1JNHB

Crystal structure of fab-estradiol complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
214
Chain Sequence
EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARYTQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTVTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal anti-estradiol 10G6D6 Fab light chain
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 214
sequence length 218
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB02
2K3TA 3VWJC 4LARL 2OXHA 1LD9A 4NWTL 1MFBH 4J8RB 1QD0A 2D4FA 3QIWC 2BDNH 4JFHD 3KDMB 3WNOA 4JO4L 3VI3E 4HIJA 1HEZB 4MAYC 4WUUB 2CD0A 1TLKA 4I4WA 3ARFA 1FLRH 3C5ZC 5IBLD 1ZLUH 5A2KH 2AJYH 5K9JL 3JWDH 3FB8B 4LBEB 1ZHBB 1BF2A 5GIRA 1BF8A 2KDGA 3S35X 5MI0C 4NYLB 2CK2A 4Q0XH 3OKMA 1OSPH 1Q0XL 2VLJD 5MENB 1FZOB 5C0BE 5T3XH 3DVNA 2XTJC 2AJSH 1AD9B 1CGXA 3O9WA 1DQDH 2OSLA 3MNVA 3WMSA 1NGZB 1YNLH 1T2JA 2GCYB 3AGVA 1ACYL 4EOWH 2W59A 4XCCL 3VXMB 2HKHL 3L95B 2H41A 3S88H 1JRHH 1NCCL 1T2QL 2E8ZA 2ICES 2CKBA 4KTEL 2JJSC 3GFUA 4YHZH 5SWSD 1RURL 4RGMB 1WEJL 4V1DE 3TWCL 4MYWB 3CSPA 2XTLA 2WK2A 1IGYB 2ADGB 3V7AG 1KPVB 2XT1B 4GW4B 3FQXB 5DWUH 3O6FC 1A4JA 2O5YL 3WIHL 4XNYH 1JPFA 4FP8L 1KG0A 5IROA 4OLXH 3GJEB 3LS5L 1MY5A 3FONA 4FFYH 2CDEA 3CDGA 1Q9WA 3INUH 4WWKA 4OCYL 3AREC 1YC7A 3WNPA 5KZCD 4NPYB 3CX2A 3O3AA 1YEDA 4ONFH 2VZTA 4ODVH 2Y5TB 3QNXA 5DGQA 1A7QL 3PP4L 1EO5A 1IL1B 3PL6B 4BA8A 1CDYA 4LSRL 2FECL 4CDHA 5BVJA 2UZYB 4L1HA 1AGDB 4XAWL 4BM7A 1IFHL 3DSFL 4ZD3L 4KZEH 2A9NL 3NCYP 4LKCA 5DRXB 1MIEL 5CEYA 5DJZB 2GJZA 4JZJC 4KK5C 4XPTH 4LMQI 4HCRL 4MXWH 5JW4Q 1DEDA 2ATPA 5DD6B 2CPCA 4QNPE 2B4CH 2X6MA 4E41B 4RRPA 4YH6A 4WY7L 5D1XC 2GSGB 5IVOA 3VGBA 1XMWA 1BGXL 1N3NB 5JOFA 1FRGH 1XF3A 4M1GL 5JQHC 1EIBA 1GXEA 2DDQL 3C2AL 3X3GL 4UOW1 2GT9A 4PJDB 3MRBB 2P5EA 4JY4B 3HZVA 4FQXC 5TDPA 2FJGA 3QI9A 2IADB 4U7MA 4LVOC 4PJFE 4LHUG 1U58A 3BKYL 2WLYA 5I1KL 5E5RB 1BVKA 1FFOA 3VWJA 4WFEE 5GGQH 4NQTA 4ZODA 4CADB 5J11C 3VXPA 5L0QB 1YNTB 3RQ3A 3RWFA 4NBYB 1V3JA 5I1CL 3IFLL 2DQHH 3PGFL 2XZCL 2KPNA 3C60B 5AUMB 4MAYA 2VDMH 1I75A 1AO7B 1R3KA 4M7KL 2JJTC 2X4QA 4QHMA 3BQUA 4LEOA 1VPOH 5CSZA 4G6JH 5FGRA 4JJ5A 1J7VR 1U0QA 1LE9B 3ZDXF 4Z7NF 3RPKA 3O11A 2A6IB 5BCAA 1XCQB 4LNRB 3WSQL 2AS5M 1BOGA 1MH5B 2IPKB 1BVLB 1Q8MA 5ITBL 2BRRL 4PJ5E 3O6LH 4JZOA 5L7XH 2CRZA 5DEFA 2F15A 3KGRA 3VFSA 1SM3L 2CUHA 3PGDB 2CO6B 1GZPB 1NGYB 4PLKC 2VAJA 1WVZA 2B2XH 2AEQH 1KPRA 2EO9A 3KPSA 5EUKB 3RWHB 2FJFA 3FRPA 2NMSA 4I0CC 3QCVH 3KJ6L 4OZIE 1SY6A 3WJLC 2JJSA 4L3CB 5TH2A 4CN6A 2FCBA 4GRWF 4GBXD 4NUGL 4X6DF 4XGZB 3OAYK 3EW3B 1IJ9A 1P7QA 1QSEA 1FAKT 1DEEA 1TVBB 4FQ1H 5EH1A 1DQML 1SJVA 3RA7H 3NIGE 2OL3H 4POYA 4JKPH 3V8OA 4FZEL 1FL6B 1T7XA 1QHPA 2CRYA 3O6FA 5T1KB 1HSBA 1MCEA 3O2DL 4NZUL 1FCCA 3UZQA 2EE9A 5IQ7L 1KACB 5KSAB 3SDYH 2DYPA 4ZS7H 5FYLH 1F45A 3CSYA 5F7DB 2AGJH 2NY7H 1RV6X 2X40A 4KKLD 1DSFH 1N6VA 3K8LA 1S7RA 3G08B 2XKUA 5ILTH 3IVKB 1P1ZA 3S3JA 4YDJA 3WXVL 2A9MH 4PS4H 5D9SA 1DVFA 4N8CL 4ODHL 3TBYA 2RCSL 3QEQD 5CLTA 4RMQA 1PYWA 4HXBL 4PV8B 3T4YA 2YMXH 4YHYC 3QA3A 2VSDA 3JUZA 4NN6C 1YMME 5AYUH 3RVTC 3GMQB 6CGTA 4Y4HB 1T4KB 4YUEL 4LU5L 4POZD 3QFJE 4GH7B 1AGBB 4GUPB 3DURA 3L3HB 4KROC 2A6JB 3HFML 4XBEH 4NDMB 3L6FB 1JPGA 1NMBL 2CDGB 4HXAH 3QHZH 5F7EL 2JTDA 4R96B 2DLIA 3OGOE 4U1GB 1II4E 4QOKE 2WWKO 4XNQB 3HE7C 5IW6A 2E9IA 3TZVB 1LNUA 5ESVB 4K7FB 3HE6B 1I1AB 1RIHH 4OZ4B 4Z7WA 3PHOB 3OKLB 2VITA 1U8IB 3BMVA 5ENWA 4FQCH 3CFDB 4Z7VF 2PXYC 4PRNB 4RMWA 3W39B 4ODUA 4WHTA 3TCLA 1I7RA 4P59L 2R0WH 4MXQC 4FQXA 1U8LB 3LIZL 4NSKA 4ZXBD 1BEYH 1N5YL 2IAMA 1B4JH 3MPCA 4QHUA 4IRZL 1K4CA 4KTYA 1TJGL 4PJEB 2HLFD 4WW2B 4Y8DC 3RGVA 1WWAX 5CBAB 3CXDH 5D8JL 1MAJA 3MOAH 5EG6C 5HDQH 3CDCA 2MWCA 4LCWA 3BESR 1JNJA 1U6AL 2MQ3A 4XVUD 5A40E 3O2VH 5I8CB 2ZUYA 4WJ5A 4Q9RH 2VZ3A 3MCKB 1J12A 1FFRA 4Z7UB 1FL3B 1M71B 3ARXA 2X7LB 1SEBB 5CKAA 4Z78A 2EECA 1AD0A 35C8H 3EFFA 4HF5H 4HLJA 4U0QB 4GS7B 2FDBP 2GY5A 4MJIA 1MWAB 4XVTL 5C8JA 4G42B 4N0UE 2BX5A 3P0VH 1SBSL 3OBAA 3TP4A 4Y5XC 4U1IB 5I16B 3ELAT 3SE9H 2YR3A 1R5IB 3U83A 3BP5B 1GCFA 1J0YA 1SVCP 3MNWA 1NBYA 2D0HA 2XY1A 4YO0A 3GSWB 3ULVL 2EDRA 4QHKJ 3EYFB 1QFHA 5D6CA 5D1ZC 4CMMA 4DZ8B 3KYMB 1AGCB 1VB9A 1X6LA 5EOCH 4L8DB 5HHXL 1M05B 4EDXB 4XBPB 1A6AA 3MV7D 5ICXA 2O26U 4N0CC 4LSTH 4YBQC 3WFHA 3C8KA 1KFAL 3J7HA 2XY2A 1QYGL 4RX4A 4DAGL 5IB3B 3LV3B 1F58L 2QQNH 2R0LH 4WGWB 3BPCA 5D7IF 5JOEA 2VLKD 1KULA 1MAMH 2MJWA 5C2UB 1GOHA 1B0GA 4PJ7E 3VGFA 1HNGA 1YYLH 5DLMH 2J8UA 4UTAL 1LK2A 4DZBA 1P2CA 2G60H 5GRUH 1BAFL 4WFHE 1S5HA 4YQXH 4NO3B 4L4TE 4F58L 4HGWA 5CIPA 3LQAH 4ODXB 5F3HA 4PGCA 2Y25A 4P5TB 3VXSD 2BC4A 4W4OC 1YY9D 3KPRA 1N59A 2M8XA 1KIPA 5EUOA 4KDTC 3T09A 1QSFB 3F5WA 4W68A 3K80A 1RUPL 2VABA 1OCWH 1WC7A 5SWZE 5JUEH 4JFZL 4BYHA 2Y07H 4K94L 3NZ8B 3NA9L 3QZWG 1A7PH 4PRPB 4WU5A 3FFCB 3ZDYF 3BPOB 3I75B 5DRWB 3EOYG 3N1QC 4U1SB 2BSSB 1CBVH 1T21A 4DVRH 1YEHH 1UJTA 2AXJA 4H1LG 4UUJB 4GMTL 4IRSC 4PGDB 5ECJE 3NN8B 1VGKA 1AFVH 2YC1B 5ISZA 2IGFH 2Y6SD 4G8IA 1IKNC 2DL2A 3QXWA 1S9YB 4R0LC 3HMXH 3LKPA 5D71H 5GHWL 4Z5RA 1JHKL 1P84J 3N50A 3MRIA 3ZKNC 2HRLA 5C0BB 