1JNHB

Crystal structure of fab-estradiol complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
214
Chain Sequence
b'EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARYTQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTVTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal anti-estradiol 10G6D6 Fab light chain
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 214
sequence length 218
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB02
3FKUS 5JIHA 3GSXB 1U3HB 1JCKA 5EZOH 5BCAA 4F7TB 4MJ6B 2BC4B 2NTFB 3ARGA 5D70H 1DQQA 4FMFA 2CR3A 4HD9A 2DQHL 4YHOH 4ODHH 3OAUH 4U1SB 4JGUA 1WZLA 1UKQA 3ZKMD 5J12C 2P8PA 2AJZA 2MOVA 3PHSA 2MCPH 4XPHH 4PRIE 1K4DA 1JTPA 4CU6A 4JDVA 1WWBX 4GMTL 3CUPB 1LE9B 3DO3A 5DDHA 3ROOB 2OR9H 1EIBA 1CWVA 5C0BB 3U2SA 4DKFH 3QEGL 3VFMB 3ZKNC 3KPSA 1N2RA 2XN9A 4OD2A 3REWB 4P5KA 3FT3B 5C6TH 5FV1L 1AJ7H 4HUMB 4MJID 1F58H 1H0DA 4JVWA 1RK1A 3PGCB 5IHUH 2E6PA 1IQWH 3LS5L 1NFKA 5IJVA 1NL0H 2ZOKB 4U3CA 4RMUA 2XZAH 3FQUA 1FL5B 4JFQA 5GSRB 3CFJA 4FP8L 4U1MB 1FGVL 2PW2B 2R8SL 5HYJD 5JPMA 1FQ9C 4JVPA 4JDZB 3PGDA 1RZGB 1DDHB 4JFPA 4YR6B 3VFSB 4H25B 2WIMA 4PJHA 1QACA 3V5KB 3C5ZD 4LCWA 5EC2B 4J4PD 4ZSOE 4MQXC 4KDTC 3HFMH 1ETZB 1SHMA 5DO2C 1ADQH 4JQVC 3EJYD 1SY6A 3DIFA 4FNLH 3KJ4B 3BUYA 4U1LB 1RZIB 1B90A 3E6FB 4X6BB 3FO9A 5CIPB 5AG9A 5DJCA 3MLYH 4JEGB 4S2SB 3JWDH 1A6ZA 4LASH 4P9MH 1OD7A 4U7MA 4NQDB 3FN0H 5DJ8A 4OGAD 1IAOA 1K8IB 5ACLA 1PKQE 4NQUA 3CFIC 3AREC 3QPXH 4H20H 5DD3H 2X1PA 1XCQA 4KKBC 1E4WH 3EYQC 3BVNB 2I24N 3EHBD 1MRFH 2JIXD 1A6AA 5GZOD 1LDPH 3WHXA 4DGVL 5DD6A 3TF7C 5DXWA 1MHEB 2R15A 5JR1L 4HK0B 3MLPA 3X3FH 5GGQH 1A7PL 3BJ91 1OW0C 5BS0A 2I9TB 3MTRA 1FORH 3DUSB 3W82A 5ICZA 5HI4D 3LH2L 1H3VA 2DLGA 1U8NA 4XC3H 4WI6A 4X6CF 5E4EB 5IFAL 1WC7B 2NW2A 4UB0H 4MA7H 1WGOA 5CS7A 1SEQH 5E2TH 3RDTC 3BKCL 3T0EC 2XACC 4HC1H 4DCQA 2DQIH 3LCYA 4JZNB 2I07A 2DLFH 1JGDB 3UP1A 2YRZA 3SDXA 3JSSA 1T83A 1FO0B 1I1FB 3TGXA 1E6OL 3VXNB 3IS1X 3SDDB 4RZCB 4QRQB 2H3NA 2YEZA 4N90E 5IHBA 4M6OH 1MCHA 1FE8H 3KYKL 4AENA 3KPRA 2VYRE 3WN5B 3D87B 2ZUVA 5GPRA 1Y18B 1A6TB 2A6KA 3RFZC 3AS2A 1AR1D 1J0JA 5DT1H 2A1WL 5KSBA 4HJGA 5BZDA 1CF8H 4ERSL 4DUWA 3RVTD 4N9OB 2DYPB 3SO5A 3BZFB 3DRQB 2C1OB 4JRXD 1H3WM 3RP1A 3WS3A 4MXQD 4XP4L 1HDMB 1UEMA 1VGEL 3DHJA 2F54B 4XXCA 4WWKA 3IRZA 1L6ZA 3LKNA 3NIFF 4J23A 4XP6H 4DW2L 1LO4H 2DKMA 5AWNH 1HN1A 3QISA 3ARUA 1RJZB 1OSZA 5GRVL 2VQ1B 2X9YA 3QJFB 4RFOH 2VMFA 2HFGH 3O6LH 3VMOA 3QHFL 1YEEH 5DHXB 4WUUE 2WUCL 4PLOB 1MCOL 3DWTA 4ZPVA 3UCRA 5L7XH 4G3YL 2WWMC 3I3EA 1U6AH 4FZEH 3SDCB 3LEXB 4QRUA 4OV6F 2D03L 4NPYB 3MRLB 4I0PB 1GAFH 4K7FA 5D6DA 3HMXA 4B0MM 4TYUA 3GBNH 4LEOA 3IETA 3TA3A 1I9RL 1XMWA 4JFXA 1I9IH 4UAOC 3T4AA 3BQUD 3F7VA 4JY4B 2ERJC 2X2YA 4FQ2H 1AFVL 1EAJA 5E6IB 3MRNB 4XPBL 4NO2A 1HHIB 3OBAA 4QF1A 1CK0H 4C55A 2P24B 4UT9H 2XTJC 3V52L 9CGTA 5T33H 1CU4L 3RAJH 4XXDA 1OM3H 4X9BA 5IEHA 1UWGH 3X17A 2BVPB 2RGSA 3OV6A 5I6XB 2IPTH 1YJDL 4EOWH 3LKOB 4RFEB 1ONQA 4XPAL 4M1CD 2F8OA 5JXAL 4NKOA 4JO4L 5GS1A 5GRWA 1G9EA 4OZHF 4L9LB 4RQQB 2J7LA 4GFTB 2YMXH 1S9VB 1ZHKA 1QZ1A 3MLTA 4K94H 1BBJA 5DEFB 4EN3B 4Q9CA 5KG9A 4IS6B 1ZVYA 1U2HA 1RJCA 1WWAX 4GS7B 5ISZB 5F3BB 5C08A 1S5HA 1MVFA 1INQB 3V6OC 4RFNC 5CEZE 2XICA 3RVUC 1S3KL 3HG1B 1S7XB 4XCFH 4LOUD 3GEWB 2MKLC 1OP3H 1VFOA 4PD4J 5MERA 2JB6B 5J0BA 5D72H 1EAPB 1NLDL 5DVMA 2CKNA 2VISA 3DETC 5D1QD 3S5LA 4FQ1H 3IDXH 1NFDE 4LSSL 3O11A 4LCYA 3BHBA 4EIZC 2P48B 1T0NA 5MP6H 4U1NA 5L2KA 1S7UB 3WSQH 3NA4A 4GW4B 5B4MD 3HI1B 5C2BL 5B3JE 3GNMH 4E42A 4JLRB 2AEIT 2VN7A 1CDBA 3GMMB 1RUPH 2Q3ZA 3TVMB 3ZKXB 1JF5A 5CSZB 1YEJH 1JMXA 4DVRH 1MAKA 4Y16D 2A38A 3MRQA 3MJ7A 2BVQA 1QFHA 2QQNH 3WXVL 3SBWC 4XGZB 3C60B 4R96B 1JTTA 4I9WE 1J0HA 1EFXD 3MREA 4CMHC 3QWQB 4MA3B 4L4TB 4FFWC 5C7XH 4FFYH 3KXFA 1PSKH 4R8WH 2CH8A 5GS2H 2DQDH 3QG7L 4QRRA 5MENB 2IMMA 2NTSP 5LWYH 3VH8G 5C8JA 2UZIH 3UTZB 3P77A 1PG7W 4WFHE 1EV2E 5T3ZH 1A7BA 4YX2H 3HMWH 2DJ4A 4PJCA 5HGBA 3UBXG 1IZKA 4PJBB 3B9KD 1J5OH 2QTEA 4ZSOB 4NDMA 5EU6A 4OLYH 2O26U 4FABL 4PTUB 3O8XD 2GTZB 2F5AL 1BD2E 5KSVB 3O41A 3ECBB 3TIDA 1I1RA 4HG4J 1FVCA 2GSIB 4TRPH 4YFLI 1FHGA 5HHNB 3F7PC 4P2CG 1F97A 4OCRH 1H8NA 4GKOA 1QG3A 4AY0A 4ODWB 2Y23A 2B5IB 4U6XB 4JQXC 4IOFD 3LIZL 4JFFE 3QO0A 3L3GB 4JZOA 1PLGH 4N5UA 3BDYH 3G08A 4WDIB 3ZYIA 1MPAL 3G5YA 4E5XA 1I7UB 3CFCL 5KANG 1RHFA 4NN5B 1MF2H 2EDFA 4Y1AD 1HSBB 2CDEB 4LSRL 2Q86B 2O5YL 3B9AA 5DC9B 5FUZL 1YA5A 5CD5C 4ODXA 5E5RB 1Z5LB 1AQKH 3IGAB 4K07A 3P4NB 1MY7A 2X4UB 5FGBC 1YEGL 3H7LA 3SGKC 5CINL 4V1DE 4P5MA 5ESQA 1S9WA 4PJ5A 5GRUL 4M7LT 3QUML 2R2HB 3OGOE 2RCSH 1B0RA 4G8GB 4P3CH 2AXJA 3MBEA 4OCXH 1W72L 2ORBH 2MWCA 5JOFB 5HYSG 1H15B 1BM3L 1TNNA 2VXSL 3D3VA 4RNRB 3JV6A 5FYJE 3V6BR 4HUVB 4O4YL 2X89A 4RAVB 4L3CA 1UH2A 5F1KC 3O4LE 4MNGE 4Y4KC 4JG0H 3MCLH 4XCNB 4Y4FD 3MRRB 4FHBD 3EOTH 4X0KA 4KV5F 5JHDA 5SWZD 3QUYD 3VWJD 4LLDB 1KCKA 1XF1A 3I50L 4PB0L 2DL9A 1UQSB 3CU7A 1E28B 3LEVL 3U4BL 4DOHE 4N8CL 1MCJA 2A6JA 4WI7A 4OFKA 3ARWA 4RISH 1YEHL 5C0RH 1RK0B 4NFCA 4LGRB 2QR0A 5E5MB 1QSFD 3G9AB 2EDHA 5F7UA 3BRDA 3K1DA 2EZ0C 3MXWL 