 4KRUA 1NF0A 2G8ZA 3WLPA 4MPQA 4JDBA 3F5KA 4YLWA 1KR1A 2Y8VA 4GZEA 1T99A 4QSFA 1A5MC 1EL3A 1H61A 4RR4A 4JN6A 4DEFA 4FR1A 2PB1A 3EKLA 4WIWA 4C7FA 2VVNA 4W87A 5C71A 3CB3A 2HPMA 4LCQA 4PE8A 3ARSA 1G94A 3SIZA 4HNTA 4R34A 4D8AA 5I3HA 3GNPA 1W5OA 1XYBA 3CJPA 5G5IA 1S1RA 1BYCA 3HJZA 2Y2WA 3O7UA 2NQ9A 4AY8A 1EJTC 1IE7C 3UYCA 3CASA 4L1WA 4IFRA 4A8NA 2Z6JA 2V6AA 1SYTA 3KABA 3URNA 3TTSA 4PUKA 1AVAA 3JZUA 3XIMA 5C5YA 4GA8A 4NZ1A 2ZCGA 2CHOA 3O5JA 1TCDA 5BOEA 4Q8NA 1FP8A 4HK5A 1D7JA 4LAKA 1OQFA 1V7YA 3RLGA 2CU0A 1B5TA 1XIJA 4B5XA 3S5ZA 3EIPA 1TV8A 1R7OA 1VF8A 5LGXA 3JU2A 3TFXA 1V03A 2NQHA 3DESA 3B8WA 3DU0A 2HE5A 4UDMA 5FCZA 2E40A 1PTAA 3TONA 4XO6A 4NI8A 3WQ6A 1SO4A 2DJXA 4I5XA 2CLOA 4AZBA 1OX6A 2PGEA 1QI5A 4KIEA 1BLIA 3C4UA 4UMAA 4W86A 4AEOA 2G96A 4JX4A 4OGZA 3TWAA 3MWAA 2ISDA 1JCJA 4B9YA 1KW1A 2YBUA 1CGTA 2RSEA 1EQCA 4GYJA 3N3MA 3CO4A 1ZPTA 2BDQA 3I7SA 4OKDA 1W3KA 3M6DA 4Z2GA 5I09A 1QASA 4TUFA 1UWIA 2QUVA 2ASHA 5LIWX 3CC1A 4OOZA 1OY0A 1TE1A 1ESWA 1CCWB 1J0JA 1XH1A 3TJIA 4KCWA 1GOKA 2YFNA 5AN7A 1S2TA 4DVOA 2ZA3A 4CQDA 2WC7A 3ATZA 4XX6A 4LALA 2GVEA 2E6AA 1EZ2A 4KETA 3MYPA 1IIGA 4GVFA 4N4QA 4S1FA 1JCXA 3GTFA 3TYZA 3PZMA 1KFLA 3G0XA 1Q6QA 5HNUA 3BW3A 1FHLA 5BXJA 2DGAA 3TN4A 1KFJA 1Z6KA 2XP6A 1XKYA 3VGGA 1I2OA 3OG3A 4GQQA 4ML9A 4NAEA 3ARTA 1GUVA 1KXQA 1GVQA 2CHNA 3VTRA 2CEQA 5BNKA 1W9UA 1D8CA 2BXYA 4ECLA 3MMDA 3CU2A 1NJJA 1XBVA 5D9NA 3E3HA 3M46A 2A79A 3QSTA 1E71M 3NQVA 2E67A 3KBJA 1CXIA 5JBFA 1XYLA 1RVGA 3MZ2A 2I5IA 2BB0A 2HDJA 4U4MA 1C9WA 3CUIA 3B4YA 3ORWA 1PX8A 4ROPA 1ISXA 3D47A 2VEPA 2VFHA 3E2SA 1HGWA 1GOQA 1FWSA 4JFVA 4EP8C 1QOQA 3TW7A 5FAJA 2PUZA 1VFLA 3HQPA 1H60A 3W7HA 2VEMA 2ZR6A 3TJXA 2C16A 1W5QA 5EB8A 3A4JA 4MZYA 3W71A 4D8ZA 2XP9A 3GX9A 1Q45A 2GJNA 3PZTA 2BXZA 1GONA 1YW1A 5C6MA 3BMBA 1I9CB 4PB3A 3U48A 5H2ZA 1RA0A 1PYFA 2Z2UA 3CQKA 1PWMA 4KFOA 1XM3A 5TQLA 4MSSA 1YTEA 2AMGA 