1JNHB

Crystal structure of fab-estradiol complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
218
structure length
214
Chain Sequence
b'EVQLQQSGAELARPGASVKLSCRTSGYSFTTYWMQWVRQRPGQGLEWIAAIYPGDDDARYTQKFKGKATLTADRSSSIVYLQLNSLTSEDSAVYSCSRGRSLYYTMDYWGQGTSVTVTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVSWNTGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords monoclonal anti-estradiol 10G6D6 Fab light chain
molecule tags Immune system
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
total genus 38
structure length 214
sequence length 218
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2001-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnhB02
4YDIH 3RVVC 3GSQB 3OXRB 4JM2A 1HEZB 5E4EB 3ULVD 3T0EB 3MOAL 4HDIA 2X6MA 1QP1A 3W9DA 1DUYA 4MA7H 2BVOA 2Y25A 3B2UD 3HAEH 3U48A 4J4PA 2CLVB 4PJ5A 2IPKA 3ZTJH 3KPOA 1HOCA 1AGEB 4HX1B 2DLGA 2ZPKL 2ZUXA 1ZKAA 1R5WB 3ARZA 2VIRB 3L6FA 4HS3A 4BFIB 4HIHA 5DRZB 2Q3ZA 1U8PB 4F37F 3AU1A 3WIHA 5DK0B 3Q3GA 3RVUD 4P57B 4I0CC 5E99H 2OI9C 1GOGA 2E7BA 2DDQH 5ANME 2FCBA 4NN6B 4O4YH 3V7AG 3JTTB 1DQJA 3NGBB 1KLUA 1BBJA 4JRXB 1FNEB 3T8XB 5C92A 1FLTX 5CZKA 4KGJA 2BSRB 3D9AH 4N0CC 4PJIE 3VH8G 3BMWA 1CFTB 1RUPL 3DI2B 1B2WL 3WNPA 3K8LA 2QSCL 3CFDA 4NNPL 3DV6A 3EYQD 2LTQC 1VFAA 1T5WA 5E2UH 1QSVA 1BZ9A 3IXAB 3B9AA 5IF0A 3C8DA 2FEDD 3EFDL 4Z0XB 2FH8A 1YNLH 3CDGA 1X5HA 3QJFB 2AJZB 3PDGA 1SVCP 4NKIL 1GAFL 3DIFA 3PG2A 2NY3B 2XWJB 3O6FA 3H3PL 3FAXA 3P4NB 3MNWA 1JWMB 3QO0B 4D3CL 1T7WA 4XPHL 3UJIL 3U0TB 5AD0B 5E8EA 4FG6D 3GJFK 5DK2B 4LLUB 3KJ4B 3V5KB 2FATH 1I8MB 3VXME 1CFSB 4NN7C 4OQTH 1B6UA 2VKWA 5DMYA 3MBED 2GCYB 4U2ZA 2YD3A 4OI9A 3FQTB 4JFXA 2NY3D 3HE6C 1A4JA 3CNKA 2VDOH 1CT8A 4MB3A 4B7IA 2VDQL 1FFNB 4UAOB 2VR9A 1IEBA 2GAZB 3UJTH 4XCNA 2DQHL 2H1PH 3NMEA 2PYEB 1X5FA 5HGHB 4ZUTA 4HIEB 4J8RB 4GW4B 5TH2B 3WNOA 1FNSL 4K3JH 5AZEL 3L3HA 1HE7A 1LO5B 3STZB 4ZG1A 5EOTB 1ZHNB 1KIUA 3NPSC 4QXGL 2CIIA 4K94L 4WV1A 4G6ML 4LIQH 4POZC 3MCKA 5I6XB 4HJJH 4WU5B 1X5GA 4F3FA 3RL1B 3V4VL 1LE5B 2AS5M 4M7ZB 1S7SA 3QQ9D 5JHDB 3HMXA 4ALAH 5DQDL 1JNLL 5T5NF 3H9SE 4JVWA 3RL2A 5IHLB 3EOAB 3LPFA 1KJ2A 1HH6B 1EEYA 3QQ9C 3RWJB 3QSKB 5SWSA 2J6EL 3VXNB 4JO3H 3EJYD 1NGWB 3KPSA 3QH3B 2DKUA 5EIQA 3MRQB 3LN4A 3A6BH 4RBPH 4TUJA 5D7IF 3VFVB 5IMMA 4TVSa 5MEQA 2J8UF 4GXUM 2H2PC 1L7TH 2W0FA 3VMNA 5D9SA 1EVUA 4M6OL 4UBDD 4NUJB 4OFYD 1S7QA 1YMHB 1RZFL 1MH5A 4Y16B 1L6XA 2R1YB 2P5EB 2FO1A 4X6FB 1KEGH 1G6RH 3T08A 2ZOKA 3W0WA 1N8ZA 3E6HA 4M43L 3HB3C 3RGVD 3L9RA 3MA7B 4JN1H 5C0CB 1TJGH 4QCIB 5DSCA 1U8KA 1JYNA 1GVIA 2Y7QB 3QUMH 3QRGL 3B5HA 4YHKL 5KVDL 5C0NC 4ORGB 5SV3A 2H32H 5IJKC 4RGNE 2BNQA 1LP9E 3ZL4H 5C7XL 4HJGA 1VEMA 3GDBA 5ENWA 3V5HA 5IHZA 4KJYB 4HS6A 1U2HA 2F19L 3CSGA 3GSRA 4M1DL 1CFBA 5L6YH 5ADOH 1R5VA 3CVHL 4LLDA 1D5XA 5IM7B 4NM8H 1LO4H 1BAFH 2MHAA 3MLRH 3EYSL 3PL6B 4OZFB 3TV3L 3REVA 3ZTJG 2VXSH 3UO1L 4ELMA 1KIQA 4C4KT 2CDFB 2X9XA 5BW7C 2D03H 4YBLB 4ZFOL 4XNYH 1I3VA 4MSWA 3O6MH 2X4QB 1M05A 4NZTH 2EDTA 3V5DB 1S9WA 4WCYH 1S7VA 3LPGA 2F5AH 1I85C 4ODUA 4NUGL 4MB5A 5DMIH 2E3VA 4PJ7B 4HAGA 1RU9H 4M61B 4Z7UE 2AXJA 2IJ0C 1JPFB 1R3HA 2P8LA 1A14H 3S3SA 1KPRB 3QXDB 5D93B 3VXRD 4KUZL 1BQSA 1PY4A 3UCRA 2G9HA 1CBVH 1IAOB 2V5SA 5E5MB 4NQSA 4U3CA 4YQXL 1X5KA 5IMLB 2D4FA 5J89A 3WFCL 4HX1A 2P7TB 2CDEA 4HKXA 5J6HB 2ICEB 2OP4H 1WWWX 3FFDA 5FKPA 3AREB 5D7LB 5LGHL 3TJHC 5TE4L 3FONA 2W0LA 1FJ1A 2WBJC 4YQXH 3ARXA 3SQOL 2IFFH 1CGTA 3HC3H 4M7LT 4BSVA 4AMKL 3MRNA 1E4KA 1PAMA 5C0FA 1SJEA 2R39A 4F9PA 1UWEL 1AFVH 4BQ6A 4JFFA 4PRNA 5EWIH 4KZEL 2XXMB 4W70A 1P5UA 5I66A 2YHGA 2V5TA 5DZLA 4UTAL 1MCQA 1I9IH 2FBOJ 4X6DE 4KWUA 4OD1L 5IEHA 5DUBB 4YEFA 3U7YL 4A2LA 1TZHA 1FNFA 3NH7H 3OMZA 4MWFB 3SPVB 2X4OA 1JUFA 4LSTH 2FIKB 4KK5D 1D6VL 4F58H 5HYJD 3ZT5A 3I6GA 2B20A 3TYGL 1OCWH 3G6DH 1I9IL 3FT2B 5KSBB 1MFEL 5HDBF 2AJSH 2DMBA 4OFIA 4R4ND 4S2SA 5DF0A 4NRYA 5D7KE 2I07B 2NW3B 1P1ZB 1FZMB 2YPKB 3QUXC 5I17B 2JB5L 3VGBA 3TH2T 3BKMH 4JREB 1YMMA 3U46A 1LEIA 2OTUB 1WGOA 4I2XA 4EI5C 1GH7A 3B2VH 5TF1H 2A83A 5FAAA 1S9XB 1I8MA 4Z77A 2GEEA 4PBXA 1JGVL 1JL8A 1JHLL 1I85A 3OF6D 3IJYB 4Q0XH 1ITCA 1I7ZB 4XBEH 4DGYL 5F9OH 3QISA 4KDTC 1OTSC 4OF6A 4TOYH 1T1ZA 2NY3C 3T0BA 1HHKB 4DW2H 5TDNB 1E4JA 3CLEL 1SJXA 2NY6D 4X7DC 4NHCL 3FQXA 2QQLL 1AJ7L 5EU6B 5I1KH 2FGWL 3HNSH 1C7SA 3O4LE 5BS0B 1M7IB 4L4VD 3NIGE 1N6UA 3JV5A 2VL5A 4LPXA 3HPJB 5FYJE 4BKLA 3S3PA 4ZUTB 1J1PL 3WJLC 5E6ID 3KGRA 3NOIA 2EIZB 3BEWB 3KLAB 4JDZB 2Q6WA 5CILH 4BH8B 4KK9D 1FHGA 2EDFA 4OQTA 3MLWL 1AHWC 1T0PB 2HVJA 4ZOBA 5CEZE 2AXGB 4J23A 5IW3A 3SKUD 3ZT6A 4GSDH 3IDMB 2VMFA 1MCEA 4CMMB 3TO4D 3RTQD 1X6NA 5IVOA 1T21A 4NHUB 1EJ6A 1MJ8L 2A74B 4M48H 5GSVA 3PWNB 1YNTA 4RQQA 5J9PA 3BWAA 1FRGL 2BOBA 2EDRA 3GI9L 1KCKA 4JPWL 1CU4H 1HIMH 5ERWA 4GSDL 2Q8BL 3L3DB 1NPUA 4CAGA 3UYPA 2DLTA 4CU7A 1A5FL 2G2RB 1ZT1A 1ZEAH 5DC0A 3QXVA 1CG9A 4NRZA 4U1JB 4MQ7A 4LIQE 3HNVH 1O7SA 1KFAL 1YEEL 2EEBA 1QSED 3LN4B 3RBSA 4R2GC 4IDJH 1DUZB 3H9SA 1BLNB 5KANG 4EUPG 2BNRA 3ARBD 5EOCL 3PHQB 1WSST 1QSZA 4G9FE 5SWSE 1YMMD 4M6NL 4NRXB 3UROR 4ZSOB 3NA9L 1FCGA 3VGAB 3S36L 5H94B 1CXIA 4R2GD 1KB9J 