5I66A 4PJBF 4OB5L 4L8CB 2NY4B 4YWGL 3WDJA 4UUJA 3W9EA 2DL2A 4PV8A 5SX5H 3MV9B 1NC2B 2A6DA 5IBLC 1IRAY 2DQJL 3VE0A 4JO3L 5IW1A 3CVHH 4M1DH 1LEKB 4Q6IA 4CN4A 1YNTA 4P9HH 3KPOB 4IMLB 1JGEB 3W9DA 2YD7A 4LEXH 4OFYA 1KPVA 2KQNA 4NN6C 4YHIA 1A0QL 5FA4A 3H9SE 3U82B 4P46B 1EMTL 4OKVA 1QRNA 5ID1A 2ZJSH 4FXGA 1T5WB 4ZODA 5EO0B 1KB5A 3AAZB 1DBKL 2DI8A 1U8QB 3WJLA 3QQ3B 2EDEA 4OGXL 3V4VH 3PQYB 4ALAH 3ARDA 4AL8L 4WUUB 1HI6B 3FB5A 1KGCD 1WIPA 3VXUD 5IB3B 1IMHC 5CD5D 4NT6A 3V9FA 4LHUB 5F89B 1LEGA 3MROB 5IVOA 5K59F 2DLTA 3EOBA 3KPQA 3MRGA 3A0OA 1B6DA 3MJ9A 2ADGA 4HDIA 3MRBB 1G0DA 4PJIB 1KCSH 1AXIB 5HHVL 4QHUA 1DBBL 1V3JA 3TO4A 3MV7E 2VH5H 5DS8A 3M1BB 2RQ8A 2AJ3A 5JOPE 2APWA 1NCCL 5F9DC 3P9WB 4ZXBD 3G6DL 4RGND 1G9MC 5DFWH 2CJUL 3QFJA 2Y07L 2NY0B 5E1AA 5BV7C 5MEQA 2SEBB 3FONA 1GZPB 3GSVA 3Q0HA 1KELL 3D48R 4O2FB 3IDUA 5DJAA 3D6GA 1JZ7A 2YBRA 1DQJB 4JRYA 1FLRH 1PYWA 3BEWA 5F9OL 1A1MB 3SY0B 4N0CC 5I18H 4OCYH 3OL2A 1LK2B 3S34L 1MHHA 1P84K 3ZYOA 2G2RB 1E4XI 3TN0D 3QIWB 2AQ1A 2DTMH 2HT4C 1IT9L 4OV5A 4R97C 4WEBL 5JW3H 2FJHA 3QEQA 3L6FB 4PJ9C 2E27L 4Z76B 4MA8L 2EZ0D 3FHQA 8CGTA 3ESVF 3RNKB 4I77H 3DPBA 4L4VA 2P8LA 4WNQB 4XPFH 2DJSA 4HKBA 4GW5B 3CDGA 3WNMA 5KW9L 5HHOA 1NLBL 2NXZB 1NFDB 4LNRA 2PR4H 1S7VB 4EUPA 4PLJC 3ZE2F 2OL3H 4JPIB 3Q3GA 3UTQA 3VFRA 2HYMA 2VDNH 1X5AA 4UBDD 2ZSWA 3Q5TA 1IE5A 5E8PB 3C8DA 3ETBF 3QDMB 1KG0A 2P7TA 3EGSB 4JFEA 2ICEB 1EZVX 4FFZH 5I2IB 5H37H 1D6VH 1WZ1H 4HF5H 3C87A 1RZ8B 5ERWB 5D7LE 1MUJB 4I5BB 1R0AL 4HEPG 1LNUB 3PG2A 4YNYA 4M7ZC 2XKNA 5AAMA 4M6NL 1G7PA 3IXAB 3E8UL 4QOKE 2ZSVA 2R56L 4FQQA 3QIBC 1KCRL 4G6JH 4JHBA 4OZGA 1HK6A 5IMMB 3A6CL 4UOJA 5T1LA 4F7CB 3SE8H 4NN7B 1CFNA 1WBYA 3G6AB 3WKNA 1FV1B 4ZFFA 4N1EA 5CZVL 4Z7UF 3GMNB 3BP4B 1QR1B 3I3DA 3BP6B 4PRPE 1D5XB 4ZQKB 3IJYA 2FGWH 3O4OB 4N0YL 1YN6A 4S1SH 4WO4C 1B4JH 4BZ2L 4W68A 4ZPTA 3TWCH 3O2VL 4E0RB 1WWCA 1MCQA 1ZLSL 3GRWH 4ONGH 1U8PB 5L6YL 2PUQT 2EXYD 4YBQD 5KVFL 1SYVB 4NZRL 3P9MA 4XBEH 1JN6A 3CSBA 1WT5A 3KYAA 3V6FA 5IF0B 1EGJA 3WNLA 3MRKA 3RL1B 2XV6B 3U0PA 4PGDB 1GGTA 2E5EA 1T20B 4P2QD 3QIUB 1E4KA 1MLCA 1W0WB 3H9ZA 1MNUH 4GBXC 4W70A 2XY2A 3E0GA 3DROB 4V2CB 3O9WA 1XGUB 35C8L 4HUXB 2HTLD 2X4PB 5DQ9B 4LSUH 2EYSA 1S7QA 3QO1B 3QCTH 1NGYA 1L4IA 1VPOL 4LPWA 1RFDL 1U8MB 3GJFK 3AS0A 4YE4H 1JK8B 4NIKB 2IEPA 3BP7A 4OFDA 1U8OB 4IRJC 3H0TB 3FO0H 1O0VA 1HZHH 2BY0A 1OY3B 1GGUA 4O9HH 3B6SA 3PABA 4JY6A 4O2EB 4H0IA 1S7SB 5CD3B 2NY5H 3BGMB 2OTUA 4JFDE 3WD5L 5FYKL 1I1CA 2CLZA 3BPOB 2V7NA 1WJ3A 3VFWB 1IVLA 2R2BB 4IHOB 3VFUB 4WFEE 1G7IB 3OKEA 3O4LB 5DGRA 1CDHA 4FTVE 5ICYA 4G8EA 1PZ5B 2R39A 2R69L 5D2LB 4KJYA 2WBJC 1CD8A 3HZVA 3QFDA 5DR5L 1K9TA 2OK0L 4KPHH 5FK9A 1FO0L 4G5ZL 4GQPH 1NC4D 1NBVL 2APFA 4PUBH 3UPCA 3RZCB 4DOHB 2O5XL 1T2JA 3RI5F 4JM2D 4P57B 4HH8A 3ZDXF 4X6CE 3ISWA 5CHNA 3PDDA 3LOWA 3QULB 3MLXL 4QHMA 5FGBA 3I84A 2A83A 1TQBB 3N1QC 1MFCL 3SE4C 1IC1A 4D9LH 3MCG1 1HOCA 2YK1H 4W4NA 3C8KB 3D1MC 1QYGH 1DVFB 3ARGD 1G6RH 1EH9A 2N7BA 2JCCA 3RVVD 2VERN 8FABB 2FBJL 4TUJA 3P3YA 3JV5A 1AY1L 3BT2H 4HX1B 3CH8A 2PYEE 3D9AL 4CN1A 1YPZE 3OSKA 2FB4L 5JIKA 4WI2A 2R23A 5JW5A 5DRZB 1TETH 2BXZA 3DXAB 2I9LB 1J8HE 4XI5D 3TIEB 3D0LA 3KR3L 1A6VL 3LKRB 3IFLH 1IM9B 5F7WC 5FO7B 3S98A 5HHPA 1CFQA 3QDJA 4YDVA 1EVUA 3IDYC 5HDBF 3OJDB 4YH6A 3DMMB 4QNPF 4HXBH 1FVEB 3OKKB 4RA3A 1I7TA 4DKDC 1WBXA 1CFSA 4YHYC 3BOVA 5T1MB 1S78D 2C3WA 2W0PA 4ETQA 2OTWA 4P48A 4I3SH 2BX5A 2V6HA 2I60H 3P0YL 3MGOB 1U8KA 3L3HA 4MX7B 1MRCH 4X4MA 3HI6L 5GIRB 1OAQH 4Y5YB 1OSPL 3QDGB 4POUB 1FZMA 3STLB 1AGEB 3TYGH 4HIXH 4MJIE 4UINH 5D2LF 3I9GH 4LCWD 1IC4L 2UVFA 1RU9L 4JB9H 4LVHC 4YEEA 2F8VA 1FDLH 1PY4A 5DK0A 5A16B 3QEHB 2FL5A 3O2WH 3C9NA 2J2ZA 2DMCA 4BH7A 1EJ6A 5GSVB 1P4BL 5HYJE 3G6JF 4HPOH 1GIGL 2FATL 1FFQA 1U8IB 3SE3A 4EXKA 3L3JB 4QO1A 4G8FA 3FO2A 4MCZB 3ULUC 3GSNH 4K71B 4ZO8A 2PO6A 4G8IA 5BRZB 2A0LC 5F1NB 5I1HH 5GISH 5DGQA 3DJ9A 4ZUVA 3WFHB 4F7MB 5BQ7B 4XVTH 2OQJB 3MRJA 3FB7A 1EZVY 3DLQR 1B0GB 3IXTB 3KPNA 3R1GH 1CBVL 5KSAC 4ZFZB 4CADA 1OT1A 5ACZB 2W9DL 4OFIA 4OIIH 5F96H 1I7ZA 3UO1L 3ZZ1A 4DTGL 2APXA 3FT2A 4HUUA 5FB8A 3FQNB 3MV01 2HJLA 1UB6B 5BS0D 1MHPL 2VDPL 4UT7L 3PWUB 5F88A 3LV3A 1J11A 3HC3H 1DBAH 1A6WL 3B2VL 5JW4N 4HHAB 2R0WH 1DN0A 2HT3D 4W4OA 1YECH 1HEZB 1C16A 2WWKT 1SQ2N 3EYVB 4EVNA 5D7LB 1SEBB 2GTWA 5BJTA 2CD0A 1YDPA 3UC0H 2A74B 4QOKB 4YPGB 4HJJH 5C0AB 4MWFB 3A6BL 1T22B 4LSQL 4QWWC 4M43H 4KROB 1VGKB 4TPRL 3TBVA 4IMKA 4ZD3H 4HV8A 2CR6A 1ZV5A 4IJ3C 3KPRD 5EN2A 1F11A 4GO6B 4KMTH 1DQDL 3QUXC 3BKML 1F4XL 1M7DA 25C8H 5KSUA 4YXHH 2UYLA 3GM8A 3QH3A 5CJXC 5DQDL 1LO3L 3DVNA 1A7NH 5DWUH 1D3CA 4Q2ZB 4I18B 4P3DB 4PRPB 1KPRA 2MPAL 4TTDC 4AIZA 3X3GH 1P9MC 5I1GH 3Q2CA 2XA3A 4Z7NF 5IFHL 2JELH 1BOGA 3CFDB 4P2OA 5LAXA 1OLLA 4LAJH 5AZEL 4Q9BA 2MQ3A 2NW3A 5I1CH 1LQSR 2X9WA 4G6MH 1QKZH 4GG6E 1ZA6A 3OGCB 4M7KH 3TLRA 1AE6L 4WWKD 1I1AB 3LDBC 4RMTA 1YNLL 4S1QH 4NYLB 3GSRB 4XBGB 5CJOL 3ULUD 4RRPG 1RIUL 1ES0A 4RDQG 3RWHA 4POYA 3UBXI 5EUOF 2CUMA 5GRXG 2Z8VC 4NKMB 3C6SA 4NWUH 5ALBL 4UQ2A 1PEZA 3TPKA 4JRXE 4M6ML 2QADC 3IJSA 3QXWA 5AUMB 5T3XD 2X9XA 4RWYL 1JPFA 4YK4C 1N6UA 