1UR2A 2FJUB 3R13A 3BDKA 3LV5A 3FVMA 2F84A 1EUAA 1DXIA 3T07A 3M07A 3T42A 1F73A 2R8WA 2WKJA 3SM0A 4POCA 5CBJA 1R5YA 2X7WA 5I3DA 1EC9A 1PZ0A 3BMVA 1H1YA 2RFGA 1BWVA 3NJ3A 4MFDA 4US5A 5CPTA 3S3GA 1XLIA 2NW0A 1MW0A 3UVIA 2C18A 3W1TA 5CBBA 2P4VA 4AZGA 1O94A 3TN5A 4YVVA 3UF8A 5I98A 4GFIA 2NUWA 4DJFD 3DGBA 3TVAA 1KA9F 2HVOA 1VPXA 3UR8A 4AZCB 3ARVA 1RY0A 4ZODA 5MHBA 1TR9A 5L6UA 3KL0A 1V77A 3HPFA 1VP5A 4J3UA 1U5JA 2J13A 3OZYA 5KITA 3RPDA 5HDRA 1LUCA 1TPVA 3NQ7A 3BSMA 1JF6A 3OOBA 1EOMA 2GWNA 4XZBA 4TTGA 5MKGA 1I4NA 1VS1A 2BX7A 3VCNA 4Q32A 2WOQA 1W6TA 1ADSA 4UTTC 3NGFA 1CDGA 1V5XA 2J7CA 4LV9A 5DITA 1UKQA 3COTA 4IPJA 2F38A 2E4TA 2FHBA 2ZIDA 1GQKA 3GVRA 3WDHA 1GG1A 6PTDA 4J3SA 3DFOA 5CQ1A 5K7JA 3TSMA 2D22A 1UKTA 4QNWA 2WSPA 4ZOCA 3CM4A 3GDMA 4WDUA 2XN2A 3VOJA 2VQUA 4BQ4A 4LCRA 5DMYA 5H8MA 1ALDA 2WQPA 2GGEA 4FX7A 4HK6A 3KS6A 4MB5A 4BFAA 2H8XA 5D37A 3Q67A 5DO2A 1Q6RA 3M0JA 4JFSA 4A21A 4HPGA 3I6RA 3W28A 3B9AA 1Q6UA 3S8HA 1UKOA 4O1BA 2PRMA 4Q7NA 1S5TA 1DJHA 2Z1KA 3O06A 2IMRA 4HNVA 3WK0A 2SFPA 1DIOA 3FXYA 4W9PA 2TYSA 3S5YA 2VWSA 1P4CA 1NQ6A 4H9TA 3EXTA 3G1RA 1JAEA 3GTXA 3S9ZA 3S4TA 3RX3A 2AQOA 4O28A 3SAZA 4H8UA 1VH7A 4PB4A 2QQ6A 2VCCA 5HPOA 1YKWA 4RDWA 2DZTA 1SFJA 3TDBA 5F7UA 1M5YA 5GQBA 4IF2A 3U9IA 4Q4OA 3LYEA 4FNSA 3CPGA 4JCLA 2GQ9A 1AQHA 2OB3A 1OFBA 3FHQA 1UWUA 4IPXA 3CZEA 1PX3A 1OZQA 2CZDA 2HV5A 1R9HA 4Q4PA 1PO9A 1OEPA 2QCFA 1ZGDA 3IIOA 1R3WA 1PAMA 3V35A 4DI8A 2G3JA 4S38A 3NPWA 1I75A 1YNQA 3NIYA 2BY0A 3AOFA 2WMGA 1UH3A 4DPPA 3HBLA 3N6JA 1LOSA 1BGGA 4GC4A 1WKYA 1WZMA 2J7BA 2GVGA 4QS5A 3BMWA 3STGA 2XINA 4XZMX 3R94A 4PTMA 1TV5A 5HW7A 3G0SA 3W53A 1PIIA 4Y9OA 4AMAA 4KS0A 3GUWA 3G18A 4A35A 2ZADA 5AYBA 1XG3A 1MYRA 2MF9A 1HNYA 3KL3A 4NASA 1W9VA 1KLZA 5LNVA 4I9MA 4XKYB 1FKJA 2R9RA 4OBRA 4L56A 1KWGA 2XWEA 4AZHA 3WBYA 1E40A 2D2JA 4B5WA 2QDEA 1K77A 2R1MA 4IFKA 4UQDA 4IT1A 4JFJA 2CFFA 1E72M 1ZS2A 