1FFQA 1E4XL 4G7VH 1I8IB 2NTFB 4L3CA 4Q2ZB 1WIPA 4XP6H 3S35H 3W9EA 4EZMA 5FHAH 2BVEA 4JR9H 3MLUL 2FBJL 1SM3L 1NBYB 3OJDA 3LH2L 1SYSB 2HAZA 5E2VL 4R96B 1Q9WA 4FFVC 5DMKB 3MBXL 3ZE0F 2ZUTA 4ZAKA 4PRBA 5I1IL 3MXWL 5CZVH 1RY7B 2YPLA 4KKCD 4WHYG 4DCQB 1G9EA 5C0GB 5B4MC 3F12B 4JR9L 3RTQC 2R23B 2V9TA 1GL4B 2YN5A 2HVKA 5FKAB 3MV9A 1A7QL 3QDAA 3ALPA 2BCKA 1MCDA 3IDNB 4IMKA 2KL6A 2BNQE 4KK9C 4QOKB 1LP9A 2HJLB 3M1BA 1QR1B 2BERA 3RAJL 4QT5A 2GIYA 3L5WA 1YA5A 1BZQK 4ONFH 4KTEL 5L7XH 1REIA 3BP6A 1XF2A 2XYCA 3WDJA 3GO1H 2VLJD 1AD9A 5T3XD 1JMZA 5L9DL 1ZT7A 4JFHD 1G9NL 1A14L 5MEPA 3BH9A 4HKZA 2F54D 3O6LL 5CD5D 3MLZH 3QUXB 3TBSA 2IPKB 3VFGH 1HSBB 1RIHL 2IH1A 1UYWL 4YXKH 4Y4FB 1OAKL 4S1DC 1JPFA 1R3HB 3X14B 1OGTA 3GMPA 4C56A 3OJ2C 2Q86B 2CUIA 2ZP0T 3DX6B 1KPRA 3QXDA 4M9OA 1CF8H 1GIGL 1A1NA 1C5BL 4QTIH 4RCAA 2OM5A 3BJLA 3F7YB 4ZUWA 1IC7H 1MCIA 5C9JB 1J0YA 2MQ0A 3PHOB 1QLEH 2NY6C 4Z7UA 5FM8A 2D4DA 3F7VB 4G6AD 4G5ZH 2QLVB 4HKJB 1E4XI 1UT9A 4XMKL 5GZOC 3RDTD 4HCRL 3P0VL 5J56B 4KZEH 2V5MA 1ZSDB 3TCLB 3DYOA 3AY4A 2ORBL 4KK5C 5DMGC 5C09D 4YO0B 1S7XA 1G0DA 1G9ML 5I9QC 3T0EC 3ZO0A 4Z7VA 4G5ZL 5JNYB 5I6XC 2XTJB 3ZYOA 2W0KA 3RA7L 5JHLH 2D9QB 7FABH 1OPGH 4JFFB 2FD6H 2J8UB 2UZXB 4JHAL 4HC1A 5HGAA 1QRNE 2BMKA 4F57H 4LSQH 4O5LH 1WQVT 2APWA 4GRMA 5CZXD 4JFYB 3VDAA 5KS9A 1MUJB 1QRNB 2WWMC 4N9GB 1XR9B 3QIUA 2V5YA 4R0LB 4QRRA 2QEJA 4N8CL 1IM3A 2HMIC 3RA7H 5JHLL 7FABL 4M7JL 1NGYA 3DETD 1VA9A 2P5EE 43CAA 4WU7B 1IMHC 4OZGE 3W5NA 4MD5A 4ELMF 4DVBB 5CD3A 5JHDD 5EIIB 3I6LE 3NAAL 2X4NA 3RJQB 2VLLA 3VWJB 5I8EA 4X6DA 5BOPA 3ZKSD 5LWYH 3QPXH 3INUL 2W9EH 5I17A 1UB5B 2LQRA 1BIIB 2JJWA 2DTSA 1KGCD 1DZBA 5DRWA 2OTWA 4TSBH 1HHJB 1Q8MA 7CGTA 5E7BA 5DVKA 1A2YA 1FFNA 2ZJSL 1XR8B 1WBZB 2XG4A 3IYLW 5LWYL 4UOJA 4LVNC 1U8HB 2FB4H 4OUUB 1AXTL 3WDIA 1XIWA 5GJTH 1JZ7A 3D0VA 5FDYA 1A6VL 3OKNA 5D1QA 3HAEB 1N2RB 2JKXA 1TQCC 1ZHNA 5KZCD 1BX2A 5E8PB 2AJZA 1LE9B 3OKDB 3OZ9L 2NXYC 2CQVA 3BKJH 3TBYA 1MIEL 3IFPA 3HG1A 1NLBL 3AS3A 2ZSVA 4PJAE 2Q87A 3QWRA 5CJXC 4HHAB 2M8XA 4YBLC 4AH2B 4HZLA 4JO1H 1IKFL 2WIMA 4Q9CA 5AZEH 1BJ8A 5EOQL 5JOPE 1CFSA 5A2KH 1CGWA 3PWJB 3RPIA 1C08A 2LVCA 5I9QB 2GCYA 1NC2B 3ISWA 3FQTA 2R0LL 4RGND 4LU5L 5I30H 1DQDL 2A0LC 3P11H 3T65A 4NP4H 5TE7H 2OX5A 4IOIA 4Z0BL 1KB5H 5C0BB 4U3HA 2V2WA 3DVNA 4X6BA 2X1PA 2Q76A 2ZUSA 1W72B 5F97E 1YN6A 3DJ9A 4HIHB 5DRZA 1MEXH 4X6FA 4W4OA 1BWWA 4JFZH 3OB8A 4NPYA 3GMOB 3WV0A 4L29B 1XGPB 3H9SB 4DOHB 3RTQA 5SV4A 5HJ3A 4QHLB 3RWEA 1AGDA 4W6XB 3TO2B 4PLNC 5C6PB 1R3KB 2CR3A 2VRAA 2HFFB 1CGSL 4L8BB 2XA8L 4ZOEA 3MRDB 2VDKH 4JFZL 2DOCA 4KC3B 1QVOB 3LS5H 2RB8A 4H20H 3EOAA 4KKLD 5FGSA 5DRNA 3D6GA 4RWYH 3V4VH 4OZIE 4FNLH 2EH7H 4U6TA 3WHXA 3VJ6B 1A1OA 4YBQC 3MLTA 4JZNB 5MHSE 4HXBH 2Y5TB 1KTDB 1FFRA 2AERT 5FYJL 1J5OL 1FNSH 3OKLA 4K3JL 3CDGB 3C6LD 3BGFC 1PGRB 3KR3H 3GMNA 1TPXC 1KCSL 2BK8A 3SBWC 2AV7B 3MCLL 3O45A 4JRYB 1CU4L 3JWDL 4OTXH 1YDPB 1UFUA 1FYTE 4HGKC 3HHRB 3FOMA 3QEHA 1QD0A 4OZFA 3ARPA 3WFDL 4Q9RL 5SWZE 5HSFA 4XNXL 4XPGH 2E7LC 5BRZE 3QP3A 1F11A 5IBLC 1UH4A 4P46A 3VA2C 1KLFA 3NFPA 1DBBL 5EUOB 5DJ6A 3WCYA 1KNOA 1G9NH 5DSCB 1WIOA 1ZLVK 4G80A 1CGUA 5EBGA 4JY6B 3VXMA 2LU7A 4XP5H 1PG7H 4P5TC 1P4BH 4MLIA 1MHCA 4TPRH 2OZ4A 2X4TB 2DD8L 4AIZA 5ENWB 4HMCA 2Z91A 3KYKH 1FVDA 4XNYL 2XIDA 5FUCC 4X9HA 3ARWA 1BJ1J 5TDOA 2BVTA 1UWGL 3D2UB 3GBMH 3QIBB 1JJUA 2V7HA 3VRLE 5I1AB 2RJMA 1I3RB 3X14A 4W6WB 3VW3L 2QL1A 1I8LC 3DX6A 4I48A 4PS4L 1QRKA 3LN5A 5K33A 3IDYC 2XOTA 1KTLA 5T3XL 1BOGA 1HILA 4LCIH 1A1NB 1KIQB 2EIBA 1MJJA 2AI0L 3M17A 4LSVL 4NC2B 2VN4A 4V1DD 4DOHE 4POUB 1CD0A 3HE6D 4EVNB 5ID0B 2FJHA 1ZHBA 3WE6A 1BZ9B 5IEKA 1WT5C 2AABL 5JTWA 1OB1B 3ROOB 2VNCA 3IETA 4Z8FH 4PJBB 5EO9A 4JG0H 4MNQE 1LDSA 3QXAA 1NMAL 4G8IB 2CRZA 2J88L 3O2VL 5I0DA 2A73A 1Y0LA 5E94B 1LK3L 1PYWB 1EO8L 3GM8A 3S96A 1OOAA 1UCBH 4RGNB 1H5BA 4HC1L 3L3JB 5EBLB 2DWDB 3UDWC 5EU3A 1UM5L 1JMXA 1MIML 2QV2A 1T6WA 3HE6B 4NSKB 3WKMH 1RZFH 1L7IH 5GZNC 1ONQA 3ZTNH 4EJ1C 4IM8A 2Z8VC 3KPSE 3S4SG 1KEGL 2VZVA 1PX4A 3UTPE 1BBDH 5C3TA 4HCRA 1CL7H 4XPBH 4HGWB 3QDMD 1LO3H 2ENSA 4D0DA 3NFNB 3SKNB 2DM3A 4GRLD 3HR5A 5EZOH 3MFFB 4QWWC 4WRLA 4WI8A 1BBDL 5EIIA 5JW4N 2AKRB 1RPQA 2WP3T 1ADQA 1G7HB 4AQ1B 2DQGH 4N0CD 4IRSC 4PJFB 4HJGB 5IHZB 2APBA 2ZWLT 3EOYG 2GSIA 1T0MB 1HHKA 2GQHA 4HV8B 4LRIA 1M71A 3IJSA 2R4RL 3A0OA 3MPCA 2VQUA 2JB5H 3P2TA 3V0VB 4YZFE 1S7TA 5EZLA 3LKSA 3MRCA 4ZO6A 2PUQT 5ACZB 5H8DA 4Z78A 3LQAL 4QHKI 2X4PB 1QLRA 5DRXB 1QYGL 3GKZA 3G5YB 5L6YL 3E8UH 1D5MB 4XCCL 4PIRF 4D0BB 1BX2B 2YN3A 4FMFA 4LHUA 4NO0A 2F5BL 1CGYA 5D2LE 4WCYL 3H8NA 4XXDA 1P84K 4L9LB 3DXAD 1PZ5A 2VISB 5F1IB 4HUWA 1FN4B 3H9ZA 3ZLQC 1DUYB 2J12B 5JDSB 5LCVL 1MOEA 1ED3A 3DOSA 3TBWA 5CZXC 1MAJA 1UVQB 3HRPA 4MX7A 4XX1E 1A7PL 4PJBE 4PJ7A 3ZE2E 5FO9A 3UTTE 1MCSA 1U3JA 1S5HB 2GTWA 4Y5VA 1JZ2A 3CDYA 4UIMA 5TDNA 1QHOA 2CRYA 3S37X 3CX2A 1NC2D 5LXGH 3MRRA 3R1GL 4PJAA 4QXUH 1YEGL 5CIPA 4MD4B 2IBZY 2F8OA 5LGHH 5C0CA 1UH2A 2DLHA 4EUPB 5BO1L 4ZTPH 1B4RA 4I1NB 4DW2L 1OLLA 4N8VA 3CXHK 4QRQA 1CBVL 3Q6GL 5KSBE 2NXZD 5B21A 3IXTB 5JXEA 2BVPA 1F90H 3P0YH 1QPPA 4M00A 3B2VL 4H1LH 5TF1L 3I3EA 4MHHI 