1JNNH

Crystal structure of fab-estradiol complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
EVQLQQSGAELVKPGASVRLSCSASGFNIKDTYMFWVKQRPEQGLDWIGRINPANGISKYDPRFQGKATLTADTSSNTAYLQLDNLTSEDTAVYYCAIEKDLPWGQGTLVTVSVAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN KAPPA CHAIN
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
total genus 41
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnH01
3EAKA 2IAMC 1K85A 3O3EA 3U30B 2HRPH 3BGFC 1OGAD 4MB3A 1FZJB 2QKIA 1I7ZB 3V5DB 2ARJB 2DKMA 1LK3H 3R4DA 2XA8H 1L0YA 4JREC 1AE6H 1ZHBB 1FZMA 1MRFH 3GSUB 4P5KB 4PLOB 4DKEL 5EOCH 5CCKH 4KJYB 1A6TB 3WE6B 3LRSB 3BH9B 1KIRA 1VACB 2MMXA 1AD0B 5JHDE 2GK0B 5B3NA 4P2QB 5TDOB 3VWKD 4JLRB 3V7AE 4K94H 4LBEB 3UBXA 1TJIL 1DVFA 1A3LL 2RFXA 3V4UL 3MGTA 3HZMA 4OCNC 1UJ3C 2VXTH 3P9MA 1NCNA 1G6VK 3KPLB 1BP3B 3O3DA 1N59A 1KPUB 4CUCA 1JNHA 2OSLB 5JW4Q 4QRSB 1T04A 5L2KD 3W11D 5T1KD 3FT3B 1JF1B 1GOGA 1SM3H 3KPMA 2C5DC 1KC5H 1FZOB 3P0GB 4K3GA 4X9IA 2P1YA 4N0RA 2FJHB 3BZEB 1BQLL 1DUZB 1MF2L 4NC0B 3MFFA 3SO3B 3L3JB 4UT9H 2NX5D 5EBLB 1BECA 1NEZB 5CZVL 4N5EC 5DJZA 2ORBH 3ARGD 4L8DA 3TIEA 1PY4A 3WMSA 3VFSA 4HGKC 5CEZD 4RX4D 2ZKHL 2D7TL 3EOTL 1Z9SA 5IQ9A 1WQVT 5GGUB 3L3GB 4GRLA 3AMKA 4N1HB 4X6DE 1CE6B 1FH5L 1MWAA 4R9HA 5DRZA 3K74B 3STBA 1MLBA 5E1AA 1A3QA 3RGVC 1QPXA 2R1WA 4HAFA 4MCZA 4BSVA 2GSIB 5D1QB 3CLFL 5C09D 2DQJL 3PDOB 2EEAA 1EAPA 4I77H 1QSEB 4PJIA 1MHPH 4LP4A 3HC4H 4S1QH 1NAML 4XCNA 1G6RL 5A43C 3BT2L 1WBXA 2F74A 2XN9D 3O45B 5J9PB 2BMKB 2H2PC 1O0VA 4NQEB 4YQXL 4WTZA 1F13A 5EFIB 5GRVK 3L5IA 2W0FA 2FO4B 3BN9D 4HPOH 5D70L 3I6GA 3UJJL 4I8DA 1P7QD 3UZVB 4WWKD 3S88H 3FB8B 3VWJB 1RHHA 1JGEB 4LPWA 1MJUL 5CSZB 3FO2A 4LGPB 4LOUD 1FFNA 4YHYB 3PQYA 1IM9B 3FFCA 1F3DH 4HBCL 5KVDH 4N9GB 4E42A 5J6HB 1DTUA 2X4OA 3BKMH 5HDOA 4GBXB 3IAGC 1AFVL 1IGFL 3Q6GL 3QUXD 4HG4J 5LXGL 4RMWA 5BRZA 1GAFH 1NGWB 1BJ8A 1NGQH 1QYGL 1DBJH 1AGDB 1Z5LA 4O51B 4XBGA 3DYOA 1FAIL 4ERSL 1XH3B 3VGHA 1PQZA 1CFSB 1NGPL 4WUKH 4BSJA 5GS2H 1I8KB 5CD5C 4MCYA 3IETB 4ONHA 4WFFD 5EBGA 3H3KA 4QNPE 2EYSA 4FQ2L 1JI1A 3SDAB 3STLA 