1KC5L 4FFVD 5MP6L 2IPTH 2VISA 4P23A 2OTPA 4DQOL 1LK3L 4QKXB 1NBZA 1T7ZA 2VQ1B 3U4AA 2VYRE 2YRPA 5KOMC 1GAFH 1KT2A 1ZLSH 1IQWL 4MNHB 5GGVL 4OLUH 4P9HH 2JB6B 1YEFL 4XVJH 1ZT7A 4Y5YB 4U6TA 3RWDA 3VFGL 2XQYK 5H37H 4V1DB 2CIIA 4KQ4L 3QPQD 3SDAB 1CXFA 2D4DA 4NWUH 4PBWD 3QCTH 5T5FH 1FO0B 4MA3A 2NY1D 4FQJH 4XP6L 2AP2A 3EZJB 5F7YC 3BW9A 2HFFA 43C9B 4K9EH 2ZCLH 4PYGA 1OLZA 3MLSL 1VADA 1S78C 3P11H 1LD9B 4Y5XA 1QRND 3THML 5HHOD 4F8TA 5LGHL 5DEZA 3MV9A 1MJUH 4HIJB 3CDFA 1RZIA 4FMFA 4I4WB 3ARFB 3C08L 4R4ND 1J0HA 2ADIB 1MF2H 4QEGA 4ZOEA 1ITCA 5GIRB 5DS8A 1FAIH 3VXNB 1F90L 5JMRA 1IGTB 1OAXH 3OKMB 5EIQA 3KHOA 4FFWD 3F8UB 3DVNB 1U36A 1RZJL 5D2LF 3O9WB 2ARJA 4JRYA 3QHTC 3MNVB 2OSLB 2XWBB 4M5ZL 4TULH 3VH8A 5IM7A 2B0SL 1EHLH 1UT9A 3QP3A 4PY8I 4YHMH 3RWGA 2EYSA 5C0NC 2VKWA 5TE4L 1CE6A 2CKBB 2AI0H 1DQJA 1G7MB 1I3RB 4G3YL 2DKMA 2VDKH 4HS6A 5E8DH 5D7SL 3FQUA 4PTTB 3O4LE 1TENA 4PJCF 4P48A 4UDTA 4APQD 2Y36H 1A4JB 3IGAA 1JPFB 2BSTA 1EZVX 3V6ZA 2HYMA 1KG0B 4JANA 3UPRA 3MV8D 3QUZC 4MQTB 3LMJL 3FONB 3RAJL 2CDEB 3CDGB 4WWKB 4M6MH 3MV9E 1ZANL 1IRAY 5IB1B 2NY3D 1M4KA 3O3AB 1YEDB 2GEEA 1A6VH 2X10A 2YPLA 1NFDF 1HWHB 1D6EA 3QNXB 4HUVA 1R5WA 2AKRA 3B9EA 4JKWA 5KN5A 3W5NA 3GUTB 4OLYL 5T3ZH 3UZVB 3VFRA 2R4RH 5KVFL 5BVJB 3IDMA 5C0GA 1H5BA 5FHBH 1TVDA 1JVKA 2D2OA 4LKCB 5JXED 1UYWL 1MIML 3QNZA 5CEYB 5GS0D 1XZ0A 4JRYE 4LP5A 4NO0A 2GJZB 2BY2A 1D6VL 1S7SA 3UTTA 3LB6D 4YNYA 4RMVA 2JLLA 1HIMH 4G7VL 1MJ8L 2ATPB 3KPOA 2YBRA 3F65A 3WFCH 4Y89A 3U2SA 5F8QC 4O51B 1P84K 3BD4A 4OZHF 4FQHA 4L3AA 1NGPL 3AS3A 4PRBA 1S7TA 2OL3A 5FKAA 5JOFB 2Z8SA 4GQ9L 3T0DA 4OBRA 1BJMA 4P2OC 2Q8BL 1CL7H 2E7HA 4QXGL 2WUBL 2NY2B 1XCTA 2EDKA 3EFDH 3ZZ1A 2GT9B 2QSQA 2P5EB 2VIRB 4HWEL 2O93L 4P4KD 1ZT1A 5TDPB 2VDQL 1OGAD 1MPAH 2FJGB 2O5XL 3BZFA 3QFDA 3QI9B 2ZUTA 3RZCA 1MCJA 2YPLE 2C3VA 1U58B 1BQHG 4GKNB 3GMRA 3QWOB 3Q1SH 1BVKB 3IXAA 1LEIA 1U91A 3VXPB 2HT2D 4PRID 3ZT6A 1ZA6A 3RWFB 4IMKC 2GHWB 4JO3H 5F6IB 2W9DL 4ODSH 3IFPB 3SHSA 3W0WA 8CGTA 3JV5A 1BIHA 1WJ3A 5KTEL 1R3KB 1W72H 4QHMB 2F54D 3BQUB 4LEOB 4ELMF 2W0LA 5CSZB 1OB1A 1G7JA 4XP5L 4JJ5B 2A73A 2D7MA 4NRZA 3UTTE 3RI5K 3T3MF 2BY3A 4AENB 3MXWH 4LCCA 1P53A 3MCLH 5D1QA 1BOGB 3DTXA 2EDYA 2WBJD 1IC5H 1YMMB 1L4IA 4JM4H 3PF2A 4DUVA 1P5UA 1EMTH 1L9NA 2GITA 4K7PL 1K3ZA 3VFSB 1KPRB 3KPSB 2FJFB 5EBWA 2OI9B 3FAWA 1DDHA 4TNVF 5D70H 4JY6A 5TH2B 3I2CH 4OB5L 3UP1A 1CDUA 4QOKB 3P0YH 1P7QB 1DEEB 3FB5A 4NQSA 4XWGH 3H8NA 4CVZA 2LABA 4NQDE 2XG5A 5F1OB 1JMZA 4ACPA 1MQKL 2UWEF 3WIIH 5FDWA 4N0YL 1A3LH 5KS9A 1DBKH 4J23A 4HFWA 5DVLA 2DLFH 2OZ4H 3CSYB 1RMFH 3CC5A 5F7KC 4X8JA 4WHCA 4WFFD 1S7RB 2VTFA 4UB0L 1KTLA 1P1ZB 1KEMH 3IDYC 5GZND 1MHCA 1AR1C 3AS2A 1D9KC 4HW6A 5D9SB 1DVFB 1KF9B 1SYSA 3EO9H 3QNYA 1JWUA 3QIWD 1XIWC 4MS8C 4QRRD 5EORL 3MZGB 5J89A 3A6OA 2B8OT 2XZQL 1X7QA 3T4YB 4QTIH 3OKEB 3TV3H 4D0BB 5I17B 5DMIL 2Q87A 1C1EL 1ZHNA 4UAOB 1EFQA 4G6AC 4U1LB 4LGRB 3QXTA 3QIBC 3O45A 5KJRL 5E6IC 3DURB 5D7KD 3SDDA 2NY0D 4YDVA 1U8QA 4HAGA 4KMQA 5CGTA 2XTJD 1JPGB 2WW8A 2BP3A 3BT2L 3BN9C 1AHWC 4UI2A 2HJKA 3VXUD 4ERSH 4MJ4A 5E2VL 4PUBH 5IW6B 4XB7A 5IMMA 2N4IA 2A1WL 4XMKL 1X6NA 1Q72L 5DT1H 4XP4H 1NCBL 4Z7WB 2R56H 2EDWA 5ENWB 3NFSH 1T66D 5EU4B 5HYJA 3QQ9C 2G5BA 4ODUB 4WHTB 5I1EH 3TCLB 1I7RB 1BD2A 3H9SD 3MLVH 4LASL 4NSKB 4IDJH 2IAMB 3FB7A 5HVGB 4QHUB 1K4CB 3AB0C 3VI4E 4JVWA 2YEZA 3RGVB 1WFTA 4X6FA 1NUFA 4UIKL 1N2RA 3MLWH 5E1HB 4XZUA 4LCWB 1ZGLM 2PW1B 1WIUA 1EHNA 4WJ5B 3NPSC 3U46A 4XCNB 2BNQD 4N5ED 1NCUA 3BZDA 3R1GL 3P4NA 3U9PH 1G9EA 4Z78B 3T0EA 5HGAA 1AD0B 5C86A 2D03H 4YBHA 5HHNB 4G7YH 4K3EH 4C58B 1X5KA 1XF5A 4MJIB 5IK3A 5BRZE 4PJAE 4KK5D 1A47A 4RMUA 5C8JB 1UGNA 1JNNL 4N0FA 3BDYH 2J5LB 3D39D 4AEHH 1TIUA 5CUSL 3QG6A 4QLRA 2EDTA 3TM6A 4KJPD 2EIZA 4UILH 5SWZB 2W0PA 5EU6D 5D1XD 5F21B 1OPGH 3V6BR 4PJGA 4OTXL 4D2NA 1CDCA 2X89A 1NUGA 2Z93B 5DJAA 1MJ7L 4LCYB 1TZHA 1NBYB 5F9OL 2BVPA 1BD2E 1Q0YL 3HMXA 3TLRA 4YO0B 4PJIF 4R26L 5IFJA 1KN2L 3L1OL 5D6CB 5T1DL 2HT3C 1HKFA 3C6LC 4NHUB 2Z9TA 1CD1A 3PABB 1K9TA 4GT7A 3X3FH 1GGUA 2NQCA 3VWKA 4MQSB 5B3JF 1ADQL 2QHLA 5D4QA 4ZUUA 4Q7DA 3WFHB 3C8KB 4KJQC 1OTUC 3GNMH 1JUFA 5CJXC 2EDHA 1D9KA 3QEUB 4MA1C 43CAA 2FL5B 5FHAH 4CRPA 1X44A 4JDTL 4WV1A 5C08D 4PG2A 2DQJL 4OUUA 1B0GB 4UTBH 1A14H 2APVA 2J8UB 3T0EE 1LK2B 3K3QA 1P2CB 3RHWK 2CMRH 5CINL 1S5HB 4HV8A 5CP7A 1CR9H 3S37L 1FH5L 4JFYA 3TH3T 3LZFH 5F3HB 4PGCB 1EEZA 2A38A 2BC4B 3KPRB 3E3QE 1UWXH 1N0LA 3IJSA 3F5WB 1AQDA 3TA3C 3L3GA 2R8SL 4Y16C 1AHWA 3ZTJG 4PG9A 2NY5H 4HAFA 4PJGE 4WU5B 1QO3A 2BVYA 4PLKD 4Y2DD 1MQ8A 1QFPA 1WBXA 1NGWA 1PFCA 3HKFA 3V6OE 1T21B 1F11B 1YDPA 3PWPE 5I2IA 3FHAA 4EXPX 1WAAA 3RFZC 1F4YH 4W6YB 3I3EA 5HYIA 1VGKB 2XN9D 1GYAA 5DUMH 1TNMA 5ISZB 1MFCL 5LQBH 2Q1EA 4G8IB 1UADC 1RUQL 3MLXL 3BKJL 3TYGL 2F53E 1TITA 3U7WH 2DQTH 3LKPB 4Z5RB 1S9WA 3GSNL 3S5LA 4NQEE 3FAXA 4JFEA 3MRIB 3Q3GA 2NXZC 4OCRH 3KNBA 1C5CL 2D7OA 3S7GA 4P23B 5K59F 5B39G 1X5LA 1NBZB 5DHVB 5BO1L 1R6VA 4HS8H 1KT2B 1JNLH 4J3UA 3RWDB 1ZT7B 3RNQB 2D3VA 4RGND 1TCRA 3QUYD 4ZOAA 1IGFL 1MCIA 2CIIB 4MVBD 5GS1A 1KLUA 3I9GH 3O4LB 4MA3B 5HYSA 4P46A 2XXMB 