3C5QA 3R43A 1R47A 2GSHA 3O6AA 4NJGA 1W1IE 1YATA 1GQJA 5DY2A 1XC6A 1M53A 4ACZB 3R0DA 3NQEA 2WPBA 2BZNA 4PCSA 1G4PA 4KCUA 3M7WA 3S83A 2Y1HA 3CQJA 3IUDA 4UB9A 4M6VA 1H41A 3PTQA 1KCZA 5CKSA 3I3DA 1DJNA 4WDTA 1VC4A 1QATA 2GLKA 2R1LA 1JQXA 3BZGA 2TSYA 1XL9A 5D9MA 4Z08A 2DZPA 4HTBA 5FKYA 4M8UA 4QHRA 1PZ1A 1OVDA 4I6VA 3G5EA 2PDFA 3BANA 2J6XA 2EG6A 3QOMA 4DRSA 4DBUA 2QGYA 3VINA 3KP0A 4V1YA 3LHWA 3BL3A 3NZGA 3AS2A 4A22A 4B91A 3ZVIA 2DG4A 1SR9A 4DRKA 4XBSA 2V5KA 1A5KC 4O13A 1ZY9A 4ZMGA 1MQQA 5HWJA 1XSKA 4HCDA 3PG9A 2PDGA 2VC6A 2E68A 2CNCA 2YCEA 5E6YA 4IX0A 4H6RA 4KWOA 4UBPC 1L2QA 4LNCA 3VGHA 2QCNA 2ZXAA 3H4WA 2Y0FA 4KKXA 1RAKA 3L2MA 1QW9A 3DX5A 3KADA 1SMDA 1E51A 3CHCA 1MWOA 2ISFA 4UQAA 2QT3A 4JQ2A 3IGXA 3MMTA 1EDQA 3ELFA 2XFFA 3APGA 4U3AA 3F4WA 1TA3B 4HU4A 1ADDA 5A8QA 2GK1B 4EK7A 2POZA 3N18A 1SO6A 3WF1A 5C2XA 1MW3A 3CS2A 2RGMA 1PKYA 4FK9A 3KEHA 3L66A 3FOKA 4ZOBA 3DIPA 4NUWA 2QDDA 4ONVA 3W83A 1LBFA 4DZHA 3O3RA 3UG3A 4UCGA 3EBVA 4LS0A 3QFWA 1XBYA 1JZ8A 1GJUA 4DELA 1CXEA 4TYOA 1DHPA 2Y89A 3VX0A 4AIOA 2HXTA 1XD1A 4B3ZA 1R2SA 5C9UA 3W1QA 3FV9A 2VVSA 1WPCA 2A3BA 4DJDC 3WNKA 2IKGA 3ZFHA 2NX1A 1B30A 4WJ8A 3TZFA 3T7VA 1E4IA 2E28A 3EYPA 2YB4A 3IV8A 4ZS6A 4XTIA 4A4AA 1BKFA 1EX5A 3EX4A 4C6QA 3LGGA 4IG2A 4LUSA 3ZT5A 2YDRA 1Z9AA 3OOQA 4TQTA 2NV1A 3NSNA 1H5YA 4FNRA 3GU0A 4HN8A 3AYSA 2VEGA 3GG7A 3F4NA 1TV7A 3UZYA 2VZSA 2VN1A 5E0CA 4JIIX 1NOFA 3HURA 1GKRA 2VDHA 1F7BA 4R7OA 4Z1DA 2PTXA 1Z48A 3VZYA 4IIHA 2A4AA 5C2CA 1BXNA 1XYCA 4KCVA 4QDPA 5PTDA 2A3LA 3GNOA 2ATSA 1B6CA 3RMEA 3F4VA 3UY7A 4FLRA 1FWBC 2NXGA 5EMUA 3W1XA 2NQZA 2BGSA 3IACA 2FTPA 3IJ9A 4MNJA 4H01A 1BG9A 2WSKA 4KMQA 3UZ5A 2Y5SA 3EOLA 4UCFA 1IEQA 1QO5A 1UA3A 2CLFA 2HS8A 1SJAA 3ZJ7A 2XPBA 4J28A 1X6LA 4LX4A 4J2PA 2WW5A 1UWRA 4A6GA 4N6FA 3EOSA 3HG4A 4ZL1A 4HZ8A 4DIAA 1FH8A 4B9ZA 1R86A 2DUZA 3Q58A 5I3KA 3CGMA 4MWAB 4NRRA 3URQA 1C91A 1ISVA 