4C56B 4U1IB 4L8CB 1IT9L 2WQ8A 1RZ8A 4PREA 2K1MA 3ULSA 1PFCA 1EGJA 2EC9T 3GSNH 1T3FA 3VE0B 3WL9B 4CNIB 3FQWB 5HHOE 4F15B 3UYPA 3JWOH 2VDPL 4W70A 3L7EA 3WS3A 4LASH 3FN0L 1MJJB 5I8KL 1Q9LA 3A6BL 4PJ9B 5FDWA 3VJ6A 5D7IA 2GY7B 1IQDA 2WLZA 1CFVH 4YHML 4IMKC 4JFFA 15C8H 3ZL4H 3WFCL 4AG4L 3B8YA 1RJYB 4ZPTB 5E9DE 3C5ZA 3VDAA 3GDBA 3HI1B 4DZBB 4WO4C 4G3YL 4UU9A 4YUEH 1JGDB 5T3ZE 2F53D 3L3HB 3MCLH 5CINL 4OF5A 1RUKL 1ODAA 3RWDB 4Y5YC 4JM4L 4TVPD 1P69B 5C0BD 3H42H 1OF2B 1RK0B 4WCYH 1R3HB 4PG2C 5BS0E 1D7FA 3FO1B 4GMSL 2FBOJ 4GQPH 1CDJA 2NY7L 4MJIB 4KVNL 4ZTOH 3P4NA 2F19H 2NY4C 1EUUA 1VDGA 5C0ND 2R9HD 1M7DA 2F5BH 4HIIA 5D1ZA 3FQUA 4G6KH 3OKNB 3E8UH 3QDJA 3SGKA 5CWSA 3SKJL 4H20L 4LLWA 3TH4T 3DRQB 5CKGA 3WFZA 5L2JB 4PRPA 1J1XH 3T3ME 1QR1A 4PJEE 1PJ9A 3NTCL 5KJRL 5FUOL 3RWEB 5FB8B 4OZIF 1XF1A 4JAMA 2OP4H 3JUZA 2VDLL 4WEBL 4PBWD 3MX0A 4PJ8B 1CL7I 3U9PH 2Q8BL 1QSFE 3TFKD 4MMXC 2Z4QB 1OTSD 2E7CA 3BW9B 3AS3A 3MJGX 5IB2B 5JORB 2B20A 4KY1L 4TOYH 2IG2H 5ITFA 5GS3A 2NY3C 4PJ7A 3LN5B 1I1CA 3OBAA 2FEDC 2YD2A 5DD5L 3BDXA 4XNMB 5J1SC 4HEPG 3QT2A 1HN1A 3QI9B 3P0YH 5J6GA 3MRLA 5CJQL 5MP6L 4UT7L 2X42A 3G6JA 2XZCH 4P2CG 4Z7WF 1JYXA 2B1HH 5KSVA 3AUVA 4H25B 5DEGB 4YXKH 3QUYA 4YWGH 2H26B 3T0EC 5JPMB 2Y06L 2X4QB 35C8L 5JOEA 3RVWD 1YEIL 1EEYA 3HUJA 3QDMB 1R3LB 1BQSA 3K8KA 1RUAL 3OAYK 3RDTA 3LHPH 1KSRA 4RMSA 3B6SB 5E5UB 3VFPA 1YMMA 4HFUH 5E8EA 5ENWA 3G5ZA 5D96C 2VR5A 2Z91B 4DGVL 1T03H 2YR3A 3MBXL 4PGZA 2IANA 4NNYB 1S7QA 2VXSH 5FAAA 1PGRB 5EIIA 1ZXQA 4GW4A 12E8H 3BQUD 2VH5L 1G6RB 3PABB 2OS7A 1JZ5A 3IDGA 3CH8A 5E99L 1P4BH 2P5WD 4RGMC 3RA7H 5TE7H 3TO4B 2WANA 3MROA 4GW5A 3T4YA 4F9LC 1S9VA 4MA3A 1L0QA 1CGYA 1WTGT 1RMFL 5C6TL 1RUML 3B9EA 2W91A 5IROA 3TBWA 4KZDL 1NAMA 1QNZL 2H3NB 5DYOB 4C54A 1LEGA 4X8JA 4RMTA 2EDQA 3QDGB 3CFDA 5DMJB 5KG9A 3PV6A 2FYYA 1ZEAL 3B9DA 3ULUH 4WW2F 1AC0A 1IRAY 5CBAA 4G9FB 3O6FD 4GS7C 4JY5L 1C16A 3P4OB 4JR9L 4NPYA 4PYHA 1FZKA 4HX1A 2QQNH 4LEXH 5T3XE 4S1SL 1QBBA 3MREA 3QQ4A 3DMMC 1V3LA 1K4DA 1GCFA 4D94A 1NANI 5K59F 3RU8H 2WSKA 5HYQB 1BVLA 4I2XA 4OLXH 1GOFA 5HYEA 2OI9B 3B5GA 