2R23A 4TOYH 3A6CL 4M6NH 3BW9B 2HFFB 3IF1A 3O3EA 5ERWA 4L1DA 1J11A 2QQKH 2F74A 1LDSA 1XGRB 4ALAH 3RIAF 5KVEH 1QUNA 1MI5E 2PTTA 2B1AH 1TQBB 3MV9B 3HE7D 5FCUL 4OT1H 2FGWH 3NCFB 1RZIB 1BX2B 4NO5A 5JZ7D 3QUXA 2C5DC 3U79A 1B6UA 5FM8A 3WXWL 3QO0A 4Q9QH 2X70A 5DS8B 4AM0A 3GI8L 1JTPA 2PXYD 3C6LA 4CVUA 3WFDH 4HJ0C 4BK4A 1H3XA 5DTFA 3P9MA 5EOQL 1OF2B 2AK4E 2BMKA 1DBMH 3L9RA 4H1LH 5D7LA 1KXQE 5I8OH 3IT8D 4KKAC 5DSCA 1PKQA 4JRYB 5IM7B 2CIKA 2ZKHH 2HTKD 3MJ9H 2VXTH 2A6KA 3RWGB 3NACL 4RAVA 2EYSB 4G9FA 3GHEH 1ZHKA 3WYRA 5IB2A 1XGPA 1CE6B 4PB9L 4Z7NE 2EIEA 4GLRH 2AVGA 4IHOA 1KENL 3O2WL 1FZJB 4HS6B 5JR1L 3BPLC 5IF0A 1ZVSA 4CMHB 4X4ME 1ZK9A 5I71C 3FQUB 4FRWA 4UDTB 2VDPL 4HH8A 5IVXA 1N5AB 3IGAB 2VDNL 2QKIB 2CGRH 2C3XA 2IBZX 1F4WL 3ZSTA 2BSTB 3RPIA 4YFLI 3MGAA 3V6ZB 3UPRB 4JANB 3U7AA 2ZZUT 1WBZA 3MYZA 7FABH 2YSSA 5GSVA 4GRWE 2PYFA 3BXNA 3WLWD 4X6DE 5ID0A 4O02L 1VCAA 2C1OA 4K8RD 1MHEA 3WFZA 1GL4B 2CKNA 2OCFD 2YPLB 1TDQA 3JV0A 5FYJH 2JKXA 1D6EB 2AKRB 5KN5B 2GFBA 1MLCA 2NX5E 5KSBA 1RULL 4K3JL 3ARUA 3SO3B 1SJEA 4QRPD 3KPLA 1XFPA 1FIEA 1Q38A 4K23L 3IDMB 5C0GB 3DOSA 1UH3A 3VCLA 1H5BB 1B0RA 4JN2B 4ZNCD 4G80B 1IQDB 5INDA 1PKQE 3MRKA 3Q6GL 3QNZB 5D1ZD 1XZ0B 5I15L 1W8NA 4E0RB 3SKOA 1FBIL 5EU5A 3UTTB 4YNYB 3T77A 3RDTA 5I9QB 1RUAH 3OKKA 2DIAA 3O6ML 2LU4A 4Q74A 4YBQD 3KPOB 2YBRB 4R4FL 4I18B 3MA7A 3U2SB 1QQDA 4FQHB 2H26A 5DK3A 1S7TB 2OL3B 3G5YA 2VAAA 5TFSH 4DGIH 1UM4H 4HBQA 3U1SH 1TQCB 4FFZH 5C9JA 4NT6A 3VXTB 1G6RA 5GGUA 1MNUL 1Q1JL 3V7AE 1OAUL 4P3DB 2OZ4A 1XCTB 3B43A 1CFVL 2A74B 4LLVA 2YD2A 5EZOL 2ZUXA 5FGCE 2E7CA 4PGEA 3HUJF 4NQDB 1ZT1B 3RTQC 5E2WH 3U9UA 3QFDB 3BZFB 3RZCB 1NAML 5CEZH 5A16A 4MA7L 3ULUD 3GMRB 4OGYH 3IXAB 5KSBE 2GK0B 1LEIB 1U91B 4EDWL 4U0RC 2D9QB 4LHUA 5F96H 2DF3A 3C5SA 1ZA6B 1N6QH 3O41B 4Z7VE 5BJTA 5MEND 1RJYA 3W0WB 5I18H 3X11B 1EXUB 3MX0A 2E9JA 4GMSH 1W0VA 5LKNA 4IRSD 1G7JB 3MRDA 2WBKA 4NRZB 4HHAA 4YDIL 3VXMD 3GDBA 4HQQL 3V52H 4LCCB 4JDVA 4NIKB 3EO0A 1A4KA 5D1QB 5ETUA 1I7TA 3DTXB 4D0DA 5I1LA 4NFCA 5EN2A 2ADFH 1GVIA 1PKOA 5IGXL 3ESUF 3BAEH 1KCSL 2GITB 1YEGH 2AJSL 4JREB 3ZKND 2HFGL 4HIXH 4FTVD 2FRGP 4CJ1A 5F6HI 3B5TA 5EBWB 5EZIL 1YNLL 2VDOL 3P2TA 2X4PA 3NGBC 1DDHB 1MRFH 5FGBC 3MOQA 4JY6B 3D85A 5TQ0L 3FO0H 4FXGB 1CT8A 1U93A 2Q7YA 2LVCA 2R2HA 3FB5B 4NQSB 4CVZB 5DRZA 5DMGC 2AQ3A 4Z76A 2ZUSA 1S7XA 4BH8A 4OFPA 3WE6A 1ZLUK 5FDWB 4ODTH 3PL6D 1BBDL 5DWUL 3GMLA 4EI6A 4JO2L 3FQRA 3KG5A 4HUXB 4OM0L 4DGVH 1QEWA 4PY8J 2HN7B 2VXQL 4X6CA 4M61A 4F2MA 1OOAA 5CILL 5IHZA 2XRAL 2GAZA 1MHCB 2XWJA 1LEKB 3WO4B 1SYSB 1HYRC 5DUPH 3QNYB 1JN6A 1JWUB 2Z31C 1G7PA 1N4XH 5DD1L 3TJEL 4FQLH 1PX3A 1X7QB 1T0NA 5DFTA 3SGJA 3STLA 2DJ4A 3WIFA 4XRCA 2E7LC 4E41D 1J18A 5I74B 2EE6A 1A0QL 5F8RC 5IBUB 5I1AA 3MO1A 4FXKB 3O45B 4L9LC 2UVFA 3MUZ1 5JOPE 5D7IE 3OB0H 3SDDB 3MRCA 4YDVB 1U8QB 1H0DB 32C2A 3CLEL 3ILQC 2EYTB 1LO2H 5HVFB 3B2VH 4POUB 2ZCHH 4PJXA 4GAYA 1L0XA 2HJKB 3K2UL 5BRZB 1UH2A 4DKAA 4YZFF 1QNZL 4ONGH 5SV4A 1I3GH 5IMMB 5BXFA 4MQ7B 4YGAB 1PZUB 2AABH 4WUKH 4C56E 4OD1H 4S1DC 2ZSWA 3FT4A 4R2GB 1EFXA 4LMQE 1MREL 5ELIA 5HYJB 3ARGA 2G5BB 4I77L 1XGQA 1BD2B 5DRNA 5I76A 2NTSP 4MNQE 2Z92A 1AO7D 3FB7B 2EH7H 5IHUH 4F9LC 2UY6A 4LF3A 2FD6L 2XKNA 2YEZB 4KTDH 4X6FB 4TRPH 1N2RB 3HNTH 1QHOA 1ZLWH 3BEVA 5KG9A 1E4WL 1FG9C 4PGJA 3L5WA 3U46B 4HJGA 2D7TL 1LO0L 5I0ZA 3B9KA 3DLQR 4X7EC 5J1AA 1JV5A 1IC4H 1T89C 4EN3A 1IAIH 3T0EB 3H3PH 1P4BL 5HGAB 4JRXD 4F7EB 1D5MB 1XF5B 3MBEC 1Y18A 4FXLA 4OAWA 2FSEA 3P4OA 1UKTA 4X5XA 1ZVYA 3QG6B 2SEBA 3NTCH 5JQ6L 3BO8A 1H3VA 4PPTA 4YIQA 5C6TH 2EIZB 5J9PA 4EIGB 4H20L 5KSAD 5GGSA 1RUKL 4PJ9A 3W9EA 4PJGB 3WKNA 5DJAB 1TPXC 1TZHB 4TSBH 1E4XL 3FKUS 1HH6A 5DJ0A 5IFJB 4RA0C 3VD9A 2I9LA 5CJQH 5INCA 1CD1B 3I50L 1SEQH 2NR6D 3DXAE 4FMKA 3SOBL 1WSST 3VWKB 3QPXL 3M8OL 1RU9L 2FJHB 2WLZA 4ZUUB 4ZS7L 2F53B 1HINH 1JUFB 1YEIL 2AGJL 1GGBL 1BJ8A 2FX8L 3CD4A 1DSFL 1VFBA 2ZNXA 1E4KC 2H1PL 3ULUF 5TF1L 2W65A 5TGBA 4WV1B 1IAKA 1KJ2A 2R1WA 3WDIA 4OUUB 5B4MD 3FOLA 2DMBA 4JG0L 5J6HA 3ARBC 3HCVA 1JYWA 4AK1A 1N26A 5D2LE 4HV8B 5CP7B 3MMEB 5I1DB 5IBTH 4YHOL 4JFYB 1XF4A 4L29A 3I6LD 4EJ1C 3RJDA 5IFAL 5DO2D 5HDOA 5EOCJ 5GRZA 3HE6D 3VDCA 3IJSB 1AQDB 1CGUA 1I1AD 3L3GB 4IOIA 2CR3A 1CGWA 1OSZA 4NFBA 3UZEA 4PG9B 4JQVC 1JPSL 5MEQA 4Y19E 3U0PB 2AW2A 1WBXB 1NGWB 4M93C 4PJCE 3QZWA 2QQLH 1AKJA 1ZLVH 1YDPB 1AY1H 2FX7L 4JCLA 4OF5A 2BY1A 5DQJA 5F1KC 4TPRL 3S9DB 5GRXG 2E27H 1YECL 2C4FU 2DKUA 2YHGA 1YEEL 2V9TA 4H1LA 4KGLA 5GQBA 2BVEA 1QKZL 4ZPTB 3H0TA 4KI5D 2KUTA 5A2FA 3MJ9A 2AERT 1HZHH 1U8PA 1NFDE 4KUZH 3CFIC 1S9WB 4X7CC 3S5LB 3DECA 3F7VA 4JFEB 4NHCL 4FNLL 3Q3GB 5I19H 2YK1H 2EDXA 4DJMA 5J06A 3KNBB 4HKZA 5IG7B 2AK4B 2Y4SA 1GPOH 3K74B 3LN5A 4NZTL 4RFOL 3VRLF 2DL9A 1HSAA 5DK2A 2ZPKH 5DJCB 1RK1A 4LPTA 4GAJL 2RAMA 4HT1L 1XIWD 4TSAL 3VG0H 1T5XB 2VDLL 4KC3B 1T1ZA 5HHMB 3UYPA 3QCUH 4Q9RL 3C8HA 3ARDB 3QQ3A 3KXFE 1TCRB 2E9BA 2V5SA 5C0CA 1YN6B 3P9LB 1U8HA 5GS1B 4JPWL 4LVHB 5SV3A 1KLUB 2NY6C 4XWOC 1UCTA 4HC1L 5HYSB 4P46B 5CGYC 3QH3B 3MBEA 2I9TA 4MWFA 3IF1B 5ERWB 3O3EB 5HGBB 1J5OH 1MOEA 1CFBA 2F74B 4LHQB 1CG9A 3X12A 4ZUVA 3BN9D 