2JALA 2TODA 3LBMA 1UWSA 1WDDA 5AZ0A 4LEQA 4OE7A 4PUNA 2W62A 3E12A 1FKRA 3DFPA 2M1IA 3LNPA 5HTGA 4L80A 2ALRA 3A9IA 5I3FA 3UF9A 1VD6A 3GIPA 5JIWA 3BQ6A 1JFHA 1TQXA 3P5ZA 1PINA 4ACZA 3TH6A 3O5FA 4RNIA 1BVWA 4DHGA 2P1FA 1ONEA 2JEPA 2P3EA 4I8DA 5JQ9A 3V0UA 3O16A 3B0PA 3DDMA 3RDKA 2Y5EA 2Z28A 3WBXA 3PWGA 3ARQA 3DHUA 4UTLA 3TEVA 2WXDM 1J8VA 2YDQA 2Z24A 1ZALA 2OQYA 2AL2A 4FA3A 1Q5MA 4C6NA 1E0UA 3FEMA 2ISVA 1BYAA 3GSMA 3BG5A 3O5EA 4LYQA 5C9WA 1YNPA 4CNNA 4OTKA 4B3LA 4UFLA 1TWIA 2KAUC 2V2DA 4Z0SA 4WJXA 1DV7A 1GZGA 3HQ1A 3P74A 4GI6A 5CPOA 3NGJA 1LG1A 3LTYA 3SY8A 1GVEA 5KINA 4ERIA 3NTYA 1YDYA 4O57A 4DXKA 4WVXA 2DZWA 4N19A 4IPLA 1LOLA 1N8FA 1H11A 3FJNA 3HIJA 2A3EA 1TJ0A 2ZRWA 3KRUA 2QAFA 5A2BA 5K4XA 4ODKA 1ADOA 3LCXA 3BLKA 2QIIA 4IXHA 3S6OA 3FGCA 3W07A 1H5VA 5B8IC 1CXHA 1S5VA 1XS2A 2V5DA 1V02E 1XUZA 4J3TA 2PDNA 4HU8A 1AQ0A 2X7VA 2C71A 2AL2B 4CNUA 3H2NA 3H23A 4BWLA 1H0GA 1MW2A 3WLTA 2JF6A 2IXUA 3WJZA 1M7JA 3NQDA 4XZ9A 3RM8A 1FBAA 1FWWA 2D3LA 1IWAA 4AUBA 1SSGA 1KFCA 2ZQTA 3R8HA 1TIWA 3W3OA 2VRKA 1V08A 1ITXA 5ABFB 3ANUA 4Q4KA 3RFAA 2GZXA 4ZENA 1W3JA 1DIEA 3BC9A 2IQ0A 3A5FA 3A21A 4QROA 2OYLA 3P61A 1C8YA 4HA0A 1XIIA 3MP5A 1H0IA 3OGSA 1W1VA 3SCTA 4WSHA 5DCEA 4HJWA 4DO7A 2WMIB 4IM4A 4KCTA 1A53A 4O1FA 4MWAA 1EDGA 4MFEA 1GJPA 3QC3A 1HVXA 3L4XA 4XKYA 1QPNA 2EQDA 2E77A 3TX9A 1UD8A 3NI6A 4WZHA 1US2A 3WZ0E 3NURA 4ASTA 4X9YA 4QLJA 1Z8AA 2OEKA 2O7SA 1H7RA 4BEQA 4M80A 4ALDA 4PYSA 3GH7A 3RNDA 1U83A 4JIEA 2I1OA 3LEPA 3BV4A 4PMYA 4Y7EA 3KAIA 1FY6A 4C91A 4DRIA 1FWGC 3EPMA 1FWAC 4Q8UA 3KWSA 3RAOA 3S1XA 4IX2A 1Y8BA 4AVOA 1S46A 2QEZA 3KAHA 1OC5A 4XZNX 2VFGA 2XUCA 4GACA 3SUVA 3W25A 1JXKA 1EQPA 4DPQA 4UMCA 3NR0A 1K70A 4HHMA 1OIFA 1W54A 2BODX 3SCSA 2V3FA 1ZP4A 3N6HA 2J66A 2WMHA 3A64A 4MMWA 4DNHA 2PGWA 3O0FA 5KZ6A 1NOUA 1UMLA 1V0KA 5DRIA 4I90A 1MZRA 3UGVA 4RJEA 4NSBA 1Q8AA 4HKPA 1ZAHA 4NJJA 3TOPA 5C0QA 