1JNHB

Crystal structure of fab-estradiol complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
214
Chain Sequence
EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARYTQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTVTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
molecule tags Immune system
molecule keywords monoclonal anti-estradiol 10G6D6 Fab light chain
total genus 38
structure length 214
sequence length 218
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB02
2NW2A 3Q5TA 2Z8SA 4JQXA 3BE1H 4D0DB 4PB0H 4OIBA 4LCCA 5MERA 3C2SA 2CJUL 4JRXB 1A9EA 1NUDA 1CR9L 5DQJB 1S7TB 5EO1A 4HWEH 2IGFL 1IC5L 3L3HB 4MDIB 4LP5A 4P9MH 5BS0A 3I84A 3X3GH 2VXQL 1NKOA 1O0VA 4OFYA 3RL2B 4XB7A 1VB9A 4HD9A 1MI5A 2R29H 4OLWL 4KROC 1NAML 4JO4H 1XT5A 4NNXB 1L7IH 4ZDHB 1MREL 4E41D 1K4DB 5K59F 1OAQL 3DLQR 1TCMA 43CAB 2WMPA 1IBGH 4KTEL 4A6YB 4ZTOH 3OJDB 1AC0A 5D1ZD 4ONOA 1VGEH 5E08H 4DKEH 3VCLA 5EN2B 5EC2A 2AJXL 3CFCH 1V3JA 5J0BA 4F37F 1KACB 3D39A 2MPAL 4P5TA 3TNMB 3VD5A 2Z92A 5C2BL 3VI3E 4OGXL 4PJ8B 1KJ2B 1E6OH 3CC5A 1MCNA 4X9HA 2W60A 3WNOA 1T22A 1QR1A 4CNIA 4Q2ZB 1DDHB 3H9HA 1KENL 4Y16D 1OM3L 3RVWC 3VDBA 1I3UA 1ADQL 2YPVH 4LOUD 4GMTH 3RGHA 1R3HB 4AG4L 1FNAA 4MJ6A 1ZHLA 3D25B 3VD7A 5HXMA 1LQSR 2Y36L 3L5XH 3G04A 4L8CB 5JOFA 1RHHB 5HHMD 3VXMA 1CFSB 3LQZB 3GB7B 2BSTA 2OYPA 4YGVA 5EU6B 3PJSA 1R5VB 2D0FA 4Y4KB 5E9DA 3O0RH 4RMUA 3T0EE 2ARJQ 1KSRA 1NMBH 2EDKA 3H9SB 3OAYK 2JCCA 2Z9TA 2B1AH 2VLKB 3UBXB 4APQB 2W91A 3TA3B 3E8UL 4UDUB 2GK0A 5C3TA 1NUFA 4XAKE 1NLBH 3RAJH 4X6CF 5DJYB 4W6WB 2VDKH 4U1JB 5H94B 5CCKL 4XX1E 3WXWH 3BSZH 2DLEA 3X14A 4XMPH 1HYRC 3FN0H 2ZUQC 1QSFA 1F3RB 1U8MA 5D2LE 4X99A 4G6JH 3GI9L 2P8PB 3MNWB 2R23A 5EPMB 2VSCA 5ESQA 3HNVL 1MUJB 3FO2A 4XPHL 5FF6A 1BMGA 3RAJL 5IESH 2A83B 3KLSA 1D5MA 2HRLA 3REWB 1E27B 1GGUA 4PP2B 5L9DH 3NACL 2ITCB 3SGDH 4N0UE 5CJ8A 1J5OH 1BF2A 4ODSL 1UZ6F 2PETA 4EDXB 3VFNB 4LOUC 5C0CE 5F3HB 4WGWB 3ZE1F 4WI9A 1RSFA 1KB9J 4RAUA 2OZ4L 1YY8B 4JY5H 1AR1C 3ZTJG 3UTTA 1VKXA 4OM1H 1FPTL 4KV5F 3MLUH 4H1LH 5JXED 3U0WL 5C9KA 5IKCA 1D5IH 4DZ8B 4MAYB 5C0DA 4NDMA 4XC3H 5EUOA 4GXUN 5E8EA 1N5AB 1BJMA 1U9KA 4PR5B 2BC4A 4M61B 5F89A 4MQXD 3T2NL 4R97C 4ZOEA 1NCDL 5GIRA 4AEHH 3L3OB 3U82B 1BX2B 4YFLF 5IEHA 1MJ7H 1X4ZA 1HSAB 3GMPB 3N06B 4ZS6D 4WUUD 3L7FB 4KMQA 4PRPB 2BSSA 1J86A 5C08B 5HI3C 4B5EA 5E2WH 3QWRA 2I27N 1EO7A 2BRRL 4Q58C 3WCYA 4Z6AT 4P5MA 1UM5H 5F9OH 3SPVA 1ORSB 1BFOA 5HGHA 3BIBX 3OMZA 1NEUA 4HX1B 3TT3L 4TN9A 1SYVA 2UZIL 4WHDA 3P9MA 4PRHE 1GL4B 4MCZA 3HE7B 1MFDH 4M7LH 5FYJL 2F15A 2V2TB 3PGDB 2C4FT 4C57C 3ARZA 4W4OC 2I9TB 2ADFH 3MRMB 3RWCB 5IB2B 4KDWA 1D5BB 4QHMA 3SBWA 5SX4H 1L9NA 1WEJH 3W9EB 4IMKA 2X4UA 5T5FL 1BEYH 4WW2F 5FO9B 4J6RL 4L8SA 5DQDH 2UWEB 1HH6B 4KKBD 2ADIA 1TENA 3LN4A 3BP5A 3UTZB 1OL0A 4GW5A 4P48A 1FV1B 4UZGA 3WUWA 3EYFA 1KJ2L 2GUOA 3HR6A 2IAMB 1WZMA 2IMNA 1OLLA 4X6DA 2GYSA 5KJRH 4HS3B 3I3BA 3FFCD 3SDCA 1U93A 4TSAH 1EJOL 1KV3A 2MKLC 5F7UA 2PN5A 5J6HB 1ND0A 2FBOJ 4K7PX 4PG9A 5HYJE 2B7DT 1BOGB 4ZD3L 5I74C 1U95A 3VXTA 4N9GB 4J4PC 4LHUD 2BNQD 4UAOC 2YRLA 4CJ1A 3QDME 1H15A 5ANMB 3O45B 3MLSH 3WIFB 4NWTH 3QQ9D 4APQC 4M03A 3PWLB 5D96C 1A3QA 3LSOA 3BEWB 1BD2B 4PJIE 3BQUC 4TNVF 5EO0B 3AFLA 5C71A 4NZTL 4ZOBA 1HXYA 1Q72H 4J2XA 1V7ML 4NN5B 3UTQA 4HXBH 1DVFA 4CL7A 1LK2A 3UZEA 1NLDL 2D03H 4ZNEA 3O6FD 4KRPB 2VITB 3NPSC 5EOCL 5D1XA 4BFIB 3BRGC 5CJOH 1BFTA 1OF2A 1N5YH 2AABH 3IS0X 4HMCA 4NZRH 1TZIB 1T89C 4GKZB 4NBZB 1CG9A 2V9TA 2F8OA 2P5ED 2DD8L 1P7QB 3BRFA 5DVMA 1JFQH 1F58L 5K9QG 1UWXK 3CU1A 4HIHB 1D6EB 4LARH 1ZA3A 2W9EH 2OS7A 4HK0A 1JGEA 3AC0A 3TBVB 3WLWC 4RNRB 1Q1JH 5F88A 3D69B 4WO4C 4P46A 3GMQA 3TJEL 5CJXC 3RVTD 2ICES 3O2DL 5DLML 3C60A 4IOIB 4GKNA 4K3JH 1G7MA 1KELL 3GSNL 4HUUA 3ZYIA 4G43A 4P0DA 3GFUA 5DD5L 4UT6H 3Q6FB 4ZPTA 2WSKA 2FWOA 1I9EA 5C0BA 5DO2D 3VFRA 1S7SA 2FYYB 1A02N 1ZWIB 3AAZB 4OBSA 3RI5F 3VXNB 1MFCL 2OXHA 2X4TB 4DKDC 4OAWB 1E4WH 2CDEA 4WI5A 4TRPH 4BQ6A 1IAOB 5ACMA 3RX5A 2F8VA 4JY5L 3SGJA 1AGFB 3BKCL 5JW3L 1BM3L 5C0EB 3CVIL 3HCVB 3CMOL 3VFMB 4Y1AB 1RIHL 1ZANL 1U8OB 1SM3L 3OAZH 3QG7H 3QWOB 3CSYA 4M7ZB 4Q9BA 2X4PA 5HGGS 3ALWA 2VC2H 4P9HL 3BJLA 3MXWL 1J1XH 1IGFL 3S36X 3ZE0F 1NCCL 2GHWB 1VFAA 3P9LA 4YHOL 2UUDK 3U9UA 1R0AL 3V7MA 4JFDA 2K7QA 4EUPA 4QLRA 1MAML 1YJDL 2WBWB 4XPHH 2VH5H 4GAFB 5E99L 4U31A 5IESL 3ULUH 1IC5H 2C3VA 3BD3A 4PRHD 4QHUB 3V6BR 2M26A 1YQ2A 3QB7C 4F7PB 2LU4A 3T09A 4K23L 2IADB 2VISB 2X7LB 3VI4E 2ZCHH 1UB6A 1ULVA 2YD6A 3UTSB 1G9EA 3W2DL 4UOW1 2JF1A 3OKKA 1BQHA 1FAIH 4JJ5A 4RZCA 4XXCC 1HZHL 2EDWA 3E3QC 3O2VL 1HYSD 1A7QL 5DR5H 3PNWA 1MAMH 3IRZA 3U7YH 4WO4A 2FZ3B 4ONGL 1VGKA 1DN0B 4PJFE 2DQUL 2HT2D 5GGRB 5T3ZD 1MAJA 1KJ3L 1EEYA 4HF5L 3W81A 4NJAH 5A2JH 5L2KD 1ZT4A 1PDKA 4OBRA 5C70A 4NN5C 4HQQH 4HIJB 1QEWB 2BVPA 5HY9B 1N7MH 2HLFD 2NY0C 3KPMA 2UWEF 2YMXL 4P4KD 1I8KB 1J9CT 3HR5A 2CK2A 3R8BB 3DSFH 5DWUL 1RURL 3HUJA 1CFQB 2VL5A 1DEEB 3SDYH 1N0LA 3LRSA 5JXEA 3OZ9H 1AY1H 3ZKSD 4NRXB 1T0NA 1PG7W 1U3HB 4TNWK 1LE5A 5D6CA 4LSRH 1XCQA 3D2UD 3WLBB 5K9JL 3WIFA 1Z9SA 2DWEA 2HFEA 4UT9H 3RI5K 4AENB 1E6OL 1A2YA 