3U7YL 3STZA 1M7XA 3NOIA 4AH2A 3RUGA 2D7NA 3BP6A 5D96C 3MCG1 3RBGA 3TBVA 1MFEH 2PTTB 3WUZA 1IZJA 3BKMH 3OG4B 4PJDF 2GKIA 2HVKA 4NO5B 5A2LH 2HJLB 3QUXB 4XC3L 3BHBA 4LARH 3M1BA 4NWTH 4J3XA 3ZTJH 3HG1E 3QO0B 1S7VA 1JF5A 5EC2A 3MJGX 4M7ZB 4JO4H 2OQJA 3DUSA 4XPGL 1LO3H 4Y5VB 3QQ9D 4TVPE 1P6AB 4MQXC 1K3IA 3P9MB 4F9PC 2BMKB 2F19L 2PYEA 1CFSB 2WNGA 5K9JH 1S9VA 1PKQB 5ICZA 2CIKB 1UM5H 4GRLA 2A6KB 3BIBX 4YK4C 2DJSA 3RX5A 4RAVB 3UTOA 1E4KA 1Q0XH 1ZHKB 4G9FB 4P5TD 5IB2B 3TVMA 1XGPB 4ZFOL 4XHJD 2O5ZL 3T3ME 1QSFD 5AZ2H 1M1SA 3QG7L 2J8HA 4IHOB 5FEBA 1S9KC 5C0CE 4OFKA 5IF0B 1ACYH 1I3UA 1ZVSB 4PRPD 4RFNB 4XCCH 2HKHH 3LSOA 1NCCH 2G60L 1T2QH 1Y0LB 3FFCD 3FO1A 5IVXB 5FYJE 4E5XA 1EZVY 1RURH 1PBYA 1WEJH 3RPIB 3TWCH 3DV4B 1NJ9A 4EBQL 5JW4M 3R0MA 4KV5E 1Z6JT 5GSVB 1AXTL 3BXNB 5C0AE 3B9DA 5ID0B 5HI4D 2C1OB 1BBJA 1W72B 2O5YH 3WIHH 1RZKC 3HRPA 3V5HA 2GFBB 3LS5H 1MLCB 5KSBB 4X83A 4Y4KC 2UWEE 4OCYH 2VLRA 4WO4C 2X4UA 1SJEB 1OTSC 3MGOA 3KPLB 5F9DC 5C0BD 3L5IA 1R5VA 4YPJA 2HRPL 1B0RB 1A7QH 3PP4H 1XH3A 5GJTH 2OYPA 4EQ3A 3MRKB 4ZO8A 4LSRH 3BD3A 1INEL 3SKOB 5C7XL 5KW9L 5EU5B 1IAMA 4HBCL 3T77B 4XAWH 3RDTB 1IFHH 3DSFH 4ZD3H 2A9NH 1F5WA 5C71A 3KLHD 1OTUD 3MA7B 4V1DD 3TJHC 1CZ8L 4ZYKA 4YPGA 4WW1A 1MIEH 3RL1A 1QQDB 2H26B 2PCPA 1ZE3C 4RDQF 5JW5B 1LVEA 3G5YB 2VAAB 3IJYA 4HCRH 4XPAL 4LIQH 1R3LB 3G6AA 5C9JB 3QDGA 4NT6B 5JTWA 5FA3A 3NPZB 5GGUB 5LGKA 4WY7H 5C07A 1CXIA 4OLUL 3NFNA 4I0PC 4K3HA 1BGXH 3FRUA 3NVQA 2ICWI 4PGEB 1NKRA 4M1GH 4P57A 1L7TH 1IGIH 3TA3D 5A16B 4D9RE 5EA0L 2DDQH 3C2AH 4PLOB 3X3GH 4NN7B 3RVWD 2LE9A 4LHUB 1QP1A 1BQHA 4ZS6D 5GS2D 5BJTB 3MLTA 2VZOA 1RJYB 5D7JC 5A2JH 5HHPA 4I3GA 4JFQA 3BKYH 1U2CA 5I1KH 1NCTA 3O9WD 1W0VB 3MRDB 4HHAB 5I1CH 3PGFH 3T2QA 4B50A 4JDVB 3WDJA 4AMKL 4K2UL 4PJEF 1V7NH 2XZCH 1A4KB 3EO0B 4WW2F 4KXZH 5ETUB 4M7KH 3QQNA 4D0DB 5I1LB 1NAKL 2P8PA 2X9XA 1JZ6A 4KI5F 3STBA 4BSJA 4BELD 1I8KA 3WSQH 1EHLL 4O2EA 5E4IA 4O9HL 4Y4FC 3RVUC 2X4PB 5ITBH 2BRRH 1RD6A 1U3YA 3CFKB 3D85B 1CF8L 4L5FL 5C07E 1U93B 4WWKD 4QGTA 1SM3H 2N7BA 1RAMA 2R2HB 1HHIA 1YNKL 3UTSE 4YHIA 5DRZB 5KVDL 1E28A 3KJ6H 2L7UA 2YKLL 1S7XB 5HYFA 4IOFC 4C56B 3WE6B 4NUGH 4M3JA 4WFED 3MRGA 1A3QA 1HQ4A 3GMLB 4HWBL 4EI6B 3FQRB 1T1YA 1DQMH 2HT4D 1UFUA 3UO1L 3T0VA 1KB5B 1QEWB 1T0MA 4FZEH 4TUKL 4X6CB 3TT1L 4M61B 5E94A 5IHZB 3O2DH 2GAZB 4TUOB 5IQ7H 1OAZL 3HC0B 4GXVL 2XWJB 2MTPA 5BS0E 3R0NA 2FHCA 2Y1VA 3HMWH 4V2BA 5DJ2A 4WO4A 1MHHA 2YS4A 4NOFA 3E3QC 4L3EE 5I66A 1T0NB 1WZKA 5GRVK 3STLB 3WXVH 5CLWA 3WIFB 3JTTB 1DL7L 4N8CH 4YC2B 4ODHH 1BZ7B 4J7RA 2RCSH 4YDLB 4Z0XA 1JZ5A 3RRQA 1R24B 4PLNC 2X05A 4HXBH 5IQ9A 3V6OC 2KZWA 1DANT 5L88L 32C2B 2GTWA 5E4EB 2OS7A 3TN0C 4PJXB 3I02B 4GAYB 4YUEH 4LU5H 1N6UA 5CD5C 3D2UA 1QLEL 4FQQA 4WI2A 4JHZA 3HFMH 4DK6A 4QGYA 5C0DA 4MZ3A 2C1PA 1NMBH 3QDME 4X6EB 1IGML 3GSQA 5F7EH 1HN1A 2ZSWB 3MLRL 3FB6A 3FT4B 4ZSOA 3SDCC 1EFXB 4Y2OA 3VGHA 2BERA 4JVPA 1NMCB 3UC0L 3LCYA 2C3GA 3ARGB 2EC9U 4WHDA 3GJFK 2XFXB 2R2BA 5DRNB 5I76B 2Z92B 5MHSE 3CCHA 2FH6A 4XP9L 4OFIA 4LF3B 1R3JA 1WITA 2XKNB 1TFHA 1MCDA 5BV7C 4P59H 5CS7A 3VI3F 2JIXA 3LIZH 1N5YH 5D7JA 2IF7A 4HJJL 1YMMD 2WM0A 3BEVB 5KG9B 3N0PB 4IRZH 3V8CA 3L5WB 4HJGB 3ZE1F 2F5BL 5C0RL 5D8JH 2PW2A 1B6DA 1QZ1A 3B9KB 4D0CA 5J1AB 1JV5B 5FB8A 2H32H 4EN3B 1U6AH 2DS4A 1RFDL 1EJ6A 5K59E 4QOKD 3LS4L 2R1YA 5I73B 3VW3H 1JMXA 1Y18B 3VFMA 4LNVA 3S36L 1SHMA 4X5XB 5DVMA 2SEBB 4XC1L 1IC7L 5C2BL 3BP7A 1A6ZA 4YIQB 5J9PB 1C5BL 3OF6D 4ZSOE 4PJ9B 3W9EB 1XR8A 3V5KA 3LQMA 4XVTH 1O5DT 1U8MA 1T3FB 4RGOL 5E0QA 4ZUTB 1A7BA 3LKQB 4Y8AA 3BIKA 5K9OA 5K9QI 1KCVL 1HH6B 4P2QA 2DQIL 5HJ3B 1DVFD 2XYCA 4LLQA 4TVSa 5ADPL 2I9LB 3Q48A 5INCB 3SCMC 3ZE0F 3OKYA 3DMMA 4OD3L 2DQEL 1G6RL 3IS1X 3ULVH 4WEBL 1X3DA 1JGVH 1AXSA 5E1AA 5BOPA 1T0PB 1VFBB 1V05A 2B5IB 2W65B 5DYOA 4RWHA 5HHXH 1IAKB 4KUCD 2VL5A 5JXAH 2R1WB 3EO9L 3PV7A 3ZT7A 1KFAH 1G7LB 3FOLB 1QYGH 3G5VA 3CVIL 3QT2A 5J6HB 1ERNA 4DAGH 5H2BA 1F58H 3HCVB 1VA9A 3I6GB 2WWKT 4PJ8A 2JJUA 3CMOL 3PP3H 3H9SE 4NKIL 4QTIL 2N1KA 1XF4B 3Q5TA 4L29B 4YAQA 3CNKA 3BRDA 5F9WB 1OLLA 4XVSL 3VFNA 1QFWM 1N0XL 5EOTA 4C55A 1BAFH 3ES6A 3MFFA 5I8EA 4QNPF 1FZKB 3DYOA 2AV1A 3NZHL 2XZAL 4V2CB 4F58H 1OSZB 3TN0A 4U6VL 5MEQB 3S6CA 2I07B 1J9CT 3MRFB 4L4JA 3QZWB 1AKJB 5E9DE 3EDEA 5F7FA 1F42A 3O8XB 2OTUB 1RUPH 2IAMD 3MGTA 5DQJB 3SN6N 1FNEB 3EDDA 5A3ID 1KCRL 4K94H 1GC1C 3NA9H 4I2XE 3TCXA 4F15C 3GGWA 3RGVD 1I9JL 4H1LB 1CWVA 2R56L 5DMGD 1UACH 9CGTA 3H0TB 4DCQA 1U8PB 4GMTH 3PGCA 1MFDL 3BD5A 3EO1A 3F7VB 2QV2A 5DI8A 4G6ML 5EU6E 4HKZB 3EOAB 4I48A 4BSVB 3LN5B 4NN5C 4NC1C 4M7LL 5C09A 5GHWH 4WFHD 1RK1B 3SQOL 2AXGA 3MLWL 1NCNA 4P99A 3IETA 3OSKA 5K9QG 1CTNA 1C08A 1T1ZB 1SBBA 3RWIB 5B39A 1KC5H 1Y6KR 4DVBB 5MP6H 1F3DH 1B2WL 4DQOH 2APWA 5C0CB 1LK3H 2OMNA 5SWZD 5TDOB 3U6RA 3WIHA 1IQWH 5GGVH 2I9TB 1YEFH 4MWFB 3VFGH 4K3EL 3LEXA 1WFNA 25C8L 3ILQD 5TJWK 1CG9B 3X12B 4ZUVB 2BZDA 1P4LA 4KQ4H 3STZB 4AH2B 5L2KE 3RUGB 3BDYL 3BP6B 3TBVB 4LDEB 2AJUL 3RY6A 5C0AB 2IBGA 3CAFA 4G8EA 4XP6H 5F3BA 3RVXD 2HVKB 3GMOB 5FIEA 3ZL4L 2MMXA 3MUY1 3HUJE 1OPGL 2NTFA 3MLSH 3TYFA 4GFTB 3M1BB 4LDOB 2BJML 4M6OL 