1CXHA 3TA3D 1E6JL 4EJ1C 3NFSL 1OTTC 3PDOB 2Y25A 5A3ID 1RZKC 3JVGC 4OT1L 3H42H 4R3SA 3F7YA 3BKJL 1DTUA 4MAYC 2Z8WC 3T0VA 1DUYA 1CFVL 5I16B 1A7OL 1ZS8B 5E2UL 4J3SA 5IMKA 1MIML 1AH1A 2L7UA 4JFDB 3IF1A 3K4DA 3IVKB 4OQTL 5KANI 2IAMC 3DGGA 3L1OH 2VXTL 4U6VL 3UTTA 2YD1A 3SE9H 2FLBT 2E7MA 3DUUA 3UTPD 4LVOB 3HRZA 2FJFA 4FTVB 3S88H 5CGYC 3P30H 1DLHB 3JTTA 1M05B 2CQVA 1NKOA 5CCKL 4XWOD 5FO8A 1KT2B 4CDHA 4TNWK 1JZ2A 1QSEB 3V4UL 5I8CB 5B8CC 2N56A 4X7DC 1G9MH 2AXHA 3DO7B 3DHMA 2VE6B 2HVKB 1Q9OA 2P5EA 1U8HA 5E8DL 3HZKB 4HH9B 3CLFL 5BV7H 4MD5B 3TH2T 1ZANH 4YXKH 4BA8A 1S9XB 4LLQA 4L9DA 4CVWA 1VFBB 3BISA 2VLLB 4CVZB 3V5DB 3ZL4L 4GAJH 5IKCB 2GT9B 3IU4L 4I0CC 1S8DB 4F7PA 2Z93A 3MRFB 3E6HA 4K55A 3GM0A 4FXKB 3GSOA 3BEVA 1G0YR 5BMFH 4XCYB 2AEPL 1IEAB 1UYWL 2W0KA 2YPKB 3U30B 4ZNEE 4MVBC 3VXRA 1TFHA 4GKZB 5K9QI 3N85H 3G9VA 3U7WL 2BVUA 5I1LB 5F9WB 4NO3A 1S7TA 4FQJH 4UMGA 3BIBX 3SDAC 1FH5H 4NBYB 1KCUL 5MHSD 15C8L 3BZDA 1KN2H 2KZ1B 1AIFA 5L2KD 5D5MA 3FQXA 1UVQA 3NCYS 5EZJB 5CP3H 2PYEB 1YN7A 5KS9E 3MA9L 4EZMA 3QZWG 3OAZH 4UT6H 1FNFA 1YPZB 1IGCH 1P69B 3QHZL 2KPNA 1LHZA 4YHPA 3KDMB 4CW1A 5B39A 1XF3B 2VXVH 3ULVC 5CEXA 1Q94A 2VO5A 1VKXB 3Q1SL 4QRPA 4C58B 2Z35A 1VHPA 5I9QB 3RWJA 3MOQA 1H8OA 2VITA 4S0TD 2M2DA 2LAGB 3SDXF 3CSPA 1KLGB 4MQ7B 1I9JH 3DVFA 1CR9L 2WIIB 4PJAA 1A5FH 4D9QD 4IBLT 5DD0L 1J1XL 4PJEA 5HGAB 3Q6FB 1MWAA 5D2NA 4CMMA 4EQ2A 5ANMA 4MAYD 5EZIL 3VFNB 3PWJB 1NKRA 4ZOEA 3F8UB 3SGJC 2GJ6A 1NMCC 3O0RL 4NQVA 3QCUH 5EBMB 1Q38A 5IB1B 4MJIB 3LN4A 5KSBF 2EDQA 1YEIH 2IANA 2ZP0T 3BKYL 3C2AL 5EU6D 2KUTA 5C0CB 1HYRC 4X7CC 3P4MB 5HJ3B 5FYLH 2DMKA 4U1GC 4X7TA 5JHLL 5HYJB 3BZEB 3WL9A 1RD6A 5EPMA 5I75C 4FQXC 3OQ3B 1A7QL 1J12A 1EO5A 4JQIH 1U93A 4ZAKA 3PUCA 5EB9A 1SJHA 3PHOB 1AP2B 1N5YL 5ACMA 1VACB 3NZ8B 3KJ6L 4NRZB 4OZFB 1RVFH 2P47B 3C8HA 2AV7B 3CZJA 3ME0A 5L0QB 1X5LA 3OR6A 4K8RD 2X4OB 1WFOA 3F7RA 2VR9A 1I85A 4HKXA 5TPWL 3T3PF 3W11D 3OR7A 4KU1A 2XT1B 4U3HA 3CH1B 2C1PA 2QHRH 4X4YB 4PRHA 2DLEA 3C2SA 3CVHB 5GQBA 2J8UE 4PJ5D 3HAEG 1ZWIA 1J9CT 1F4YL 1G7MB 1A14L 1OAUL 2BNQB 3OZ9L 4NSKA 4HBQA 3MBED 5DVNA 5F6HI 3ARPA 4DKEL 4Z0XA 4OSUH 4Y1AE 4N0UA 3D3VD 1UA6H 3K2UH 3WMSA 1MAMH 3KLDA 1KJ2L 2FD6L 2OZ4A 2X89D 1ZEAH 3DRTB 1NANI 2FX8H 2G75A 1U8LA 3ZE2E 5GGTL 4ZS6D 1SBSH 3PWVA 1BGXL 5JUEL 1JNLH 1A2YA 3MGAA 5JHDD 4ODSH 1P7KA 4OLZL 5E70A 1A3QA 3CVIL 1IL1A 1QFWL 1EO8H 1J87A 1OARH 1I3UA 4G7YH 4KVCH 5DMIL 4X6EA 1F90L 2ADJA 5JXEA 1JHLH 4UU9B 3AXLA 4YAQA 5FGRA 4GKNB 1T1ZA 3CX5K 4ZTPL 4XHQA 3FOLA 3SDYH 1BJ1J 5SWZE 1KEGH 3DX8A 1B4RA 2EICA 3BXNB 3TCLA 4X4XA 1WFTA 4YHMH 4KKLC 5DLMH 2Y06H 4FQIL 5F9AC 3VWKA 3ZDYF 4J8RA 4OFYD 3QI9C 1TVDA 5DUBB 4NKQB 1KIPA 2D4DA 2WINB 1FZJA 1N64L 1I3RA 4XB7A 1QRND 3VA2C 3ESUF 5J06A 1JE6A 4L5FH 4R2GD 3MODH 3A6OA 5IIEB 4YXLL 3VI3E 4KKCC 1HNGA 3ARDD 5DZNA 1TZGL 3NCMA 4X5WB 1XGYH 4KJQD 5KVDL 2VDLL 4MD4B 4JRXB 5D1ZC 3KLAA 4UTAL 2B1HL 1EPFA 1AGDB 1CGWA 3MNVB 5IT2L 2R0ZL 1WBZB 3RWEB 4JFOB 4LHQB 5EZOL 4LIQH 3QXUA 1NDMA 1BQLH 4NUGH 4Z95L 5IBUB 1X7QB 4X98B 5B38A 1NANH 1Q9WB 2OL3B 4LCIL 3TO4D 3KAAA 5D9SB 4OD3L 4NQSB 2FSEA 3AREB 1DBJH 5JNYA 3VXUE 3RUGE 5E2WH 1IM3B 1FFNB 2D0FA 5FYJL 1XF2B 2MCPL 4XPHL 4LP5A 1R5IA 1JV5B 2GCYA 4X6DA 1GRWA 1OGTA 3QFJD 5D6CB 5K9OB 1P1ZB 2CGRH 5E9DA 3LS4L 4X9FA 2OR9L 4HS3A 3RWIB 1HWGB 4DKFL 3QEGH 3P73B 1LWRA 4JRYD 2DRUA 3GKWH 3W0WA 2XG4A 2Q7YB 1MQKL 1F58L 5D8JL 5CJ8A 1R3IH 3M8OL 3LN5A 4RGNE 3RJDA 4U49A 4PRDA 1P4LB 4FP8H 2HVJB 4Y8DC 2R8SH 2DICA 2X4TA 3QEQD 1ZT4B 2V9RA 3BZ4A 4JPKL 3T0EB 1DBMH 2VXQH 4GG8A 5LG1A 4L4VD 3BD5A 5TDNB 3GKZA 4DEPC 3Q6GL 4JDTH 5EU4B 1OCWL 3VMPA 5HHOD 1C5CH 3HFML 3ULUH 2YSSA 2AK4B 3DI2B 4WW2A 4UDTB 4G80B 1CG9A 5E94A 4GRLA 2YPLB 5DMGD 1XH3A 3TV3L 2HWZH 3DARA 4NM4L 3JWDL 4LASL 5HTSA 4DZBA 1K5NB 4P9ML 4OZ4B 2BHYA 5JIIA 3EDDA 4JFED 4KI1A 3IFPA 3B2UD 4TUOA 3QPXL 4H20L 2H32H 4AH2A 2HG5A 5I1AA 1E4WL 3RPIB 4JAMB 3HZMA 1VFUA 4N8VG 5CBAB 5KVGL 2CSPA 3IB4A 5EORH 1VFAA 3P40A 3QA3A 1LDPL 2QSQA 4DGVH 1G1YA 3B9VA 1RJLA 5DJ6B 3MR9A 5GGQL 5EC1B 1A7PH 3MNWA 1GJIA 3P9LB 3F58H 3QWRA 5TH2A 4Y16B 2HFEA 5T1LD 1FORL 3TESA 2DQTH 3TNNB 2DJUA 4U7KA 1FZKA 4O00A 5C07A 3PWPB 5HDBE 4XNQB 2R1YA 4XC3L 4QNPE 4G9FA 1SYSA 4HWBH 4KJPD 1CGYA 4I8DA 1CDGA 5FGCE 3SQBA 2FIKA 4PGCB 4X6FB 3WIHA 5IFAH 4UAOB 3OAYK 1T89A 2ICWA 1SEQL 4Y0GA 1LD9B 2NLJA 3BKCH 3R0NA 3VD4A 2DQCL 5FHAH 1A4KB 2DQIL 2V5MA 4XNXL 1BBDL 2EC9U 1K4CB 1LK3H 4GT7A 1WAAA 2DLFL 4MNHA 5E7BA 5FA3B 4PJ7B 2ED7A 1TVBB 3SKMB 3KPMA 2VAAB 4LLVA 3WEXA 1T21B 2XTJB 4NQEA 4PRBB 1KSRA 1TQCB 1DL7H 2NY6D 2EE3A 3UZEA 3KYKH 2PCPB 3O8XB 3VXMA 2XWTB 1U3YA 5DRXA 3O9WD 4PYHA 1QVOA 3ZSSA 5DT1L 3W5MA 4PJXE 2C9AA 3E2HC 1CF8L 4JREB 2D3VA 4KQ4H 2E7CA 1VENA 1KN4L 1MCRA 4KXZI 2LU4A 1NCNA 1DN2A 2J6EA 5EOCH 4PLKD 1G6RB 3CFEA 4XNMB 1GPOL 4P2QE 1VGEH 1N8ZA 4J3UA 1N26A 3TNMA 4DW2H 1LO4L 2Q8BL 5L88L 5AWNL 5IFJA 4OZIB 1FAIH 4ODTL 4RFOL 2HFGL 2QSCH 3QHFH 2FZ3B 3DURA 4PJDA 5DFVC 5KVEL 4G3YH 4AEFA 3OB8A 4XNZB 5L7XL 5E8OA 1RZKH 3TFKC 1F4AA 2JF1A 1E27A 3SJVB 1QLEL 1YNKL 4NWTH 3ARVA 2YD9A 3QUKB 1GAFL 3BN9C 4ZFGL 3I75B 3GBNL 1J10A 3NN8B 