1FO0B 1MCEA 2AEPL 1LE9B 4UQ3B 4C56D 5DDHB 5CKGA 2BRQA 4F7TB 1VPOL 4R2GC 3GIVB 3MRFA 4YUEH 3KHQA 2H1PL 5I18L 2CRIA 3LN5B 3OKDA 3PGFH 5D7IA 5HHME 3GHBL 1L0YA 5IUSA 1YNKL 4PGBA 2NR6C 4X5LA 2DYPB 5ADOL 5JHDE 5CJXA 1BGXL 1S7QA 3SKOB 5F9DC 4DCQB 1QA9B 5CWSB 2FHBA 1DQLL 1F5WA 3MV9D 1T5WA 2E9WA 5GQBA 3FB6A 3CU7A 3JWOC 5I66B 1BBJA 4RQQB 4JZJA 1NC2D 4JAMB 3WKML 3KPTA 3LN4B 4P2RB 3QUZA 5SWSB 1E4JA 1KTDB 4MZ2A 4NM4L 1YMMD 2X70B 4RA3A 2BVEA 4N5ED 3MFFB 2XZQH 3LRGA 3LD8C 3MYJB 1CFQA 2CMRL 3HUJB 4WWKC 3D18A 4OIIH 1XAUA 3OKNB 3W2DH 4ZODA 1A7PL 3VRJB 2XV6B 4PRNB 3ARED 3UYRH 2ZCHL 2WANA 1KLGB 1B2WL 2HTKC 3N50A 4OJFL 2MNUA 4MCZB 3P9MB 3BWAB 4LFHG 9CGTA 3LH2H 1CFBA 3N9GH 25C8H 2VQ1A 3TIDB 3HE6A 1A6ZA 4ISVB 4AL8H 5JA8B 4WFHD 2EE6A 4JN2A 4M6AA 1T7WA 4O9HH 5IMMB 4X8JB 3QIWA 1N0XL 2G75B 4G80A 3MRGA 2XZAH 3BFOA 1ZANH 4PLKC 5DC0A 3RWGB 2YKLH 2ZNWA 4JQIL 4PLNC 4ZO6A 5GIRB 3F58L 2GSIA 2RR3A 5E2VL 3QZWG 4M93B 3L3GB 1CDJA 1OAYL 3C6LA 2GTZA 1U8IB 4TRPL 4RA0C 1GOFA 4NQCB 4F7PA 4BKLA 3G6JA 3KDMA 5CMAB 2C3VB 3GSWA 3C5SA 4I1NB 5SWZB 4OIIL 3BN9D 3ZHKA 4J6RH 1HSBB 2Y6SC 5GHWL 2X4RA 3CX5K 3BXNA 3U2SB 4EDXA 1OCWH 1IGYA 3AXLA 3N0PB 3MUJA 1A21A 1YEDB 3NFSL 4C56A 2VLJA 4YXLL 3V6FB 2EKJA 2ARJA 5I8CB 3ZT6A 2JB5H 2X4RB 3FB5B 4NN7B 1QP1A 4HC1H 4ELMA 1XFPA 2EXWD 1XIWD 1AGFA 1CE6B 3ZZ1A 5HGBB 3MR9B 1BGXH 4HDIB 4TTGA 4RGNB 2R39A 1Z9LA 1IAII 3IVKA 4XAWH 3O9WB 4LLWB 4D0BB 2Z8VC 2ZSWB 4PJ7B 1I7UB 4P23D 5C7XL 1FGVH 2LTQB 1UZ8A 1NL0H 1RD6A 4XNZB 2IBZY 2DD8H 1RZ7H 4Z7UA 2CRZA 1E4KA 3WIIH 4I2XB 4GQ9L 5J11C 3HI1A 5EZLB 1ACYH 5HJ3A 5EU3B 2IPUK 2Y5TA 4ZUUA 2HRPL 3TYFA 2D9CA 1KIPA 2JJVA 2VQ1B 3TIDA 3SDCD 2BSTB 2E7BA 3CMGA 4UTBH 1QPPA 3B3IB 4M02A 3RX7A 5L88L 5MEOB 1PYWB 3TM6A 2W38A 5IBLC 3EHBD 1MCCA 4HJ0D 4N0UB 2MCG1 2YN5A 3EO0B 4HIHA 1P7QD 3LPFA 2V5YA 4NJAL 5I15L 3TGXA 5EU5A 1P7QA 2FEDD 4G6AC 4GXVH 4C4KO 4EJ1C 1NCWL 5BZDB 4ZD3H 1QR1B 4JAMA 5JO5B 1KXVC 4OCRH 4Z77B 3R0MA 4HFUL 4Z7NE 2ZPKH 4EI6A 1OTUD 4PGEB 4HUXA 3S37X 2R4SH 5E1AB 3LH2L 3UBXI 4PJXF 1M7XA 1CTOA 1DVFB 4PYGA 3QXTA 3EO1B 4LLQA 5F70A 5T3ZH 3VRLF 1UC6A 3KPLB 1Z9OA 4MA7H 4UQ2B 5SWQA 3WN5C 3RHWK 1Q0XL 4NQXA 3ILQC 2J8UB 2P5EE 3IVKB 4WIQA 1RI8A 1UEMA 5D70H 4JFZH 3HN3A 2DLTA 4LIQH 1GJIA 2BNQB 2JELH 5DJXA 3QHZH 3BW9A 1A2YB 1FO0A 3MRJA 3Q1SL 5CIPH 4WHTB 3VI4F 1FVCA 5HI5D 3OKEA 3MV11 4OKDA 4BFGA 1XR8B 1KN4L 4U6HB 1YEGL 4WEBL 2DQGL 4MD4A 1FC1A 3MOBH 4XCFH 1HSBA 4LPWA 4M93C 2F74B 1MWAH 3FT4B 4YDJB 4ELKB 1R5WA 3IKKA 3QUXC 4X9IA 1DBMH 3HG1A 2OJZL 4JFOB 4DFHA 3I50H 3ZDYF 1QEWA 3MRQA 1QBMH 5BZDA 5T3XL 5IB5A 1ZOXA 1BAFL 3BZFB 3CUPB 1WAAE 1A14H 2R2BB 2P7TA 3OXRB 4GRWE 4ODWA 4HH9A 3T1FB 1T3FB 1DN0A 4YK4B 3H9ZA 2X89A 1YJDC 5C0NC 5E2UH 3QFJD 3RZCA 2ATKA 2QLVB 2IPTH 4QRRE 3RGVC 3TBWB 3FN9A 4DZBB 1FE8L 3OAUL 1AJ7H 1C5BL 3QXDB 4MD0A 5IGXL 1J18A 1G7JB 1W0WA 2VDMH 4XPGH 1JHKH 2G60L 4U1GB 4TNVK 5DD6A 1QLFA 1WBXB 3RL1B 3QXDA 3T0WA 4XVJL 4J1UA 2CPCA 3R1GL 1JGDA 2IFGA 3PWVA 4PBXA 5E8DH 1KC5H 4QHUA 4K8RH 4PJDB 4G7YL 5DYOA 4LIQE 3U0TB 5BRZB 1WISA 3RZCB 2HT2C 4MAUL 1BD2E 4Z78B 2JJSC 3ZDZF 5MENA 1UM6H 1GGCL 3ZE2F 1EFXD 5LWYH 4HHAA 2RFXA 1GZQA 4BQ8A 2G2RA 1I8LC 3SJVA 4HK3J 1K5NA 3PL6B 4XNQA 2LVCA 4U3HA 4X8XA 2P7TB 1A6AB 3O2DA 1ZLUH 2I5YH 1N5YL 1A1OA 5SWSA 1ZLVH 3F5WB 1B6DA 5CINL 3SKJH 3OPZH 3GMOB 2DKSA 8FABA 3UTTB 3FAWA 1JK8B 1JZ8A 2VXTL 5FV2A 4MA7L 4KTDL 3UTPD 1IVLA 1UQSA 2F74A 2C7UB 3QNYB 1KEGH 2QBWA 4ZAKC 2IAMD 3LIZH 3WE6B 4OD2B 2I5YL 3F7PC 1GGBL 3S35X 5I1HH 3RUGF 5F6IB 3T65B 1NCCH 5DFTA 4XRCA 3CUPA 2AEQH 1J1XL 1B0RA 1IGFH 4GSDH 5FYLH 4OKVA 5I17B 5IB3A 1WC7A 5BMFL 4WFGD 1JE6A 2GT9B 4F7TA 3EYVB 3KYMA 4ZAKB 3S4SG 2NX5A 5E6IA 1U8KA 4Z0BH 2DWEB 2HFEB 2W1NA 3QZWA 4RBPH 4K8RL 5FHBL 1ACZA 4LK4A 5E8DL 1MEXH 1OSZB 3VFVB 4X4MA 2HFGL 3QFDB 4X4YB 5I1LA 3C2AL 1N2RB 3V4PL 3WXVL 3MV9B 1QQDA 5CEZD 2DDQL 4CADB 1I3VA 3H3PL 4PJAE 5IBLD 4ERSL 1F11A 4IJ3B 3OKEB 4J23A 1MCKA 1MFCH 3J7HA 2X1WL 2IH3A 5E8NB 1EZVY 4NQUA 3UTPE 2L7UA 4GW4B 4FQ1H 1NFDF 3MJGX 4MQ7B 3TA3A 3TO2A 5E6YA 4C55A 4YX2H 5D5MB 4O2FB 3WJJA 1TCRA 3RA7L 3D1MC 3LB6C 3AU1B 5JIPA 4RMVA 5GGTA 1KJMB 4J8RA 2FSEB 1CVSC 3IDJB 4OGXH 4O2FA 1PJ9A 1UA6H 5HI3D 2A6KB 1CFSA 3M1BA 5IK3B 3BGMA 1CGVA 1FGVL 5T3XH 3VW3L 4FQCL 3LS5H 5DK3A 1XGYL 5JUEL 5FYJH 1Y6KR 3H0TB 2BNRD 3D18B 3WL9A 1PZUB 5GXBB 1AKJD 4DKEL 3UTQB 1VSCA 2AEIT 3H6JA 4YHZL 4Z7VA 3R0NA 1DANT 4OZHE 1QBLL 4U33A 3PV7A 3MOBL 3VFWB 5I1AA 3ULVD 1HNGA 4QXTB 5FB8B 4S1DC 2W9EL 1L7IL 1UACL 3PXJA 4P3CL 1I9JL 1KJVA 32C2A 4HLZG 3BDBA 3EZJB 2H3NA 3KJ4B 2PUQT 2FIRT 1JPGA 2ESVA 4J3WA 4DKFL 1P5VA 4ZXBC 4IRJB 2ZJSL 3NVQA 1T2QL 3DV6A 4L8SC 4OQTA 4JO2H 3CFBA 4HWEL 2H2SD 1XF5A 3DXAA 1MIEL 5LCVL 4PJIF 4N0YL 3O41B 1CDCA 1Q0XH 3RZWA 4CMMA 4LLWA 4OGAD 1UYWH 2VR4A 3TYFB 3ZO0A 4L29B 5HJ3B 1EPFA 3MA9L 2IBBA 4I2XA 4JY6B 1FV1A 1GIGL 4H26A 4O51A 3H8NA 1TJIL 2GSGB 4ELME 1IAIL 3F5WA 4OLEA 3THMH 2DM3A 2NNAA 4Q6YA 4UINH 2XKUA 5ECJE 3VFUA 3ZKXB 3GJEA 3RPKA 2ARJB 1QFPA 2O5YL 2YUXA 3DETC 2ZCKL 1W0VA 3CFDB 2Z31A 2EDFA 1E28A 3ARDB 1MH5A 4KQ3H 1SVCP 3VXUA 2VLLA 3RGVD 2NTFA 2FYYA 3D3VB 4AEIH 3NCMA 2BXZA 