1BQHG 4I18C 1T5WB 5DJ0A 3RHWK 4AM0B 2IQ9L 5EC2B 3RTQB 1NJ9A 3KPRB 1AXSB 3LQAC 4PGCA 5KJRL 2DTML 1OTTC 4BZ1H 3VFOA 2HT3D 4F7MB 4HXAL 4PJCB 4X4ZA 3NCMA 3RIAF 2DQCH 1MVFA 5E56A 2YUWA 3X13B 5JW4M 3L7EB 2APVA 1RFDH 3PF2A 5E95B 5I1EL 3G5XB 3X3GH 2CDGB 4KVCL 4P2OA 3BSZH 4ZQKA 3OL2A 1Q72L 1SEBB 3VJ6A 1OWRM 2EXYD 4A6YB 1V3KA 4NQVB 2H9GA 3QO0A 1JWMA 1H5BC 2HVKB 4MQ7B 4DN4L 3RZCB 3TV3H 3LKRA 3UPAA 4YZFF 5DK2A 3ZKXB 4WDIA 3UJTL 5D7JD 1CQYA 4JGJA 4WHTB 2MQCA 4Z0BH 1P4IH 4PD4J 3WO3B 5HHOD 5DURD 2ZSWA 2OQJB 3PJSB 3TPUA 4PGEA 3FQNA 4UDTB 4WWKB 4Y5YC 1DBAL 4OFDA 4I18B 4PP2B 1GGBH 4HIJB 5E5RB 4P9HL 4HBCH 1Y6KR 4M61A 2BRRH 4OLYH 1A02N 1EK3A 2FR4A 5J06A 4JFDB 4PYGA 2NY2B 3RZCD 4QTHA 4FXKA 4Z7QF 3R8BB 2JK5B 4F15C 5M7QA 1G7PB 1TIUA 3MR9A 1BQLL 3VRIA 2A77H 1HYRC 4KROC 1JK8B 4X4YB 4NJAH 2G5RA 1T6VN 5FUZH 3C6LA 4EIGB 4JZOA 2Q86A 5D8JL 4PRBB 2AJVL 4AEHL 3RUGE 3BUYB 2XN9B 1QFUL 3TBTA 4K94C 4XC3L 1NDGB 5GS0C 1M7IA 2XKSA 4IRSD 4F3FB 2VR4A 4JO2L 3CVIH 4RMSA 1ZXQA 3MRIA 1TENA 1W0YT 1UM4H 1CYGA 2EEAA 1BM3L 1DEEA 2B1HH 2W0PA 3B9KD 1SJEB 3KHQA 2FWOA 5IB4B 1X5LA 4AQOA 5C8JB 4QWWD 2Z4QA 1L7TL 4F8TA 4PJAF 3HTLX 5F3HA 4V2BA 3WO4B 3FQWB 5KSAD 3P9WB 3CVIL 1T04A 5DEGA 5DS8A 3MQIA 5GRWA 3OHXB 3TIDB 4TVPD 4QTIL 3O2VH 5ANMB 4JO3L 3HI1A 1F4HA 1PG7X 4KZDL 1GGIH 3NA4A 2GTZB 4OSUL 2B5IB 5J12B 1WBXB 1UZ6E 5FOBA 5GGVL 2P5ED 3T3ME 1HI6B 3EDFA 4IDJL 3RBGA 1P4BL 3TO4A 4CKVX 1XR9A 3QIUB 4N8PA 3W0WB 2F19H 4KMQA 4FABH 3RDTA 2OS7A 3LQZA 5JQ6L 4N0FA 3MA7A 5KANI 4N5EC 3PQYE 4NO5A 5GGVH 4OCSH 1LEIB 2B4CL 3SGDH 2QKIA 3GBML 1A4KB 1A22B 1FIGH 1S9YA 5BXFA 4H26A 2BNRE 2AXFA 4Z7WB 1C5CH 1LHZA 3LDBB 4M62L 1SJHA 4YHKH 3WXVH 4CJ0A 5KVDH 4MXQD 2Z35A 2ESVE 5J3HC 4UAOC 5LBSH 3MNVB 4I0PB 3Q6FA 1JZ8A 3RVTD 4LSPL 4XVTL 2W9DH 1YPZE 3BI9X 3QDJD 5SWQA 3KXFD 2AKRA 5K59E 1JTTA 1NBVL 1JRHL 4N0UB 4K23H 2YA0A 3TWCL 1CDBA 3PGFL 2PO6C 3SKJL 1J0KA 4HIIA 5HGAB 4GXUN 2ZNWA 4CVZA 3MROB 3EO1B 4GRMB 3WSQH 3B83A 4P5TD 3PGDB 4P9MH 4N9GA 3V79C 3BRGC 4HF5L 3PXHA 4H88L 3HE7D 5BV7C 3D39A 2CJUL 1F02I 2BCKB 4ZFOA 2WUCL 3MV9E 4HPYL 3O3BB 5ECJE 5CEXA 2VQ1A 3X12A 3G9AB 3CSBA 4EQ3A 4M5YL 5FOJA 3FB8A 1YJDH 4UV4L 1WZLA 2P8PA 1F6LL 3JV6A 3PWLB 4PJIA 2X05A 2RFXB 1OAYL 5IROA 1E27B 3WS6A 5MEOB 2CGRL 3G04A 1HIML 5KVMC 3EOTH 3VXUB 1CZ8H 2E7LA 2F53A 5IV2B 1DN2A 3GSNB 4BFEA 4IOIB 4XNQB 5FO9B 3A67H 1FFOA 1S5HA 2GTWB 3U9UB 4Y1AD 3RJDA 1W72A 3WIFB 1FAIH 4KMTH 3U7YH 5FCUH 1FC2D 4Y4HA 2PF6A 4L29A 4N1HB 3BP7B 2CXGA 4N0UE 1WISA 1DQTA 2D0HA 2J4WL 4JY5H 3W9EB 3VXRE 1KB5L 1JNHB 2W65B 3T1FB 1AGCB 1KUMA 2ZSVB 3ZYZA 2CPCA 1KBGH 5MHSD 4P2RA 3QDGE 4U6VH 2Z31B 3MACL 3KPLA 2V9RA 1NAKL 1CXFA 1VADA 4XCFH 5HYJB 4LPYA 2OYPA 4GMTH 2EZ0C 1AIFA 5GS1C 2FB4L 4KRPD 4N1CA 4YHYC 3PWUB 4M1GH 1I7RA 4PB9L 5D7SL 5KVEH 4NBYB 3SE8H 3CCHA 3ZE0E 3MRJA 1LD9A 4OZFG 1JGVH 3VFWB 3I3DA 2UWEB 3C9NB 5F9OL 1MUJA 1QRNA 4UOW1 4UQ2A 1PZUB 1QR1A 1TQBC 1KJ2L 3ELAT 3BE1H 1J05A 1FRGH 1K6QL 2FD6L 5C0BD 2W59A 4Z7OE 3O3DA 4YNYA 2Z8WC 3L5XH 5I74C 3MRLB 4M6MH 3STLA 3RP1A 4QRRE 2QHLA 4XAKE 3NVQA 3VXSA 6FABL 1A21A 1FFPB 2NXYD 5IOPA 4ODVL 2NY6B 3DX7B 2GJ6B 1U8IA 3EGSB 4J3VA 4BUGA 3TT3H 3Q6GH 1A64A 5HTSA 3U1SH 2H41A 2Q3AA 2UZIH 4PJ7F 3FQXB 3TNMA 4J1UA 5EFIB 3QWOB 5EG6C 1NAMB 2FGWH 1QPXA 1S7UB 3TYFA 1OT2A 1XF5A 3Q0HA 4U1SB 3MJ6A 3HPJA 3QEGL 3D0LB 1FE8L 1U9KA 2R8SH 3LEXA 1RZ8B 3BQUA 4KAQL 3IFNH 3ILQD 3QUZC 4ONHB 3VG9B 2E9IA 2VB5A 1RVFL 5ID1B 2WBWB 3GMNB 4FTVB 4TPRL 1CVSC 3SDAB 4X99A 3DX8B 5I71B 3D5OF 3BDBA 3SY0A 4OCRL 5D2LB 4OZFH 5B8CA 4R0LC 3HG1D 3QCUL 3IDIB 3QDME 1X4ZA 4B7LA 3EFFA 1MRCL 4Z7VB 1IM9B 5EOCJ 1GGIL 4RWHA 1YN7B 3OR6B 3RUGA 2NCMA 3QXUA 4PG9B 4MJIB 4M3KB 4TUKL 4WI4A 3QA3B 5CEZL 3KPSD 4PRPB 1PQZA 4HPOL 4MYWB 5I1JL 3S34L 3HZMA 2NR6C 2W1NA 4LSVH 2V17L 3EYOA 1LEKB 3I02A 4JFOA 3IGAB 1T89A 4ISVA 1TMCB 1V3JA 4XP5L 1RQ5A 1WBXA 4YWGL 5FOBB 2MTPA 3HE7C 4CNIA 2E5EA 5IFHL 2Q76B 4XC1L 4NBXB 5HYIA 2DLIA 4HSQA 2FL5B 1WEJL 1FBIL 5H94A 3WHE0 3CMGA 1T1YA 1UCBL 4QKXB 4IS6B 1MHEB 4XCYA 4LEXH 5JORA 3L95A 3MFFA 3NPZB 1UJ3B 1LQSR 5GISL 3J8F7 2FX7H 1IQDA 5H35A 1XZ0B 1A7OH 1WFTA 3ULVL 2DIAA 1SJHB 3QULA 2XZAL 3VFNB 4ZOCA 3V7MA 1CLOL 4HG4K 4BSJA 3V6FB 1WAAE 1ZLSL 2ZUYA 5CZVL 5FYJH 4LGRB 1N2RA 4JRXD 3GO1L 2PTUA 4NO3A 3PQYA 3BZEB 4YJZL 5JW3H 4PRIB 3MLTB 3N1FC 4ODXA 2IH3B 4C59B 3V0VA 2Y5TA 4TNWF 2LU3A 4GW1B 5CINH 3D3VD 2QSVA 3SDDA 4K7PY 1N64H 3GJFB 2Q8BH 1QLRB 5DRXA 5IROC 4P4KA 1RZJC 5ALCL 4IMLB 4ZNEA 1AD0B 1XFPA 1EO8H 2YZ1A 5I15H 1KCVH 2KUTA 2HRPH 4XP4H 4BH7A 3LAFA 1DBKH 2HJKB 1BPVA 3NIDF 3T2OA 1YEKL 1MWAL 3QNZA 4LCYB 1AQKH 4NQCD 1ZT7B 2OBGA 1H8SA 2Z92A 1A9EA 4ZAKC 3SCMB 3LEVH 2VXUH 3VDBA 1INQA 5IB2B 3H42H 2VQ1B 1U95A 4AZ8A 5HI4D 1MFBH 4ZD3L 5L0QB 1FZOB 4PGDA 4M8VA 2FEDC 4M7KL 4MQXD 5I30L 4NWTH 1YZZA 4M5ZL 4G7VL 2V7NB 4PJIB 4TTDC 3BW9B 3GGWA 5BVJB 3AFLA 4OGYH 5CIPH 5DJZB 2J5LB 1FZJB 43C9B 3AROA 5CEYB 2BVOB 4RMUA 4FA8A 5TDOB 1F4XL 3KPOB 2BVUA 4MD4A 2V7HB 1VGKB 1NCWL 4Z6AT 4JQXC 4PGZA 3NZHL 5BQ7B 4FQHB 1LO2H 2E7HA 3GMMB 3RY4A 2UVFA 3LY6A 4UT9H 4YHOL 1JGEB 4L5FH 3AU1B 4ZODA 1ZSDA 3TCLA 3QWQB 5L88L 2OZ4H 5IFJB 2ARJA 1FV1B 1J9CT 5HHQA 1QVOA 