1MVUB 3N1MC 1NJ9B 5GRJL 1ACYL 1AXSA 2N4IA 4FQ2L 1AFVH 2CRIA 3FT4A 3QWOB 3OHXA 2CMRL 3ZO0A 1A4JA 5B21A 3LZFH 1YMHA 4ESKA 4RWHA 1FCCA 4Y4FB 4PRAB 4CVUA 4UT9L 2APBA 3PJSB 2NNAB 3V52H 4HKJB 5T33L 1CU4H 4ZNCD 2XWBB 1UWGL 4F33A 3VWJB 3LKPB 1Y6KR 3SCMC 3L3KB 3VRLF 2F15A 2IPTL 4EOWL 3WN5C 4YO0B 1JUFA 1F5WA 2HA1A 2B8OT 1OAZH 4PJ7F 1JNJA 5L2JA 4XPAH 2F53A 1HCFX 5JXAH 1JWSA 2PXYA 4PP2A 43CAA 4ELMA 4JO2L 1QSFB 4RIRA 3U0TA 5IMLB 4NJ9L 1NEZG 1GZQB 3QUMA 2YMXL 2CDGA 1OF2A 3BDXA 4TNVF 4K94L 5CJQH 2DWDA 4N5ED 1W72A 2GI7A 4LPYA 2EEBA 4KXZH 5FAAA 3X13B 2D0GA 2E9JA 5EBWA 2ITCA 4R4FH 3EYOA 3OKDA 3MUY1 5C71A 5E1HB 1BJ1H 1MLBB 5GS0L 1HILB 1S3KH 4LGSB 2YN5A 4OUOA 5M94B 4XCFL 1NGZB 1U2CA 1NUGA 1AQDA 1QFUL 5D72L 5GHWL 1NLDH 3D2UA 1FJ1A 1WZKA 5DYOB 4YDLC 5IROC 1CCZA 1T0MB 3IDXL 1N59B 3ULVH 4R26H 1URLA 3L3DA 3MLSL 4FQHB 1O7VA 4H8WH 1Q0XH 4JN1L 1QBLH 4BQ8A 3WSQL 3VXUB 4I0PC 3RUGB 3TYFA 4OZIF 4HWZB 4IIQB 3WHE1 2XN9E 1RUPL 4WU5B 4P2RB 1HHGA 5E6IC 3V8CA 4DVRL 4MNQA 2YWYA 3O3DB 1KC5H 3L5HA 2Z92A 3WXVH 2W0FA 5C0IB 1BQSA 2VSDA 3UTSB 3GMLB 2VL5B 1QO3A 3I6LD 2FJGA 4KMQA 3TH4T 5C7XL 5IB2B 4FFYL 4APQA 2VDML 2DQDL 4DZ8A 2YOCA 4LLYA 1VCAA 1NSNH 2IFGA 2UZIL 5D1ZA 4Z7OF 1MAJA 4PJHE 2PO6D 4P23A 3NZHL 4LCWE 1K8DA 1IAKB 1FG2B 2OR8A 4JGMA 4Y4KB 3GMRB 4YX2L 3B3IB 2EO1A 3AS3A 4J7RA 1T1WA 1ZHLA 5C0FA 5EO1B 4GS7C 4OLYL 1P4IH 4U1JB 4HUKB 1BHGA 4XCEA 3CC5A 4IRSD 4LCUB 3H3KA 4HPYL 4MCYB 4U6YA 2IADA 3U9UB 3VXSA 1OGAB 1ZLUH 4OCRL 5INCA 2NY2D 4TVPH 5ESVB 1JHTA 5HI3D 1WQVT 2AQ2A 5CZXD 3LIZH 1ORQB 4N68A 4LHUG 2DIAA 3BDBA 1FSKC 1WICA 4CNIB 3MYJB 2VLKD 4QY8A 3BDYL 5JO5A 4M5ZL 2WLZA 3CFCH 1UB5B 2P1YA 5DHYB 5K93A 3HR5B 1GGCL 1CZ8H 2AV1B 3U6RB 4ZOBA 4LSRH 4P4KA 1BQHA 3RGVA 1QSVA 4HXAL 2XRAL 5BS0E 4MB4A 4D9RE 3ZKXC 1TZHB 5DHVH 1QLFA 2X40A 4XX1E 5IB5A 3DVGB 3QUZC 1JGUH 3L5WB 1IEBB 1U58B 1UM6H 4CVXB 2HFFB 1I1YA 2BNRA 4QGYA 5GRUH 3BW9A 3NBNA 1BLNB 1DQML 2JJTA 3VD9A 3L3IA 2ORBL 3BYTA 4H88H 5HPOA 5IQ9A 1JNNL 4JFZH 5GZNC 4Y88A 1RZJC 2OR7A 2VXSH 4PG2C 4H5SA 5LCVH 3M17A 4MSWB 4QHLB 4XZUA 2Y1VA 1HIMH 3G5ZA 2LU3A 3SDXE 1S7RB 3B5TA 4YFDB 3VXQB 4LSDA 4JZJB 3MUGA 4JG0L 3GSXA 3RX8A 4PR5B 3FO1B 4P2OD 1U3HA 3V5HB 2EIDA 1YY9C 4KI5D 4F7TA 4MJ6A 2BC4A 3L7EB 4GRWH 1QPXA 4M7LL 3KPRE 3QSKB 4BELD 5DRWA 5C0NC 5T5FL 1V8HA 2FECL 3KHQA 3KPTA 1EEZB 4I4WB 3U4BH 4F9PC 2J4WH 1FN4B 5DMYA 2FWOA 3LB6D 2CIIB 5DK3A 1YEHH 2ATPB 5KSBE 4L3AA 5GGUA 4HCRA 2Q6WB 4YQXL 4J3TA 3CUPA 4OB5H 1F00I 1LE9A 1RUQL 2B5IC 3ROOA 4YWGH 5A40E 2BFVL 5C0BA 3MCKB 3KPPA 5SWSB 3VH8B 2G60H 2EDOA 4J3VA 2ADFL 3REWA 1N7ML 1YYLL 2DQJH 4JO3H 3CVHL 2H6PB 1CICC 1HXYA 3MFGB 3QXDA 4Y5VA 4KC3B 3ZT6A 2LU7A 4JN2A 4S1DC 3UBXB 4LEXL 2ZOKA 3ZKQD 4JJHA 3WUZA 1EMTH 5E24E 1FL5A 1UZ6F 2FNBA 2CIKB 2ZJSL 4CGTA 4U1MA 2XPGB 5J3HD 3KG5A 2DF3A 3ZHDA 5F72S 1R3HB 2FH6A 4JDZA 1MH5B 3NA9H 4OGXH 1JGLL 4ALAL 4GKSB 5T3XE 3UTTD 1DDHA 3MMEB 4YR6A 4PREA 3VFSA 1CD9B 3MQIA 2X4SB 5HHQA 3CZFB 3V5KA 5IVZB 1JYNA 3DX6A 2DIJA 4G43A 5IB4B 3KHOA 1KCSL 3NACH 3EAKA 4U1LA 2JE8A 3E6FA 1ND0B 4X6BA 1DBBH 5CIPA 2E8YA 3JZ7A 4PJ8A 5FXCH 5ETUB 3RVWD 2ARJB 1DUZB 4QTHB 3TJHD 2I25N 4ZDHA 3UTPE 3HKFA 3ZSTA 1K8IA 2C3GA 4NZTL 3I6KB 4NBZB 1UM5L 4NHCL 1TITA 3G6DH 3BH8B 2Y9RT 3Q48A 2Y07H 3VXRD 3GJFB 2ATKB 4WTWA 4KUCF 4WEMB 1QNZH 3QIBB 3K80A 1KELH 3FFCB 5HYSB 2DB8A 3V2AR 5KZCD 4NZJA 1FLRL 5F9OH 1MRDL 1MHEA 4HK0A 4OCYL 4TN9A 3GMPB 1UWEH 5C08E 3T2NL 1EEYB 3BIKB 3FQRA 3EUUA 4OF6A 2I9TA 3OKLB 4PLNC 3RHWF 4GOSA 4RGMC 3OAYH 1L0XA 4C57C 3DUSA 1C8PA 4XC1H 3ZHLA 4YFEA 1NDGA 1QTYT 3FQTB 3OXRA 4PTTB 4WEBH 4XMLL 5JW3L 1TDQA 4Z0BL 3BX7C 4NRXA 4P46C 4OLWL 4GXVL 4QRPD 3ARGB 2R0KH 4I77L 4HQQH 2BOCB 5MHSE 4XPFL 2YWZA 3ARYA 5L2KE 4LRNL 3FCTB 4WGVB 2DN7A 5J6GA 5TE7H 1TENA 2P8PB 2AJZB 4JZNA 4OLEA 1CICD 3B5GA 1JGDA 3OX8B 1K4DB 1W8NA 1I1FA 5HXMA 1D6EB 5DDHB 2FEDC 2VDNL 3VXNA 3X11A 2F5BH 4OZHA 3U2SB 4IDLA 3SDDA 7FABH 5J1SC 1VDGA 1MCBA 2HAZA 4XVUC 3HAEH 1N2RB 2GJ6D 4YDIL 2YD3A 3ZYZA 1EO7A 3NIGE 2HKFH 4YGVB 4FFZL 1Y18A 1A6TA 1D6VL 4HF5L 5JW4M 2IAND 3KXFE 4LARL 2WZPD 4D9QE 4IRJB 1ACZA 1EVTC 3K3QA 1GGIL 4QRRE 2M26A 5J9PB 2GK0A 4P5TC 2NY0C 1C7SA 2DYPA 3DRQA 2C1OA 3E8UH 2IQAB 4NNXB 3VW3L 2IPUG 2R56H 1HDMA 4JFPB 2PNDA 2CLRA 2F54A 3SHSA 3EYUL 4PJCE 2AJUL 4ZAKD 3GMOA 4PJHB 1ZGLB 5EU6E 1HXMB 2VQ1A 4HMDA 4M61B 3QJFA 5C0DB 2WBJB 3ROLA 3JTSB 4U1KB 1EXUA 3QIWC 4U0RB 1QBMH 1E4XL 3AB0C 4I3GA 3HE7C 4W6WB 3SDCA 3LEXA 5DJCB 2FGWL 5DJYB 4S1SL 4NPYA 3MRLA 4PRHD 3O2VH 2O61B 2A9MH 3SKOA 2F19L 1QR4A 1ZT1A 4Z7WB 4ONGL 2HLAB 4JY4A 2C7UB 3TBWB 4ZUTA 5E6IA 1XCQB 4XBEL 1EDQA 1EJOH 4MB3A 5FYKU 2D0HA 1HHIA 5D7KD 3WLWC 1I7RA 1MNUL 1JRHI 3V6ZA 2EH7L 5DUPL 5DQJA 4PJ5E 3B4NA 35C8H 2BVPA 1J1OH 3MRIB 4TUKH 3KWWB 4FQLL 3QEUB 5HBBA 3LKOA 4RFEA 4D0BB 4BQ6A 1VPOH 4WI3A 5DMJB 3GUTB 3EDKA 2XZCL 3D3VE 2F74B 1U8NB 1BWWA 4L9LA 1HZHL 1I3GH 3QRFM 3AM8A 5IV2A 1DJSA 4K3EL 1MFDL 5DEFA 4EN3A 4KUZH 4IS6A 1XIWC 4KRPC 5JXED 2B4CL 1A6PA 2NY5L 5F3BA 5JDJA 3QQ4A 1INQA 3WD5H 2I07B 1SBBA 1CE6B 2V9TA 5JHDE 1S7XA 1UJ3C 1BIHA 3HPLB 4L3EA 5I73B 1EAPA 2EDKA 3HLAA 2OP4L 2R9HC 4I48B 3VWKD 1EBAA 