5GGSY 2OSLA 5HGDB 4Y2DB 5D2NB 3VXMD 2OL3A 3DV4B 4DK6A 1GGIH 1A6WH 4TSAL 4NQCA 1T20A 3EOBB 1XGRB 3O6FA 5E8OB 5MEND 1NC4D 2EDJA 3WFBH 2NY4C 4WI7A 4M7ZC 5GGRA 5ITFB 1Q9OA 3F6LA 5FUCE 3I75A 1JI1A 3L7FA 1SJHB 3RNKB 4LSQH 5HHVL 1IEBA 5F7LB 2ATKB 4G9FE 1S8DB 1ZE3C 4RDQG 4PJCE 2AGJL 2ITDB 2XTJE 1UM6L 1NL0L 4JJ5B 5T1MA 2PTUA 4D9RD 2R0KH 1QKZH 3JXAA 3S97C 4KXZH 2A9NL 3HC4L 4J3OC 4U7SA 4DOHE 4X6DE 4HV8A 4FRWA 3A6CH 4M62H 4M48L 3IDYB 5JW4N 3INUL 3U6RA 3ET9F 1FN4B 4KK6D 3L5XL 3FONB 1DE4A 4WUUE 4FQQB 4D9LL 4UIKL 3VGEA 2VLLB 3UPRA 3MSPA 2GJ6B 3PP3H 3TBSA 2Z91A 2CDFA 3QCVH 2VZUA 4PGJA 3A67L 4BFEA 4EXKA 3RGVA 2NNAB 2LE9A 5EO9B 1LO5B 3L1OH 4QGTA 4XWGL 5F7KC 3H7LA 1B0GB 2IALB 1A3RL 3UTSE 2E7LC 4PRHA 1DVFD 4GAJL 3B4NA 1QA9A 4KI1A 1KB9K 2B5IC 4DKAA 2ZCLL 3NBNA 3KNBA 4I3SL 3SKUD 2OCFD 3GMNA 4R7NA 1HCVA 4TVSa 1A6TB 3LDBC 4LCUB 4OZIA 3KAAA 4U6VL 5JPMB 5FECA 2YA2A 3RDTA 3X14B 4Y4FB 4OCLC 3DV6B 3LQMA 4RGNC 1VA9A 4ZTOL 3TV3H 3QXAB 3MRFB 4S1QH 2ESVB 5F97E 3TN0D 1BPVA 3QQ9C 3FAXA 4X6DB 4BZYA 3TVMA 1RIVH 3QEQE 5B8CC 3I2CH 4N8VA 2DQUH 3OAYH 2R29L 2WP3T 2H6PB 2XZCH 4L8SB 5C0ND 4QXTA 5FB8A 5FCUL 5D6CB 3WSQH 4GRWH 4ZXBB 5HVFB 2WP3O 3KGRA 5FK9B 2R15A 4UV7L 3LB6D 1JHLL 3FQNA 5JPMA 1ORQB 4H0HB 1BREA 1S7XA 3BQUD 5INDB 5F1SA 5ILTL 5GS2D 4PJEF 1SBSH 3KPMB 3UC0H 3GIVA 2F54B 2YC1A 2HKFL 3D9AL 1R3HA 1KIUA 4NOBA 3DGGB 1ZLUK 3VE0B 4ELMF 4ZOAA 1JNNL 2AEWA 4L3ED 1XR9A 2A9ML 4BSWA 4OQ1A 4Y4FD 1OSPL 1KB5B 4S1RH 5IHUH 1MRCL 4P57A 3HI1B 1T22B 1OF2B 1RJLA 4OI7A 1R24B 1PX3A 5SX4I 1M7IB 4XNXH 2VTFA 3JV0A 5D1QB 3P4MA 4Y2DC 5D2NC 3VD9A 4G9DB 4MA3A 2F19H 1L7TL 3RUGE 2NY0D 3FL7A 2FDBP 2MCPH 1HXYB 3R1GH 2XN9B 1HDMA 5C92A 2QQLH 3MUGA 2XPGA 4FG6C 5FGCB 4CVZA 5IW1A 4P2RE 2Y36H 1YNKH 4U6YB 3ULUE 4NDMB 5IBTL 1H5BB 5GISH 1CZ8L 2KBGA 4X9GA 3B9EA 1DJSA 5J13C 3JTSB 1FE8H 1K3IA 3OAUH 4O02H 7FABL 3PWJB 5DURD 2X6MA 4GXUM 2F53E 5HHPA 1ADQH 1CL7I 1KNOB 2NCMA 4W70A 3WUWG 4E42B 5E8NA 3TBYA 12E8L 4OZHF 4UDTB 5FOBB 1WSST 1B0RB 5FCSH 2ICEA 2PXYD 3CXDL 4NSKA 4TVPD 2D7PA 1RUPH 1ND0B 1JGVH 5F7YC 1ZGLM 4JZOA 3L95A 1C12B 3BDYL 2A77L 3VGDA 1X4XA 3U2SA 4I5BB 1HHKA 3DUSB 3E0GA 3QFDA 1AY1L 4LSSH 4KUZL 1NC4A 3B5HA 3MCLH 4MJ2A 4XB8A 2AJSL 1YPZA 3VFPB 3CNKA 1MFNA 4Z7VE 2DTSA 2BXYA 3O2DH 5DLMH 3IS1X 1DBML 4U2YA 4MMXC 2XY1A 2EH8H 4WHYG 1N7ML 4OKVB 5IB3B 4HAFA 5E4EC 2MJWA 5TFSH 2X4TA 2CGRL 2OTPA 2Z31B 1GVIA 4Y4HC 2ATPB 5MENB 1KCVL 3I9GH 2ED9A 2B4CH 2H32B 4HK3N 1NFIA 1UQSB 5C0BB 5C8JB 3V0AC 1S9YB 5DA0B 1BQUA 4L4VD 1AR2A 4JRYD 5H37G 1SYVB 5FYLE 2FO4B 4PRBA 4WNQA 2CDEB 2I24N 2H8PB 1PFCA 2XTLA 4GKNB 1A6AA 3GJFK 3P0YH 1N59B 4HIEA 4FP8H 3NIGF 3IXAB 2BOBB 5DTFB 5KAQF 1F97A 4YBLB 2HTLD 1IZKA 3UJJH 1G7HA 4NKIH 3VXRE 4NZTH 1S7UA 3PIQA 4LRIA 4LLMA 5DT1L 5C07A 2HJFA 2H2PD 2V9QA 3FOLA 3L3OA 3ULSA 3ZT5A 1TNNA 3PGCA 5ADPH 2B1HL 2BC4B 4QXWA 5F9JA 3O4LB 4BZ2H 1OAUH 2HVJB 2R0LH 4HUUB 5ICXB 5B21A 2D31A 1Z0NA 2NTSP 3FMGL 2GIYA 4MD0B 4EDWH 2APXA 2ZP0T 1EDQA 1FDLL 3MRDB 1ADQA 1MRFL 2ZZUT 4X6EB 1ZT7A 3UEZA 3WL9B 2DQJH 3D85A 1IM9B 2IQAB 3BKCH 1H3PH 4OM0L 4OUOA 1T2JA 2VSDA 4MJIA 1RUKL 1KN2H 4FQIH 3HE6C 4XP1H 1GGTA 4FABH 1NDGB 3GSQA 4FZ8H 1S7WA 1QHPA 2A6KA 3PGCB 5TQ2H 1AQDA 1KGCE 4TUOA 2CDGB 4QRPA 4N90E 3WN5A 1EH9A 1NJ9A 4M1DL 5JQHC 2P48B 4XPTH 5EC2B 4ZFGH 4Y16C 5AG9A 4EOWH 1TCRB 4PGCA 4G3YL 3QJHA 2X4SA 3OAZK 5I75C 1C5DB 1MFAL 3D0VB 5DTFA 4E9LA 1U3ZA 4JO3H 5SWZE 1HIMH 3O6MH 3FT4A 3VXRB 4KKLD 3WLBA 1OAZL 2DQCH 4NQVA 2J8UA 3K7UA 4MCYB 2EICA 4ONFH 2P1YA 4ZFFB 2E7CA 4N5EC 4ZUSB 3PHOA 2H2SC 5KOVC 1OP9A 3A6BL 3HR5B 2VMFA 4QHNA 4XVUD 4HUXB 4X80H 3GSUB 4ONHB 1KTLB 4NO0D 4X6FA 5CP7B 3RDTC 2ATPA 3H9SD 4J4PA 2NZ9C 4JREB 4KTYA 4MNHA 4FFWD 1QHOA 5IF0B 3OTTA 3SDCC 4NQDD 4HWZB 2Q76B 3QJFB 3EJYC 1DQDH 2NY5L 4PTUB 4DGYH 1BOGA 3JV6A 4BZ1H 4YBQC 1DBJH 2PW1B 3QI9B 4GUPB 1IE5A 4OZGE 3UTTE 5IMOA 3SE9H 3L5HA 3FHAA 2NXZC 4CU8A 3SO5A 3PDOA 5I2IA 4LFHD 1MCFA 1IC7H 3VWJC 3W82A 5IB2A 4ODXA 4XCCH 4B7LA 5F7WC 4JY4A 1ZHLB 3D25A 3L3DB 4X4XA 3GIZL 4PUBL 2ENYA 1ZT7B 3SDYL 2V5SA 4XPFL 1HNFA 1TTUA 3T04D 3FFDA 4DGVL 3TA3D 2R4RL 1G6VK 3WXVH 5CLTA 4DVRL 2XICA 4H8WL 5CEXA 4KDTA 3LPWA 3QNXA 3SJVB 3OKOA 5F44A 3UJTH 3DPBA 5CEYB 2AXFB 5D7JB 2Z31C 4Y4HB 1HQRA 4X7TB 5MEOA 4AM0B 4JFDB 3VMNA 1ZGLA 2HFTA 1HQ4B 4G8IB 5DI8A 2W0LA 2GCYB 3ECBB 4P5KA 4PJIB 2J2ZA 5I71B 4M6MH 1UJ3C 3D39B 4PJ9B 5B38A 2XN9A 4JDVB 5GPRA 5GSRB 4LKCA 1AGCB 1YN6A 2F5AL 3NA9H 1EO8L 1DN2A 3ARGC 3MV8D 3OJDA 2N1KA 3VH8B 3HAEA 4GRWB 5A43C 1DSFL 2QL1A 4QRPD 1ZV5A 2R56L 4OLZL 4PG2C 1KJ2H 4X5WB 4IMLA 2I60L 3RZCC 2D7TL 5F7DB 3DI2B 1MOEA 3CXHK 2V7HB 3ULUF 1NMAL 3ULUL 4ODWB 3VMPA 4F7CA 4XCYA 1MCQA 5H35A 4MHHG 2YC1B 2XZCL 3W11D 4BUHA 4H20H 5SWZA 1S7RB 3S7GA 5JLZB 4PRIB 3SOBL 4LVHB 4GFTB 5F1NB 1SM3H 3FQNB 3RWHA 2UZYB 3MYZA 3NH7H 3UO1L 3MO1B 4YR6B 5DHXB 3L3GA 2DJUA 1OW0A 1FL6B 1G7MB 2DQIH 5D2LA 5H8DA 3TC9A 4QY8A 5EIQA 4I3RH 2CD0A 3QDMA 1TTFA 3U4AA 1AD9B 3UDWC 4DUWA 1GRWA 1WV7T 2BRRH 3FQWB 1U42A 3OJVC 4U3CA 5C0FA 2BERA 4IOFD 4U1JA 2EEBA 1PG7X 4I0PC 5GZND 2J6EH 3T4YB 2NY4B 4UDUA 5AYUL 4ORGB 1P4IH 2JCCB 3DOSA 4JFFD 4IRSB 5J1SC 5D7IF 