4OIIL 2WWKT 4WJ5B 2F53E 4OI7A 4TRPL 2BY1A 5DRNB 5DJ0B 1DQJB 2VWEE 1BVKA 4I5BA 5FUOL 3PUCA 5CLWA 3X3FL 1E6JH 2VISA 3IETB 1T7XA 1VEOA 4EKXA 3MUHL 3L3OB 1IFHL 4I2XE 5C3LD 5I1HH 2F53D 4G6FD 1V8HA 4JO4H 4JFYA 4XMPL 2FJGA 3QHTC 1U0QA 4ODSL 3O8XA 4MNQA 4YHIB 3W39B 3RRQA 3F62A 3AVEA 4RFNC 5DR5H 1R3JA 1C16A 1DR9A 3HC4H 4GRWH 4ODHL 3TA3D 3VXRA 2WIIA 4MD5B 5CD3B 1EHLL 1G6VK 4QXTA 5EDXA 5DT1H 1A6TB 4Z5RB 5EC1B 1ZE3C 1QHPA 3FCTB 4JFPB 5DFTA 3QUKA 3U36B 3KPPA 4JVPA 1WC7B 2VLKE 5E4EC 2MFNA 3FQUB 3ILPA 4D3CH 4DGIH 3H9YA 2AJYH 3VGAC 2X4TA 5CP7A 5J11B 2KQNA 5F7WC 5DD0L 1Q9KB 1X6LA 4XP1H 4WV1C 4FP8H 2NLJB 4XVJH 4WFGD 3CFKB 3KDMB 5GIRA 2CLZA 2P24A 4H1LB 4RFEA 1EH9A 1KELH 5DVMA 3C60D 4F7TA 2D7TL 1U92B 5DJYA 4QXUL 4FXLA 4J3XA 3DECA 4IOSD 2CDGA 1S7TB 2Y06L 2E6PA 5D70H 5EZLB 4WHDA 3BT2H 5T5NG 5DC9B 5C6TL 1KTRL 1JNJA 1E0OB 2X4RB 4EDWL 3DGCR 3FFCE 3VU2A 2D7TH 4P23C 4UT7L 3LRSB 4L3AA 4OAWA 5IEKB 4L8SC 4TVPE 2HTLD 4RISL 3TVMD 2GKIA 5JUEL 4NQDB 4MDIB 5C0AE 1OF2A 5ITFA 5FB8A 5IBTL 3QNXA 3QXAB 4G9FA 4D9LH 3BYYA 4L4TA 2LVEA 5GGRB 1T4KB 4Y4FD 5D2LA 4MS8C 4OCXL 5F3BA 1VFMA 2BY3A 5BZDA 1XGUA 3EFFB 1YY9C 3VFMB 3NZ8A 2OL3A 3ARGC 1IAKB 1EEZA 2QR0B 1T3FA 4BQBA 3MR9B 4J2XA 1KC5L 4PG9A 3GMRA 4LGPB 5JXED 4P59H 2VLKB 3DHJA 1RZJH 3IDXL 4PJ8B 1QA9A 4XC1H 32C2B 4OIBA 5H2BA 1T5XB 3QDMA 3H9SD 5GRXG 3T0XA 1CR9H 3OKOB 3RDTB 2EH7L 2QADB 4LEOA 2AEQH 3TBTB 2O5YL 2VL4A 4FTVD 3QT2A 2X4UA 3NTCH 5DQ9B 1RZGB 2NX5B 3RI5F 5LGJB 4JDVA 4OSUH 2Z93A 3VCLB 1SYVB 1X5XA 5K9JH 4HD9A 4MMZC 5DLMH 1FDLL 1CGSH 1GGYA 3WMSA 1N8ZB 5F7YC 4PRHA 4M43H 5FYKH 2H1PL 2DWEA 1DLFH 5FGCB 4YHZL 1FNHA 2PN5A 2I9TA 4BUHA 3LKNB 3RNQB 3O4LB 2VDPH 4GMSL 3VFSA 2A77L 1T04B 3FQRB 5DEGB 3OAYK 2B4CC 1TCRB 1GGCH 3LB6D 1TTGA 4PJCA 3UZEA 1VFUA 4DFHA 3NIDE 1X5AA 3QULB 3U4AA 1MCLA 3MNZB 4Z78B 4NKDB 3OAZK 3K2UH 3WFBH 5I8KH 4M1CD 4GRLC 1RURH 2AEWA 2APTA 4ZFFB 1MWAB 1U8LB 3FKUS 4OV6F 1WICA 1XIWD 5KN5A 3MCG1 5F1OB 1DQDH 2VWEC 4PB0H 1QFWH 2YUVA 3BGMB 4GW1A 5IJVB 5I1GL 1MRFL 1DBKL 3E8UL 3NFPB 3BGAA 4CRPA 1Z5LB 1EVTC 4NZUH 4HIXH 3ECBA 5HGDA 2OQJA 4HMDA 4Y4HC 3H3BC 4V1DB 4GG6F 3TBWB 4I18A 3MGOB 4I3RL 5C09A 4PJXE 1HZHL 5BXFB 1BFOA 4FQ1H 3EO0B 1MFBL 3R0MA 2G5BB 4QRTA 3U4BH 5C0RH 4QTHB 4KXZI 3S3JA 5DJXA 4Y5VB 1ZHLA 1LDPH 2RFXA 4HDIB 2PTTB 2ICES 3AMLA 3ARYA 5INCB 3O3AB 1EGJA 1A7OL 2A6IA 4LPVA 4XC3H 1HOCB 1HYSD 2DQHH 2PYEE 4JN1L 3V4PL 3WUWB 2NNAA 1I1FA 1UEYA 5GGSY 5DJDA 4O58L 4J3SA 1AY1H 2PW1A 3PXJA 2O5XH 5EORH 1AXIB 1VACA 1QUNA 3MROA 1M7DB 5DMJB 2PXYC 4MVBC 3GJEB 1MCFA 4K55A 3QRFM 2RQ8A 1IGMH 2ZKHL 2FJHB 3NACL 3U7AA 5EC2A 5C8JA 3ROOA 2C4FU 1RIVL 3MJ7B 2BSRA 3MX0A 4WI9A 1FC1A 3ZDZE 2EXYC 4P23A 3O3BA 5A16A 2XZCH 4Z7QE 1UM4L 5T3XE 1A0QH 3DO3A 1J1OH 5E9DE 3WL9B 2Z31A 2VXTL 1LK3H 3OHXA 2CJUH 3KYNA 4M7LH 4XMPH 2EYRA 3EJZC 5I2IA 2HTLC 4PY8I 1MFAL 1CE6A 1DP0A 3P9MB 1SEBA 4OLXH 4I5BB 5ADPL 4NN5B 3ROLB 4YH6A 3W5MA 3X3GL 4HWBA 4WUKH 1EFXA 4EI5A 2ITDA 3D18A 2HFTA 2D03L 5DJCB 1F2QA 3P4LA 4TSAH 2F58H 4AEIL 4GBXC 2A9ML 1MNUL 3BJ91 1KN4L 3VWKB 5IT2L 4QY8A 5DHYB 1U93A 2LAAA 5GRUL 3CZFB 1JHKL 3MUY1 4L3ED 2V5RA 5E6IB 4NC0B 1CFQB 1F8TL 4KV5E 3HG1E 4QF1B 3BE1L 4HH9A 5H37G 2BFVL 1AKJB 4JFQB 1JHKH 4XHQA 3A6CL 5HDLA 3QIWC 1F13A 2VQTA 2ATPA 1MPAL 2XN9A 3GHBH 4XCNB 1N6VA 5ACZA 4YHLL 4ZPTA 1NMBH 1AH1A 1FYTB 1NC4B 4LCCA 2FWOB 1HKLL 1ZHKB 3C9NA 4HC1H 3GSVB 4XXCA 5CBAA 2VDNH 4P3WA 4NOBA 1CCZA 4RDQF 3DX8A 3BISA 4FQXA 4AT6A 3TNNB 4YFEA 2UYLB 3H7BB 2XTLA 3V6OC 2UUDH 2WNGA 3BP4B 4PJDF 3HPLB 4S11A 1JV5B 1OQOA 3CU7A 4U1MB 5EO0B 3M45A 4OAWB 3UPRA 4YK4C 2IANB 4RGNC 4IMKC 3RL2B 3SOBL 4LVOC 4OKVB 2F9BT 4EEEA 3QNXB 5EN2B 2IBBA 2BZDA 3E2HB 1BZ7A 4QHNB 5IMOB 5D93C 2C3HA 5JIPA 1BF2A 3G04B 1NGWA 1J1XL 4MJ6B 2UWEF 5D5ME 1GPOH 2N7AA 2IQ9H 2Z8RA 3EDJA 1BFVH 4FFYL 4ZTOH 5C0DB 5C0AA 1R6VA 4GKSB 4MGXA 1A6UH 1U8OA 5JOFB 1N5YL 3QJHA 3AS2A 2BNUA 4GW4A 5IKCB 1ZEAL 1IKNA 4OLZH 4AG4L 1LNUA 3VMPA 4UU9A 1FDLH 3S8WA 5FDWA 1K4DA 3V6OA 4MQXC 3GMQA 1T1YB 4RX4D 2X1WL 4M62H 4N1EA 2X41A 3WXVL 2W07A 2D7MA 4LHUG 3UTTB 5BRZA 1QYGH 3MACH 3R8QA 5E2TL 1D5BB 4XCCH 4E5XB 3IDIA 1S7SB 4JO2H 3VXQB 2DM2A 2HFEB 3I84A 4J3TA 4LGSB 4NCDA 4NKMA 4HQQH 4NM8L 1DN0A 2IADA 4ENEC 1I1CA 3MOAH 5C2BH 2DJ4A 5ALBL 5DJAA 5F6HI 1PX3A 4K23L 5J1AA 4Q2ZA 5CHNB 2H8PA 3B9EA 3FHQA 5SX4H 5IM7A 3QCTL 4K2UL 4U0RC 1V5JA 4R96A 3K8MA 1ES0A 4U1LA 3MNZA 1JP5A 3BPCB 3IGAA 5B3JF 5KVGL 3DGGB 5D6DC 5C0EB 1QKZL 3TT1L 2ICCA 4H88H 4P4RB 4P46D 2GT9B 2GK0A 4ZUVB 4J4PC 4Y16D 2XQYK 5DEZA 5B39B 4LHQB 4LF3A 3BD3A 4GG8A 5HGBA 3T0WA 5IJVA 2CLRB 4PJCE 1DVFD 1INEL 3QIWD 4NJ9H 3SCMA 3L95B 5HY9A 1K6QH 2YD1A 3EZJB 1Q1JL 1DEDA 3HMXH 4NNXB 4Y2DA 5JQ6H 3OXSB 3V4UL 4NT6A 2N1KA 4KTEH 3O0RH 5D7LD 5L7XL 3VXSE 5TF0A 3L3GB 4IRJA 1Z9OA 1MSPA 4OF5A 1UENA 4IRSB 4J1UB 5D8JH 3DUSB 4KAQH 3BD4A 9CGTA 3MRBB 5DK0A 3Q3GB 5IGXL 4DKEH 4L3EA 2QQLH 3QBTB 5E5MA 3Q5TA 3VFUA 4WTWA 3SGDI 1XGTB 4QHKJ 1IC4L 3PDOA 3OR7A 1LO4L 3DROB 4PJXA 4LFHD 5DXWA 5KTEL 3D87B 1RUKH 2P7TA 3EYSH 1HXYA 3V6ZA 4XB8A 5F7MC 5FKPB 1BOYA 4X4MA 3BAEL 3LH2H 3OAZH 1IEAB 3I6KB 5HHOE 5DS8B 3CFDB 3IKKA 5B38B 1ZGLB 2ERJB 12E8H 3ARDC 3MRNB 