3OJMB 3ARZA 1JFQL 3EIFA 5GRZA 1SM3L 4OAWB 1FO0H 3KPRB 1DZBA 4RAHA 5EIIB 1S7UA 2VLJA 3JWOC 4PUBL 4GW4A 5ALCH 3HI1A 3CSYB 2LQRA 3QDHA 4JLRA 2GEEA 3GMMA 3HUJF 2NPLX 4LVHB 3GSQB 3TVMA 1JI1A 1D5IH 4KKNA 3MLXH 2XXCB 5D93C 1BIIB 4JR9H 2V7HB 1MFCH 5T1DL 3C60A 2H2PC 5FF6B 4R96A 3MRDB 4WWKB 3LAFA 2ENYA 2VDQL 1QRNE 1QYGL 3QIUC 5CEZD 4Z7WF 5DA0B 4B53A 4LSVL 4LKXB 3BESR 4PJEF 2C4FT 1IC5L 1G6RL 1JRHH 4MA3A 4L4TA 1OSZB 4AT6B 3WUWG 4PGZA 5J89A 3K1KC 3UYOD 4P0DA 1D9KD 5MENA 4KK8C 2A9NH 5I8KL 1RY7B 4POZD 2FB4H 3UTZA 1TETL 1HNFA 3RTQC 2XA8H 5KSAB 3UPAA 1K6QL 2BSED 4K7FB 3KR3H 1A6VH 3IFLL 5BOZG 4Y89A 5DFTA 4LEOB 4OIAA 2GITA 5TDOB 3T4AB 1KTRL 3OKMA 4PJBA 1ZVHA 1C08B 5D7JA 1KFAL 5I8EA 4PTUA 4P99A 2GTZA 5KSVA 4HXBL 1OTSC 4F9PA 3BPOC 4JFHD 3STZB 4NO2B 1P5UA 2GSIA 1UZ8B 4HJ0D 1CXEA 4R4NC 4XP5L 5D7IB 1F42A 4QF1B 4RSVA 3F5WB 4GAFB 3MC0A 2VLRB 4KZDH 2W1NA 3C6LC 3CGTA 3QFJE 4XP1H 5IEHB 4B50A 4U6XA 3WIFA 4HSQA 4LBEB 1KYOJ 3P0YH 3HB3D 2Z9TA 3E1F1 5IP4A 5BO1H 1UENA 1QEWB 3ALPA 1NAMH 3L3GA 1R5VB 4U33A 4HULB 2UWEB 2W92A 1BJ8A 1UCTA 1LO5A 4JRYE 3RZCC 1WEJH 4WDIA 1OSPH 4KDVA 3EJZD 1I7UA 5D7SL 3V7MA 5GS1B 2OCFD 2QLVB 1I75A 1V3MA 4UINL 3TBYB 2CDEA 2Q86A 3I9GL 2P46B 4MMZC 2ZOLB 4JB9L 3IGAA 4UV7H 3P4NA 4RA0C 1IGYB 5DJDB 3R0MA 3DX9A 1TQBC 3O2WL 4WU7A 1IC7H 4HEME 2HMIC 1UJTA 4PJFB 5DEGB 4GRLD 2CDFB 1X5GA 3QEQE 2R2HA 4JM4L 3IDGB 4BM7A 4JCLA 4G8GA 3T2OA 4PY7A 1UG9A 2EO9A 2NZ9D 3WKMH 1DVFC 4L4VE 3DTXA 4N0FA 3V95A 5JOFA 2FX7L 1M4KA 2H1PL 2M1KA 3RY6C 4NZDA 1OLZA 4RNRA 5GISL 2VISB 5C0EB 2E7LC 5HHOE 4HUVA 1ZSDB 3O11B 4OQTA 3CDYA 1JF1B 1M7XA 4JANB 2Z91B 4LLWA 3R1GL 4U1NB 4RAVA 3LN9A 2HN7A 1XF5B 4PB9H 5E5UB 4ORZC 2JJUA 1MJ8L 3LDBB 4OIIL 4XCNA 3MRRA 1CIUA 4DTGH 5BZWB 2VIRA 4LLDA 4M02A 3DMMC 3QWRD 4JFEE 1UQSA 1E28A 4HUWA 3MJ7B 4OCMC 5ABDE 2BVQB 3HC3L 1JHKL 4V1DD 5C07D 3RTQD 5J13B 1HHKA 3B2VH 3AY4A 2R0WL 3LQZB 3STBA 3WNPA 3ULSB 4L8CA 4G9FD 4WHTA 4YK4B 4M9PA 5C86A 1T3FA 2ESVB 5FOJA 1EBPA 1BF2A 5A2LH 5ILTL 3O3UN 3MV9A 1NC2A 4OZGE 5C8JB 1LEKA 4LLUB 5D7IF 3UC0L 4MAYB 1RZJH 3P77B 3KPOA 3QPQD 4IMLA 1JGEA 2C3VB 3A6BH 4NNYB 5HD8D 4P46A 3UAJD 5HGBB 1JIBA 4OI9A 4S1RL 4NQED 2I5YL 2UWEF 4KGLA 1T5WA 4AG4L 5IR1B 5EU6B 3D39B 3AAZA 2PETA 1U8QA 2DIBA 3QQ3A 1G9NL 2HLFD 1DQDH 4KMTL 3BKMH 1F4XH 1IKNA 3PQYA 1R6VA 1H9VA 5DQDH 2KH2B 4XHJD 5B8CB 4K71C 5HVHB 3QDAA 2MPAH 2NX5A 1H5BA 5F89A 5IFHH 1VEOA 2JELL 3MROA 3A67L 3QO0B 4PJIA 3MRBA 4ZYKA 2MQCA 5I1CL 4G6ML 1QKZL 4XVJL 1MCIA 4M7KL 1BOYA 3F65A 1AE6H 1C12B 4E5XB 1FLTX 1GYAA 3RL2B 3M1BA 3IU3B 5CJOH 4ODXB 1JWUB 1LVEA 4LNVA 1AKJB 2NY1D 4ACPA 4P5MB 2W60B 2SEBA 4NWUL 5ALBH 3CSGA 5I1EL 2WP3O 1H3TA 4O2FA 4X5XB 4Z7UA 4URTB 1NFIB 1DQJA 3MBEB 4RWYH 4KK5C 4PRNA 4ISVB 2O5ZH 1A1MA 3CXDH 4WJ5B 3SY0A 1INEL 1LK2A 5F7YC 4F37F 3JV6B 3NFSH 4Z7VF 3EO1A 4R90L 4KJWC 5CJ5A 4X8JB 2OX5A 5FKPB 2G2RA 3AFLA 2CK0L 1I8IB 3QIWA 2RJMA 4L29B 1CFVH 4L3CB 4Y8AA 1Z9MA 3RKDC 3DSFH 1MIMH 3L6FA 4Z76A 3EO0A 4X9IA 4G6KL 3S8WA 4OQTH 2NY3D 4X0KB 3L1OL 5IK3B 2VXTH 4CJ0A 5DRNB 3RWCB 4MYWB 3F6LA 3NAAL 3MV8B 3S88L 4GW5A 3I02B 3P30L 4R9HA 3KYMA 3QXAA 3QCVL 1T7VA 2A6JB 2FIRT 4DJMA 5CCKH 2G9HA 2F53D 1MJ7H 1S7VA 3VDAA 3V4UH 2FHBA 4JPIA 4EI5A 1KB9J 4I18C 2YN3A 4NOFA 4OZFG 4K3GA 5I66B 1F6AA 1ZTXL 5E8DH 4KWUA 2FX9L 3GIZH 4ZUWB 1FZOB 1ZANL 4YXKL 4PV8B 2A6DB 1HYSC 5CJBA 3ZL4H 3H9HB 4GAJL 5IW1B 3IU4H 3VE0B 3QDMA 2IGFL 2ICEA 5J1AA 2V2WB 3MO1A 5BMFL 2JJSC 4U1GB 5EU5A 2JCCE 4UIMB 1KPVB 1RZ8A 4Y5XA 4YHIB 2BVOA 5ERWA 1CE1H 3VGAC 1MUJA 4ENED 4I5BA 3D2UD 5I75B 4OCSL 3QAZC 3TCXA 4FQJL 4AK1A 4FQXB 4EBQL 1FH5L 3BRFA 5GGTA 4U6HB 4R2GB 4FXGB 1BVLB 1KB5B 1UFUA 2OMBA 5GS0C 1F4WH 3KVQA 1KN2L 5FIEA 2VWEE 2GUOB 4Y4HC 1WUNT 2C3XA 3ARDB 4F9LA 3FB5B 2AK1H 4KY1H 2QQKH 4IDJH 5F7FA 1MOEA 5IGXL 4UT6L 1I3VA 5AEAA 1MCLA 4EKXA 4F7CA 3QHZH 3S4SG 4NT6B 3VG9C 4KRLB 5KVMC 1IAIL 4GW1B 4HDIB 2ADGB 4HGWB 3PL6A 2XY1A 3GMNA 3PP4H 3BP6A 3TO4B 1D5XA 2ILLA 2IALB 5E8NB 1WTGT 4LP4A 3LRSB 5DS8B 1GVIA 5HVGB 3HNSL 4E0RA 2UV3A 5E0QA 3ULVF 1I9JL 1CR9H 4APQD 2EIZB 1U8PA 3HE6A 4X4ME 2Z31A 1OPGH 1TNMA 3QFJB 2W59A 1SYVA 5E1AB 4BZ1L 2GJZA 4OCWH 3FONB 4P23D 1WVZA 1IGML 3RL1A 4F3FB 4PGDA 1P7QB 3T4YB 3K4AA 2X42A 1PYWB 5E8EA 1W0WA 2QL1A 3QCUL 1QFOA 2MJWA 1GCFA 2P5WB 3I6LE 4OTXH 5FKAB 1BECA 2DBJA 1RURH 1YEIL 2X4PA 3BKYH 4OM1H 1T7XA 1T1YA 3U1SL 1CVSC 4UIKL 2XQYG 2XKUA 5FYLL 1U8MA 5JQ6L 1X4YA 2V5SA 1Z9OA 2BDNL 2FJHB 1JK8A 4KVNL 3QEQB 3VXSD 1U8OA 3NCJL 5F9WC 4GRWB 5AD0B 4NOBA 1A7QH 2P8LB 4UDUA 1T2QH 3BYYA 5C6PB 3QNYB 3MJGX 5I1JH 5CD3A 1EFQA 3BGMA 3QQ9D 3S3SA 3WYRA 3CDGB 1WFUA 4ONFL 5IBUG 3VFWA 2R2BA 4IHOA 4P4KD 3VFUA 3QI9B 3RGVD 1G7IA 5TPWH 2EC9T 3BMWA 1PZ5A 4TVSa 2YUVA 5D2LA 3B83A 2GSGA 5CBEA 3EZJB 3VGHA 2QHRL 1RUAH 1J8KA 2BNRD 3N06B 2ED9A 1F4YH 2P7TB 1OAUH 3OZ9H 4OFVA 5I9QC 3LRGA 3S96A 2YS4A 4Z7QE 3G6JA 3ZKMC 1IBGH 4DKEH 4D8PB 3BP5A 1MELA 2JLLA 1UA6L 4YNYB 3U36B 2LTQB 3K2UL 4Y2DD 3B5HA 1KJ2H 5F7DA 1YYMH 5C9JB 1G7PB 1ZEAL 1NCBL 2ZSVB 5EG6C 4HT1L 4RDQF 2LAAA 1U91B 4OZGB 1TJIH 4HFWB 3C8KA 1BGXH 1U3HD 1Y6MR 2GKIA 3V4PH 3EOYG 1JNLL 5T1LB 1KNOB 4ODSL 4OLZH 5I15H 