5C0RH 1DUZA 4Y2DD 3ARSA 3A67H 3GMLB 1G6RH 1W72H 1EO5A 1C08A 2Q7NA 3JWDH 1F4YH 3D39D 2WAHA 3HC3H 3MRGB 4FMFA 1ZHNB 3FQXB 2VE6B 2BMKA 5TQ0L 4D8PA 3W0WD 5EG6C 2J6EA 3EZ8A 4EI6B 3TNNA 2IC2A 1U2HA 4HXAL 1RZJC 3AVEA 5E6IC 3VGHA 1HXMA 1IBGL 2NLJB 3STZA 4HJ0C 4PP1C 2AJVL 1QPXA 3DROA 4A6YH 1G6RA 3V6ZB 3WIHL 1A7NH 1DDHA 3H9HB 4LARL 4KI5C 3GJFB 1Q8MA 3GBMH 5I1JH 2COQA 4FFZL 4JKPL 5DHVB 4NRYA 4NZDA 2VXQH 4YO0B 3TFKD 3VRJA 3PE9A 5DJ8B 2EDRA 4K9EC 5INDA 4P5TB 4UOJA 1M7DB 5CZVH 3EIFA 1FAIL 1CT8B 1D9KC 4ORGA 1EEZB 2VWEE 3SDXA 3QULA 2EIEA 4DFIA 2OXGA 3QUZB 5EZLA 4LPYA 5CUSH 4UQ3A 1QSVA 1AD9A 3ZHDA 2DQFB 2LAGB 5ID0B 2E5EA 3BZEB 1YJDH 3QCTH 2CRMA 5D2LB 5B39G 3ZYZA 4AEIL 5GGRY 4I18C 3MJ7B 4YQXL 3CJJA 1QZ1A 1U58B 2I26N 5I1KL 3FO1A 5I1DB 4QWWC 4ODTL 4JFEE 4PRIA 3GMNB 4R7NB 5T1KB 1A6VL 4QHMB 3SGDI 4B0MM 5IVXF 4E5XB 4XP9L 1JUFB 4WDIA 1AKJA 2GY5A 1NBQA 5T1LA 1W0VB 4I77H 3KLAA 3QQ3A 5D7KD 3S3SA 1UG9A 2CXGA 2ADJB 1D5XA 5TPWH 3ESUF 2VUYA 4KJYB 3AXLB 4KRNA 5D7JD 4RWYL 5AWNL 3RY4A 2NMSA 5GRJL 4JB9H 1LNUA 1QFWH 3MLXL 4RAHA 4RFOL 4DKFH 5D7LE 4L9LA 1A9EB 1BEYL 43C9B 3B5TA 2BNUA 4OUUA 4ZS7H 1WFTA 2KPNA 5DUML 5HSFA 3DRTB 2RQ8A 1PG7H 3SBWC 4PJ5B 2LVEA 5KSBE 2EZ0C 2EXYC 2HWZH 1YEIL 1XZ0B 3TT1L 5IKCB 3O3DB 5DHVA 2VLRB 3WDJA 2FB4L 1P4BH 3HNSH 5HYQA 3TT3H 4AIXA 4PJFA 3LY6A 3A6BH 4KY1L 5DMGD 1HKFA 4PLJD 3V4UH 3G6JF 4LQ1A 3QI9D 4KDTC 4QXUH 1SEQH 4Y8AA 1UJTA 5JUEH 1QVOB 4MB3A 2CUIA 1MCJA 5FO8A 4JFED 2XQBL 4NO5A 3VDAA 2JB6A 4ZTPL 4GRWF 4PD4J 2EDHA 1S5IH 4JN2B 5AUMA 3PG2A 1CWVA 3RBGA 3P30L 4I3GA 4NO0B 5A2IH 5EIVA 4HS6A 4E0RB 1DQML 4K55A 2NY0B 1KPVA 5EU4A 3K2UL 5C0EA 3UJIL 4OFDA 1NKRA 3F7VA 1SJVA 3DJ9A 5EOCH 2DRUA 1J0ZA 3IDMB 1G6RB 3V6ZA 3GMLA 1U8QA 2Y7QA 1VFAB 3P9LB 2R23B 1EHXA 4Y19D 3VXUB 4I0CC 3V4VL 4XTRD 4XWOC 5KVDH 1JF5A 3L5IA 4UILH 5C0AE 1OP5K 4X6FB 1RZKC 3P77B 5E24E 2C1OA 4ODVH 3QXVA 4KQ4H 2EIDA 4S2SA 5FOJA 4BH8B 1RZJH 5INCA 2J8OA 3PWNA 4LSVH 1J5OL 1UH3A 1ONQB 3DX6A 2MOVA 3LQAL 2E9JA 2EDXA 3TJHD 5I76B 4POZD 5BOZG 2AEQL 3DYMA 4GSDL 3NIDE 5I19L 3IFNL 1CTNA 1Q9LA 4I18A 2VZSA 3LPGA 4EN3A 3QG6A 4PGBB 1T1ZA 3OQ3B 3D0VA 2PR4L 4WW1A 3WNPA 1OVZA 5T1KD 1S7SB 4Y16B 3CFEB 3CZFB 3TLRA 1NUNB 2C1PA 1JGEB 2QQKH 1HKLL 4XRCB 1MI5E 3C5JB 3OG4B 3WN5B 4LHUA 1KJVB 5JZ7C 4JFQB 3HAEG 1DVFC 2C5DC 4MWFB 2UY6A 1V3MA 2A0LD 4YR6A 5I1AB 1U3HC 4F33A 1AGBA 2HLFC 3MNVA 3QDGE 1AE6L 3QUMB 5FAAA 4Z7VB 5FYKD 2X40A 2DQDL 5DJ0A 5KS9A 1MLCA 1D9KD 4QOKB 2R0ZH 2B4CL 5F1KC 3BAEH 1CFNA 2W92A 1YY9D 5FA3B 4S2SB 1UVQB 5IP4A 2DLIA 3AB0C 3P77A 3K8KA 3TVMC 5ALBL 2RAMA 1F4WL 3M1BB 1CXHA 3OGOE 2DJSA 2R0WH 4AMKH 3BEWA 1OGAA 1XF4B 3BIAX 5F7DA 1K4CB 2VDML 2EO9A 2AXFA 1G7QB 5D1QC 1GSMA 4NHUA 4MZ3A 2YPVL 4CU7A 1OOAA 2YRPA 2MMXA 4L9LC 1IGTA 5EZJB 3U0PA 5E2UL 3WS3A 2EEDA 1PKQA 5JW5B 4N5UA 1AHWB 1N3NA 4QT5A 1MI5B 3SEPA 2Q8BH 2OZ4A 1NCDH 1PVHA 3RU8L 4XP5H 1F2QA 1BQHB 3NN8A 3OKKB 4NJ9H 5AYUH 12E8H 4WFEE 4XPBH 4LF3A 4JY4B 4R3SA 1ZGLB 3SE4A 1FFPA 2WIIB 4N8CL 3AM8C 3L3IA 1ZXQA 1MFEH 5DQJA 5IOPA 5I8EB 4KAQH 3LV3B 4OF8A 2V9RA 5LBSH 4EIZC 1XZ0A 3B6SB 3MBEB 5GGVY 3E1F1 4OZFB 3RWDA 1KXQE 4XCFL 3IB4A 5ALBH 4YDLC 4J3VA 4L8DB 5IMLA 2QSVA 3L9RB 5KSVB 5FGBA 3SDCB 3VXSA 3VXSE 5CGTA 4CDHA 5FYLL 3QPQD 4D0CB 4LASH 5FDWA 1RK0B 3L9RA 3X3GL 1HHKB 4I5BA 4KKAD 4P9ML 3KXFD 1P4LB 3DMMB 1E4XH 4JZOB 1SY6A 5JA9A 3HNVH 3EYQC 1SMOA 2A9MH 4GUPA 1H8SA 2WQ8A 4JFZL 5B22A 5FO9A 3U7WL 4HLJA 3MFGB 3VFOB 5AEAA 1JV5B 1YA5A 4QRUB 3TYGL 1B4JL 3MX0A 4BUGA 2DB8A 3VGAC 5J7CC 5TGBA 4GAYB 2E9BA 1DSFH 2XOTA 3E6FB 4HS8L 4H1LG 2BNQA 2D3VA 5CZVL 1ETZA 1D5ZB 1R3KB 1T03H 4L3AA 2V5TA 5I74B 4X7SL 3MRMA 3RWCA 5BVPH 1K4CA 4R3SB 3I3EA 3U9PL 1XF2A 4TUJA 1PKOA 1NJ9B 2DJ4A 2EC8A 1OY3B 3WFEL 2KKQA 5I19H 2YZ8A 3VXOB 5J6GA 2B1AL 3EFFA 3OB8A 3PQYD 2AS5M 3EJZC 5IG7A 5I1JL 4M6ML 1JNHB 1YMME 3QCUL 3WS3B 4L1HA 3QEUB 4WW2B 2WV3A 2J5LB 5IFAL 3MLRL 1WF5A 4MXQD 1OT1A 4QTIH 4YE4H 3V5KB 5IQ7H 1G7QA 3GMRA 3DBXB 1QYGL 3T2OA 4KJPC 5E9DE 2XNAB 4UILL 3UP1A 4PJ8D 4PJAA 1DQTA 2LABA 3N85L 5TH2A 2BHYA 1FJ1A 3IJSB 5DJAB 1AGEA 4PUBH 4ZO9A 5C07E 1NGWB 1YYLH 3UX9B 1T89A 3MLWH 3G5ZA 3MLYL 3S5LG 2QEJA 4NO2A 1YUHA 2DI8A 2Q8BL 4XNZC 4UUJB 4IEFB 3DUUB 2Q6WA 1U8NA 3GJFA 1F00I 2EYSA 1Q9LB 1A14L 5CS7A 5EPMA 4P5TC 5TDNB 3FB7B 4KGLA 4OSUL 1PW3A 2XQBH 3IKCB 5CZXC 3UAJC 3MRCA 5KVGL 1WZLA 1FSKB 4XCNB 5E1HB 4WFFE 5BCAA 2W07A 4HJJL 3STLA 2BMKB 4D8PB 1YMMB 3MV7A 3BO8B 3O4LD 3A0OA 1MWAL 3PIQB 4FHBD 1ZVHA 4PP2A 4TNWF 1MHEB 4LPXA 3N1FC 4F37K 1Y0LA 3D39E 1JZ2A 2D7QA 3MRJB 1EAPA 3CVHL 2ZSWA 4LGRB 4PJ7A 4QF1A 5B39B 1OWRM 3MBED 4HZAA 4HC1L 5J9PA 3ULVL 4K94C 1HHHB 4NQDA 2DQDH 3IDMA 5JXAL 2VIRB 4YGVB 5HGBA 1A8JH 3TCLA 1HWGB 3UXFA 2AXJA 5DJDB 3T4YA 5FYLD 2VOTA 5KVFL 2B20A 4Z5RB 3BO8A 5TE4L 4P2QD 4I9WE 4YFDB 1IILE 4N9OB 1EA9C 4C56B 4XGZB 1YEDA 1GC1L 1HKLH 4OT1H 3QDGA 5F7EH 4YK4C 5DZNA 1B90A 1AFVH 1NGZB 1A6WL 2ZUXA 4PLJC 4Y4KA 1G9ML 1U8QB 4YXKL 2VKXA 1MCWW 4QEGA 1I8LA 4PRIE 4XMKL 2R1WA 4XP9H 2KZWA 3JVGC 2D9QB 4JVWA 2BY0A 4BKLB 1PAMA 4FXLA 1FDLH 4U7KA 3O3DA 3MMEA 1X5ZA 1D5BA 3C60D 4OFPA 4PS4H 1C5CH 4RFEB 1INEH 3QDJE 4GXVL 5IT2L 