3THMH 1MLBA 2GIYA 4TSCL 1S7VB 5LGHH 5EC2B 1Z2KA 1AE6L 2UWEB 1AI1L 5T1LD 2OQJB 3DUSB 2IPUK 1V3MA 1OHQA 1I1CA 3S35L 3C08H 2PYEB 1S9VB 2C7UB 2DLGA 2WUCL 3CDYA 2V2TB 5ICZB 4HCRA 2R9HC 1F90H 1IEBA 2IANA 4GRLB 1UC6A 3QWRA 5DR5L 4MJ2A 1TZGL 3TVMB 3DYPA 5GGTH 1RZJH 5B21A 2VLME 5FHAL 1A2YA 4M5ZH 1CICC 2B0SH 2RFXB 5C0EA 3MREA 1BZ9B 1G6VK 5TE4H 3FO1B 2D7PA 4E5XB 1A6TA 3BDBA 1UM6L 1X5HA 3BUTA 2APTA 1FC2D 3MRHB 3FN9A 3U30C 1NJ9B 3BH9A 4QY8B 5D7SH 1KTDA 4MJ5A 2N7AA 3QDHA 3SDXA 1NMAL 2Q86A 4FABL 1CI5A 4QRSA 2J4WL 1IM9A 3V5HB 5JDSA 5J3HD 2JJVA 4BFBD 3LMJH 2OR7A 3FQTA 3RAJH 2VLRB 2IFFH 2X4UB 4OI9A 1ZANH 1JFQL 1VGEL 3ILPA 3MGOB 1KOAA 2HFTA 1A6WL 4P23D 1XH3B 1DQTA 4OLYH 5LQBL 1B4RA 5KVFH 3FN0L 4LVNB 1KLFA 4M3KB 3B3IA 4JM2A 4L4VA 2F58L 1UWXK 4ZYKB 1UYWH 1MIMH 4WW1B 2JJWA 4Z7OE 3RL1B 3AMLA 2PCPB 5ANME 3O4LD 3IJYB 4G7VH 1MJ8H 2XA3A 3G6AB 3QDGB 4ENED 5FA3B 4HS8L 3ARBD 3V79C 3BJLA 5EWIL 1NGPH 3JV6A 3QSKB 5C07B 2EIDA 4MCZA 3NFNB 3MV9D 1L0YA 3FRUB 4NCC1 4GQ9H 1KJ2L 3UTSB 2GTZA 3O2DA 3EHBD 4YZFE 1PG7X 4P57B 4CN1A 1HKLL 2Q8BH 1FSKB 2BHYA 4QXGH 2WUBH 4OCWL 5B8CA 3VU2A 4G8GA 4Z7WF 2O61B 4HWEH 1BQHB 2ITCA 3MRQB 2O5XH 2P7TA 1HHHA 3MLTB 2AEIT 2E7MA 4XPBL 4JFQB 5J0BA 2H9GA 4QRUA 1I8LC 4JRYD 4NUJB 1NCWL 2RBLA 3ZDZE 2HVJA 1E4JA 2GQHA 1E4XI 2W9DH 3JWOC 3HB3D 4L3EB 2MOVA 5KTEH 4YJZL 4L4VE 4R9HA 1ZVHA 2P8PB 4K55A 5GJSH 3SPVB 4XP5H 4IRJB 1LWRA 2BRQA 2VERN 3ZLQC 5E8OA 4H88L 4WTXA 3V6FB 4O2EB 4POZC 2ZKHL 4PY7A 4QHNA 2VXTL 3EKCA 4F7CB 1DQQB 1YUHA 3N9GL 5F7NC 3VH8G 4K7PH 1HHIB 4YHIB 1E28B 3L3IA 2YPLD 3PQYA 4J12A 1AGEA 5JPMA 3WNNA 1NQBA 4OB5H 4OIIL 3WHXB 1HQ4B 1LGVA 2CGRL 2NZIA 1F4XL 1K8IA 2V2XA 1T1YB 4MHHI 5F71A 3T2NL 5CGYD 3G5ZA 2BXYA 3LKOA 1T0MB 1A7OL 5E94B 4KWUA 5C9KA 1KXVC 4NC0B 5J13B 1MQKH 4WI5A 4N0YH 3K7UA 3I3DA 1FIGL 4LDLB 5GRWA 1T7VA 4WVRA 3UTTD 1E6JL 3BSZL 4HZLA 1MHHB 4UB0H 5I66B 3O4OB 2ZCKL 4UT7L 4XMLL 2DLEA 1C12A 2HLFC 5IEHA 5L2JA 2W92A 4GW5B 3REWA 2BVTA 3JV4A 4NRXB 4WUUE 4U2YA 3PWNA 4HLZG 5EORH 3EOBA 2ID5A 5FUCE 4Z0XB 1S7UA 4XVUC 2LTQB 4IBLT 5IQ9B 1MSPA 2XZQH 1S5IL 3WDHA 2KZ1B 2GYSA 4LPUA 4PBXA 2GTWB 2FEEI 5DMIH 4NQXA 5FYLD 4H26A 2J8UF 3OL2A 1RUAL 2NNAA 4XNZC 2Z8WC 1EEYB 4KRMB 3T4AA 3LKRA 1X5IA 3D2UB 5KJRH 4NQDD 4WNQA 3CU1A 3RZCD 3OB8A 5DD5H 2C1PB 3PQYE 3BT2H 5SX5H 2OM5A 3GSQB 5EUOF 3VFPB 1CD8A 4DUXA 1F4AA 4ZSOB 1TZIA 3FB6B 3VG9C 5E2VH 5CP3A 3NH7L 3N1MC 1MCOL 4TNVK 5CHNA 4P2CG 3DIFA 4OUOA 2P8LA 3E6FA 3W0WD 3UTPE 2R2BB 4XMKH 4GBXA 1Q72H 3B8YA 3IKKA 1NCBH 3CCHB 3DVGA 1KELL 4MNGA 3B83A 3SGDI 2YN5A 5ICYA 3HZYA 4S10A 2FR4A 4Z9KB 4DN4L 5D1QD 2JIXB 4LASH 2R1XB 3CZFA 5ID1A 5LCVL 1B3JA 3T3PE 1U95A 2YPVL 1QR1B 3IDNB 1AQKL 5IB4B 4R6UA 5CBEA 1NGQL 3WLBB 4XCFL 1GHFL 4GMSL 4UIKH 4D0CB 5FB8B 1I1FA 15C8L 1TCMA 1UG9A 3NCJL 3VRLE 3QEQA 1WCBA 5IP4A 1ES0A 4JLRB 4IIQC 4MGXA 5GZOD 3T0WA 5HY9A 3R1GH 1E27A 5DQDL 3VFMB 3KPNA 5JLZA 1A1NA 1G7QA 2Y72A 2VUOA 3BP7B 1N64L 1A6ZB 2ZSVB 3K1KC 3MRMA 4HIXL 1YY9C 2DQUL 3P30L 1XR8B 1G9NC 1U8MB 1JNNH 4HS3A 4YXHL 3ULVE 4E41E 3O0RL 4X98A 4N8PA 5CUSH 2EKSA 3V0VB 4J2XA 3BIKB 5D2NC 2XZZA 3IDGA 5K9OB 2VR4A 4OV5A 3BI9X 4I2XB 5FK9B 2PR4L 4OTXH 4I0PD 3T8XB 3H9HB 4IJ3B 1MJ7H 4QYOA 3DMMB 1WT5C 2F5AL 2YZ8A 5F9OH 1Q0YH 4TYUA 4PJDE 1INDL 3GSXB 4R26H 1MVUA 1KN2H 2L0DA 3L1OH 5T1DH 5E1AB 4J1UA 2Y6SC 1MCHA 1ETZB 1U3HC 4EZMA 3F7QA 3VFVB 5DYOB 2MPAL 4YWGL 4ZXBA 3AS1A 1ADQH 2VL5B 3MRPA 4JFFA 4LSVL 3QXDA 4PJ8B 4FFVC 4FQLL 3HC4L 5BRZD 1E6OL 2DRUA 3V7MA 3FTGA 1MRCL 4JDTH 4YAQB 2DQJH 4HWUA 3VFNB 1SVZA 2A2QT 1HK6A 3ES6B 3MFFB 5CINH 5I8EB 2AV1B 2F9BT 2NXYC 3GSRA 4R2GD 3S37H 1FH5H 1U8NB 2WIMA 5A2IH 3QPQC 3UPCA 3O3BA 1BD2D 4G6FB 1WF5A 2NY1C 3EJJX 4Y4FD 3QJHA 3RVUD 2R8SH 3SGKC 4U49A 1F6AA 4X4YA 3QAZB 2AABL 3GGWB 3Q6FA 4TUJA 4GO6B 3ARRA 4HUWA 5F1IA 4GKZB 3ALPA 2DBLH 1T22A 2P8MA 2DMCA 3OJDA 4DCQB 1JK8B 3PGCB 3UDWA 4BFGA 2P4AB 4R4NC 4ZFGL 3EO1B 5HI5C 5GGTA 4M03A 1MFCH 3MJ7A 1FG2A 4Q9BA 5JHDA 3MLXH 4JFFE 3BKJH 3T0ED 1NBVL 3TYGH 3CVHL 5C09B 3BWAA 4KRPB 2XIDA 4PJHA 2X4SA 3GSNH 3LKSA 2AXGB 1HCVA 3MV7A 2VUYA 2H45A 1DBBH 2KH2B 1C08B 2X44D 3KS0H 5IJVB 5B39B 1OVZA 2L7JA 1KV3A 3AY4C 3QIUB 4N1HB 1F2QA 1FNSL 5D6DA 2D9CA 1RZKL 2VLKA 2UUDK 3VRJA 3Q2CA 3E2HB 5BO1H 1YEJL 2V5MA 4IIQA 2VLLA 4GJTB 4NQCA 1RUML 3MJ6A 3LEXB 5FOBA 1IGFH 1UA6H 2FIRT 1UJ3C 3G9AB 1P4LB 4HZAA 3PWPD 2RJMA 5DD0L 3FZUD 1QRKA 4LHJB 5DJYB 3PWVA 4G8EB 3NTCL 4HUMB 1ZXQA 2ERJC 3A6CH 2DICA 2XWTB 3K4DA 4OLWL 4D3CL 2NTFB 1FVDA 2F53D 4OZFG 4ODWA 3TYFB 4DWHA 1N8ZA 2JK5A 3TNNA 1AC6A 1OD7A 1ZLWK 1MLBB 4OF7A 4M7JL 4NQED 1KJMA 5CWSA 1UB6A 2ESVA 5JHDE 1WT5A 2W91A 1DFBL 4QF1A 1SMOA 3WXWH 3HR5A 3GI8H 1IEBB 4YHLL 2DWEA 3FQNA 3VFUB 5JORA 5GS0C 3TO2A 4QXTB 2CXKA 5EOQH 1CXHA 3CSBA 5C0IA 2LVEA 3SQBA 4PJEE 3P0GB 3CK0L 4Q6IC 3BGFC 1A2YB 2C3WA 4EI5A 2EDLA 3NACH 3LKNA 4PB9H 4TQEL 1T1WA 3G6JA 5IMKA 4NQCE 3MR9A 2VXUL 1AC0A 3O2WH 3U0WL 5JR1H 5HSFA 2W9LA 3BH9B 1MI5D 1LMKA 4E9LA 3RGHA 5E70A 4WIQA 3LDBB 3FCTA 4MJ5B 2VDPH 5ITFA 3DX8A 4C57C 2VDNH 2EDDA 4JN1L 2Q86B 5IKCA 1F4WH 2V9QA 3DROA 5I75B 4C83A 5JDSB 2UV3A 3FQTB 4AIZA 4BKLA 3MV11 1VESA 4XCEA 