1BQHA 3ALXA 3F6IA 4Z7UB 3C6LC 3FB5B 1RUKL 1WFUA 5JO5B 1D6EB 2MNUA 4BK4A 4RFOH 1IM9A 1DQLL 5GS3A 1JNNL 4NQXA 5CP3A 1TVBA 3WKNA 4ODUB 4HJ0C 4CADB 2P5WB 4PJCF 3MO1B 3G6DL 4PRID 4KKLC 1VESA 3CDFA 3GKWL 1IAMA 3QUZD 3ILQC 1JUFB 3IRZA 4O9HH 1QLFA 3K74B 5BVJA 4JFOB 3WO4C 4HK3N 3SKOB 5C71A 5FV2A 1B90A 1CGXA 2DAVA 1EV2E 1EJOH 2X5PA 2DB8A 4K94H 3SKMA 5E9DA 4UNTA 4N0YL 3RHWF 2V17H 1CICC 3QZWB 3V0WH 4OM0H 1MWAH 4P49A 5B4MD 1QFUH 1CLZH 4TSCL 4PRDB 3SDAD 2H6PB 5JORB 3FFDB 5KOMC 4EQ2A 4M02A 4DVBA 1PKOA 2YSSB 3DMMB 3ZKNC 4W68A 2ITCB 4XXCC 1EHLH 1XZ0A 2NW2A 4QO1A 1I3UA 5D1ZD 3V0WL 2NLJA 1TETH 5GGTL 1NQBA 1GIGH 4M5ZH 2DQIL 1MLBA 5GRVK 3O3EA 1EFXD 3HS0B 1GZPB 2P45B 4KHTL 2Q1EA 1G6RA 4NO3B 1DQMH 3EO1A 4PJ7E 1DL7L 1UKQA 5DURB 3ARBA 2IH3A 2BDNH 1FNGA 3NN8A 1IQWH 2VE6A 1NH6A 2G60H 5BS0A 3TH3T 2MOVA 4RGOL 3IFNL 3FB6B 4WU5A 3DIFB 2NQCA 3NCJL 2HRPL 3O81A 4WNQB 4QHUB 1EAJA 2L7JA 4QXTB 1FIEA 1TZIA 5CSZB 4LCCB 3S5LG 2VXVH 3LMJL 5D5MF 3OAUL 2X9YA 3D48R 5C0CE 3ULUH 4WHYH 5FB8B 1MCOH 4RGOH 3F7QA 4OQ1A 3TNNA 5E8DH 5C08D 4L4VE 4IOFD 1A9EB 1IKNC 3RGVA 1U8MB 1A4JB 1WAAF 1YMMB 3UAJD 5EO0A 1NBZB 4UV7H 3RX8A 2F53B 2PW2B 3HNVL 1MREH 4Z77B 4PRPE 4ZFGL 4LQFL 4KRPB 1T3FB 5E4IA 3FTGA 4MAYD 15C8H 4PJ5E 5EN2A 2W0FB 3H2WA 1NC2A 4LSPH 4XVTH 3BW9A 3GGWB 3MV9D 3VWKC 1YQVH 2YOCA 1CDUA 4F7TB 4NRZB 4U1JA 3ZHLA 3RVXD 1TXKA 5EOTA 1DQQB 2VOTA 1RHHB 3IDJB 4OFVA 3WN5C 3ZKQD 5E6IC 2GSGB 5JLZB 1U8OB 1FNEA 2X10A 3MLYL 2A1WL 4WW1A 2DQDH 4XBEL 3LVEA 5FYKE 1JGEA 4WENB 1Y6NR 2VITA 2HMID 3DO7A 5L8LB 2WWMD 5TQ2H 5I75B 1EZVX 2AXGA 1FG2B 5IQ7L 4EDWH 4Y5YB 3GSRB 3GSNL 1EEUA 2R29L 4G8GD 2XZAH 3MRKB 4ETYA 2XWTB 3T3PE 2NPLX 1R5VB 3QR2A 3FHAA 3VRJA 3ARGB 4LLMA 5EZIL 4JG1H 2M2DA 3OB0H 5EUOE 1LD9B 1CLYH 5GGUA 2UUDK 3TVMC 5BS0D 3SE9H 4XVUC 1WWBX 1FL6B 2HG5A 2YPLB 4YHIA 1AGFA 5EU6D 1RK1B 1WLHA 3CUPA 4JZNA 6CGTA 4IRJC 3RDTC 5AYQA 3P4NA 1TVHA 2VDRH 4DFIA 2EICA 4KQ4L 2B1AH 4LLUA 2ILLA 1A9BB 4ODWA 1GC1C 5F6HJ 3SDYH 1EMTL 3R06B 5IOPB 4JZJA 4WO4C 4PJ5B 3VGFA 4R90L 8CGTA 2GT9A 4LCWB 3WFEL 1A3RH 4UNVA 1XT5A 2VSCA 2B1AL 2EDYA 4Z18A 4QRSB 2J8HA 2PETA 3E3QE 3AREC 5F1NB 4P5MA 5HGHA 5T33H 4FZEL 5FV1L 5KVFL 5TH2A 4LRNH 2WZPD 1TJIL 4X7FC 4GRLB 2YD9A 5E2WH 3WIHH 2AEPL 1BBJB 1YC8A 5DJYB 3RKDD 4IRSA 4XCFL 2X2YA 3KYKL 5ALBH 4CW1A 3GSXA 4WUUD 1AP2A 2DJSA 5J4MA 3S34H 3P0VH 3NTCL 1IAIM 3O9WD 5L2JB 2QADC 2D7OA 3QFJB 4PJHE 3DROA 4PJXB 5BVPH 5C0FB 3QIWA 4HKJA 1KCRL 3ECBB 1IC5L 1QKZH 3TT1H 1A5FH 1AKJD 4LHJB 3E6FB 2FYYA 4ONFL 5DUMH 3QQ3B 4X6CF 1IEAA 1OLZA 3BP5B 5F3BB 3W39A 2LFGA 2ESVA 4LCCC 1JGDB 4XPTL 3D85A 4OTXL 4LPUA 2EH8L 2FNBA 3O6FB 5D2NA 2WIIB 4HS8L 4OJFH 2DLEA 2BX5A 1RURL 2IGFL 3BD5A 1OM3H 1FSKB 1RIVH 3FT2A 1KCLA 1S7QB 4XNMA 5I1KL 4RMQA 1N3NB 3MRPB 1OQXA 2DWDA 4MCYA 4XPTH 1KT2B 3T2NH 2DYPD 2AJ3A 1UA6L 5FK9A 4NSKA 2YPKA 5E1AB 3VWKA 2ZOLB 5B22A 3ILPB 3VXMD 2FBJH 2IQAB 3KNBA 1OM3L 1IC7L 3DI3B 4RMTA 5DA0B 2EDNA 4JPVL 1JGLL 2UWEE 4NZRL 4DAGL 1L9NA 3IDUA 2HLFD 5A2JH 1V7MH 5ICZA 5HI4C 1OAKH 4PD4K 5I16B 3WLWD 3VGDA 2QSTA 5I66B 1IZJA 2J8UE 2VLRA 4JPKL 1JYVA 1P7KB 1HHIA 1G9NC 4DGVL 3CIQA 3VI3E 2XFXA 2C4FT 2BDNL 2EDLA 5F44A 3GJFA 3FN0L 2H3NA 3PV6A 4MB4A 4LPWA 3RGVC 3Q1SH 1Y6MR 2P8MA 3MRMB 4U3XA 3UTQB 2JELL 3BN3B 1DDHB 4QHMA 1G6RB 4GQ9H 3VD5A 3KYOB 1I9RH 3THMH 1RULH 4UTBH 3ZYJA 5E8PA 3GSVA 4OLXL 1TJHH 5TJWK 3H7LA 2VJXA 4GJTB 4P2OC 3TVMB 4G9FB 1ODAA 1JWUB 3FB6A 1G9MH 4ELME 3GIVB 4XNXH 4XPGL 4YDIL 3PP4H 3HG1B 1YEHH 5EWIL 3MV8E 5IBTH 1XGUB 5CSZA 4RQQB 1J8HD 4D0BA 4HJ0D 4PYHA 2IPTH 1IT9H 1VGEH 4NQED 2QR0A 3VFPA 3MV8B 4OD1H 1MNUH 1VPOH 3G5VB 4QEGA 4B5EA 5JZ7C 1UB6A 4G8FA 4LQFH 4U05A 2W9EL 4KRNA 2BSSB 4ACPA 1H3PL 3S4SB 2OMBA 4ZXBA 4U1NB 1MQKH 1CG9B 1MF2L 4JFQA 3B6SA 4OT1L 2NZIA 5D71L 3OV6A 3QDMB 5LJYH 1NBZA 3L5HA 1X4YA 4HULB 1FLRL 4GO6B 4HT1L 4YGVB 3WNNA 1A2YB 3QIBC 2DYPA 3MBEB 1N5AB 3L3KB 1AY1L 2AJUH 2Y6SC 5AYUL 5DQ9A 1SHMA 2VL5B 2CDEB 2SEBA 5EU7C 1K3IA 4LLWB 4RGMC 3ZHKA 1HHHB 5IMKB 1P7QD 3MLYH 2VH5L 4CGTA 5GRUH 1OAQL 4OCYL 4PJAB 1FV1A 1W0WB 3MMEB 1FLRH 4HT1H 2DQGL 1LGVA 5CINL 3L7FA 4Y0GA 3WS3A 2FRGP 1I8IA 2GJJA 2HVJB 2H26A 1II4E 3RNQA 1I9JL 4NZDA 3IDMA 4LOUD 5MP6H 4CVXB 4J4PD 4P46C 1NAMH 5D1XD 3KLHC 5D7JB 2J5LC 4N8VB 4CBPA 1O0VA 3RZWA 3P9LA 2D3VA 3ZSSA 5E08H 3HNTL 3IXTA 5DMKA 2ARJQ 1T1WB 2FHCA 2GFBB 5JXAL 4WY7L 4YPGA 4IIQA 4MAYA 4TQEH 3VXSD 1MWAA 2J88H 1C16B 4Y5YA 5FUCE 3T09A 1WF5A 1T7ZA 4ELMB 2KDGA 3HI6H 1JFQL 2NY5H 3LSOB 3ZE2F 1T22B 3MV9B 2ZG3A 3VGHA 1J86A 4KI1A 4Y16C 1MFNA 4XVJL 5K9KA 4ZFGH 3QPXL 4MAUL 4P5KA 1MCRA 1G7JA 2YC1B 2WBJD 5ISZB 1CIDA 1WC7A 1DANU 4EIZC 5T1DL 3NCFB 1N7MH 4P0DA 1RUQH 1F8TH 3N9GH 1S9KC 5EU7E 1IGCL 5F8RC 5DQJB 1TTUA 4I2XB 4OLWL 2OR9H 3ARFB 5EUOA 4NPYB 4XMKH 3SDXA 4OV5A 1YEIL 4G7YL 4HLZG 2E9BA 2Z8SA 4UDTA 3M07A 1Q0YH 2VDMH 3DMMC 4ENED 3O11A 4H1LG 4IRJB 1FL5A 1KELL 1GOHA 5BRZD 5KVFH 5T33L 5F9AC 5K9JL 4AJ0A 4JFDA 1WBYA 2QQKL 3DUSA 5DJAB 1KV3A 4Y4KD 1A6WH 1NLBH 3QAZC 4G6MH 5F1NA 3VD9A 4I3SH 5I1CH 3OF6A 3BOVA 1VDGA 2YPLD 3GJEA 3QEUA 4KRLB 3RUGF 5JW5B 5GZND 1XGTA 2VDLH 5ITBH 5KBNC 1MCBA 3C6LB 5B38G 2FH6A 3BZ4B 2APXA 4RIRA 3RWHB 4FQ2L 1QRND 