1NDMB 1VHPA 4M6NH 3THML 3OF6A 5D72L 5FO8B 3WEXA 1MVUA 2OLDA 1TZGL 3MV7D 2ZUYA 1WFUA 1PBYA 5HYFA 4WUKH 3MC0A 4LRIC 4CN6A 1P9MA 3ILPA 3TO4C 4FNLL 2APFA 4PRPA 4GRMA 4XXCA 5LAXB 1ZLWK 4J4PD 1CL7L 1ZA6A 3T08A 1PD6A 2K3TA 4XP4L 3TNMA 2OI9C 4RGMC 2E27H 3W9DB 1ED3B 1I3RA 2ORBL 4I13B 4MLSA 3ECBA 2GCYA 3R06A 4XHQA 2OR8A 3QAZC 4MA3B 4AM0A 3G5XB 3VXQA 3PHQB 1PZ5A 5IFHH 3VG0L 1KFAL 2D7MA 5E4IA 4L1DA 1QR4A 3MA7A 4CN4A 2J8HA 3L5WA 4YHIB 3QUMA 3MFFA 3FO1B 5I1DA 5I0DA 1K4DA 2R8SL 2ADJA 3IF1A 5C0IB 3IAQA 3N1PC 3QRGH 2R1XA 4ZPVB 4JFDD 4MWFA 3K74B 1FZJB 2W9DH 3RVUD 1MY7A 2EKSA 3BXNB 4X4XB 1T5WB 5GS1C 2FX8L 1FVDA 4WVRA 1YEJH 5KTEH 4F7MB 4KVCH 5ICYA 4CMMB 4N1HB 5DMYA 5TJWK 2P5WA 3TCLB 1TPXC 3LEYL 2WINB 4LSUH 1CGSH 1KCUL 2VIRA 3RFZC 2NW2B 1WK0A 1TVDA 4NN7C 1FFNA 4D9QE 5L6YH 4PTUA 1I1YB 5JQ6L 4GKOA 5AWNH 5F96H 4JFHD 1ZLSL 2PYEB 1EFXB 4LVOB 1G1CA 4LGPB 3L3IB 4RISH 4CMHB 4FQXD 1OAYH 2KZ1B 2YMXH 2Z93B 1ZT1B 1QO3A 3HMXH 3S37L 3SDXB 2HP4A 2DMKA 3B43A 2EH7L 3NN8B 4R4NC 4XCNA 1NSNL 1OLZA 5BV7H 2YS4A 3OJ2C 2HTKD 2VLKA 1N8ZA 4APQA 3RKDD 1AHWA 3BMVA 2XY2A 2GY7B 3NIDF 1RZKH 4G7VL 5EZJA 3U0PB 4Z7WF 4JHZA 1VFMA 1ZHNA 4NRYB 1Z3GH 4XNXL 1UT9A 3BGMB 3GB7A 1HCFX 5C0JA 1JZ4A 4MXWH 4LSTL 1R3JB 3EJZD 2B1HH 4YZFF 2AQ3A 1LEGB 1XF4A 1CDBA 2BY3A 2AK4D 4GG6F 3BKJH 3HZYB 4WRLA 1TETH 5GS0H 1HINL 3HPLA 4U4BA 2R9HC 1CBVL 4UOW0 3FT3A 4ZAKD 1UCBH 5DVNA 3BMWA 2VXTH 3FOMB 1NCTA 3UYRL 1DE4B 5C0FB 5IR1A 4GAGH 3G08B 4CNIB 1I1RA 3CFIC 1DBKH 1CLZL 1T0MB 4JQVA 4MX7A 4F33B 3TF7C 5I1LB 3ABZA 4MAYD 1MHPL 1ZEAL 3C6SB 2FBJH 4U0RB 1JWUA 4YFEA 3T0AA 4K7PY 2IWGA 4GBXA 1A7BA 1D6VH 2FGWH 4JKLA 1RJYA 4PLKD 5HGDA 3HI6L 2J88L 4CW1A 1IEBB 4DVBA 1OW0C 2RGSA 1Y6NR 5CBAB 4K2UL 2O5XH 5CKAA 4XPAL 3WDIA 1AR1D 1YDPB 4XPGL 3U79A 1MF2L 1VESA 2F58H 4MJID 3HRZA 5IGXH 1HK6A 1E4WL 2VZ1A 5I18H 3CK0L 2APBA 1CIDA 1VPOH 3RL2A 3OR6B 5IB4B 1JK8A 4B41A 4KRPC 1WCQA 1AKJB 3ALXA 5JQ6H 3MRNA 4R2GB 3FQTA 2IG2H 4YH6A 3R4DA 4F8TA 3HZVA 1RVFH 2NY2D 1DBJL 4U3XA 2J6EL 1FAKT 3TO4D 1XGPB 3CK0H 1YN7A 4NCC2 3WS6C 2XACC 3DX7B 2XKNA 1QSED 3CDGB 2DF3A 2D4FA 3DRQA 3SCMA 3PWVB 3WFCL 4L4TD 1RULH 5IOPB 3OKMA 2MCPL 3CCHA 5EU4B 1KPVB 4L29A 4HLZH 1NBYB 2ERJC 1LD9B 2BSRA 3MLRH 3WNLA 1I85C 4HF5H 4ONFL 3QR2A 4NGHL 4JFPA 3SOBH 1ZHKA 2YK1H 3PUCA 3JWNC 3T3MF 2WWMD 2HMID 1S7VB 4DEPC 1C1EL 1LD9A 2BSRB 3S88L 4XX1G 1HQ4A 2XTJC 4PJ7F 4QYOA 4MD5A 4ENED 3O2WH 1NMAH 1TQCB 2F9BT 4UT7L 3MUHL 4K07A 1Z0MA 4OF0A 5DC4B 4LPTA 4EUPB 4ZNCD 1HILB 4MJIE 1MIMH 4N1CA 4U6YA 2VAAB 3MGAA 1B4JH 2QQKL 2B8OT 4FZ8L 1RZ8B 1N4XL 4HKZB 5DHYA 1KEMH 1NAKL 4JO1H 4WWKB 1JNLL 4C4KT 1P7KA 2YRZA 5JIHA 3ULVE 3QUYB 4XGZA 4QOKE 5I75B 4OQTH 1JHLH 1C16A 3H0TA 5DJ2A 3PQYA 4JPKH 3DX9B 4LASL 5DZOA 3F65A 2B2XH 4DQOL 2P42B 5IK3A 5L8KB 3EYUH 4NFDA 3I2CL 3ARPA 1KIQA 4MHHI 2JE8A 4G7VH 1DANU 4XNUH 1RZKL 4BSWB 3O6KL 4YWGL 4U1NB 3FCTB 3BJ91 5EOQH 3BW9B 5DJXB 4DVRH 4YIQA 3SE8H 1QLRA 2OR9H 5ISZD 4QRQA 4RISL 1T4KB 4WEUD 5D1XC 1UWEH 1LO2H 2QADC 3GIZH 4JEGB 3MRCB 4V1DD 3FO0H 4ZO8A 3QG6B 1Z5LA 3HMWH 5E94B 1A3RH 5BOPA 4JQVC 3QNYA 4JM4H 3NCEB 4KROD 1DFBH 1IM9A 2IQAA 5BV7C 5HHMB 1SEBA 5E5MA 3EYSL 5CILH 5EBLB 3VXUE 2GUOB 4D3CH 3BQUB 5F1NA 3GMQB 4PBVC 3BUTA 5D7KE 3KXFE 4QTHB 4NWUL 4R2GD 3UDWA 4M1CC 2X4QA 3Q48A 5C0GA 1E0OB 5ICXA 15C8L 4PJ7E 5TFSL 3O4LA 1FJ1B 1UGNA 1B9ZA 1J88A 4ZSOA 4WCYL 2AVGA 4R4BB 3DXAD 5EC1A 3BHBB 5BRZA 4BELD 3MZTA 3QHFH 4HFWA 2CO7B 1I7ZA 2AJSH 1UJ3B 5E5UB 1P2CB 4OZHB 2VZTA 2X4OB 4NFBA 2YEZA 4RBPK 4OGYH 2C3GA 3C08H 4XNMA 5D93C 3BKMH 4OF5A 1F3JB 1GPOH 3RWIB 2VJXA 1AXTH 3FO0L 4U1GC 2DQHL 3U0WH 3TO4A 3FONA 5L8JB 5HVHB 3PWPE 2H32H 4K7PL 4XCEA 4P4RB 4R26H 2OR9L 2VN7A 5EU6D 1QLFB 1WBXA 4K3DL 4Z7WA 3RL1A 1OQOA 3DECA 1YNLL 5EUOF 3TEUA 5J3HC 3H3KA 1OWWA 3IDGA 2I07B 5E56A 1T1WA 3FMGH 2P5WB 4KQ3L 4EDWL 1RK0A 3OBAA 3MZGB 3QCUH 4QWWD 5L9DL 4ZNEE 4HKJB 5DUBB 1IEAA 2UVEA 5F93C 1TJGL 3V6FA 3BUYA 2V17H 3VMOA 4LHUG 1EVTC 2LU7A 4M3KB 3LIZL 1KLUB 5M94B 3ARRA 2ADGA 3JV6B 5MI0B 1EEQA 4QRTA 3N1GC 1HWHB 2XIDA 2NY3D 1U36A 4UDTA 3PABA 3VWKA 4N1EA 2L7JA 3IDXH 3IDIA 4FP8L 2GFBB 3O8XA 3P0YL 3MROB 1I1AD 5CP7A 2DICA 3KR3L 3VWJA 1AXTL 2NY2C 4L8BA 4ELKA 3C6LB 5I0ZA 5CCKH 1F4XH 1FG2A 4Q7DA 1NC4B 3UJIH 1IQWH 2ED8A 2J12B 3K2UH 4NPYB 1UKTA 3DUSA 3SDAD 1WTGT 2D7NA 5FCUH 3S9DB 4ZFZA 1QSFB 2NY1C 4F7EA 1U58A 3VU2A 4YHKH 4ENEC 1FCGA 1I9JH 4M1CD 1ORSA 5C2UB 1XGTA 4GMSH 5FOBA 5GRXG 3AREB 1OARL 4IMLB 4K7FB 2CGRH 5DJYA 2NY6B 4E42A 4C58B 1CLYH 2QSCL 4H26B 1CLOH 4G6MH 2JIXA 3DTXA 1C5DA 3TV3L 2BSSB 2XZZA 2JIXD 4JHBA 4KXZI 4NBXB 3Q6GL 4WCYH 1HSAA 3GMPA 5D1ZA 1H5BA 4DUXA 1AGCA 2UYLA 4DW2H 3TT1H 4FFWC 1IL1A 4DN4H 4HWBL 3SGJC 4U1LB 5MEQB 4EBQH 2ZUSA 4K94H 4PJBA 3FO9A 3QIBA 4OLVL 5DI8B 2F54A 2P43B 5IVNA 1UWGH 4FTVE 4X6CE 4RFOH 4C56E 2IG2L 1CXEA 2X09A 5GGQH 1T5XA 5IW3A 1N64H 5CEXB 3MRPB 3MLWL 4ZXBA 1KB5A 1KIPB 3H7BA 3F7RA 4OIAA 5GGSB 4FQXA 3BESR 3SGEH 5T1DH 2Q20A 4HAGA 1BBJB 4RQQA 5LGJA 1GOGA 5B3JE 3V4PH 1MCRA 1SYSA 3HS0B 1QYGH 4AMKL 4L5FH 5L2JA 1U8LA 3QUXA 1NEZA 2DYPA 2XT1B 2Q7YB 1BVKB 3A6CL 5DJDA 1D5MB 4N0RA 1NBVL 1CLYL 4Y5VC 4JKWA 5IFAH 1MREH 