4AZCA 2Y6ZA 5D09A 3DERA 3THUA 4KF1A 5EFFA 4B5NA 1CTNA 1JVWA 4NHVA 4AVFA 3IGSA 4QM1A 2C14A 5T9CE 3AMCA 2G37A 4XUYA 3WLLA 1Q63A 1P0KA 2EGZA 4XVEA 1ZJIA 5HQLA 2Q5AA 3CXOA 1OG6A 3MHGA 1BXCA 5D30A 4GIVA 2R1NA 2O9OA 4DJFC 2X16A 3ITYA 3NVDA 5CC6A 1ZU8A 4C6CA 3KTCA 4H19A 5BRPA 2R94A 2FZMA 2F2DA 4V2XA 3L5MA 1VR6A 4HYWA 4N0RA 3NQGA 1C8XA 4KT2A 4C60A 1J2BA 4GIAA 3VOCA 2OWCA 4YYFA 2BY2A 1YHTA 2AOSA 2J8TA 3TW6A 2WNQA 1QNOA 3IIXA 3FKKA 2OWXA 4TX8A 5I7GA 4ZB5A 1PIFA 1VIWA 3S1UA 2P3ZA 2B5UB 1GW1A 2GUBA 1V3IA 1OWQA 1M01A 1G4EA 1OC6A 3W0KA 1R9YA 4ZQPA 2AMXA 2O55A 4ZE4A 1F61A 3GVGA 2YPIA 3P60A 4BF8A 3P6LA 4NP7A 4C6IA 4CVUA 4QJ1A 3UZXA 5HJXA 4IIDA 4DNMA 3N2TA 1R2TA 3POHA 3M5ZA 4FP1A 2OPJA 1XSIA 2J4GA 1B9BA 4C6PA 2Z1WA 1LOQA 4XBJA 4E4FA 4RL3A 2DIKA 3O8AA 2V67A 2EAWA 1H62A 2YJQA 1MQPA 5K9CA 4JFWA 4H8HA 3NTPA 4IICA 3E0LA 7XIMA 1MXDA 5K4ZA 2YXXA 4AEEA 2OZTA 2QS8A 4D72A 5AHLA 3W23A 4QXIA 1NWTA 1PTDA 4RK8A 1DXEA 2NQLA 1H1ZA 2VRJA 2H8ZA 3TK7A 3WJYA 2V5CA 1Q3NA 4JIPA 4DLFA 2WZEA 2UV8G 2XIJA 1HP5A 4RE2A 5A8MA 5U4NA 2V2CA 4MYAA 2A6NA 3NQ6A 4YVXA 3KZ7A 2D0HA 2J9ZA 1IV8A 4XZHA 5J5RA 5CZTA 3FAPA 5JH2A 1OT2A 1CECA 4HNOA 2B7QA 5LA0A 4K8HA 2QCDA 4F3HA 4GUJA 1UHVA 3G1SA 5I5RA 1K7FA 3H54A 3PBGA 4MB4A 5CLWA 1WA3A 3UD6A 4F9JA 1LRTA 3A22A 2NSOA 4WRHA 3TNOA 3OBAA 2ADAA 1NFPA 1VENA 3M9YA 5T26A 5HNRA 4DUWA 3VKCA 3HF3A 2O4QA 1BYDA 1HGYA 2ZE3A 5HATA 1N82A 4Q7BA 4UTWC 3AZTA 4B4FA 1NDWA 2G41A 1J0ZA 2OODA 1CBGA 2OCZA 3SDOA 2CESA 1UPMB 1N2VA 4LUYA 4N9DA 1GVFA 1IEIA 3ABRA 1P6WA 5BZAA 4EPBC 1ZAJA 1ZZMA 4QJ3B 3UI5A 3QQ0A 2X2GA 4WCJA 2ZR5A 1LT7A 4GZ7A 3VM5A 5HMDA 3LCGA 3H9RB 3EB2A 1OINA 1KO0A 3HJEA 4HMEA 1B4KA 3WLMA 4YPJA 3IK8A 3BVJA 2GK1A 1UASA 3XINA 4AISA 5LA1A 4QDMA 4MAZA 2WSQA 3M0HA 3BAWA 4E2VA 4H83A 4AQLA 1WBHA 3G1HA 3W2JA 3AIQA 2J6VA 2KGJA 4GCAA 3KACA 4N2YA 2L2SA 2RDWA 1NH6A 3AU2A 5K3VA 3ZSSA 4AB4A 1BQGA 4XZLX 3ONBA 