1ADQA 8FABA 3CVIH 4NQXA 2K7QA 1DFBH 1EA9C 1F2QA 2DAVA 1CS6A 4HX1A 4HWNA 1CDJA 4G7YL 4KVCL 4WTZG 3WS6C 4ZG1A 5DRZA 3IJYB 1F90H 2EDNA 1YN6B 3DXAA 2BOBA 4HIJA 1JHLL 4ZPTB 3TIEA 2ITDB 4QKXB 1SY6L 1IM9A 1AI1H 2UZXB 1INDH 5C0BD 4KI5E 1ZGLP 1ZVSB 3JWOH 4M8QA 3C5ZC 3KPLB 3OJDA 4J4PC 3DMMA 5DLML 1JN6B 3V6FB 1FVEA 3U7AA 3OKKA 3CLEH 3MRKB 4FQIH 4GRWF 2NY6B 1BFOA 4FN0A 1N3NB 1CLOL 4OIBA 4C56B 4G6AD 5FCUH 4HK3J 4ZO7A 3O9WB 1G7HA 4L5FL 4WW1A 1CFBA 2EYSB 3MGOA 1IGJA 4MLIA 2B2XH 4MX7A 4OGAC 3DV4B 1KJ3L 3JUYA 1IKFH 5GIRA 4Y5YA 1XGYL 3QDGA 4LKCA 1ZHBA 1KTLA 2P4AB 3CXHK 3RA7L 3STLA 1AGEA 3BP7B 1C1EH 4BSJA 3PV6B 3TT3L 3EHBC 4E41B 5IT2H 2R0ZH 5A16A 3QEHA 5GZOC 1TVHB 4HC1A 4LIQL 4JPWH 5BW7C 4LVEA 4PJGB 3VFTB 1BQLL 1X4ZA 4M00A 4NUGL 4Z95H 4LCIH 5TE6H 4PJ8D 1V3LA 1DR9A 2V7NB 3L3JA 4OD3H 3UTTE 4LDOB 5A2KH 1DBJL 1HINL 4MCZA 4GQ9H 5E2WL 2VAJA 5FYJH 5HI4C 4WUKH 5ICYB 4G8EB 3BE1H 5BRZA 3FHAA 4KJYB 1Q72L 3HAEB 3HZVB 4QYOA 1G7LB 3NCEB 3HCVA 2CGRL 4TSAH 2A73B 4F7MA 1ZA3B 4WI5A 5BQ7A 2OQJA 3LS4H 2VRAA 3IXTA 4EI6B 5E00A 2NXYD 5EUOA 2XWJA 4ZFZA 5ACZA 4KQ3L 4KMLB 1J0IA 4F2MB 3GKWL 3FQNA 1QA9A 1MQKH 2E3VA 5D8JH 4BQBA 1R3IL 2AERT 3M8OH 4QHMB 2V5YA 1F6LL 2ZCLL 1CFTB 2A83B 4M5YL 1FL6B 1AC6A 4YC2B 5I1KH 5IJKC 4MXVF 4HFUH 3VXRE 1LP9F 2N7AA 4X80L 3QYCA 4HHAA 4JPKH 1DBML 2EYRB 2VXQL 2ZUYA 3GSWA 4PGEA 3QG6A 5FYKD 2JCCB 2DBLL 3RIFF 1H8SA 1SEBA 4MDIB 5D5ME 1AR1C 2CXGA 2J3SA 3Q6GH 4A2MA 4JDTL 4YLQT 1OCWH 1C5CL 5I19L 3ULUL 3VCLA 1JJUA 32C2B 3L7FB 3RVTC 1R5WB 2A74A 4AEIH 3BH9A 4KKAD 4R0LC 2AXFB 4XMKH 4OGYH 4BUGA 5C70A 4YPGA 5C0AA 5L8LB 3UJJH 2MTPA 2CRZA 4MXQC 1T22A 7CGTA 5CSGA 5HHPB 1VGKA 3TV3H 3UDWC 2HWZL 5FECB 1QRKA 4NM4H 3SDDD 4Z6AT 4QRPE 4YDVB 3LHPL 3O6MH 2AGJH 1EEQA 4KRMB 3FRPG 4RMQA 1KJMB 3E2HB 4OM0L 4WTXA 1U95B 2JJWA 1I7TB 2O93L 4UILL 2VOTA 4Q2ZA 4PJAE 4I18A 4P3DA 5EO9B 1CVRA 5JW4Q 4Q0XL 4Q6YA 1RJYB 3BO8B 5KVGH 4PJGF 5EORL 5JA9A 5D2NE 4XNUH 3WNKA 5D96B 5ANME 5EFIB 3CFDA 1II4E 2DYPD 4FG6C 3W81A 1OP5H 1GXEA 2GJ6E 3BQUC 5GJTL 2CUHA 3ARBA 2F54D 4QCIA 1YC7A 2D7MA 3GK8H 1I1AA 3F58L 5HGGS 3D0VB 3VMNA 4XBGA 2Q7NA 2IANE 2DQTL 5DK0B 1U41A 3CMGA 5L8KB 3V7AE 1X6NA 2FL5B 2J88H 4N9GA 2XQYK 4HWBL 3MYZA 4NKMA 5C92A 2YD6A 3SDCD 3MXVL 5AUMA 1NGQL 2DQCH 5FHAL 3Q5OA 3FO2B 1YQVH 4XNXH 1BBDH 4M1CC 5FM8A 1LK3L 1TPXB 3T1FA 1BZ7B 1JNHB 5IVXB 3PDOA 4NC1E 3T08A 5H35A 3ARFA 1I8LC 3IAQA 1FRGH 4UQ3A 2OSLA 4D2NA 1ZS8A 5I16A 1DL7L 5JMOC 1BZ9B 3SCMB 4JFDA 4R4BB 2E9WA 3IVKA 1NCAL 4ZO9A 5FB8B 4PRHE 5IESL 3HPJA 5FCSH 1HH9B 4IRSB 2ZUWA 2HJLB 3S35L 2D7TH 4LOUC 1NUDA 3CK0L 1IGTA 1S9YB 1SMOA 1DLHA 3LV3B 1M05A 5I0ZA 5ICXB 1KT2A 4P3WA 5D1QC 5ADOH 1QSEA 4KQ4L 1KN4H 5I8CA 4B7IA 4N0UE 1FIEA 1R3KA 3TBTA 5DZLA 3IKCB 3DO7A 5EOCL 4F15C 1DN0B 2VE6A 5FO9B 1XGTA 1GPOH 2FGZA 2AKRB 2VLKB 5D7KE 1C16B 3HZKA 1R3LA 5B4MC 4EVNB 4HBCL 1Z2KA 4EN3D 1S9XA 2GTWB 4BQCA 1FFOB 2Q8BH 2VLLA 4CVZA 5L88H 2ZUQC 3T0WA 2V5TA 1S8DA 3BSZH 4PY8J 1FAIL 3MRFA 4ODTH 1T66D 4FXKA 2QSCL 4YDLB 3S35X 4Y16C 1IEAA 3CMOL 2YPKA 4QXWA 4L3ED 4GKZA 5KVEH 1JVKA 1RZKL 4JHAL 5I1LA 1V5JA 1QLEH 3TBVB 3PHQA 4NWTL 1YNKH 2B4CC 2NY5C 1KXQE 2ZUTA 1OTUD 3GZKA 4ZFGH 4FG6D 5EN2B 4C59B 5JQHC 5BOPA 2VLJD 5GRJH 5EZJA 1ACYH 2UYLB 3VGEA 1KPUB 3QH3B 4N8VB 1YPZA 1XGRB 2YZ1A 4C83A 2CMRH 3O3BB 4AIZB 2J5LB 3OMZA 3GI9H 1FAKT 1H3UA 2JK5B 3QP3A 1XF3A 4Z18A 3LZFL 3TVMD 4CJ1A 5J1TC 3F12B 3TZVA 1BOGB 1NAMB 2DM4A 3DBXB 4P2OB 5J6HB 3MOBH 5LAXB 1VKXA 2NW3B 2AABL 1X9QA 4KDWA 1CDCA 1TQCC 2XNAA 3L95B 5A2JH 3B9KC 3C60D 5INDB 4KK9D 5HGHB 3O8XC 2WBKA 5D1XD 4G42A 3FFDB 5HI5D 5IVXF 4P2YA 5LGHL 1OAZL 1KLGA 4L4TD 4OBSA 2WIIA 3O45A 1EUTA 4YHNB 4JO2H 3Q6FA 4NJ9H 4JKMA 5MEND 4JFYA 4JREC 3C6SB 3VFNA 5CJQL 3WCYA 4IOFC 2L7JA 3PWJA 4TQEL 5DJ0A 1T4KB 4R4FL 5GS0H 1NGWA 2ZPKL 5EBMA 5IB1A 3NCBB 5D7JD 5C0CA 1QFUH 4R3SB 3BJLA 1XAUA 5GHWH 3GMQA 5LBSH 3BGAA 3ULVL 4R26L 4XNZC 2VB5A 1RIHH 3MLSH 1FSKB 3H7BB 4H8WL 1Q0XL 4JN1H 1QBLL 3RNQA 4X6DE 3B9DA 4MHHG 2MFNA 3VJ6A 3TH3T 5E9DE 4JKLA 4MQTB 1YUHB 3ZE0E 1AP2A 4PRIB 3RPKA 5FO8B 4TOYH 1VACA 4NRZA 2W91A 1L9MA 3W0WE 2LFGA 2AV7A 3QUZB 4JFHE 3QT2A 4W81A 1KC5L 2X4QA 4BH8B 4TTGA 1Q9OB 2OMNA 2QJDA 5C9KA 2BVYA 4OKDA 4Y4FC 4NCC2 4X4YA 2H26B 3CVHA 3QUYC 1EUUA 3VWJC 1G7MA 3QNZB 1FC1A 1T6VN 2Z93B 2BNQA 4G8GD 2VDMH 2EEAA 4FXLA 5E6ZA 5F97E 1D5BB 3GBLA 4M4RA 1NSNL 4QXUL 1R3JA 3ZE1F 1S7TB 1XZ0A 3NZHH 5E03A 3TT1H 3P4OB 3OPZH 5KZCB 3G04B 5EU3B 3DRTA 1O5DT 1AIFB 1Z0NA 4ZOAA 2PTUA 3EDEA 4XB8A 4BJLA 3V0AC 1YN7B 4M3KB 2FECI 2YUWA 1P4IL 3IDMB 1KB5L 3JXAA 4NNPL 4CW1B 5B39B 5CAYB 4N1CA 4HPYH 3RWFB 5TQ2L 1MCNA 4H1LG 4DGYL 3HC0B 3D85D 4TVPL 1MFAH 3VFGH 1L7TL 4D0CA 1TJHH 3T3ME 3GGWA 2GAZB 1PKQB 2VITB 4UU9A 1A1NA 1R24B 1G84A 4GKNA 4TSBH 1CICB 2GJJA 1NEZB 4M5ZH 1BFVL 1CZ8L 1GGCH 4W6XB 4IIQC 3MV9D 1NC2D 5L9DL 3BXNA 1XEDA 2XRAH 4HXAH 3WFCH 1MWAB 3ILPB 5D2NB 5AZ2H 3KLHD 3MJ6A 4F57H 3O6FC 2HTKD 1JGUL 1UM6L 2ICCA 5C07E 4MD0A 2BJMH 2WINA 4NQVB 4M03A 3CDCA 4EEEA 1DQMH 2I27N 4G9FE 4WGWB 2IANB 2WV3A 3AS1A 4H88L 1N6QH 2W0LA 1JNNH 4JFZL 1XT5A 3SQOL 5IEKB 4ZXBC 4KDTA 4RGNC 4FQCL 1VADB 3PV7A 4X5WA 5FDYA 