5HYSG 4EVNA 1FNGA 1HHHA 2FEDC 4G6AD 3UBXG 1T1YB 4ETYA 4YQXH 1DUYB 4Z8FL 2E6QA 4MA8L 1JPFB 3E2HC 1FLRL 3WFDL 3QHZL 1TPXB 2E7LA 2GTWA 2M1KA 5INCB 5KZCB 4O2CB 4QHNB 4GJTB 4LKXA 5J11B 1S9WA 4RIRB 1JPSH 1F11B 3FB5A 5EIIB 4FTVB 3KPQA 2ED7A 1NUGA 4I0PA 4P3WA 2ZWLT 1SJEA 2P45B 4AH2A 5B3JF 1CF8L 1EERB 4K3EL 4NIKB 2HJKB 3T8XA 4JRXA 4IMKC 1AIFB 1TJHH 4P59H 4NOFA 4D0DA 4EN3C 3WFHB 3S88H 3LKNB 4HV8B 3ZLQC 4MS8D 5I17A 3KYAA 3IU3B 1AGEB 2ZCKH 2CDGA 2VLJB 2VDOH 3OV6A 1I7TA 1IFHL 1NBVH 2HT3C 4JFYB 4PJEE 4XBGA 3V2AR 3H42H 3RWGA 1MJ8L 4LDOB 5LBSL 3D85B 2PO6C 1KXTB 2HYMA 4U05A 4X7FC 3QXWA 5C0AA 4R6UA 4U6XB 5J3HD 3X11B 3RNQA 4F9LA 4ISVA 3O6FB 3EDEA 4P2OD 1H8OA 2HVJA 2GSIB 4Y1AD 4AJ0A 2ICWB 3MBEC 1IC7L 1JRHL 1AD0A 1A4JB 1CYGA 3ARGA 5ESAA 2NXYD 3DI3B 2J8UE 4LLMB 5C07B 4F9PC 4G80B 3VWKD 5C2BH 3V6OA 2PYFB 3SDDD 1SJHA 1V3KA 1QRKA 4A6YA 3UZQA 1RK1A 3GSNA 3BGAA 4HZLB 1KELH 3I3DA 3QRFM 3S8WA 3MLZL 3I50L 3MOAH 2L4OA 2OJEB 1KTDA 2NXZD 4XBPA 4QRPE 4N8PA 3QPXH 1HHJA 3C6LD 5BS0B 1TVHA 4Y2DA 5D2NA 2VO5A 1CD9B 3L3DA 1DQQA 4UAOB 4KK5C 2BOCA 1F2XK 5D8JL 4BYHA 1QSFD 2Z8RA 1WTLA 3VXNA 1A6UL 4ZSOB 4JDTL 4LNRA 5FFLA 3OG6B 3JV4A 3WHXA 2Y1VA 3G6JE 1MHPH 2XXMB 4Y5YA 2R2BA 3MLXH 5DC9B 1LO3H 1WZKA 1UKQA 3AS3A 3LV3A 2YOCA 2ENSA 1YPZE 1RUQH 4YHNB 1GOHA 1C7TA 4M43H 1T1XA 4XVTH 2WBJB 1LE5B 4IOIA 3C2AH 3HMXA 5E94A 4IS6A 2VYRE 4PBWD 2DI9A 4ZUSA 5BW7A 1NGYB 4NQSB 1M7DA 4MVBD 3GSVA 2XQYG 4HFUH 5ANME 4F58L 5FO7B 5IVOA 4G6FB 1A5FL 4M9OA 5IHLB 1FC2D 4QRQB 4AT6B 3ME0A 1BBDL 3DMMD 4YO0A 1U92A 2CQVA 1ZAGA 2B0SL 4PRHB 3QIUA 2F53A 3MRBA 3O6LL 3SCMD 3ARBB 4QRRA 2FSEA 4IIQC 4KI5E 4KQ4L 4D94A 4WFGE 5JR1L 1B4RA 4NNYB 1PLGL 3AU1A 1U3HA 5KSAB 5DJZB 1U3JA 4TUOB 5HDQH 3BZDA 4XVTL 5HYIA 1X5LA 2WWKO 1UM4L 4L4JA 5CZXD 2EDEA 4TSCH 1N4XH 4OZ4A 3UPRB 5IJKC 1TVBB 4LMQI 4KJQD 2FZ3A 5E1AA 3U83A 4IIQB 4P2OC 3FB8B 1IGCL 2UWEE 1IKNC 4XVUC 4OZFH 4N0YH 3OPZL 4OZ4B 3L7EA 5KBNC 4JO2L 5KVFH 3GM8A 4P57B 1BD2A 4LSUL 1EGJA 4PTTB 2NY6C 2VISA 2FO1A 3WD5H 3TN0B 1XCTB 2EYTB 3NA4A 2FH6A 3SKMB 5F9WB 2E7HA 4UIMB 1CGTA 2NW3B 1FNEA 1U92B 3VXRD 5I8OH 4KPHL 1WBZA 1WC7B 1MFDL 5C07D 4XVJH 5FO7A 1JGUH 4LDLB 3QDMB 1BVZA 1URLA 4WENB 2VDPL 3S36L 1MFBL 4ZUVB 1JCKA 3KS0J 2JJTC 5KVGH 3BEVA 2HWZL 1F4AA 2XA8L 5IROC 3TFKC 1U6AH 1SMAA 2AK1L 5C1MB 3U48A 3CH1A 5ETUB 3U36A 2J3SA 1YC7A 3GSVB 3DX6B 3NFSH 3BDXA 1S7RA 3DMMC 1V05A 4NKDB 5JLZA 2X9YA 3QXAA 4R0LB 2UWEA 5C86A 2XKSA 3QEHA 2FX7L 5GGVH 2A6JB 5J56B 4ZFGL 4AZ8A 2Q8AL 4F7CB 1PSKH 4WO4D 3RIAK 4P23C 3RWEA 3K0WA 3VDCA 1S5HA 1IQDA 4JM2B 5FGBC 5T33L 3N85H 4F2MA 4ESKA 1BZ7B 3U30C 4FFYL 1QSEE 1DQQB 4OM0H 3C09C 3SE8L 2V2TA 1MCWM 4MNQA 4XPAH 3VFPA 1P6FA 3LS4H 4JY6A 1WWAX 1YYMH 1XIWC 5FUOH 3SDAB 2AQ1A 4XP6L 2Z35B 4M5YL 3MV8B 1JF6A 2IF7A 2OJEA 1NFDE 5EU7C 3CDCA 1ZGLP 1G7JA 1YMHA 5EBWA 2Z91B 4DAGH 1C12A 3WO4B 3C09B 3WS6A 5JZ7D 3F7YA 3GI8L 2J8UF 2GKIA 1EXUA 2DQEL 5ICZA 4JGJA 5AZEL 5IHUL 2NY3B 3RX8A 3SO3C 1JPGB 1BX2A 4XC1H 1CF8H 5IEHB 4Y19E 4WFHE 3N9GL 3D0LA 4UIMA 1T7VA 3JTSA 1JNJA 2VLMD 5GRUL 5DFVD 2D7TH 5ITBH 1B6UA 2QADD 4OT1L 5EUOB 3TCXA 4OLZH 2HFFA 2VB5A 1T21A 5D7LB 4K71B 3NCJL 3RPIB 3TWCH 4HULB 4KRLB 2QV2A 1JZ5A 4PJCB 5GS0L 5JNYB 2XTJB 5CINH 2P5WD 3SDDC 2H2PC 2DLGA 1NLBL 4X7CC 3EDKA 2PNDA 2VDQL 4YDJA 4B50A 4NYLA 2BVQA 3FKUS 4LSPH 3S35H 4HK0B 3DVGB 4GOSA 5FA4B 2HN7B 3I75B 3HC0A 1W8NA 4MAUH 4PJEA 3QG7L 1EFQA 1A6ZB 2AJVH 3S5LB 1XGRA 1I9RL 4RGOH 4M5YH 3QQ3B 3QO0A 3BWAA 4CKVX 4ZG1A 3RP1A 5DK2A 1BM3H 5EOTA 5JW3H 4JFEB 2GJ6E 5E2JA 3WNNA 4XBGB 4HJJH 3KYNB 1J0YA 3FRUA 2FR4B 5CD3A 3OKNA 2AERT 5IWLC 2E6JA 3NCFB 5C0AD 2GJJA 4GG8B 1LP9F 1KENH 1AIFA 4NJ9L 4X4YA 2FX7H 1CIUA 5GGVL 5C0RL 2XG4A 3CVHB 3BVNB 5HD8C 2GTWB 2N4IA 1MY5A 2GQHA 1X5IA 4KZEH 5BZWB 2YUZA 3VA6A 2VR5A 3P40A 3H9SA 5JHDB 3MGOB 5C7XH 4PY7B 4HWBH 1FFNB 3RKPA 2OJZH 4ETQA 1LDPL 4FFVD 3S34L 3CSGA 3I6LD 5BO1L 5FHAL 4G42A 3BKYL 2X9WA 2R0WL 3DXAE 3EYQD 3KNBB 1A1MB 3HC4H 2WWMC 4HS3A 4WFFD 4PGEA 3PGDA 3PXHA 4JFHE 1DR9A 2IAND 3Q5OA 1KF9B 1WVZA 4KK8D 1EBPA 4YBQD 4OCWH 3LOWA 2R1XB 1KULA 1EVUA 2BCKB 2YD1A 4JHWL 4P5MB 3S35L 5CEZL 1WLHA 3VFWA 3ZHLA 2JELL 1CFVH 4WV1A 3TBSB 1UB5A 2MFNA 4QRSB 3DWTA 5BVPL 1A7QH 1RK1B 2V2XA 3GSNB 3HZMB 3ARFB 1UXWA 1I8KA 2HT3D 2HKFH 3D9AH 4M5ZH 2BDNL 1E6JH 4GS7B 3CLFH 1O7VA 2DM2A 3QIBC 1CBVH 3NPSB 4X5XA 2MQCA 1BIIA 1CK0L 3K4ZA 2PO6D 3BKJL 3IDJA 1H3PL 4U49A 4CVWA 4J8RB 4ZQKB 2WWKT 3V6OE 2Y5TB 4OGZA 5IIEA 2V17L 4J3UA 1T7ZA 3W39B 2NQCA 1A1MA 4M6NL 2EDTA 3MRIB 3RUGB 43CAA 5CAYB 2BJML 5C0AB 4PJBB 1ZLVK 3TBWA 4Z7UB 5HVHC 4ETQB 1S8DA 2IH3B 4XI5D 3P9WB 4G9FD 5KG9B 5I73C 5D1ZC 3PP3K 3HI5H 1EX0A 4PV9A 1MPAH 1YNLH 1VENA 3OB0H 1RZGA 2A6DB 4APQD 5ITFA 2VUOA 1FZKB 4XMKH 5BZWA 4QY8B 4PR5A 4HKBA 4NKIL 4MAYA 2IADA 1JGLL 1OGTA 3LMJH 3MMEB 4KH2A 4HJGA 4PJAF 4I3SH 4FQ2L 2ZCLH 3VWJB 1I3GH 5MERB 1BECA 3DV4A 1Q0YL 4C83A 5E2TH 1W2KT 3ZDYE 1K6QH 1FL3A 3HUJE 1XH3A 2X1QA 4NPYA 1WQVT 1U8PB 1RPQA 4JGUA 2ADGB 2F54E 3LEXA 2FX9L 2XZQL 2YPLB 2ZG3A 1FG2B 4LRNL 5H35B 3MJ9H 1A7OL 2CKBL 3IU4L 3RZCD 3ARDA 3KYNA 3LEYH 4H8WC 5HHOE 2A6DA 1A7RH 5T5FH 1YECL 1XR8A 3MROA 4KVCL 