4FLOA 1QU4A 3WBEA 1VHCA 3CQHA 4GVHA 4RZ4A 1R0MA 1RP9A 5L9FA 3TC5A 1BXBA 1TWDA 3UCQA 4E6MA 4XV0A 1CZ1A 3OZOA 3R4IA 1MXGA 3VDHA 2Z29A 1NDVA 1K4HA 1AZ2A 4CGTA 1EA0A 5FJJA 2JZVA 5HNNA 4C1LA 2XPKA 3BUVA 5D02A 2CKRA 6ALDA 2P88A 2FZBA 3IUIA 5K9XA 3O5OA 3NO5A 1UP0A 3CGTA 3FA3A 1TZ9A 5AVNA 3TROA 3KCEA 5CG7A 5DMNA 3QC0A 2QXWA 4IPPA 1BF6A 1QRQA 3V75A 1RD6A 4LJ3A 4EPKA 5G4HC 1KBBA 1W2PA 2XIOA 3EX1A 1JCLA 2Z00A 4XUGA 1HL2A 3T05A 4FXSA 3W2MA 2ZZ5A 1AG1O 3M0MA 2FPYA 4LEFA 4OBSA 2LGOA 3S42A 3S5NA 2PWVA 4KFPA 3GHTA 4PRWA 3KW3A 1YPFA 3CHDA 2XP8A 1C8VA 1Y5XA 2OZ0A 1U30A 2QNEA 5ABFA 3BGJA 2Y7DA 2J9YA 1JRBA 1PWLA 3IVUA 2W0UA 2WMJA 3MZNA 1RP8A 3PUDA 3B04A 1KB3A 1MFVA 1S5WA 3BGAA 2NT1A 1ITUA 3ATYA 3DHDA 1UROA 4S2CA 1C8QA 1NVMA 3P67A 2W92A 1ME8A 3PUEA 4F9DA 5HWBA 1WX0A 3TC3A 5LHEA 3VIMA 3C0JA 2W5FA 3MDUA 4U85A 1KV8A 4FAPA 4GYFA 3LY0A 4XWUA 2X1IA 1QO2A 3EZ4A 4TXEA 3W7IA 1YNYA 2VMFA 1WQ5A 4ZFMA 4S3KA 1P1MA 4D6EA 1CPUA 1SFSA 3V36A 3AI0A 1QMLA 4ML4A 3QZAA 1QK2A 1RLCL 3CLWA 2FHCA 3FW6A 1CLXA 1D7KA 3BJFA 3A6OA 2E09A 1QR7A 4JYSA 4U84A 3WF3A 5CLTA 4GH3A 4PMQA 1PS9A 1CWYA 5HQMA 1VBRA 3S2LA 1SPQA 1J6OA 2VGGA 1JYXA 5F1UA 3KVJA 1UZDA 2OFJA 3O0KA 4IQDA 5HA7A 2JQXA 3BO9A 4KESA 4JBRA 5D75A 1XIBA 2HBXA 1EJ7L 4GI9A 1G7UA 4LRSA 2IPGA 2EEXA 4DJEA 2QGHA 3NSMA 4C6EA 3M4HA 4LAOA 4JTDA 4KR0B 2P53A 3HA1A 1V3HA 3WQDA 4UTJA 1BFNA 1EYWA 3L0NA 3PZVA 3M43A 4XD5A 1UP3A 1RCOB 3DUGA 3XISA 4FB7A 4EAYA 4Q8OA 4A2RA 1GVYA 2Y4SA 4DWSC 2OYKA 3WQEA 4UR7A 1C90A 2QUTA 4JIQA 4NVTA 1IT7A 2X41A 3C0QA 5E09A 4B4HA 3DBNA 4MVAA 2INEA 5D2VA 5DIVA 3BCFA 3P0WA 1A5NC 4Z2KA 3B8SA 2C3ZA 1H7WA 4LS2A 2XP3A 1V6YA 1W3NA 2WBKA 2MLXA 4B5TA 2J7GA 2JKAA 1UUQA 5D2TA 3CHVA 2XFWA 3MV11 4LUSB 1QOPA 3G2GA 1HG3A 3PB2A 1E6QM 5A94A 5KZDA 1WUEA 3TUUA 3QR3A 5EA9A 1F8IA 1RSCA 4W8AA 1OYAA 4TVDA 4N9EA 1C92A 3TYCA 4EXBA 4XSMA 2WMIA 3CZJA 2YR1A 1W5MA 3I3BA 1UR1A 