5KS9F 2ESVE 4O02H 4GSDL 5ABDE 2CDFA 3ILPB 2G5RA 2AJ3B 2GJ6E 2AK4D 3SEPA 1QRNA 4LCIL 3OXRB 1FVEB 3L3JB 5IWLA 4PGZA 4BFIA 1RULH 2Y06L 1UZ8A 1T04A 3PXHA 4K3JH 2ATKB 2KKQA 3SCMD 4PP2B 4H25A 5AG8A 4K23H 1HZHL 4KUZL 3B3IB 4LLMA 3TIEA 3ARDD 4JM2B 1C5DA 4L4VB 1R3HA 4U6YA 5EZJB 3M45A 3Q6GH 5I15H 1JCKA 2WAHA 2OR9H 3TO4B 1CD9B 1FBIH 2WBJC 3NBNA 1GGIL 4NGHL 3VD5A 5GSRB 3O6MH 2MQCA 3G6JE 4R4FH 1ZLVK 4R97C 4JZNA 3L7EB 3JV6B 1EO7A 1HILA 2DTSA 1TJHH 1OAQL 4DK3A 5CEXA 4E42B 3Q5YA 2V17L 4XCYA 5BQ7A 3QUXD 1FFNA 1S3KL 1MNUH 1Q1JH 1J0IA 4U05A 5BVPL 1OAUH 3KYNA 2NX5D 3IU4L 4DEPB 4GKSA 2AEPH 4ZFFA 4APQA 5B8CB 1J5OL 1CFVH 4QRTA 1S8DB 4G8GB 5EZOH 2P7TB 1HHHB 3MV8A 1QBLL 1NAMH 4UIMB 3BKML 4MA7H 1A8JH 2H9GB 5JO5A 1PEZA 5CIPH 3FFCE 4QXWA 5KZCB 1K6QL 4EDWH 3RNKA 2DM3A 5GZNC 1MUJA 3CH1A 1Q9OA 4AIXA 1CTOA 3DUUA 1EA9C 5LXGL 4HIHB 4KRNA 5EBLA 1LO3L 2K7PA 4KK8D 2A77L 1KIQA 4YDIH 2EEAA 2DIBA 4BZ1L 4HQQH 5HVHC 3ZE1E 4KAQL 4NBZB 4QRQA 4TTDD 4JGMA 5JXEA 1WIPA 4PY7B 4UINL 3QO1A 1UM5L 4QHNB 4M43L 3NMEA 4ODBD 1J10A 3L3KA 1YUHB 2NY0C 5IGXH 2E9WA 4YR6A 3QULA 3ROLA 3SKUD 1R3IL 1IC1A 1KCSH 4WFGE 5AZ2L 4CNIA 3VGAB 2HFGH 5BV7L 2DI9A 3MRLA 1CDIA 5EZIH 1VACB 4HKJA 4M62L 2VDOH 3L3IB 5D93B 1QTYT 3PQYB 1A7NL 4DKEL 2G2RA 5JPMB 4I9WE 5J6GA 5TQ0H 5KANG 1K8IB 1RHFA 1MJJA 3D69A 5E00A 1YY8B 4PJGF 3G5ZB 3LKOB 5GGRB 1T66C 4J6RL 3M17A 3WN5C 1FFPA 3MUGA 1QA9A 5T33L 1BBDH 2PO6A 4CW1B 3FT3A 4Y1AE 3ETBF 4JO2H 4P4KA 5GXBB 1OAKL 5D5MA 1OGAA 4OM0H 5KOVC 2H32B 2EDEA 4HZLB 3RDTD 3ZE0E 1VHPA 2EKJA 2VXQH 3NCEB 3U82B 2H2SC 5CILH 2XRAH 5E2UL 3GSUA 1FL5A 3DRQA 1C12B 5L9DL 2HG5A 4PRIA 4JHWL 5IEHB 5L2JB 3QEHA 3REWB 3JV4B 3PWNB 3EOBB 2ICWA 1S7UB 5DD1H 3V2AR 3AAZA 4Z0BL 5GJTL 3TJEH 6FABH 3HC3L 4K8RH 1GSMA 2E7BA 4QXUL 2F54A 1N7ML 4N5EC 1UB5B 1KNOB 3DX7A 4NQXB 5E2TL 4H26B 5JMOC 4KJWC 1A0QH 2J7LA 2EE3A 2NNAB 2R9HD 3T4AB 3LKRB 4RMTA 3T2OA 3HPLA 4WNQB 2RR3A 3KJ4C 3CLEH 1XF1A 4GG6A 1MCWW 3K2UH 4LIQL 1CICD 1KYOK 1NFIB 3D25A 1QNZH 4KJPC 5CHNB 3DIFB 2P8LB 3E6FB 1YPZA 5IW3A 4CVXA 4R90L 2QBWA 4GBXB 3GO1L 2H3NA 3KPPA 3DVGB 4X99A 1QVOA 3IAGC 4MNGB 3KWWA 1MREH 1ADQA 1L7TL 1IGIL 4EKXA 4I77H 4GW1A 3RY5A 1WAAF 5ICYB 1ZGLP 2I60L 3HZYB 1DUZA 4YBLB 2DWDA 2XG4A 4LLWA 3CZFB 3C09B 1U95B 3WFEL 3BN3B 2FD6H 3MLYL 4L8SC 5I1JL 2BOBA 2DKSA 4HKXA 5JOPD 1VFAA 5CBEB 2OJEA 4NNPL 1ZOXA 2XOTA 3D18B 4BH7A 1F6FB 3QIWA 4QRRA 5FECA 1E4WH 3D85D 3QEQB 1WCBB 1A9EA 1ES0B 1GC1L 1V7NL 5HY9B 1MCWM 2D7TH 1PG7W 5DQ9A 1LO0H 3H9YA 4K3DL 5DJ6A 3C5ZA 1F3JA 3KPNB 3GSVA 4U1NA 1A1NB 2MCG1 3EGSB 4J4PD 1JGUL 4C56D 1P4BH 4HLZH 4GG6E 3DVIA 2QSCL 1LEGB 5GRYA 3MRMB 4AQ1B 2WZPD 4JKMA 4XXDB 3C9NA 1IILE 4O4YL 1CDHA 1TETL 4X98B 1AJ7L 3TFKC 4MNQD 2EKSB 1I9IL 2EEDA 5JQ6H 1OWWA 3IDGB 2CK0L 4Y2DC 1K4DA 4H20H 5EBMA 1RUKH 4ZG1A 4PRHA 1A1OA 1TVHB 4QYOB 1E4XH 1BJ1J 3QIUC 1Z3GL 2P5EE 3GSNA 1OT1A 1MVUB 1D3CA 2UY7A 3MOBL 4Q9CA 1J1XL 4HWNA 1V8HA 4J1UB 3WN5A 3AVEA 1WCQA 3I50H 2VZSA 1JYXA 3VFOA 3SOBH 5TPWL 4NNXA 4ZXBB 4XPHL 3ZSSA 2E5EA 3QPXH 4BQBA 3M8OH 4UT6L 1RU9H 4JFFB 1HE7A 1YEIH 2FEDD 1GGBH 1AIFA 3HMWL 2FX8H 3QXDB 3AREA 1RIVL 1U8KA 2H1PH 4Z8FL 5TF1H 1LILA 3NCMA 4RWYH 1JBJA 1OM3L 3UJJL 3ZE2F 4K71B 3T2PA 4JG0H 5FO9A 3QUKB 4C4KO 3B2UC 4X4ZA 4QWWD 1M7DA 3VA2C 5C92A 3S34L 3TBTA 4YHOH 4RGNC 2NY4B 3QUYC 3OR6B 3BPNC 4HFUH 5DUBA 2LFGA 4MA8L 2EYRA 4MVBC 4X7FC 3PJSA 3W2DL 5IFAH 3AXLA 3O3BB 1XGUB 4PYHA 3DVFA 5IVXF 3KLAA 3QJHB 3DV6A 4OLVL 4JZJA 1I7ZB 1F6AB 3KPSE 4X4YB 2DM4A 5FGSA 5JHLL 5BMFL 1JPSH 3AC0A 3D39A 4PRHE 3DXAD 3Q6FB 4TUJB 1A02N 4LEXL 4HUWB 3B9VA 4KQ3H 1KJVA 2FX7H 2P8MB 5D1XA 3V4PL 1QSEE 3OJDB 4TPRH 2MCPL 5JZ7C 1A5FL 3UTZA 1YECH 1YQ2A 4G5ZL 4M48L 4LQFH 1YEEH 4XNUL 5KSBF 4Q58C 5J12B 5K9KA 3B9KD 1GZQA 1NCDL 3ZKXC 1FG2B 1QKZH 5JHDB 3S8WA 1M7IB 3BWAB 4X8XA 1JHLL 3LKSB 3MV7B 4NHCH 4FNLH 5FDYA 4ZAKC 4ZNEA 1H15A 3MLUH 2HTKC 4RFOH 4NZTH 3T65A 5L8KB 4LL9A 3SKJH 1D5BA 1XAUA 3V4UL 5I6XC 1FQ9C 4GAJH 4HT1H 3VRJB 4TSAH 4U1JA 2VDLH 4YGVB 4Y19D 2VLLB 4KPHL 1I8MA 5E03A 3SGEI 4NQCB 2JJTA 5MEPA 2OLDA 3VW3L 4EEEA 2I24N 2J12B 3TPUA 5H35A 5FYKE 2PTVA 3VJ6A 1KJ3L 4JPWH 2XKSA 4WI4A 3LEYL 3RWJB 3PWVB 3D3VA 1DE4A 4HC1H 3REVA 3SGDH 2E8YA 3ESVF 3BVNA 1LDPL 2Z4QA 3WLWC 4ODWB 3U7YH 1N8ZB 1A3RL 2JK5B 3TNNB 1QOKA 3QRFM 5GGRY 4K8RC 3JSSA 4N9OB 3E1F1 4Y2DA 1KJMB 1UQSA 5CWSB 1UB6B 2ESVB 4JKLA 4Z7WE 3T0AA 2GJ6B 3WJLA 1YQVL 4XC3H 5FM4A 3L3OA 2XV6B 5HYEA 4X6BA 4QF1B 1XGYL 5T5NG 4NO2A 5JW3L 4XPGH 1JGVL 3IDIA 2DWEB 3FQNB 3DNKA 5JORB 3TO2B 2DTML 4LLAA 1U8JA 2F19H 3KXFD 5C0IB 1K2DA 1ND0A 1WWCA 1ZWIA 5FXCH 2QSVA 4AG4L 5JXAL 5AG9A 4EI5B 3BZEA 2BHZA 4LCWE 4R7DB 1DQLL 4LRIC 3G6JB 1GOGA 2KBGA 2O5ZH 1AKJD 5IMKB 3QG7H 3JWNC 3IDXL 3MR9B 3O8XD 2AV7A 1WLHA 2J8OA 2ZUQB 3U4EA 4AZ8A 1KPUB 2C26A 3D3VE 3FCTB 5ITFB 3LPGA 1NAMA 3JWOL 3QUYA 4M1DL 5IKCB 4MJIE 4DKFL 3DROB 4C83B 3HG1D 5FM5M 4EBQH 4MMZC 4OZGA 4M4RA 1JI1A 1F4HA 1AXTH 1OW0C 3BMWA 3VMNA 2OTWA 4RZCB 4AIZB 4BKLB 1VKXA 1CLOL 4XCEB 2PUQT 2ICCA 3ULUC 4TVPD 2CDFB 5LVEA 2IFGA 1H3WM 1QRNB 1BECA 4MSWA 1JHTB 2HH0L 3HPJA 3LHPL 4X6CF 4BFIB 1I7UA 3QUML 2VZVA 3HE7A 3C5JA 1UZ8B 3LRGA 