1ZOXA 1KJMA 4I3SL 3S5LB 5I1CL 5HYJE 4MJ5B 4LSSH 2DKMA 1FGNH 3QG7L 2EE2A 2AGJL 1ZA6A 5DT1L 5FYLD 5GQBA 4OCXH 1AD9B 2R0KL 3PWNA 3B2UC 3HR6A 4JM2D 4LKCB 5AUMA 3HUJE 2C1PB 2ZUVA 3UEZA 5C08B 5HY9B 1X7QA 4LLAA 1OP9A 4LSSL 2ITDB 1BZ7B 3D18B 1ULVA 4NYLB 4XCEB 1EA9C 2Y07H 1NFKA 1I3GL 1B9ZA 3AS0A 4YDKH 5F96L 1OP5H 4PJHA 4JPIA 1WAAA 1QLFB 4XPAH 1FVDB 1F3RB 5D2NB 1XMWA 4ELKB 2A9MH 1JNNH 2X4NB 3EYUH 4E0RB 5TPWL 3HB3D 3BQUD 4JHWL 5IWLA 5DYOA 4U1KB 5BO1H 3QZWA 1JHLH 1I7ZA 3FO0L 3VW3H 5FK9B 3V6ZB 2MPAL 3HR5B 3OBAA 2EDKA 1HK6A 1Q9OB 2N56A 1KJ3L 2QKIB 5B38A 1ZGLA 5IVXF 1SBSH 5DHXB 4RAUA 5DQDH 3VRLF 3I2CL 2EC8A 1JPTL 4OIAA 2A9NH 3T0VA 1T7VA 5ICZB 3GHEH 1S3KH 1T0MA 2YPVH 4RNRA 4C4KO 1DBMH 3OKNB 2Y6SD 1UC6A 4XTRD 4LK4A 3AGVA 3QIBD 5FHBH 5JOPD 1DE4A 5E2VH 1NUDA 1HDMA 4QOKD 4ERSH 4XPFH 1QLEL 1UM5H 3EJZD 5GRJL 5KZCB 2MWCA 4F7EB 2A9NL 5IQ9A 1X5ZA 3P30H 3QIUD 3MLVL 4N5UA 2EXWD 3QHFL 1UADC 3PP4L 3ULUE 4PG2C 5HHMB 4KTDL 4GBXD 2HJFA 5CEZD 4CN4A 4XNZB 3NGBC 1PSKL 4YHNA 4JLRB 4U1GB 4OKVA 3L3IB 4K9EH 4JQIH 3TVMA 4LDOB 4R7NA 3QQNA 3UTOA 3BEVB 4F80A 1E6OH 4MJ6A 4C54A 1HHJA 5LXGL 1U41A 2DI8A 4KU1A 1KB5A 3V8CA 4PS4H 3O3UN 5F7DB 4N9OB 2NY4D 4NQEB 4MCZA 3FMGH 4DQOL 4U1IB 2D7NA 3O3EB 4MXVF 4M7LL 4UI2A 2GJ6D 4C56E 3LKOA 1XGQA 3IU3B 5KAQF 1W72L 5CIPB 5D1QD 2PXYD 2NXYB 3MCLH 3QCVH 2PNDA 5GS1B 3T1WA 4FG6C 1GC1H 5D96B 4MLSA 4G6KL 4U1HB 5C0IA 1FAIL 1NFDE 2RBLA 1QFHA 3DUUA 1HYSC 2BHYA 1W8OA 1FP5A 2UVEA 4D8PA 1XCQA 3P4OB 3T77B 2PYED 4X4ME 3WIIH 3IU4H 2ZUWA 3UZVB 4BELD 2HFGL 3HZYA 3T2QA 3P9MA 2MCPL 3WHXB 4X7SL 5HI5D 1WFOA 5I1DB 5HPOA 2R0ZL 1JPSL 3FZUD 3ARGA 4LLMB 1QFWM 4F7MA 1U36A 1ZA3B 3T65B 4DN4H 1XF4B 4HF5H 3OX8A 2VLJE 3X13A 2GFBA 4PJ9C 4LASH 4XMLH 1BGXH 2QJDA 5D6CB 5ESAB 3QCTH 2G60L 3EDKA 2DQEL 4YPJA 1LDPL 4OD2B 4KI5C 4GRWE 3O9WB 4PJ9D 4PB9H 5D7SH 5EPMA 1TVHB 3K1DA 5EU5A 5T1DH 4APQC 2P49B 2NMSA 3CCHB 3QEQD 2QTEA 2W92A 1I7UB 2EKSB 1X9QA 4ZYKB 4OZGA 5T3XH 4Q97A 1GPOL 3BZFA 5ISZA 1S7RA 1U6AH 4G80B 1VB9A 3TBSB 3FFCA 5IB5A 2VKXA 3L5XL 3E0GA 3KPTA 1ZGLM 5BV7H 1XEDA 5FGCE 2HWZL 1I7TA 3LB6C 1ZVSB 4HLJA 3BWUC 3CC5B 4C56B 5E70A 1ZLUK 3ARRA 1CD1A 1WK0A 4Z8FL 1IGTA 4S0SD 3GBLA 4WI7A 1EHNA 2IG2L 3HI5H 1OGAB 1ZAGA 5CP3H 3MRKA 3P0GB 4V1DE 5D1ZC 3PNWB 1PJ9A 2VLME 1AXSA 4WUUE 4H5SB 5ESQB 1WFNA 3DETC 3PHOA 5FF6B 3VFOB 4LLYA 1NC4A 2VUYA 3CSPA 4KTYA 2RCSH 2IALB 4G8EA 4MNQD 3G5XA 3KPQA 5JIKA 2NY4C 1LO0H 4UNUA 1T2QL 3DPBA 4Z7NE 4HWZB 4R7DB 1KBGL 1EGJH 1MVUB 1ZMYA 1GRWA 1HINL 1JV5A 1MFCL 4EVNA 4M4RA 1NKRA 1AI1L 4HHAA 4CU6A 4FZEH 5IB4A 2BSTB 4S1RL 4JFDE 1MJUH 2CKNA 3I9GH 5T3ZH 3VE0B 1GHFH 3UTPD 5E8OA 3EW3B 2HN7A 1RMFL 4OFPA 3EHBD 4IBLT 4O5LL 3ARGD 4OCRH 2A73B 1H3XA 2VZUA 2Q7NA 2R4SL 5HHXH 2DQUH 3HCVA 2VXVL 5EU3B 3VI4E 4G6AC 5D7IB 4L4VA 1CLYL 2PW2A 3IF1A 5F96H 3L5JA 2DBLL 3I50L 5C0BA 4OFYA 3VG9C 3EOTL 1U3HB 1XCTB 5DHVB 2ED8A 3V8OA 4PRPA 3ULSA 3BMVA 3ARDD 5I8EB 2I25N 2PCPB 4Z76A 1G1CA 4KFZC 3K8KA 3HZMB 3LZFH 1BF8A 3GRWL 4KQ4H 4ZO8A 1OSZA 4XTRC 4ZO7A 3TPKA 3NFNA 3SKNA 3GMOA 5E1AA 3WJJC 1BIIA 2IANE 1A6WL 4ELKA 4KJQD 1HILB 2P1YA 3U1SL 1OGAE 2F5BH 1LK2A 3TO2A 3ZE1F 2UZIL 5DTFA 4YAQA 5DYOB 1G7HA 2B1HL 3C60C 1Y18A 4OGAD 5ID0A 1MHHB 4GKZB 1IILE 4K8RL 1AQDB 5FUZL 4I0PA 5F3HB 1WIUA 5EZIH 4O02H 3QDGB 1BHGA 2L7UA 4S1QL 3TZVC 5DFVC 3ZDXF 5IHBA 2VE6B 3SQBA 1JWSB 3AAZA 3VDCA 2ESVB 3OKLB 3F5WB 2BNRD 3VWKD 5I8CA 2UZYB 3HLAB 1Q94A 2V6HA 3PV6B 2D31B 4RWYL 1FSKC 1PW3A 2GTZA 1XGRA 3SE8L 3RAJH 3ZZ1A 1I8LA 5F93C 2WUCH 5JPMA 1F4WH 4XWOD 3PQYB 1RD6A 1KB9K 5EBWA 3WJJA 3CDCA 3UAJC 5B39G 4HGWA 3PWJA 3RPIB 4OM1H 3BZDA 4NQEE 3W2DL 5SWZA 5IQ9B 4D0DB 1KCUH 1XF3B 5DJ6B 3DTXA 5IGXH 2OSLA 5LKNA 2AJXL 4XX1G 2IQAA 4WTZA 4JM2C 2B4CH 2HJFB 3OJMB 1YPZB 3KWWA 5DGQA 2JELH 4C58B 1BFSA 3G5VA 5AG9A 5MEND 4KXZH 3W2DH 5CAYB 4AIZB 4ZXBB 4BZ1L 5I73C 1M71B 3IJSB 3ZTNL 4P5MB 3MLUH 4K3EL 1MEXL 4KMTL 3TP4A 3DLQR 1P7HL 3NCYP 5CBEA 5C70A 1OT1A 3TN0D 4F9LA 1QZ1A 5HHVL 1I3RA 3QCVL 4ZSOE 2AVGA 3O2WL 4WFHE 4AIOA 3HZVA 4NZJA 4R8WL 1FIGL 4GG6B 4M93B 3GSXB 2VIRA 3L6FB 1QR4A 3SN6N 3UTQA 3VXUE 4HK0A 2BC4B 3MYJB 3QI9D 5DD3L 2BVPB 5F71A 2XG5A 2K1MA 4JKPL 5GRZA 4OT1H 1BQHB 5GRJH 4I9WD 2ATKB 2IMMA 3QUYB 1ZVHA 4WW2F 4L9LA 1F4AA 1OB1A 4Z95H 1PLGH 1TFHA 5GS2D 4JREC 4M8QA 2XWTA 3CFBB 3QDJB 4LCIL 2P5WD 4HUWB 4UT9L 4YHOH 4DTGH 2EDWA 4HPYH 1JHTA 1CXLA 1L6ZA 4LARH 1QBMH 3H0TA 1YECL 3HUJB 5IFJA 1V3MA 1ED3B 4P2CG 3RNKA 2FO4B 2K7QA 2X89A 1YDPA 3ZDXE 3VXPB 1RK1A 5IIEA 1OAZH 4HEME 3HE6A 3WN5B 1YUHA 1P7QA 1DJSA 4NC1E 5DUML 5FO8A 5MEOA 4S1SL 1INDH 5IB3A 3RVWC 3THML 2XN9E 1CL7I 3QJFA 5JDJA 5D2NE 2F74A 1KNOB 1HHGB 1A47A 4LPTA 3R06A 4PTUA 4KHTH 3NBNA 4HIJA 3W81A 1YEJL 4KV5F 4N90D 4IDLA 4P57A 3WYRA 2YSSA 1BVLA 1NANI 3DMMA 1A6TA 2VERN 4ETQA 4O2EA 2FSEB 4Y4HB 2VLJA 3KLHD 1FYHB 2DQJL 3KPNB 4Q6IB 1ADQL 3FFCB 3BH8A 1F6AB 4LVHB 4DN3H 3T2PA 5LQBL 3N9GL 3L7EA 4FFZH 2NX5D 1OHQA 4TULL 2I9LB 3DRTB 4AYFA 1OPGL 3KS0H 4ZQKB 3CFKA 3STBA 1HQ4A 1PEZA 3REWB 5ISZE 1HXMA 3RWFB 3ZKMC 3IAQA 1B2WH 2KBGA 5FA3A 3LSOA 3MRMA 4H8WC 4Z0XA 5D5MA 5F89A 3QFJA 5I8OH 5FXCH 1TZIB 1KTKE 4RZCA 1F3JB 1B3JA 2WBJB 5ISZD 3C08H 4O4YL 