3TYEA 3ALGA 3MMUA 1J01A 1UR3M 3K4DA 4WXZA 3ZXWA 2E0PA 4LV4A 1HUVA 3KVLA 4C7DA 3N14A 2NXHA 3ARUA 4H8NA 5LZLA 4G1NA 3N4AA 5HW6A 3ITVA 2QJGA 1GCYA 4GI4A 1FKXA 2PA6A 3IGUA 3NZRA 3HGRA 2YX0A 3ISIX 1QNSA 2VX4A 4NU7A 1Q6LA 4W88A 2FDSA 1H7OA 4ITZA 2PDHA 1I2PA 1JXJA 1J11A 4A8RA 1LYXA 3SY5A 4DYJA 1Q4WA 5GNZA 3T2QA 5EYWA 3WQGA 2VP8A 2YBVA 3UGRA 2F6UA 2UY2A 5DT5A 1UIPA 1WXYA 3WLSA 2D73A 3V7PA 2ZUWA 3MKCA 4IIGA 3BLOA 2J7EA 1YE6A 5HQEA 2B7PA 3PPCA 3GBDA 3T08A 3F2CA 2ZTJA 4QRNA 2YYTA 5CPNA 5BXSA 3HQNA 4DRQA 2EF9A 3CAVA 5BCAA 1FKFA 1I0BA 4UFMA 4YWSA 1ZCCA 3NL6A 4B5VA 5EFDA 2WC4A 3FDKA 3L7RA 1YPIA 2IW0A 1XPGA 4BHYA 4BQ5A 1E1CB 1S2CA 4EX4A 2BMBA 4R7WA 1JPMA 2LLEA 3GFYA 3V18A 3N3TA 4HHPA 2JK2A 3KFTA 5A6TC 3BG9A 1X7IA 3S9YA 2DSVA 4JQAA 3UNDA 2J27A 1KQZA 4IQLA 3WY1A 4ZO7A 4WDWA 4PTXA 1PZ2A 2QYGA 1F74A 1HO4A 1KM5A 1XH0A 3G77A 4PN2A 4DLMA 4L7ZA 3B9DA 4A8LA 3M0IA 4G9PA 4O53A 1UUMA 2A7RA 3O05A 1UIOA 3VNIA 1KGUA 1T6MA 4O0QA 3UW6A 5K9DA 1S2VA 1XDJA 2PD9A 3H26A 1LZOA 2PDKA 5T9BG 5HBFA 1XC4A 2OR2A 1X7FA 3PSWA 3EWDA 1E4NA 2WHJA 3C2OA 3W85A 3PWIA 2HSAA 2NV9A 4FIRA 4QG9A 1A0CA 1R6WA 2XSXA 3F7JA 1YEYA 3JW7A 3ZLFA 1HQTA 3WCZA 1XDMA 6XIMA 1VCVA 1UP2A 4ICMA 1A4MA 2V63A 4HD5A 1REQA 3TQKA 3KM8A 5BXRA 1MDRA 5FJTA 4RXFA 4HARA 3SADA 4K38A 4NIRA 5I23A 3S5OA 4PMNA 4D2JA 3Q37A 3CIWA 5JXQA 3BLEA 1EWDA 3AJXA 4MSPA 4MIMA 2E8YA 1Y5VA 1TV2A 5TAOA 1JYVA 3VD9A 4ZTYA 1V6XA 1IGSA 1YTDA 2YSWA 3E5BA 4YNGA 1Y65A 4PL2A 1JDFA 3MUAA 1FWHC 4HZ7A 5BXPA 4UQEA 5D4YA 1YMYA 1E15A 3TAOA 4FS9A 2ZRYA 4PMVA 4N7QA 4JFTA 1H2JA 2INZA 1LLZA 4CU8A 2RKXA 3NDYA 3FDGA 4FMVA 2XP7A 3LRLA 1AD4A 5A8GA 4F0MA 2P5NA 3R79A 4JN8A 4BCEA 1FKSA 1M3UA 2VNCA 1V6TA 3NQMA 1EJRC 4A3YA 4PTDA 4FF5A 4RCXA 1R87A 1GYNA 4GIEA 3EWWA 3GDLA 4J4KA 3UEQA 2BWGA 3N1AA 3PS7A 4RPPA 1A5CA 2DVTA 4W89A 3RO8A 4IG2B 1NWRA 4HPJA 3HG2A 1XIEA 3P8IA 3TFCA 5REQA 4LVBA 1XKJA 2ACSA 