1T04B 1UACL 3PP3K 2A0LD 4H25B 4F7TA 4OZFH 1A6PA 2Q6WA 3TBSA 4LLMB 3TIEB 2HRPH 1C5DB 1R3HB 1JTTA 4U6YB 5C0CD 4EVNA 3LPFA 2PXYA 1B9ZA 2VWEC 4JY5L 1INEH 5J8OA 1U3HD 5CKGA 4RGMC 3CFEA 3OAZK 4CDGC 5C7XH 5KW9H 4HBCH 1KGCE 3HA0A 5FYJD 1UCBL 3GRWL 4KU1A 1MELA 2ZOLA 5ADOH 1CZ8H 3CUPA 2YA0A 3AM8C 5DEGA 1HILB 5C0AD 4DTGL 4M02A 4PJXF 2J8UE 5CEXB 3PWLA 4JDZA 4XPAH 2H2PD 1HHGA 1FFNB 4JEGB 4BFEA 3AUVA 2DIJA 2Q76A 4XI5C 5DDHA 5KSUB 3KYNB 3AFLA 1K5NA 4GKSB 5DK0A 1JF1A 4ZFFB 4APQB 2NXYD 3KPRE 4OZGE 5EUOE 3WKML 3ZHDA 4QRTB 3NAAL 5IMOA 3PL6C 3U4BL 3KYOB 5F1NA 3LD8B 4ZUSA 5EA0H 5JO5B 5E2JA 4Y1AB 5FO7A 1QFWL 3HI5L 3CLFL 3BYTA 4GRLD 2NY3B 3RNKB 5HHQA 4UDUA 1MUJB 3IS0X 3CH1B 3TVMD 1Q9OB 3WHE1 3DUUB 3PHQA 3CFJA 2ED9A 3SKMA 1O7VA 2QQQA 4HKBA 5T3XE 5JIPA 5CZXD 2AQ2A 5D72L 5ISZE 4QRPA 5I8KL 2BNRA 1KIQB 5HI5D 5FUZL 4U6XA 5CMAA 3OGCA 4AMKH 4K2UH 4QRQB 5AAMA 2FBOJ 5GGVY 3ZHLA 3QO1B 3LN9A 2L4OA 2WBWB 4P2RA 5D1ZA 1NAKH 5T1MA 5C0JA 1YEKL 4YR6B 3QULB 5GGTL 3EYSH 2YRZA 3OJ2C 4JHAL 2NW2A 4CNIB 4JGJA 2MSPA 5E24E 3MRLB 4HKJB 4O9HH 5DJ8A 3ALWA 4D9RD 1NEZG 4WU7A 2G2RB 1CF8H 5J6GB 4L5FH 1JZ3A 3O3DA 3S97C 1GJIA 3FL7A 4XXCC 1WBYA 4BJLA 1YNKH 5L0QC 5KVDH 2YKLH 3M17B 1FFPB 1MEXH 3MUGB 1QA9B 3DETC 1HYSD 2QADB 3ME0A 2PO6B 1PLGL 4HWBH 3C60C 4P4KB 4PRAA 5DHYA 5D5MB 1OGAB 4W4OA 3WS6C 1VFUA 1OW0A 3UO1H 4KDTA 4TUKH 4KMLB 3TT1H 1Q9WB 3GSUB 1FL5B 3DRQB 2IFFL 2HG5B 4PRIB 1OAZH 1HWGB 4GXVH 4IOSD 5IUSA 3QEHB 2BNRE 8FABA 5MENA 1FZOA 2ICWB 1G9NL 4TVPL 2OBGA 2ZUWA 4IRSA 4P2RE 1G9MC 3DX7B 1DL7H 4P0DA 4EUPG 1RJCA 3IDUA 3RWCA 5C07D 3K1DA 3FO9A 1IKNA 1JGDA 3UTSD 1G7HA 4R0LA 5L88H 4GG6B 1A7RL 3LPWA 1CLCA 4J3SA 3FHQA 2JELL 3D25B 4FTVA 2FNBA 1QLEH 3DO7A 2EDOA 1RPQA 5KSAC 4CVXB 1OD9A 1CU4L 4N68A 1IGMH 4LCUA 4XP1L 2H3NB 1XF3B 3KPPB 2P45B 4X99B 3MLRH 1QVOB 5BS0D 3DBXA 3UAJD 3KWWB 2IG2H 3NIDE 4ZTOL 3UC0H 1X5GA 1CDBA 3UYRL 4GW1B 3OR7A 1DUZB 4L3ED 2DWDB 4LLWB 1IL1A 1BP3B 3PL6A 1OP3H 4JFDA 4YHPA 3HZVB 2NR6C 5HD8C 3RP1A 5KVGL 3X17A 2FBJL 4XP9H 3T0XA 2P5WA 3V0AC 4IRJD 1NL0L 3VD7A 5L6YL 2BOBB 1T83C 2J88L 1VFAB 1FFOB 4Y4HC 3VWJB 5DRXA 2I5YL 4HJJH 4BH7B 1QLRA 3QIWB 4QRRB 5FECB 4UMGA 3WV0A 4HG4J 2VC2L 1A9EB 1OL0A 5B4MC 3TT3L 2F5BH 4MAYB 5C0RH 5GS2H 1L7IL 4GKOA 1EGJL 5DD6A 2X4QB 5DQ9B 5DJ6B 3MBXL 3C5ZB 1F3JB 3MODL 5DURB 5GJSL 3GSVB 4U1GC 4U1NB 3ARSA 3QDMD 1RFDH 3PE9A 3TZVC 4KMTL 5MI0B 3T1FA 3O11B 5DO2C 5E6YA 4MXVF 3LS4H 1F00I 3HE6C 1I1AC 3C9NB 2XTJB 4JPIA 3S36H 4JZOB 4BQ9A 5DEFB 4XC1H 1IC7H 5C2BH 4U6HA 5MHSD 4ZTPL 1K4DB 4GQPH 2D0GA 5EBMB 1C5BH 4AY0A 2WP3O 4OM1L 2AXFA 4PRHB 3RUGF 4KV5F 1UEYA 4RGOH 5FYLE 4XXCA 2ZNWA 4OBSA 1JZ8A 4WW2C 1QSEB 1KCVH 3GSNB 4JFDE 1T1XA 2DQIH 3I85A 3ARVA 4WEUD 5ADPH 1VFMA 1I9EA 3D9AL 4KI5C 3O6FB 1HSBB 5A43C 2EICA 3VFOB 5AUMA 3OKNA 4HGKC 4OD3H 1AO7A 2DQEH 1G6RH 3EOTL 1J87A 2DYPB 4WEBH 2C4XA 1TTUA 3QUZA 4G6KL 4FQPA 2FLRT 3EJYD 1AIFB 4WDIA 3AREB 1U8KB 2XQBL 3W0WE 2RQ8A 3P77A 2IPKA 4YDJB 2WSKA 1F8TL 4GS7C 5IJKC 4OD2A 4BUGA 4X5WA 3TBYB 3CVIH 1UXWA 1UXSA 1IAOA 1PYWB 3CMOH 4XX1G 4HC1A 1M7DB 4NKIH 5EUKA 3TBTB 4R3SA 3QA3B 1TNNA 1KB9J 2EYRB 4L3CA 1BM3L 3PJSB 4XVSH 3AXLB 1N0XH 3KPTA 4O2FA 2X1QA 4JRXA 3KLAB 4M8QA 4XGZA 3DV6B 4QCIA 4JZJB 3NZHH 2XZAH 3QR2A 4U6VH 5DD5L 3C8DA 5F7WC 4N9GA 5E08L 3D39B 3KLDA 1FORL 1JTOA 2ORBL 4NZJA 5GS0L 2V6HA 4BK5A 2JIXD 5TQ2L 1KJVB 4LAQL 1QLFA 4W6WB 3JUYA 3VGDA 5D1XB 4XTRD 3CJJA 1LNUB 5F7DA 1KCRH 1NGXA 3UTZB 3CMGA 3BGAA 1LP9A 2IQ9L 1I9JH 3QYCA 4P2OA 5K9KB 2CRMA 1REIA 5KS9E 2VITB 2NZ9D 5IESL 2M2DA 1MFDH 2BOCA 5GISL 3MLZH 3GBLA 1CGVA 2AJVL 4MX7A 1JZ2A 5E56A 4FQXB 4ZFOA 4G6MH 4LVOB 3PDOA 4S1QL 1H15B 1SJXA 1QPXA 2H2SD 4M7LH 3T65B 5J11B 5SX5K 4P5TC 5EU7C 1D5BB 4XHJC 4IMKA 3SQOH 2A6JA 4U1JB 4NDMA 5BW7C 12E8L 1RY7B 1I8MB 2YUZA 5E9DD 1OWRM 5I1IL 2B1HL 5MEPB 4HG4K 1B2WH 1RZGA 3IU3A 3TPUB 5EU3A 3BPOC 2YOCA 3VJ6B 4HMCA 4Z77A 1FNGA 4KJWD 3D3VB 3REVB 4NQUA 3EFFB 5J57B 2FYYA 3BVNB 2AEWA 4LLYA 25C8H 2Z4QB 3QB7C 5HI4C 5J7CC 4S1SL 4F7MA 2AJUH 4OZFA 1UQSB 1LP9E 4MB3A 1U8LA 3BDXA 3ZL4H 2YA2A 1FN4A 4KKCC 1B88A 4CN4A 2BJMH 3MYJA 5HYJE 4M6OH 4X6BB 3ET9F 3MNWB 4PJ8D 4TSCH 5CBAA 3UBXI 1FYTA 1AE6H 1AI1H 4RQQA 1KCUL 4A6YL 3IDIB 3EDJA 3BISA 3KYKL 4CMMB 3IYLW 4OFYA 3S35H 4UV4L 1U8JB 5I8CA 3G04A 1K2DB 1ND0B 2J6EL 2WUCH 2FHBA 3NCYS 1ZWIB 1A6AB 4Y5YC 4Z7UA 5ICXB 1FL3A 3MJ8A 5BZWA 2X7LA 4XAKE 3KLHC 5DR5H 1TZGH 2WANA 3SDAC 4KK9D 3TH2T 4H8WC 1BWWA 3BPCB 5L2KD 1CE1L 1XIWA 1AGFA 2HP4A 2AV7B 4CU8A 1I85C 3U4EB 5DC0A 5F89A 4DZBB 3ZHKA 4OFVA 1NAMB 4UOW0 4YHYB 5C3TA 5TE6L 4NN6B 1UM6H 4HGWB 5CIPB 5I16A 3GMNA 1MRDL 3QIBA 1H8SA 3ARFC 1KB9K 4OZGB 1N59B 1KIPB 5E6IA 4KROB 5EUOB 2BXZA 2OTWB 1VKXB 2VO5A 3GSWA 2VABB 1NMAH 1WC7B 4FABH 5HHVL 3RVWC 5A1AA 3TFKD 2J4WH 2B7DT 4ZS6C 3KYMA 1AGCA 4MSWB 5C09D 3HPJB 5BZDA 4KRPD 1GGYA 1I7UB 2BCKA 3HE7B 3PV6A 1FYTE 1FNLA 3QXAA 2DBLL 2FGZA 1JFQH 1VGEH 4X4XA 3RJQB 4F7TB 3O9WC 1FGVL 5IB3A 3TBSB 3QIUD 4F3FA 1A6WH 2I27N 1T03H 2VLMD 4EVNB 2PXYB 3FN0H 1CLZL 2X4NA 1X9QA 1O0VA 1I4FA 2JCCA 5FCSH 5C0FA 2F58H 2ZOLB 4PJBA 2VNCA 4HPOL 4YXLL 1X5YA 1DBBL 3CUPB 5DEGB 4P5TA 2WIIA 2WWMD 