4WWKA 3EUUA 4X6EA 3GIVA 1MRDL 4NWUL 4PP2A 4YBQD 5IESH 5KW9L 3U82B 4WUUA 4EDXB 1LE5A 1EUTA 1I9RL 5CCKL 2W60B 2HKHH 3O41B 5DEFA 5ABDE 1J12A 4KUCD 4Q7DA 1ONQB 3MV8A 4Q9QH 2D7PA 5I1EH 3MRHA 4JM4L 3GEWB 3DUHA 3LKQA 4O00A 5E2UL 4HKBA 2E27L 3QA3A 5GGVY 4MNGA 1T4KA 2ADJA 2JE8A 4HS8H 2F8VA 4OJFL 3FAWA 4G7YH 1NL0H 5TQ2L 4M6ML 3IFOB 2R1XA 3FO1B 2AK4D 4FQLL 4G3YL 1ZLWK 5MI0B 1CXKA 3KLDA 3QZWG 3QFDA 3MRIB 4Z7VF 2R2BA 1TNNA 3KAAA 2JCCB 4XP1L 3SO3B 1OSZB 4MMXC 5HI3D 3MRFB 4PV8A 3VD4A 4ZTPL 4X99B 3OZ9H 2O5YH 4WV1B 4G9DA 3FQWA 4M1GL 4MJ2A 2OZ4L 1MIEH 1IGFL 1VFBA 3U2SB 4LPCA 3CH1B 4JDVB 3V52L 5C07B 5ESVA 5T1MA 1IC1A 3U6RA 1J0ZA 3LKSB 1B0WA 3WLBA 1NCCH 4PRHB 4Y19A 1OAYH 2AJVH 3FRPG 4DVRL 3MXVL 2IF7A 4CN6A 2FJFB 4ODBD 4XBGA 4MA8H 3BKCH 1G84A 2VZ3A 3Q48A 5MERB 4DUVA 1IEHA 2AXHA 1D5XB 4HAFA 4EN3C 3FB7B 3LD8C 5JR1L 1WTLA 3TESA 1JWUA 3AC0A 1RFDL 4WHTA 3K2UL 1PZ5B 3BSZL 4OLEA 4WI2A 3K4AA 3U7WL 2NYYC 3TT3L 3H6JA 3C5JA 4PJFF 4MA8L 1NEUA 4KRMB 5CEXB 2BOCB 2EIEA 1TVDA 4E0RA 4JFEE 2R1YA 4Z7WA 4Y4KA 4A2MA 2BSSA 4NQCB 2CK0L 3SDCA 1F58L 2Z92B 4UIMB 2NY1B 4M1CC 2C9AA 2R2EB 5HGDB 1FE8H 2Q8AL 4ORZC 5HHOA 1YNKL 1H3PH 4X4YA 3VD3A 3O11B 2W9LA 1TJIH 2OL3H 3ULVE 1K8DA 2YRZA 1CLOH 5T3ZE 3TBVA 1KEMH 3LV3B 4NQEA 3BN9D 1L4IA 1BQLH 5KVEL 1NDGA 2XKUA 3QUML 3QRGH 4IJ3B 4ZFZB 4K71C 5L2KD 3UTSB 2X4SA 4FQ2H 4ODXB 4LLDB 2OJEA 2P48B 5IFAH 5C6TH 2AW2A 4APQA 1EFQA 2VAAB 1VERA 2WMPA 5HHPB 1D5ZA 3QWRD 4Y7MA 2HRLA 1M7DA 2VDRL 5DD1H 3OG4B 1BM3H 1P6FA 1RULL 2OTPA 4UTBL 5CS7A 3BX7C 4KVCH 3E3QC 1AIFB 1NANH 1SVZA 4XPHH 4A6YA 2HTKD 4NQTA 2AJXH 5D7LE 2VXSL 2XKNB 5IFHH 2AAVA 2H9GB 3N50A 4UILH 3QFJD 3H0TB 1YY9D 3HUJA 3MRJB 3VFWA 3VXUA 1HI6A 5DD1L 2PO6D 1XF4A 3QG6A 4IRJD 3AB0C 4PJ8C 3C6SB 4JFHE 2VLMD 5FGBC 1JNLH 3UPCA 3SJVB 2CO6B 1RJYA 5EIVA 3FJTA 2VZ1A 1IGIL 1F5WA 1RJZA 4QRPB 4NUGH 5IW1A 1F00I 5IB3B 4FXKB 2E6JA 3EOBB 1QBBA 1G7PA 5ILTL 2X09A 3JTTA 2AK1L 4NNYB 1ZLSH 2C3VA 1Z2KA 1W0VA 5BQ7A 4X7TB 1J8HB 4X4XB 4JFXB 1BVLB 3P3YA 3B4NA 3MLXH 2VDML 3VFTB 4J3WA 4DK3A 5T1LA 1IGTB 4PJGE 4UZGA 1FVCB 1MHPH 4XWGH 4YDJB 1XF5B 4U1SA 1T03L 1IAIH 5ETUB 2CLZB 2NY7L 3PWUA 1BWMA 4ERSL 1MCPL 1U6AL 3FRPA 4RNRB 5B3JE 3L3OA 3SQOH 5MP6L 3ULVF 3VXTB 2ZKHH 3RIAK 1M4KA 3VFRB 1JRHH 1U92A 4N68A 2ZUUA 4L5FL 4FTVA 4XI5C 4P9HC 3TWCH 1NGZB 2PXYB 1MIMH 3RY6C 1KJMB 3KPRD 4U6YA 1R3LB 3LEVL 2Z0BA 2FX8L 1BIHA 3HC4L 4MA7L 2FIKA 1I1YB 3BIKB 5EPMB 1YEHL 5JA9A 3TFKD 2EIZA 1CDJA 3TM6A 2AJUL 1N59A 3Q2CA 2OLDA 1ERNA 5GHWH 5F9WC 1CFVH 4ZYKA 1X5YA 5HVWA 4EOWH 4HUKB 2FX8H 4FQXB 4P4KC 4AT6B 1Q0XL 5I18H 4X5XA 3QI9C 3FL7A 3SJVE 3HE7A 4CMMA 3JV0A 1A6ZB 3TO4B 4G6FB 5EO1B 5EBMB 4NBZB 2A6KB 4U1MA 1CT8B 3CC5A 4PJHB 5EFIA 3VFVA 5IMMB 1O5DT 3SO3C 3MRHB 4MXVE 3D9AL 1LO2L 3MUGB 2IAND 2DQEH 3IDGA 3UBXA 4QHNA 5IMOA 2D7QA 4X7CC 4X5LA 1S9YB 4RAVB 3VI3F 1J8HE 1NGQH 5D4QA 1K5NB 2XY1A 2Y23A 1KACB 3OQ3B 2ZOKB 3V4PH 1EIBA 4TQEL 5F7EH 3RZCC 2ZCHL 3C2AL 4UB0H 5ALCH 1BLNA 5GS0D 3VWJC 2ERJC 3FMGL 4DQOH 4Y5XC 3SY0B 1ITBB 2GITA 5C0IB 3IU4L 4N0UA 2R1WB 4P4KD 3V52H 4FQPA 3ULVC 4UT7H 3ZKND 1TDQA 4RISH 3GHBL 2P46B 4DEPC 3KPLB 4NDMB 3UTSD 3I2CH 3TFKC 3QDGA 2C4XA 5E0QA 5SWSB 1NUGA 5GGSB 1NMBL 5IESL 4KKNA 3D69A 2P42B 5F88A 1K4CB 4TN9A 4XNUH 3DRQA 4P3DB 4JN2B 1BD2E 3WLBB 1MRFH 2MHAB 3IF1B 2DLFH 1JGUH 3EAKA 4YX2L 3LDBC 4X7SH 5HDQH 5MEQB 1U3HA 3MJ9L 1C5DA 1U8NA 4Q9BA 1TITA 3L3DA 1MQKL 5D7JC 2CDFA 3MYZA 1NCWH 3G08B 4UTAH 3QCUH 4U7MA 1EERB 4JGMA 1FL3B 1GGUA 4CVWA 1AI1H 3PP3H 4PJDE 1R24A 5IVXE 2EKSA 4PY8J 3M1BB 2NXZC 1X5JA 2O93L 3PHQA 1IZKA 1OTSD 5BJTB 1J1XH 1BJ1H 3ESUF 2G75B 4YAQB 4LL9A 1OCWL 1ZS8A 2XQBL 1MAML 1Y18B 4OCWL 4M48L 2G5BA 2EDXA 3UJJH 4F9LC 1WBYB 1MCHA 4G6JH 3CMOH 4EI5D 1I9JH 3GK8L 4HS3B 4BFIA 1KEML 2NTFA 4L3CB 4MA1C 3ABZA 2BJML 2IBZX 1I8KA 1OARL 3BPLB 4Z9KB 3VFSB 4D0CB 3BZEA 4NQSB 2R0KH 3QUXD 4H5SA 3X17A 1SYSA 5F7UA 2DQCL 2XQBH 5DO2D 4BM7A 5SX4I 3SGKA 3EZ8A 2XPGA 4Y1AB 1J1PH 2D31A 1AGCA 3OSKA 2WK2A 4G8EB 4U1HA 2ZNXA 4S1QH 4X8JB 3UJIH 1U8LA 2X7LA 3EBAA 4F7CA 3M8OH 4L3EB 3DYMA 3QPQC 4R9HA 4TUOB 5KSUA 4FS0A 2YD2A 4HWEH 4CL7A 4JAMB 3UDWA 3DWTA 1GGTA 2W38A 3T0EA 1F4WL 1G7MB 2DQUL 5SWZD 3JVGA 3KYAA 3P30L 3UTZB 2HN7B 2P44B 2XTJE 1B4JL 3I6KA 1FH5H 2UWEA 4WFED 5C09B 1U8QA 4JPWH 5IBUG 1MRCH 4ZXBC 5K9QI 1RUAL 3UO1H 3U4BL 5C0RL 1CI5A 4X9BA 4S1RH 1R3JB 1YEIH 1D6EA 3EYOB 4PP1D 1QSFD 1F58H 2HT2C 4OQTL 3B9KB 5IBUB 3QHZH 2XTJD 2J8UA 2VLRE 4HUVB 1FZJA 3I6GB 4CVUA 5FO8B 4MHHG 4B0MM 1QEWA 4AK1A 4AEEA 3O3AA 2C3GA 1EPFA 5C0BE 1OSPL 4ZO9A 4WEBL 2HH0H 1U3HC 3D25B 4U49A 3RWGA 1YEFH 3KPPB 4TTGA 3DX7A 5KOVC 4WTXA 1GOFA 3JWDC 2BVQA 4CDHA 1U93B 5D7LA 2VXUL 3GSOB 4WW2C 5HYSB 2W9DL 1I7TB 2ARJB 4XPFL 1FJ1B 3RIFF 2X89D 4HBQA 1QO3A 4E9LA 5C0JA 2DM4A 1UQSB 3O4OC 3PNWA 3GHEL 3D2UD 3AM8C 4J8RA 2H6PA 1IAIL 4H1LA 4RFEB 3BQUB 1AKJA 2NYYD 3F58L 4IHOB 3Q5YA 4NGHL 1R3IH 4JQIL 1QFWI 3WL9A 5ADOL 2FO4A 4NOFA 2EYRB 4W4OC 4EN3D 2J8OA 3SDDB 4UQ3A 3K4DA 4LLVB 3NABH 2X4RA 4XBPA 3S35L 1ZTXH 5FHAL 3LRSA 4Z5RA 4NGHH 3TH4T 4QYOA 5F9JA 2B0SH 2YRPA 4ZNEE 3ZDYF 1EEYB 4KUZH 3SEPA 1EO5A 4JFEB 4JHZA 3TBYB 2XWBA 3QUYC 2I26N 2DJUA 1I1AC 1LEKA 