3K8MA 4K3ZA 1U1UA 4DAIA 3LI0A 2F6XA 2XP4A 3QSRA 4O10A 4DO5A 3UERA 1Q6FA 3LCFA 3VNDA 4L6OA 1PBKA 4MLRA 1WAUA 3B40A 1IXQA 4C6OA 4L72B 4RV3A 4M82A 3SN1A 4E2BA 1XYMA 2HRWA 3NQAA 4AAJA 1Z3NA 4D8LA 1JFXA 4HP5A 3M5VA 3KBSA 3OBKA 4V27A 4QQ3A 5HINA 3W7LA 1ME9A 3H7VA 3MUXA 3E2RA 2ZRXA 4GKLA 3JYMA 4GNVA 4F2UA 4F66A 4LAXA 4EOUA 4HMNA 4URIA 1AZ1A 1HL8A 5BRBA 1U79A 3TQ0A 1P0BA 2YB1A 2YOCA 3BICA 1M68A 1R3YA 3V3WA 3B05A 1UR4A 3RX4A 1M7PA 3ZLGA 3DG7A 4TMBA 3VIJA 4L9XA 5C8BB 2Y85A 3P5YA 1P0DA 3L4TA 1VHNA 3VOFA 1OFEA 4J3XA 5CPQA 2WMKA 4N6EA 1AL8A 1P48A 3VNJA 4CQBA 3BPWA 3LTSA 5HMSA 3BAYA 1B57A 1E6NA 3THDA 2KFWA 4GX8A 1B1YA 1VRXA 4JTJA 1MNZA 5DN1A 4F2BA 5LSMA 3CUHA 2BV9A 1UA7A 2I57A 3W24A 1BF2A 1U5HA 3W70A 7REQB 1MSSA 3DH7A 5DY3A 2Y62A 3VO0A 5AHMA 3WX7A 1M7XA 3VDGA 4PUJA 2I5GA 2VR2A 1J4RA 2VD9A 4JTIA 1RR2A 4HPXA 4HZMA 4NQ1A 3HV8A 5FSEC 2PMQA 3TA9A 3T2OA 1A3HA 4J1OA 1KRBC 1WCGA 1KC7A 1OG0A 1KFWA 4TOQA 3W7JA 2XJ7A 2Z1SA 3P93A 4LQ1A 3GKAA 3TQVA 3EKZA 2QCLA 1NDZA 1RJPA 2B7NA 3QM3A 4JYDA 4UFHA 1U33A 4DF1A 1BYBA 2DY3A 1ZENA 2E9BA 3ITTA 3M5YA 3OLGA 4ODOA 4GY7A 2NSXA 1DQXA 4H6QA 5DRCA 4FHAA 1O1ZA 1XHGA 4XQ6A 1F6KA 3E2QA 1J9YA 4RW3A 2QZRA 1LL4A 4DJFA 5FD0A 3P3BA 1NP0A 2I56A 5LA2A 5FEZA 3NRKA 1ZSXA 4JFLA 3PNUA 3DN5A 3SY1A 3KVKA 3TTOA 2ZDRA 1WDQA 3JRKA 3OHIA 1KKRA 4FXJA 5AYXA 1GEHA 4AYGA 3G1YA 4QJ5B 3DI1A 3FNDA 3N9SA 5IFPA 1Q6GA 1A47A 4JR5A 1ZBCA 4H00A 3TTQA 1R3QA 3HB9A 2C1GA 2E6FA 1TMHA 2G0WA 4KFNA 3CYJA 3KOXA 4F40A 1LUCB 1HW6A 1WBJA 2G4FA 1G0CA 3AROA 4HIBA 1IWPA 4PCNA 1ZBKA 4YTRA 2M08A 1TTJA 3R7MA 1DXFA 4JTGA 4Z17A 3SGGA 4IQCA 1UBPC 1JPIA 4GO8A 1X38A 4ODMA 3RGCA 2K8IA 1UG6A 2QUUA 2XGZA 1VFUA 4ZQRA 2KZHA 1OCBA 4V1XA 1QJWA 5HMFA 1BTMA 4JCMA 3SW6A 4L64A 5IOBA 3WJWA 3CHEA 4C5YA 4DF2A 4KEMA 1F5ZA 1YXYA 1E9YB 2E5DA 3BK0A 3T0TA 4LAUA 1XCFA 3DC8A 2JBMA 2RAGA 4J35A 4X9SA 3GC5A 4PGLA 3L68A 1V4YA 4DY1A 4XAY