5LXGL 5LCVL 3LQAL 1WAAE 4JQVA 1HIML 1N4XL 2NX5D 2RFXB 3V0VA 3OKNA 2X1XR 4DK6A 1G7QB 3HC4L 5KN5B 4A6YH 1AGDA 3VGGA 5K9QG 3MNVA 4NM8L 3FN9A 1WBZA 1G9NC 4H26B 4ZAKB 4PY8I 4JFOA 3RWEA 1SJHB 4NQEE 3TBSB 1KIQB 3U7YL 2XYCA 4X98A 1KLUA 1NMAL 4M7LH 2OL3A 4M8VA 4NO0D 1ZE3C 3VXME 5D9SA 4NQSA 5T5FH 3AREA 1RUMH 4YDJB 1FYTA 3TN0C 4NGHL 2J4WL 2DTSA 1FFNA 1JMZA 1XF2A 3SOBH 2EKSB 4OZFH 4J3WA 1JV5A 3CIQA 2C1PB 5D6CA 4DUXA 4YQXH 1SMAA 1RUQH 3FQWB 1QBAA 2BFVH 43C9B 1LE5B 2X1QA 4YHLL 2G60L 3RWDA 4LF3B 4NO5A 3UX9B 5GGRY 2ADFH 1OW0A 1N7MH 1YYLH 1J7VR 2IF7A 4RGMB 4Z0XB 3WLBA 2Q7YA 2GHWB 2YHGA 2XQBH 2CO7B 1CDUA 4X99B 2CKBH 1JI2A 5DSCB 1P4LA 5HGDA 2HVJA 4PJDE 1HH6B 4UBDC 3T1WA 1J18A 1XGPB 3RDTA 1OT2A 4LLAA 3T0EA 4K2UH 1UGNA 3NA9L 1A2YB 2VABA 1JGLH 4U0QB 4O2CB 3L5XL 3DX7B 2BRRL 5DA4A 1IL1B 5TF1H 3SKJH 5EU4A 2HKHL 4IEFB 2NXZD 5C09A 4ODVL 5TGBA 2VUYA 3HTLX 2AK4A 5IM7B 4X6EB 1KIRA 1T1XA 3O6FD 4UDTA 2ADJB 4EI5D 1FGNH 5IHZA 3NACL 5E2VL 1OAYH 2YPLA 4YAQB 4JZJC 3GRWA 1I9EA 1OD9A 2NZIA 3UZVB 4I13B 4OZ4A 3DX8B 3RI5K 3O3AB 3O2DH 4NZTH 3QDMD 2D7NA 1XF4B 1UM5H 4NHCH 2F53E 1CGVA 4HLZG 4P5TB 3TP4A 3MX0A 4ELME 2HJKB 4WFGD 4JAMA 1QNZL 2EDWA 5CBAA 5JPNB 5TQ0H 5H2BB 4JKPL 1P7HL 4LK4A 1MHCA 5DJ6A 1MRDH 1E4JA 3LD8C 1UWEL 3T2NH 5EC1A 1U9KA 4K23L 2EXYC 4YBQC 3P9LA 1ROWA 4PP1D 2EDTA 4XC1L 3AB0B 3TNNA 1M6OA 3HE7B 3MLUH 4XMLH 4XX1G 4Z0BH 3MUJA 3PWPA 2FR4B 2FYYB 5TF0A 4OLWH 4GXVH 4LCCC 1QLRB 1RZ7H 2R0KL 3PL6D 4HQQL 4PGCA 4X6FA 2HTLC 4LLMA 4L8DB 1NBZB 3GJEA 1LD9A 4LRNH 4J1UB 2FSEB 1EHLH 4Z8FL 2CXKA 1D9KB 5TE7L 1A4KA 1K4CA 5EOQH 1JF6A 1AGFA 1R5IB 3HE6D 4PJ7A 4G9DB 1BREA 2Z31D 2GCYB 4X6DB 1BQUA 3SKMA 2AJSL 3BPCB 2FCBA 4MNQE 2F5BL 4L1HA 1CL7I 5FHBH 5DJ2A 7FABL 4ZFOB 4EDWL 2PCPA 4YDIH 1CD1B 5I1IH 2XWTA 2EDRA 2HKFL 4GRMA 5I8OL 1JTOA 1YMMA 2ZCHL 1KJ2B 2BZDA 2G5BB 3IS0X 4LARH 1F3JB 5HVFB 1JPST 3D18B 1GGIH 3NPZB 4PJIF 4I2XE 3CPLB 2QQQA 2X4TB 4ZTOL 4KRPB 1XIWB 4LU5L 1G6RA 3VW3H 4XNMA 3RKPA 3V6OA 3EYUH 1XCTB 4JM2C 2AJUH 5IBTH 3GHBH 1UJ3B 5DD1L 2W38A 4ETYA 4LMQE 4OZIA 3NCYP 3MOAH 2FZ3A 1CG9B 5SWQB 3RQ3A 1QBML 3BAEL 3IFNL 1E4XH 1XH3B 3VXSE 5F7EH 3SJVA 5IWLC 1BD2B 1P84J 5K9KB 3HHRB 5ID0B 3QUKA 1MEXH 2A9ML 1I8MB 2F19H 3ARGC 3VGBA 2YA0A 5HDLA 3RVVC 4MXVE 1V7NH 5AAWA 1NJ9A 4G6FD 2AQ3A 3LKQA 4XRCA 4TUOB 1A7RL 5EUKB 3FRUA 3QWOA 2AW2A 3IRPX 5D93B 2HG5B 5TDPA 1EJOL 1Y6NR 2Q20A 4JFFB 3HZMB 3EFFB 4R7DA 4Z77B 3VA6A 2FO4B 3SBWA 1VFAB 1UC6A 4XI5C 5JLZB 4PRAA 1FNEB 1RJLB 4HKJA 2EH7H 5DUPH 3LKPA 3MR9B 2BNRE 1CL7H 3NABL 1J1OL 3L3KA 1NFDF 2Z0BA 5TH2B 3B8SA 1MCSA 4TUKL 4YO0A 4FQLH 2HFEB 3T65A 2UVEA 3LKSA 4D3CL 1GC1L 1UEYA 1NAKH 2CO6B 5IW6A 4V1DB 5C07B 3RTQB 2XZCH 1S78C 1QSFA 5B3JF 3N0PB 5IMLA 2VNCA 1GZQA 4UV4H 1I3GL 4YUEL 3NCFB 4K3EH 4ONHA 5EBLB 1MFDH 1JYWA 5C0JB 4KUZL 3DXAD 2AEWA 2K1MA 2NLJB 2X4RB 2Z8RA 2B4CH 1DSFH 1ZOXA 2K9UA 3GSNA 1Q9LA 3X13A 1IM9D 1HILA 4Y7MA 2DMBA 1QQDB 1NGZA 4O51B 1NUNB 3KPMB 2EC8A 4MNGB 3WEXB 3C6LB 2RAMA 2OP4H 4GAGL 4NQEB 3S6CA 3TO2B 4DFIA 1QFWM 1T0MA 3T8XB 1A9EB 1N59A 4JQXA 1JWMB 1JFQH 4U0RC 1SM3H 1FP5A 5FUCE 4WFFD 5DRXB 3S5LG 1T04B 2DQUH 3Q5YA 5ALCL 1UM4H 2B20A 5C0BE 5IOPB 1FVDB 1MJUL 1CGSH 4QT5A 4BFIB 4Q9RL 4JJ5A 1WCQA 1FNSH 4P2RA 1D5IL 3QDGD 1WV7T 2YRLA 5JDSA 5ECJE 1MY5A 1BWMA 4JR9L 3SGKA 1SVZA 3O6KH 5DEZA 5E2JA 5IVNA 3CFEB 2BP3A 3AMLA 4D0DB 5T1DH 2VKWA 5C0IA 1RPQA 3UTSA 2VDQH 3GMLA 4HUNB 4LPXA 5DURB 2VL5A 4L8SB 3TNMB 3HS0B 4LSVH 3DYMA 1IC5H 5IFJB 1JRHL 4WEUD 3H9SB 2NY1B 4GLRI 2VR5A 3BPLC 1U8JB 4NCC1 2A9NL 5I8KH 2XA8L 1IAKA 1FG2A 1J05A 1K6QH 4Y4KA 3GMRA 2HT3C 3B3IA 5MI0B 4B41A 2FEEI 5T1KA 5EO1A 3KPSD 1KFAH 2XN9D 3FT4B 3MRCA 5F7LB 4U1JA 2PW1B 4YIQB 1AXTL 3DV6B 3UXFA 4NQCA 3W2DH 1A4JB 4LCUA 1T83C 3QJHB 4HWEL 3K7UA 4XP5H 1PG7L 1A1OB 3NIFE 3UPRB 3M07A 5I73C 1OGAA 2BY2A 3MLZL 4NQTA 4KZDL 2NY3B 3MV7B 3BWAB 4XP1L 1XGQB 2EDBA 3I6GA 4MZ3A 4DVBB 4R7NB 1QD0A 4KK6D 5BO1L 4XVSH 3ILQD 3VD3A 1NAML 4CNIA 3FTGB 3CNKA 4BYHA 3MYJA 1X5IA 3IYLW 1WEJL 2OBGA 3CFBB 3GIVB 1GGBL 1UB5A 4PP2B 5D7SH 5DHYA 3MUZ1 2KBGA 2AV1A 2DQFA 1Z3GL 4RIRB 3RWGA 1BP3B 4BZYA 2CDGB 4UOW1 1TZHA 2OJZL 4UV7L 4OD1L 4OJFH 3DVGA 3L5WA 1IC7L 1IEBA 1PG7X 4CVXA 4DN4H 2DQEL 2ITCB 3EYOB 5T5NF 2PTVA 4KROD 1BLNA 1XR8B 4JM4H 4MJ2A 4WWKC 4XXCC 3AMKA 3WO3B 3WKML 4LVNB 5FYKE 4Q9QH 2FX7H 2H1PH 2Y6SD 3REVB 4HAGA 3WNNA 3UMTA 4MSWA 4QHLA 5SV3A 1FFPB 5ESAB 4LPUA 1S7RA 3VXQA 3N1PC 3MFFB 4PB9L 1OP3K 5D6DC 1MJ8H 3TYFB 3FO1A 4HIIA 4OZHE 4QHNB 3V5HA 3EOAB 4QXGH 3TA3C 4L4JA 3ARBD 5CUSH 5A3IC 2K3TA 4D9RD 1I1AD 1K2DB 3ABZA 2ZG2A 4I4WA 1FN4A 4XAWL 2Z92B 4NUJB 5HYQB 2CIIA 1JHKH 4JVUA 2ATPA 5DVLA 4WWID 1FNLA 1LEIB 2Q6WA 3WUWB 5IMOB 4NRYB 2FJGB 2IBZX 2V9QA 1LO2H 3MCKA 2IG2L 5SWSA 1RSFA 3VH8A 4YHKH 2YKLL 5ILTH 1B3JA 5CMAA 2F54E 4I2XB 1U92B 4XWOC 4BQ9A 4WHYG 1RULL 1RZJL 4P23B 5GS1C 2A6IB 2IQ9L 1K8DB 1MFEL 1LGVA 3UBXA 4MHHI 2BCKA 1DE4B 4PJ9A 1K3IA 3NFNA 3ARFD 2IPKA 3IDNB 3FAXA 5CP3A 4S1RH 2CIKA 1VESA 2I5YH 3C5JA 1T1WB 1ZHLB 5C0FB 2XPGA 5DK2A 1WITA 4AG4H 3CFKB 3R06B 4OLUH 3DOSA 1KBGL 3N9GH 1XR9B 1G9NH 4EIGB 3GSUB 4OQ1A 3CC5B 1ZMYA 4GKSA 1FPTH 4S10A 3MMEA 