3L5JA 4UT6L 2BVTA 1NCBH 2GEEA 2ZUVA 4Z5RA 2GSGA 4G9FB 2MHAB 3C5SB 2EE2A 4WHTA 5KW9L 4O51B 4GG6A 3NFPB 4HIIB 3VD3A 1JJUA 35C8H 1G9MC 4L4TE 3HNSL 3KPOB 1OD9A 1Q38A 1AH1A 1AXIB 3MRKA 1M71B 2A73A 3EOAB 3VFGH 3MOAL 4NQXB 2A9NH 3KPSE 3P73A 1XGYH 4YHPB 1HDMB 1ES0A 3VXME 5DMKA 1BVKA 1FYTB 1KT2B 4Q0XL 1PGRB 1WZ1H 4PRNA 3O3AA 2G75A 3W39A 1BJ1J 4WUUB 1Q9KB 1O5DT 2FWOB 1KOAA 1KTKE 4LSQL 5HHVH 3ZE2E 2X1PA 1WWWX 5GGSA 4JZNB 3H7BB 2VDNL 3HE6B 1LO2L 1R5VA 3PJSB 2XWJB 4PRPD 4OI9A 6FABH 4W6YB 4YLQT 2YN3A 4QHKJ 1RJCA 2Q87A 5DO2C 2PXYB 4LQFL 2AK4E 4JQIH 4CMHC 5T3XE 4G42B 4WI2A 1CD8A 2P8LA 3ZKMD 5JMOC 2XZAL 3JSSA 1KPUB 2ZNXA 4KI5D 4S0TD 4BJLA 4G8GD 5EORH 1CG9B 3UROR 2X4QB 1HE7A 4UTAL 3S98A 1ZKAA 1VFBA 4FQHB 3GMRB 3MBXL 1J1PH 4JFFE 4IRSC 1XGQB 2Y06H 1CXIA 2FECL 4ONHA 4GW4A 4YXHL 3QBTB 4R90H 4LLVA 3NIFE 5F6HI 1QNZL 3GHEL 2P5EB 3ZL4L 1LK2B 2VXSH 1JNLH 3UJJL 4XT1C 3B2VH 3PHOB 5MP6H 3OJMB 2EDDA 1A6TA 4D0BA 4MDIA 5KSBF 1W8OA 3W0WE 1FNLA 1OSZA 1JPSL 5ILTH 1XMWA 3CVHA 2KQNA 1CN4A 1U8KB 5E6IB 1E4XL 2IMMA 5GZOC 2X4SB 1Z5LB 3EYVA 3KYMB 3FCTA 1DQMH 2PO6B 4JHWH 4JKPH 1IKFL 5DK2B 2BP3A 2GT9A 1T80A 1JV5A 4MYWB 4PD4K 1UXSA 3QUML 2PTVA 4QRPB 5CD3B 2CDFB 3GZKA 4YIQB 3BUYB 3PF2A 2OTUB 4B7IA 5I1GL 2YUWA 3DETD 3ARBC 4KY1H 5CP3A 4PPTA 1EK3A 3BKYH 3IJYB 1C16B 4M8QB 4OD3L 2CIIA 3GSWB 4R96A 3VRLE 5J89A 1CE1H 4OCXL 3G6JB 1DLHB 2LV4A 3ARTA 5D7SH 2B4CC 2GI7A 2VNCA 3NPZB 4JRYE 4K3GA 5CLWA 2DKMA 1F6LL 5E7FA 2P24A 4KUZH 5DGQA 4NYLB 2YXMA 4Z7WB 2XFXA 5T1MB 4MQSB 3ROLB 1CD0A 4XCEB 1QFWL 3FOLB 2HKHH 4JM2C 3CPLB 5C09E 5HYJD 1J1OL 1Q94A 3GK8L 2IQ9L 3GRWA 3T3ME 1T21B 5J13B 2I9TA 4RWHA 1S7VA 3RWIA 3QIWB 1FL5B 3B3IA 5DVLA 4OM1L 5FUCC 1J05B 1I7RB 4I0PD 4WWID 3SPVB 1NBYA 4QXGH 2X7LA 2QKIA 2EYRB 3BN9C 1QSZA 4FG6D 1IGTB 4H0GA 3SDAA 1NMCC 3U4EA 4CU6A 1DZBA 5EBGA 1UJ3A 4YBLC 4ZUWA 1OTSC 2VABA 1A6VH 1MWAB 1T2XA 1X5YA 3B9VA 4R4ND 3REVB 1JL8A 2R0KL 4LCWD 5ID1B 3U9UB 5I1CL 4Z76B 3HFMH 2KDGA 4O5LL 5BMFH 2Z35A 3CDFA 3MYJA 4HH9B 5DEGB 5EBMA 3NAAL 3CFDA 3QISA 3QCTL 5E8EB 4TQEL 1VADA 4AIOA 1NGPH 4R0LA 3K4DA 1F4HA 2DOCA 1WWBX 5SWSD 1T83A 4ZUTB 1T7YA 4PJGA 4GAGL 4XMLH 1BF8A 3O3EB 3UYOD 3LEVH 1DBBL 3FN0L 4XTRC 1YZZA 1SBSL 1Z9MA 4LSDA 5A2FA 4PJFF 4RFNB 5EB9A 1GGIL 3C60B 3V7AE 2BHZA 4MD4B 4YXHH 5DJ6B 1TVHB 4R8WH 5I30H 1HHJB 3NAAH 3CFBB 2PKDA 2JTDA 3QA3A 2YA0A 4LVOC 5DDHA 5KOMC 1WGOA 5HHPB 1YPZF 4YHLH 4JCLA 32C2B 1I1CA 3U4BL 1I8MA 1WIPA 4I18B 4QNPF 1GYAA 4PV8A 2VN4A 5FUOL 1OTUC 1PQZA 1RHFA 4RMSA 4OCNC 3QDHA 4RRPA 1R6VA 3EHBC 3TJHC 4KZDH 3SQOH 3HMXL 1JHKL 1JWMB 2G60H 4G8EA 3S37H 1TTGA 1EJOH 4AG4H 1RJYB 4YFLI 3HC3L 2GITA 4CJ0A 5T33H 1F4YL 2GAZA 4RNRA 2VITA 1XCTA 1LEKB 5JOEA 4KHTH 2EXYD 1ZLSH 2F5BH 2VZ3A 1VACB 3C9NA 2P24B 2QR0A 1C8PA 3IFLL 1LK3L 1J1OH 1KPRA 1DBAH 1SY6H 4WWKA 2HKHL 4BFBD 1NC2B 4OFKA 1IGIL 1UWGL 4YC2B 2YUVA 4IIQA 3QIUB 4NHCH 4JZJC 5DJZA 4XBEL 5KSAA 4F3FA 1BWMA 1WT5C 4WTZG 3CXHJ 4MJ6B 4NT6A 2UZIH 3EYOB 5IVXA 3ILQD 2AJYL 2DKUA 2HA1A 5L7XL 1INQA 2YBRA 3OWEA 2EE9A 1NGYA 1NAMB 4KHXH 3EW3B 8CGTA 4KPHH 3UTSA 1QKZL 4XVSH 3T8XB 1U93B 4AT6A 2LAAA 2FL5B 5CD5C 5DMGC 2PYEA 4ZS7L 4J3SA 5H37H 2NX5B 2NPLX 3SKNB 4I0PB 1HIML 3WV0A 3V9FA 4BQ9A 3TZVD 4S10A 1MFAH 1U8HB 5GHWH 2Z92B 2P5EA 1RZIA 1DQJA 1FIGH 3EO9L 3GGWB 5DRZA 4KKNA 1JMXA 2I9LA 5CSBA 5D70L 3RDTB 3CZJA 5HYJA 1BQHG 1TQBC 4TUKH 1I7UA 4KHTL 4LCUA 4OZIB 4Z7NF 2ILLA 5D5ME 3SO3B 4KMTL 1X5JA 4ODHH 3U46B 2C7UA 2NY2B 2DLFL 4POZC 3QQNA 5JORA 2AI0H 1K2DA 3WUZA 4MDJA 4KJQC 3B2UD 3IRPX 5GRYA 4J3XA 5GGTL 1OAKH 4A2LA 3GMOA 5JR1H 2Y06L 4K71C 1G9NH 3OGCB 3P0GB 1L6ZA 5DFWH 3WLWD 3ZKXC 1RV6X 4MJ5B 3HS0A 3GUTA 1K5NB 3PL6A 4XNQB 1IGYB 5L2KA 4FZEH 1ZWIA 2ZSVB 2NXYC 5CZKA 5HHNA 3GMMB 4NKMA 1PZ5B 2PYFA 2DBJA 4E5XA 2XWJA 1AO7B 3N1MC 4JPKL 1GC1C 5B3NA 1JWSB 4UI2A 2CRYA 3G9AB 4F9PA 5I1EH 1HOCB 2EDLA 1T5XB 3KJ6H 3MJ7A 2R2CA 4EI5B 4YAQA 4WUUA 3KLDA 5HHQA 3B5GA 5IHZB 4XMLL 4PJ9C 4JREC 2YD3A 5C3LD 4S1DD 1O7SA 1QFUH 4TSBH 4ACPA 3C6LC 4GO6B 1LO3L 4U1KA 3O2WL 2ZJSH 2VXUH 4RAUB 4RAVA 5GS0D 3SE9L 1RZFH 2W0KA 2A73B 4K3HA 1M71A 3MRKB 3P3YA 3WEXB 2AV1B 3X11A 3HPLB 3GBML 2IAMC 1S5IL 1AQKH 2YPKA 4ZTPH 5I16A 2F54D 4H88L 4JG0L 3QT2A 1TQBB 5C0DB 2EDQA 3QP3A 3EOTH 1QBLH 5DVOA 1FO0H 2DL2A 2AJYH 2OL3B 5FHAH 1P4BL 3JVGA 4BFIA 4JFOA 3O11B 1I7TB 1R5WB 15C8H 5EZIH 1AXSB 1IC4H 3I6LE 3QDJD 4PGDB 1HH9A 5DGRA 4P99A 2VR9A 4OSUH 1HXMB 1CICB 5DUMH 3HE7C 1LWRA 4U6HA 4KZEL 2E6PA 3GJEB 4C83B 5GSVA 2GFBA 3O8XB 1NEZG 3QYCA 1H8NA 3FQXA 1JP5A 4UU9B 3QO1A 2BVOB 4OF6A 3T2NH 2GJZA 4JZJB 1LK3H 3MGTB 4XC3L 4Z9KB 5I66A 3FB6B 4N0CC 4H1LA 3MUY1 4W68A 4NQDE 5HTSA 1DUZB 1WAAA 5GJTL 4UB0H 4IRZH 1OGAE 4O2CA 3T3PF 2NX5D 1ODAA 4KU1A 3SQOL 3KPLA 1FYTD 4HUVB 1T1WB 2QQNL 4XXDB 1RUML 1MEXL 5DJCA 3LN5A 5D7IB 4N68A 1V3LA 4L8CA 2YR3A 3U4BH 4HGKC 2EKSB 3EYFB 4Z77A 4AENA 2OX5A 3GNMH 4XAKD 5C6TH 3EUUA 1OAUL 4NCC1 5T3XD 3D2UA 1N6QL 3RHWF 2FBJL 5KAQG 1D7FA 2FHFA 5JHLH 3TH3T 2V5RA 3U9PH 4Q97A 2ZOKA 3MA7B 1UB5B 1IM3B 1CK0H 3RRQA 5JOFB 3CC5B 3BPNC 4PJ8A 4KVNL 1H3XA 1UCBL 5FGRA 3FTGB 4PB0L 2BCKA 1FFOA 5F7FA 3K2MC 1TXKA 2RJMA 2H26A 5DUPH 