4AH2A 4RMRA 1JTPA 4ZUUB 2VLJB 4K7PL 4YFLI 1CL7L 4XPBL 3NFSH 4FTVE 2YD6A 1AE6H 3CFIC 4TSAL 2IPUG 2AK4E 4PRPD 4HIEA 2P24B 1UB5A 2LAGB 3SE3C 4ODHH 5JMOC 2LU4A 1JPGA 3A6CH 4KQ3H 3H9HA 2K9UA 5GS1A 1JPTH 4OZHA 2VN7A 3JWOC 1WCQA 5C08E 5J13B 1UJ3A 4RDQG 3P73B 2YXFA 4GG6A 1J7VR 1SYVA 5FA3B 3MLZL 2VXTH 5JMRA 4PLJC 4TOYL 3VFGL 4GFTB 5FYJU 1NLDL 3LHPH 1J0IA 1ZHKA 2KKQA 4FQIL 3QNYA 3ULUD 2IFFL 3HC3L 3ZE1E 5CLTA 1MFDH 3IS0X 4DTGL 5FA4A 4PGJA 1A1MA 4LCUA 4RA0C 1ORQB 3UTTD 2A1WH 4PTTA 4F2MB 3F7RA 1DQML 5C07A 4E5XA 5L88H 1FGVL 4KMLB 3C09B 4DN3L 5DEFB 4F33A 1DN0B 4I3GA 5GHWL 1F45A 2FJGB 1FO0B 3VA6A 4E41B 2EIDA 3PL6A 4EOWL 1BGXL 2ZCLL 3T3PF 5C0GA 4P3CH 3MJ8A 5GGRY 1FQ9C 2ZG2A 2AV1A 4NUJA 5HD8D 1AXTH 4OD2A 4BSWB 1BJMA 1JF5A 5MERA 4BH7B 3K7UA 3CLFL 1UXWB 4POZD 4PGBA 2EE9A 5SWSD 3WJLA 5IBLD 3VI4F 3GNML 5SWZB 4Q0XL 3HFML 4RRPG 5HD8C 4XAWH 4D94A 4OLVL 5C0DA 3V5DA 1AR1C 1CICB 1UWXK 3RKPA 3U36A 1YPZF 3L5WB 3NCBB 2Z93B 3VCLA 1NEZA 3CVHA 3H42L 1OP5K 5DVLA 25C8H 5TE7L 2MMXA 3HNSL 4JJHA 3LOWA 1U8JB 3B8SA 5L0QC 1X44A 4PV8B 5GS2H 3LKNA 3DVGB 1YQVL 1KENH 1UZ8B 4HUXB 3KVQA 5LG1A 4L8BA 1UACL 4H0GA 3CFCL 1CK0H 3WIIL 2MKWA 3HRZB 3PIQA 3S37H 2X1QA 5IVXA 4K3DH 1KXVC 3ES6A 1KIRB 1YJDC 5E9DD 3BAEH 4R7DA 5KN5B 1I75A 4NNPH 5IHUL 3LS5L 1HNGA 4U0QB 5F70A 2OJEB 1URLA 3MFGB 3D39D 2X4QA 1CXHA 2O5ZL 1U58B 1T83A 3BPCA 4K7PX 3LN5B 3SGJA 5ICYB 4JJ5B 2YD7A 5IP4A 5F8QC 1BOGB 5EU4A 4IRZH 1H3UA 5D1ZA 1D5IL 3TYGH 3M17B 2J6EA 2JCCE 5CJ5A 1KYOK 2FECI 2ZCKL 2P8LB 4HWUA 1QBML 1K9TA 1AO7E 2IAMD 4L4TE 1CE6B 2CH8A 2Q7YB 2AQ1A 4K2UH 1KCRH 4BYHA 4AL8L 4ODVH 3OPZH 2BMKB 3HMXL 2QHRH 3BDYL 4EI5B 4FNLL 1KOAA 3BHBA 3DARA 4LAQH 4MNGB 2HWZH 2R15A 1UKTA 2XT1B 1PYWA 3L3GA 4YGAB 2BRRL 4OLYL 4JGUA 4WEBH 4S1SH 2HH0L 5A40E 1XIWC 4QNPE 4PTUB 5F7NC 4KPHH 3GMPB 3WUWA 4MNGE 1RJYB 1T2JA 4TNWK 2R1XB 2YR3A 4YE4H 4XP6L 3GSWB 4POYA 3RX5A 4QY8B 5DHYA 1F2XK 1SY6A 5DD5L 3WFDH 1UEMA 2HKFL 4JY4B 1E4WL 3QIBA 5IB1B 3OR7B 1MLCB 3ARVA 3KPNA 4Q6IA 2AEQL 3S98A 4PRNB 2P47B 4HH9B 4L8SB 4PY7A 4X4XA 1FVEA 1D9KB 1YY8B 3BUTA 3FFCD 2IPUK 2HKFH 3FQRA 3OKKA 5J57B 4ZS7H 1YNKH 2HT2D 1A7QH 2ATPB 1JGLH 1R3IL 1DLHA 3TIEA 4ZUSB 3KYNB 5DD3H 4O2CB 1ZHBB 3WE6B 4KROD 2Y4SA 1G0YR 3NPSB 4LQ1A 1IC4H 2GSIB 1KGCE 2EDDA 4F8QA 4X5WA 2VAJA 5LAXA 1T1XB 1F3JA 4OF0A 4WI3A 2V2XB 3UXFA 1NGZA 2PXYA 4KHXH 3BO8B 5ITFB 1TZGL 5DHVH 5KSAB 3C5ZB 12E8L 4O9HL 4L4TB 2J6EH 4EN3B 2FHBA 3SKOA 5C0AD 4Q6IC 1R0AL 4LOUC 1OAUH 4JQXA 3MV7D 1MCKA 1VKXB 3R0NA 2NY0B 4GS7C 1S9XA 1QFWL 3KWWB 4MS8D 3G5ZA 3LZFL 3KXFE 4LDEB 3VGGA 4KH2A 1DANT 2R0WH 3JTSA 2E8YA 3GB7B 5BMFL 3ULUF 1EXUB 1NFDA 4JFEA 4YEEA 15C8L 1T1ZB 2GUOB 1A6ZA 4Y8AA 3MV7E 4Z7WE 4N8CH 1U8MA 3G6JE 2C3WA 3LS4L 3O2DL 3BPOC 5IVNA 2ITCA 1HQRB 3QPQD 1IT9L 1VGEL 3QAZB 4I4WB 3GIZL 1WBZA 4EBQL 4BQ8A 3P77A 1PEWA 3HZVB 4OUUA 1RZ7L 2DQTL 2BNUB 1B88A 4ZS6C 3D0VB 2WLZA 3BEWA 3KLAA 2I27N 5DO2C 3O2DH 3IT8D 1O7VA 5E2WL 3WIHL 1B0GB 3VFRA 1I4FB 1TQBB 5F6IC 1DQQA 1RV6X 3GMQB 5KVGH 2DI9A 1KSRA 5DJ2B 2AQ2A 4GQPH 4XZUB 5CMAA 5TGBB 2A38A 4PUBL 3NCJH 4M8QB 3QO1A 4MXQC 3CXHJ 4WW1B 4QHUA 1D5ZB 2EYTA 2HFEA 5DD6B 2YKLL 4P2OD 2PYFB 1IGML 4G8GE 5L2KA 4WFHD 1IVLA 3IAPA 4N5ED 4GAYA 5DR5L 2ZCHH 3C2AH 4UB0L 3I3BA 5CJ8A 1FN4A 4KKCC 4DVRH 4RGMB 1N26A 1FZKA 1T1WA 5JXAH 4KGLA 4RRPA 3INUH 4JEGB 2AABH 3R4DA 3O8XD 3DVNB 4GKSA 1CWVA 4V1DA 1IKFH 1PKQE 4G43A 4URTB 4XGZB 3X11A 2AV1B 3O6LH 3KG5A 4P4RA 3QJHB 3P4MB 2ID5A 3CX5K 3N0PB 1MCWM 4LF3B 4RBPK 1K5NA 3T2NL 3CZFA 4P46B 4TULH 1P84J 1VPOL 4WDIB 5K9KB 4RSVA 2HT4D 5DGRA 3HMWH 3BH9B 1ZHLB 4HKZB 2YD5A 4R4FH 3FT3B 4LBEB 3WKML 1ZWIB 2C3VB 2H32B 4U1GC 3MGAA 2DLFL 1ZV5A 1CF8L 2A6IB 4M6AA 3MJ9H 1F42A 1YEGH 3LRGA 4PJEA 3C87A 2BXZA 1JF1B 1NSNL 1D9KD 1HN1A 4NN6C 2Q8AH 4YIQB 1K8DB 1V7ML 5LCVH 2CK2A 2VR5A 4NDMA 3MV7B 5DWUH 1SEQH 3EO9L 2CD0A 2KH2B 5IQ7H 1RJLA 3HC0B 4PJIF 3X3FH 3T4YB 3VRIB 3OKEA 1NJ9B 1HXMB 4ZDHA 3DVFA 3O2DA 3VRJB 5CKGA 3ARDA 5EB9A 4AG4H 1MJ7H 4P3DA 3BFOA 4GRLA 3LCYA 2A6DA 3HZKB 4Q9QL 2HYMA 4LVNB 4OF8A 3R1GH 2DQDL 5D2NC 3GFUA 4CW1B 5IVXB 2WQ8A 3ZMRA 3FZUC 1QG3A 2NY7H 1KIRA 1RUPH 3DSNA 2HT4C 1RZKC 1N0LA 5CFHA 2E6QA 4NWUH 1INDL 1S7XB 4LSDA 1DSFH 2VDLL 5ITBL 4PJ9B 1MREL 3WFHA 3B3IA 3LKRB 5EA0L 4GW5B 2VDNL 1KN2L 4XB7A 2IANA 3P0YL 5FYLE 1F97A 3MUZ1 1V7NL 4CJ1A 2X1OA 3O6KL 2DBJA 2N4IA 1KCSH 2C26A 3EDEA 1TVBB 4NT6B 3PWVA 1IL1A 1XH3A 5HYFA 4Y4FA 3QQ4B 4PRAB 1QNZL 2B7DT 1YYML 2AK4B 3SJVA 3NIFF 1RZKL 4HUUA 4X6CE 3TO4C 2DQIH 3WEXB 3N85L 5KSVA 4HBCL 5JIHA 5HDQL 3QFDB 4ZPVB 3U4EB 5LGKA 1IQWL 4GAGH 5E9DB 3PDOB 1CFQA 5DC4B 2JIXD 3RWIA 1A3LL 4NNYA 2VTFA 2JCCA 2BP3A 2GK2A 1K4DB 4WGWB 3EYVA 3ZHDA 1JIBA 4BJLA 3BUYA 4X8JA 2DD8H 3T0DA 4NJAL 1JYXA 4NO5B 4FQJL 3FT4B 4QGYA 3V6OE 3CH1A 2O26U 4FOMA 3KPMB 1DTUA 5JR1H 1P9MA 3ZT7A 3RFZC 1SY6L 3W11D 5C0JB 2BXYA 3U9PH 4LNRA 4YBHA 5CGTA 1ZVYA 4CUCA 3KYMA 3UJJL 1S7WA 3PGCA 3RPKA 3ARUA 5IFAL 3IDYB 2Z31C 5D1QB 1A7RL 1YY8A 4LVOB 4NN5C 4Y2OA 2R2HA 5KW9H 1F3DJ 3KXFB 1DBBH 5I19H 3OKYA 5ACMA 3DRQB 2WW8A 2CKBB 4U6YB 3QB7C 4U1LB 4BZ2H 3N1QC 4R26H 3QXWA 3KR3L 1NGYB 4TNVK 4XBPB 1UH3A 2P8MB 5GPRA 1ZLVH 1J0HA 2OI9B 4X5WB 3C5JB