4KTEH 5J7CC 4U6YB 2IADB 3WIIH 3SGEI 3U79A 3VXSB 3CZFA 2E7BA 5IVZA 3X14B 1JHTB 4Z78B 2R0LL 5F6HJ 3OKOA 3H9YA 1QSED 4K3DL 1HHJB 3AU1B 4JCMA 4X9GA 3A67H 4GXUM 5IB4A 4ZUSB 1BVKB 4QY8B 1ND0A 4XVJH 1PEWA 3ZE1E 5C3LD 5GS2D 1F8TL 2R1WB 2ARJA 1DUZA 3RU8H 4QTHA 1JPTH 2KKQA 2Y5TB 3RGVB 3VGAB 4I3RL 5DC0A 3I6KA 4KTYA 1OWWA 3QAZB 5IB5B 2JB5H 4HKZA 2X1WL 5T3ZD 3OWEA 3BUTA 3BH8A 3PNWB 1Q0YH 3HA0A 3UYRL 2H2SC 2QQLH 2BNRB 1MWAL 4Y4HB 4IOIB 3QIBA 5J13C 5I1EH 1N0LA 3FFCA 1Y0LB 5HYSA 2WMPA 2E7HA 3JBG7 1A9BB 3L3IB 2VDOL 1NCTA 2O5ZL 1ZK9A 1OAKL 3CXDL 3RIAF 2EXWD 3VG9B 1NGXB 1INEH 1EEYA 1IAII 4Y2DB 3MJ8B 3PIQB 2AI0L 3OKLA 3M17B 4R90H 2X7LA 2CK0H 4L3EE 3FQTA 6CGTA 4PTTA 3DSFL 3TZVD 2YD8A 2WQ8A 5IWLA 4G6KH 4WO4A 2D9QB 1NCWL 2J8HA 2QEJA 3CU1A 2BOCA 1SJEB 3MLWL 3NAAH 4GAYB 5DRWB 3ZDZF 2VLJE 1YEDA 2J12B 3FCTA 4FFVC 3QCVH 5SV4A 3AUVA 4MDJA 2FWOB 4XH2B 1MJ7L 3OX8A 5HVHC 4XP9L 5GGUB 4U4BA 3DYOA 3SGEH 1D6EA 4EUPG 1ZTXH 2C4FU 3WO4C 2YXMA 2FX9H 4GBXA 2OXGA 3GIZL 2LABA 3KPPB 2Q76B 4X6CB 2P44B 5IUSA 4YHZH 4EQ3A 2XFXB 5C08D 1VA9A 3G5XA 3RVXD 5I76A 1HXYB 2IGFH 2VJXA 3QXDB 4Y5VB 4YGVA 4LFHG 2OI9B 4JN2B 1DLFL 4XTRD 1KOAA 4GUPB 1B0WA 4L4TE 1ZT7B 3H2WA 4K8RC 4LHJB 1CE1L 1L0YA 1ORSB 5C0CD 3G5VB 4IRJA 4KV5E 1CLZH 4KAQL 3W11C 4OCSH 5SX5K 1BX2B 5F8RC 4EBQH 2NYYD 2IWGA 5MENE 5J9PA 4LSPH 3QNXB 3ES6B 4OUUB 4LRIC 1F4WL 2OZ4L 2IQAA 4NNXA 5F70A 5FUOL 2AK1L 4KY1L 2QQKL 4IDJL 2C5DC 1S5IH 3MBEC 5IGXH 4PREB 5HHQB 4PJBE 1ZGLA 3PWLB 3RX5A 4H1LH 3DX6B 1J8HB 5FEBA 1HXMA 1EERB 4M61A 4G43B 1IAIH 5C0DA 2WBJA 3JTSA 3HUJA 4H8WC 4U1KA 4WENB 3VFOA 4O02L 2H2SD 3PP4L 3THMH 4ZS6C 4PJ8B 5DJYA 4O58L 2O61A 1PKOA 3HNSH 4ZDHB 3KXFD 4Z7WA 2BNQD 2HLAA 2YD2A 2C7UA 3T0BA 2QV2A 3TBWA 1OPGL 1IJ9A 4QRRD 5CWSB 4KTDL 5MEPA 4BZ1H 4OCWL 3SE4A 3ET9F 1RAMA 1IGMH 1HHHB 1KXVC 2NXYB 5ITBH 3EFDL 4U05A 3GJFH 1N0XL 4OTXL 3FQRB 5K59E 1RURL 4OM1L 5HYIA 2BRQA 3MRIA 3ELAT 3U1SH 4UIKH 3P2TA 3KWWA 4G8GE 4Q6IC 3QEUA 4FFVD 4F7EB 4A6YB 4D0BA 3MA7B 5JQ6H 1NDGB 3OXRB 2BDNH 4MJ5B 1MCFA 3GUTA 4KVNH 4AM0B 2F74A 5KAQG 1PQZB 3NCJH 4NRXB 1KCLA 3U4EB 5EOCJ 1T2QL 3VU2A 4R2GC 2AXGB 3FOMA 2BY1A 3KLSA 3ZKND 5I1JL 1TZIA 2X70B 5ENWA 3WJLC 5CEZL 3C5ZB 4JHZA 1CI5A 5J6GB 4RAUB 3MGTA 3ARDC 5DMKA 1I4FB 1KACB 5GGSB 1KLFA 2A2QT 4FMKA 1CE6A 4KJQC 4ONFH 2FHFA 4YBLB 2IBZY 3HPLA 4NHUB 1DQLH 3X11B 4OZHB 2UY6A 1MIEL 4MXWL 2D31B 4I48A 1HSAB 5FV2A 5L8JB 1RUAL 2BXYA 4OAWA 1HQRA 2GYSA 3TO4C 4MJ4A 1ZLWK 5EIIA 1YPZF 1HKLL 2IBBA 3N1FC 2IH3A 3VRIB 4ZFOL 4KHTH 2CKBB 4L8BB 1ITCA 1IBGL 3ZMRA 1YQ2A 3CSYA 1UXWB 2OJEB 3OB0K 1BJMA 1JPGA 3MV9E 3IFOB 1I8KB 1V3KA 4MQXD 3GSQA 3RBSA 5DO2D 2GK0B 2JIXB 1BIIA 1YYML 2OYPA 3EDFA 1NCBH 2V7HA 4M7JL 4PD4K 4HT1H 4M1GL 1AGBB 5FF6A 2CLRB 3S4SB 1TJIL 3MRDA 1A8JH 3V4PL 3GMOB 4LKXA 3FJTA 5I15L 4NP4L 3HNTH 3LQAC 4AT6A 3FB6B 3PQYE 3DI3B 1DFBL 1PJ9A 4ZO6A 3ROLB 3ARED 1EXUB 4JY5H 4AQOA 1KEMH 1OOAA 1FYTD 5F8QC 3UTOA 4KKBD 3MRMB 3EYQD 3M45A 2NX5E 5KSAA 2FBOJ 3EO9L 2AP2A 4CBPA 1SY6H 4ZUUA 3SKOB 3HRPA 4OF7A 2F9BT 1AI1L 4XBPA 5CKAA 1INDL 2WUBH 1ZT1B 1CGXA 4M48L 1FYHB 4PJIE 5TDOA 5KJRH 3F6IA 4U1HA 1C08A 1SJXA 2H32A 3JWOL 4HZLA 2YUXA 3MACH 3T0DA 4ZUTB 1OAXL 5E08L 3CLEL 3STZA 4HLZH 4BK4A 1UZ8A 2BY3A 2W07A 3WDIA 5D7IA 1ZHNA 4GG6B 4LSTH 3F5WA 1CLOH 1I7RB 5DMGC 1C5DB 2VLRA 3FMGH 4BSWA 5HY9B 5FCUL 3V6ZB 3LMJL 5DQJB 4PGBB 2F58H 2FLRT 4LBEA 1ERNA 5CGMA 1FNGB 5HHXH 3RDTD 2B2XL 1QEWA 3U9PL 3CAFA 3T0ED 1W2KT 4YFLF 1R5VA 1KJ3H 2UWEA 1A3LL 4Z7UE 1TTFA 1IKFL 3B2UC 4NKDA 2B1AL 4WV1B 4KZEH 3RA7H 4R0LB 1C1EL 3TBYA 4HWBA 3WFBL 4QLRA 2ZOLA 3TT3H 2LTQC 5C09D 3IDJB 1HE7A 3TM6A 5IV2B 5JORB 2AK4D 1IGYA 5DJDA 3WFDH 4HG4K 1ED3B 4JPVH 5H94A 4JPWL 2DDQL 4PJFA 2P8MB 1CT8B 4BFGA 5DEGA 1S7WB 2CDFA 3RX7A 2YPLD 3QQ4B 3QUXA 3LQMA 5TE6L 3WIHL 3IDGA 1GGYA 5CJXA 3NFPB 3L9RA 1HINH 4L3EB 2HH0H 1QSZA 3MZTA 4GQ9L 3MSPA 1WCBA 4WUKL 3RJQB 3HLAB 3NPSC 1N5AB 3BE1L 1P9MA 1Q72H 5C0EA 3T0AA 5F9JB 3TJEL 4IOSD 1ZSDA 4TSAL 4N8PA 4WIQA 1GH7A 4KJPC 1JF1A 4JANA 2NMSA 1CLCA 2Z91A 5EWIH 3BQUB 2VLJB 4HIHA 2VQUA 1XF5A 5GGRA 4KQ3H 1KV3A 1FCGA 5BZWA 2VL4A 4U2ZA 4N1HB 1CQKA 3KNBB 1AD9A 1CTOA 1M7IB 3QDME 3P0VL 4M5YH 2ZCLH 1HKFA 5M7QA 1WT5C 3ZTNH 5I1KL 4U7SA 4Z7VA 3CX5J 2WWMD 4HFUL 4TNVK 2NY6C 4WFGE 4X80H 3PWPD 3LQZA 1E4KC 3QR2A 3ULSA 2EIBA 5D1XB 2J6EL 3O9WC 1DEEA 2ESVA 2DBLH 4PV9B 1T7WA 1LO0L 5I0DA 3JVGA 2EYTB 3X12A 4F58L 2VZ3A 4LLUA 5I19H 4MAYA 4GG6F 2QBWA 4X9HA 4AEIL 1P2CA 2AJVH 4QRSB 4XMKL 4OGYL 4JKKA 3GB7B 5C0GB 3UJJL 4PLKC 3ZDXE 2C3VA 3SPVB 4NNYA 1NCDL 2ADIB 2GFBB 5KS9B 2GITB 2IAMA 2XTJD 4OI8A 3OKMB 3LPFA 2D2OA 5D7JB 2VZOA 4LGPB 4QXTA 5F44A 5IR1A 4LFHD 3LHPH 3O6ML 3D39A 5I8EB 2AGJL 4GMSL 3H3PH 3HMXH 5T3XH 5A1AA 1BAFL 1X44A 1TTGA 3CJJA 4OM0H 1PY9A 1U42A 5D1QB 3OF6A 1YMMD 1MCWM 4UILH 5B8CA 4Q0XH 5F7MC 4F15B 4UOW0 1FL3B 2X4NB 2W65B 1VFMA 4XNUL 3WIFB 1X5YA 4PS4L 4J3XA 1AHWB 4OLXL 4ODUB 3WE6A 2ZUQB 5GJTH 1MI5A 1LO5B 3AGVA 4GH7B 2D7PA 5F21B 3RVUD 1C12A 3GK8L 4XPGL 3RL2A 2BSTA 3IU3A 1B9ZA 1D5MA 5E99L 3MRHB 1JWUA 3INUH 3SGDI 5DUMH 3SDAA 1AKJA 3DETD 2J88L 2QHLA 3DX9B 4D94A 4WU7B 1EFXB 3KYNA 4YC2C 1UADC