1NGXA 3BSZL 2BFVL 1ED3A 2VXSL 5MEQA 4LEXH 4UUJA 3DURA 3GSOB 2WLYA 3VCLB 1R0AH 1TZIA 3E8UH 1N6QH 5DRNB 3MBXH 5KSUA 3GI8H 5DJAA 3SGEI 3BP4A 1NGQL 5C08A 2JIXB 3DTXB 2ZUQB 3GO1H 1IRAY 1FLTX 1I9IL 4FQLH 4NNXA 4ZDHA 4NRZA 4G7YH 1DQLH 2DWDB 3IFOB 4IHOA 1AC6A 4O4YL 2OTWB 4JRYA 4DUVA 4ZFZB 5E00A 2XXCB 2YZ1A 4ZYKB 5ACLA 5HHOA 5SX5H 2DBLL 4MNGA 4OZGF 5BO1H 2YD2A 1SEBB 1WBYA 2DIBA 5E5MB 3SDDA 3MRLB 1VEMA 3AREA 4JE4B 1C5BH 3EDJA 4JPIB 2ZG2A 4U1HB 2X10A 4N8CH 3I85A 4LSSL 1YEEH 4LCCC 2AAVA 2HRPH 4MXQC 1M1SA 4G6KH 3IETA 3O6FC 4Y19A 1CQKA 4UV4L 4S0SD 4TUJB 5E5RB 3B8SA 3V5DB 3MREB 1M6OA 4PJHA 2EC9T 3CSYB 3QWOA 1QLRB 5I9QB 5DQ9A 5SV3A 1MJJB 3E6FA 2AJUL 2ITCA 2V5MA 2VZOA 1RURH 3GSNH 3DSFL 5DWUH 3BP6A 1H9VA 1E27A 1CE1L 3IAPA 4OCXH 1RU9H 2DMCA 1FCCA 1AP2A 2J4WL 2XN9D 4MNQE 3E6HA 2ZUUA 4X4ZA 4Y89A 4Y4KD 3Q6GH 2IANB 4L4VE 2BVYA 3OXSB 3BP6B 4PJCF 3QDMD 2WUBH 4WY7L 4HKJA 4WHCA 1MQKH 4MNHB 1UZ6E 1KCRH 2G2RB 3MXVH 4KK8C 3QUYD 1EAPB 3P4LA 5DQ9B 1JTOA 3QUYA 3SY0B 3U1SH 3V0WL 1MVFA 4PP1D 2HJLA 2MTPA 1T66D 4LF3B 4EI5C 5DSCB 4YXLH 1X44A 2HFFB 2YD4A 3FT2A 2SEBA 5JIIA 1RZFL 1RQ5A 3IU4H 3U7YL 2CLZA 5DHVH 3A6OA 4LCWE 1KYOK 1EIBA 3SKNA 2WIMA 4MGXA 4U1HA 2FJGB 2WUCH 3KR3H 1BZQK 1CL7H 4P4KA 5ACZB 3CX2A 4LCYB 4WHYH 5ICZB 1EXUB 1JI2A 1YC8A 4F9LC 5MP6L 1JBJA 2CUMA 3DUUA 3PV6A 3BP7B 5HHOB 1MCOL 4OD1H 4Y4HD 3QFJE 1NAMA 4HFWB 1UM4H 3MLVL 3EOYG 3MCKB 1U3YA 3IXTB 3C8HA 5K9OB 5CP3H 1BFVH 4M1GH 2FLRT 2ZPKL 2FGZA 3MV8A 1J1PL 4X6BA 4R97B 2OMNA 3GEWB 3EAKA 1C5CL 1RJZB 3BD5A 4LEOB 1LEIA 4F2MB 2XWTA 2UUDH 2PW2A 1MCIA 2LQRA 5ADPL 4MNQD 3UJTL 1L6XA 4JPVH 1AGDB 1IAKA 1YYML 5FYJD 1WT5A 1NGXB 1NPUA 3QUKA 3QNZA 5EUKB 4YXKH 3SQBA 1P1ZA 3KYOB 1WITA 2WBKA 1XF3B 2AJZB 5IG7B 5H2BA 2WBJD 6FABL 4KI5F 2H9GA 4JKKA 4FFVC 2MQ3A 4BH7B 5DJ0B 5KS9B 5CEZE 1G9NC 3VGAB 5FKAA 5BJTB 3CFEA 3CZFA 4M6OL 4EUPH 1FIGL 2JK5A 5FM8A 3AGVA 1N26A 1QRND 1ETZB 3KPPA 3OF6D 2IPKB 1YDPA 1TFHA 1X5GA 4KUCD 5HD8D 3QFJB 4JN1H 3VXTB 1J12A 2H8PA 3WKMH 3QH3A 1MHCB 3S96A 2AJ3B 4CVXB 1P84K 2O93L 2J5LC 1IT9L 1J87A 1MFBH 4BH7A 2VL5B 3KXFB 4I0KA 3VJ6B 4W4NA 3V5HA 1JYNA 3INUH 4U1NA 1FO0L 4Y4FC 1NFIB 2FB4H 1A1NB 2CIKA 4OLUH 3S34H 2DM7A 5IM7A 3QUKB 4M00A 5HY9A 1LVEA 5KW9H 1YEIH 4JFFB 4MX7B 4HIJA 1KCSH 4PLOB 3H3BC 4NFCA 1T66C 5IFHL 4KGJA 5E9DB 1PEZA 4FQXC 3O9WC 3PQYE 3FOMA 2CK0L 2A77H 1U91A 5HGAB 3TIEB 3EO0A 2CKBH 1RUPL 3RA7H 3CXDH 4RDQF 3BPLB 1BQLH 4UV4H 1HH9B 3EDDA 3ZT7A 1LO4L 1DEDA 5J8OA 5SX5K 5E2TL 4TPRH 5GGUB 1CGUA 3HE7A 3G6DL 4HIXL 5JXEC 1P53A 4FQ2H 5GZOD 1CD1A 5IW6B 4FABL 2NZ9D 4QT5B 1N3NB 4X98A 3RWJB 5E2VH 5HI5C 2YA1A 4LNVA 1DLFL 2EYRA 2ICCA 3OKMB 3V0VA 4NO0A 3H42L 4C54A 5FHBH 4F80A 3O6LH 1IFHH 2CLZB 3K46A 2VDOL 1KJ2A 2CLVA 3MRHA 5BXFA 4W4OA 3NACH 3ES6A 4PS4L 4U7MA 2AK4B 1V7NH 2M2DA 2E8YA 5CBEB 3MUGB 1Q94B 1XGPA 1A5FH 4M61A 5F89B 3KPNA 4TOYH 1TJHL 4P59L 5I1HL 2K7PA 4FQJH 1FFRA 1QRNA 2E3VA 2XKNB 5DR5L 1BFSA 4FMKA 4YPGB 1AFVL 1EGJH 4QNPE 1MLCB 2IANA 2LTQC 1H3VA 3HAEH 1CXKA 4LPUA 4YDVA 3S3JA 1GHFL 1E6JL 2Q86B 4NUJA 4PY8I 4I2XE 1MIML 4KVNH 1A7PH 2X4NB 1HHGA 3WKNA 3WHE0 5ERWA 1FGNH 3SE3A 1A1NA 2CIKB 2DM4A 3VWKC 1JRHI 5LGKA 4XC1L 3G9VA 3X13A 2ZSVA 2VWEC 4UV7H 3CFKA 4OLXH 4NM8H 5KZCD 1JUFA 1MQ8A 5FGSA 4O5LH 1W0YT 3ULVH 1G0XA 3O0RL 1TNMA 3I6KB 4WW1B 5AD0B 1BJ8A 2J1KA 5FM5M 3WIHA 4HMDA 3Q6FA 4ZPTB 2PO6A 4WI6A 4F57H 1MUJA 3FO2B 3L5WB 5ESQB 3CMOH 4UNTA 3KPPB 2L0DA 4HGWA 4HXAH 4YHYC 3QDJB 1CICC 2AKRA 3RIAF 1U8MB 3R06B 4ZSOE 4G6FD 5IVZA 1QFWM 3G5YB 4AQ1B 2VLKE 1I75A 3HG1D 1I3RB 5E00B 4ZYKA 3UMTA 1AJ7L 4FQCH 1MFEL 2H1PH 5IR1B 2BHUA 3RNQB 1FHGA 4L3EA 1CU4L 1KG0B 4WEMB 1F6FB 3UBXA 3R8QA 3HZYA 2EDYA 5CJ5A 4DN3L 5ID0A 1BZ9A 1T0MA 2W59A 4HPOL 4RGMB 5IB1B 3VRIA 3P4OA 2PW2B 2Y6SD 5J1AA 5FKPB 1QSEB 3P4NB 2VLRD 1YQVL 4PRID 1HN1A 4NP4H 5LG1A 1F90H 4U0QB 4HEME 3DSNA 5MEPA 5EZIL 2F58L 3H3PH 1CDUA 1H3WM 2EXWC 4NT6B 4OD3H 1J8HD 4JKMA 1NFDB 3DROB 4Y5VA 4U1SA 1I4FA 3E2HB 5D6DA 5EDXA 4KZDL 1I1FA 4F3FB 3W0WA 2DQIL 3ARDD 2QQLL 4V1DB 5AAMA 2XG5A 4YHMH 2X70A 4W81A 1GXEA 3TVMD 1B88A 3T0VA 4F57L 3IJHB 2HJKA 4YHLL 5DK0B 2W0FA 5FKPA 1EFXA 3QUMH 1U8JB 3RQ3A 3C8KA 1NC2A 2MWCA 3T0ED 3ZDZE 5LXGH 4PB9L 5MHSE 4JFFA 4NM8L 4L3EB 4NNPL 3RTQB 4ZS6C 5EIIA 5FYKH 3ZKQD 5IV2B 1ZT1A 5DSCA 1R3LB 1A3LL 2VLKD 5B38G 3DGCR 3AROA 3VJ6A 3DNKA 3SY0A 4PREA 3I6GA 3TP4A 3HG1E 2D03L 4YHPA 4XMPL 1V7MH 2ESVD 3U7WH 3ZYJA 1CFTB 4GW5B 3WUWB 1XEDA 1J11A 3LKRA 5K33A 4YHOH 1FL6A 3ROOA 4P23B 5ELIA 1EAJA 1NMBL 2N7AA 3FQUB 3X17A 4D2NA 4BQCA 3GBNL 3HFML 2APWA 1BBDH 1NCAL 4HPYH 3LKQA 3UZVB 1WAAF 3IKCA 4PJHB 1DCLA 4KKBC 1RZJL 3Q3GB 5ESVA 4HGWB 3EGSA 1J8HE 1T04B 1J8HA 4NN6B 3V5DA 1IMHC 5ERWB 1OGAD 1FVEB 1MH5B 4NO3A 2BVPB 5LGHL 1DL7L 4LCCB 3W9DA 1AO7D 4R26L 1SJXA 3VG9B 5A16A 4QHKI 5HDLA 3T77A 3E3QE 4IRZL 2DLFH 4JJHA 2R2HA 3KHOA 2KQMA 2GJ6D 2ERJB 4GMTL 3AS2A 2BVUA 2N7BA 3GKWL 1MNUH 1OM3H 1JTTA 5I16B 2YPKB 2ZOLB 3ILPB 3D6GA 4OZIE 5TH2B 2H45A 4RMRA 4GQ9H 1RZGB 4X0KA 4HPOH 5E4EB 1YEFL 2AV1A 4F15B 5E8PA 1TLKA 4X9BA 2ICWJ 1ZA6B 5LJYH 1ZVSA 4H25A 3REVA 3JWOL 1WZ1L 4X0KB 4P3CH 1AI1L 2FLBT 1UACH 3PWUA 2VABB 3NGBB