2VISB 5IROC 3PWLB 3WFBL 2LAAA 3UBXG 1HHGB 4WWKC 2PETA 1B90A 1CQKA 4HWBA 5EWIH 3RWEA 2Q76B 5DDHB 3HNVL 3B2UD 1K5NB 1JF1B 4I5BA 3I75A 2BY0A 1CL7I 1KJ2H 1UA6L 5IMOB 3ZKMC 4BZ2L 5SWQA 1WWBX 1HKLH 4UUJA 1BQLL 2VKXA 4ZUSB 2HT4C 3OAUL 4OCWH 1BLNA 5FO7B 2UZIL 5HHQB 3OPZL 1VADB 4UDUB 3SJVA 3B6SA 3P73A 4Y5XB 2HWZL 4KDVA 5IOPA 1WAAE 4XPBH 3PHQB 2Q3AA 3CFJB 4HKBB 3B8SA 4KY1L 1NCWH 4OGAD 5CFHA 4QRPB 2BNRB 4Y0GA 4U6XB 3R8QA 3OGCB 4HH9A 1NLBL 4HSQA 1MCLA 4P2RB 5D1ZB 4JFEE 4PJBE 5T1MB 4OCXL 4MNHA 2NW2B 3N1GC 2NY2C 4ZAKD 3QDAA 4H88H 4OJFH 2ARJB 1DBJL 3VH8B 5CJXA 2X2YA 5HHME 3QI9C 3N9GH 3O3DB 1DQJB 4IMLA 1MCQA 3OHXA 2QHRL 4NJAH 4LOUC 1I85A 5CJOL 2GW5A 1WICA 5CSGA 5FFLA 3QJFA 2EZ0C 5F6IC 3VD3A 5FF6A 4OIIH 1U92A 2X1PA 4PFEA 4PRAB 1F4XH 1Z9MA 3H7LA 5DHYB 5T3ZE 4RNRA 4WHYG 3BQUC 3SJVE 2VB5A 3T2NH 2P43B 2OP4L 3GMPA 3TA3A 4RISL 1A7OH 2ADIA 5HI3D 2P42B 2Z35A 4JM2D 4L4VD 4Y16A 1G84A 3VXNA 1PAMA 4KVNL 4XMPL 1IGTA 1FIGH 4GG8A 3TO4D 4IDLA 3K0WA 3T08A 8FABB 2DQDL 5F9AC 1E6JH 3BSZH 4HUVB 1R5WB 1TMCB 1EO8L 2ZCKH 4MCYA 4UT7H 4NNYA 4XMLH 1P7KA 3CU7A 3VFRB 1R0AL 2XWBA 5M95B 1DLFH 4IRSB 5IW1A 2FATL 3RWCB 2OI9C 5D7LE 4GXUN 3FO9B 1JGDB 4YXKL 2YD7A 1G7MA 1G7HB 1I3RA 1S5IH 2OR9L 4NO0B 4R0LB 3ZE2E 1S7SB 4YE4L 3RU8L 4PTTA 4G9FE 1UWGL 5DHVH 3IAPA 3VFWA 2QL1A 4FTVB 4G8GD 4N5UA 4NKDB 3DO7B 3WS3A 3VRIA 4KZDL 4PRBB 1TJHL 5FKAB 4KKNA 4LCUB 2IMNA 5IVXE 3DBXB 5IB1A 4C59B 3NH7H 4AL8L 1MCOH 3HAEG 3WD5L 1H3GA 4PJFA 2ZUUA 3UJTL 1DVFC 1IEAA 3OR7B 3BIAX 2YXMA 5FV1L 3GUTA 2AEPL 3EDKA 4JFDB 4YHPB 4I3SL 3JBG7 4I1NB 2P5WB 1KELH 4WUUD 1EEQA 5DA4A 1EUTA 1HOCA 2C3VB 3JVGC 2XA8L 4UAOC 5DXWA 4DN4H 4W81A 4WWID 5C70A 5LCVH 4PIRF 2YPVH 1QLRB 3QEGL 5E5MA 4OCLC 1AQKH 2ZG2A 2LU3A 1NGQH 4XCFH 1GHFH 3E6HA 1OB1B 3N1PC 4PJ5A 4O51A 2VQTA 4L9DA 3PQYD 4M5YH 2A73B 4K07A 15C8H 3NCJH 4LSSL 5H94A 1H8NA 3PWJA 3T1FB 3RX7A 3VDAA 3VE0A 4OZIA 1OP9A 5DQDH 2CLVA 2D31A 4JPIB 2V7HA 4LRNL 1H3PH 3UTPD 3LEVH 3Q0HA 4EUPH 1X5FA 4RIRA 4U6HB 5ESAA 5KVMC 1N64H 3DO3A 3BX7C 2VIRA 2DQUH 3P30H 3VXQA 3ECBA 1S7QA 2AXFB 4UZGA 2IAMC 4YXHH 1V5JA 3O0RH 5A3IC 4LKXA 4LLDA 1J1OL 1XR9A 4GKNA 3LRHA 3QWOA 5IIEA 4MJ6A 4HWZA 4KI1A 3RGVC 1JGLL 1T1XB 4FHBD 3V95A 4XI5D 2PR4H 2EH8L 3IFPA 1DBAL 2F5AH 5ALBL 3OKNB 3ISWA 3D6GA 5KS9B 4MDJA 4HFWB 1INDH 3QUZB 4DFIA 3CC5B 4G9DA 4X8JB 1YYML 4WDIB 1U8OA 4AENA 1A6UL 3P77B 1KTLB 2MPAH 4YWGH 1OY3B 4MB4A 4OCNC 1YMMA 1KIUA 4CJ0A 4OD2B 4JPVL 3U48A 4I13B 4X5WB 4LSVH 3A6BL 1UXWB 1UXSB 4Z7QE 3QFJA 1EEUA 4YLQT 1IAOB 2J5LC 6FABL 3HC4H 1E6OH 4K8RL 2C4FT 4Z7OF 4PBVC 4R3SB 1MRCH 1JPTL 3U0TA 3ULVD 4U4BA 1ZHNB 4F7PA 4NZRL 2X4OA 3HNSL 4O2FB 4JRXB 4X9HA 4JB9L 4M8QB 4QOKA 4QCIB 4JQIL 4NM8L 3BOVA 4OFDA 2HKFL 1T5WA 1P5VA 1QACA 4N9GB 5DFVD 1U42A 3WHE0 3NABL 4UT9L 4MD0A 1QLFB 4ZMAT 3OF6A 3SDXF 4D9QD 3RVXC 4X0KA 3A0OA 5LJYH 1UEMA 1NGXB 2AJXL 1LP9B 3ZTNL 2IPUG 3UYOD 4Q6YA 4P2OB 4WTZG 1YJDC 4PGBA 4W6XB 4XPFL 4WI8A 4PTUA 1EV2E 1MFAL 2BOCB 3DETD 4MX7B 5E8EA 3C60D 4X6CE 4ZFGH 3RTQA 5HGHA 4ZFOB 3OX8A 5CJ5A 5JNYA 3OKEA 3PDOB 4D0BA 3ZDZF 4JPKL 1JWMA 5I17A 3JVGA 2W0KA 1NBVH 5BOZG 4WCYL 3CVHH 1BZQK 1QFWI 4U1LA 4X9FA 4JM2F 4URTB 2M26A 1KBGL 5C6WH 4LFHD 1PY9A 4XZUB 1QFUL 1OQXA 3ULUL 2VN7A 1FNSH 1RZGB 1RZKH 3IU3B 1ZGLA 3P4NB 4N0UA 5EU3B 4Z77B 1FNGB 3JWDC 1OQOA 1TJIL 1YEJH 3G9VA 4MMXC 1CVSC 4PJXE 2V2WA 1RUMH 2FYYB 3FOMA 3HN3A 3W82A 4LLYB 5IK3B 4BQCA 4N8VG 4TNWF 4N0FB 3W11D 5EU4A 2YPKA 5DD0H 2J2ZA 4KK6C 4IEFB 1QFOA 4F7MB 3UPAA 4OZFB 4PV9A 5T1KD 5DJDA 2DQGL 5J3HC 2VZ1A 4RSVA 2ARWA 4M4PA 4OLWH 4D3CH 4JFFD 5FGBA 1FN4B 4LSUL 4JCMA 1WQVT 3MYJB 5EB9A 4M7JH 1FYTB 2BVPB 4RQQB 4P23C 2HMID 2R15A 3EBAA 4X7TA 1J0JA 2PW1A 4UQ2A 4XNXL 3G04B 4XHQA 4S1RL 4XCNA 1DFBH 5HD8D 1FFQA 1J0KA 4YFLF 1FNHA 3MJ8B 5BZWB 3ARTA 2NY4D 4YHLH 4PJ7A 2ITDA 2CUMA 2HAZA 4AJ0A 3RKPA 4CGTA 3IDYB 4Y4HD 5HHNA 1D9KB 2RGSA 3K4ZA 5H8DA 2X1OA 2X1WL 4L4TA 43CAB 4RWYL 3CK0H 5CZKA 3KR3L 5ACZA 1XIWB 1AGFB 2WINA 2Z31A 3H7BA 4XNMA 1BFTA 1ED3A 2W60A 4ENEC 5IT2L 2VXVL 5HYQA 3N85L 2Q8AL 4GLRI 5F89B 1A22B 4TQEH 4CUCA 2E7LA 1Q94A 5SWZA 1TQBC 2IJ0C 3OTTA 2VXUH 4HFUL 5JW4R 3U0WH 3GMNB 3TZVD 3EHBC 1EEZB 2Z93A 4PR5A 2APXA 3QIBB 4L9LA 4LCYA 5E6IB 1Z0NA 1XGTA 2P1YA 4X9BA 2ZOKA 1ZEAL 4JN1H 5JHDD 1AHWB 1KXTB 4NHUA 1QO3B 3PABA 5BZDB 2B4CC 4MDIA 1PDKA 2BCKB 4JJHA 4U1HA 4KQ3L 3RVVC 3PV6B 4DN3L 3QXAB 1DLHA 4AT6A 3PHSA 4GSDH 4X4XB 2R29L 1WZLA 4B0MM 2YD8A 4RBPH 5I2IB 4LCIH 1QBBA 4F3FB 3F6IA 4LQFL 4D94A 3HB3C 2Y06H 3MRRA 3QEUA 4OCMC 2FL5A 5T1LA 2DMKA 1F13A 3T3PF 2IC2A 4N1EA 3TGXA 3V5DA 1CD0A 2DLTA 5SX4I 5DD3L 4P2YA 2X4NB 4NP4L 1I4FB 1LHZA 1KIRA 1WZMA 2JCCB 5C0FB 4MAUL 4CMHC 4NQCD 2FEEL 4HK3J 4F9LA 2YD9A 4PJBB 5IVNA 3AB0B 1I3VA 3LN4A 2YD6A 3MLUL 3ZKQD 2WIIB 1GGIH 1D5IL 4NGHH 5EIIA 3SKJL 3H2WA 3NPSB 5LBSL 4NKQB 2EDNA 3RIFF 5DGRA 4B5EA 3RWEB 3IXTA 3QHFL 1PG7L 1I9RL 1OAQH 5CD3A 4I5BB 4KHTH 4KGJA 1NSNL 2ESVD 1T89A 2V17H 1F11A 1BREA 4OF6A 5FYJU 4W70A 2GJ6D 4I3RL 3D0VA 5SWQB 3ULVF 3UX9B 1S3KH 3SO3C 5BVPH 3VXRA 3IU4H 5E8NA 2R23B 1G9ML 1BLNB 1H5BC 3PNWA 1WZ1L 3SJVB 2EC8A 3B6SB 3P73B 3QQ4A 5IOPB 1QBLH 1UENA 4PLJD