3UYRL 1MCSA 5GZNC 5L2KA 4Z7QE 3MRPA 2AI0L 1U2HA 4XWGH 4N90E 3RKPA 2QBWA 4FXGA 5I1KL 4NQCE 1I75A 4WUUD 5JW5B 5EO9A 3WNOA 3BIAX 4FFZL 1U36A 1HE7A 3DTXB 4G8EA 1F45A 3NMEA 2XTJC 3OKDA 5ACZA 1WFNA 1HEZB 4Z7UA 3BX7C 4FRWA 5IW3A 4LAJH 1FGVH 1F90H 1FLTX 4LVHB 3NZ8A 3JTTB 3ARGA 4MQ7B 5INDB 3ROOA 3MRNB 4EOWH 4FFYL 1OARH 4ALAH 2D9QB 2R0WH 1UVQB 4NNXA 1QQDB 1HHIB 3FOMA 2X4RB 3L1OL 2V5YA 1QFWI 5H94A 5B21A 3WV0A 2IALA 5J4MA 1U2CA 4LCCC 1YMHB 1R3KB 4R97C 1CDHA 4AIZB 4RCAA 1T22B 1TZIA 3R06A 5MEOB 4OZGE 1BOGA 4XXCA 5L7XH 1FL5B 3ZYJA 3GSXB 4JKKA 1BBDH 4V1DB 5DJYB 4K9EL 1WUNT 4HV8A 3BVNA 5FO9A 3CFEB 3VXRA 1IEBB 3HRZA 1GGCH 2XY2A 1KN4L 1CBVH 4JFYA 1MCBA 2IQ9L 1WWCA 4DKFH 1S3KH 1MRCH 3RZCC 1MFEL 5FYLH 1RULH 4NWUH 1AQDA 1AR1D 4WI9A 1JFQH 3GMQA 4FQXB 3FO0H 4FQHA 3BGMA 4N0UA 2GAZB 3HG1D 5IB3B 2FJFA 5SWZD 4YR6A 5AAMA 3H3BC 1E4WL 3DX9A 4P4KC 5AWNL 1MELA 1TXKA 1NBYA 4KJQD 2V5RA 4Y2DC 3NGBC 3JV4A 4G8GB 5AEAA 4PTTB 4PJCF 3GO1L 2V2WA 4LVNC 3B9KD 5IEKB 1J1PH 5A16A 2GTWA 5C0CE 2MKLC 3H9HB 4KKLD 2PETA 3V6ZB 1W0WB 3MYJA 1KCLA 3HCVB 3IFPA 3FCTB 4O58H 4P5TA 3SDXE 3QUML 4OKVB 3KS0J 4UBDD 3CMGA 3I2CH 5D2LF 1I3GL 1ZLSL 3TZVB 2QHLA 3VD4A 3PJSA 1G0XA 3PUCA 2CUMA 1T66D 3ZDYE 4P4RB 4LPYA 2IWGA 5KOVC 1ZLWK 4D9QD 1BM3L 3O3AA 5F7EH 4ZTPH 5SV4A 3CIQA 4PY8J 4HF5L 32C2B 4RGNE 4P0DA 1T1YB 4PRAB 3H7LA 2AEPH 3GJFH 1DSFH 2E9WA 1DEDA 4KQ4H 3QXAA 1L0XA 3BPCB 5E6IC 4Y19A 2P24A 2APXA 1WISA 4IIQA 4KUCF 4M6OH 3TGXA 5IBTH 4JO2L 4H0HB 3HMXH 3IFNL 2FJGA 3HZVB 2GI7A 2DWDB 2J4WH 4PP2A 4WU7B 4R8WH 4CVXB 2XPGA 4Q7DA 4DGYL 4XP1L 5J3HC 5DZOA 1BIIB 3BYTA 2YRZA 5F1NB 4YHZH 1D3CA 4I0CC 2F53A 5DVKA 3QZWA 4U6HA 2N1KA 4LSPL 3H0TB 5IHUH 3PWNA 1IC4H 1BJ1J 4TQEH 5E8PA 3S5LG 2Z8RA 3QQ3B 4M3JA 4Y8AA 4XNZC 5SV3A 2A9NL 5H35B 1CVSC 5CD3A 1EXUA 2A1WL 3MA7B 3KPRA 2X4UA 3ULVH 3VXUB 1ES0B 4I3RH 1E4KA 4ZUVA 4Q9QH 4AYFA 4GAGL 4RGOH 3WIFA 1AHWA 2VC2H 3PWPE 1LNUB 4GT7A 2FWOB 2YPVH 1TCRA 1MCJA 4AEFA 4Z7WB 4PRHE 4KHTL 1I7UB 4XMPL 1L4IA 1INDL 5HHPB 2ATPA 1A1NA 3B2VH 4MD0A 4CL7A 2DYPB 2R4RL 2YRPA 4PJFE 2EO1A 4GKSB 4KK9C 3ARRA 1RJLB 3EW3B 4YE4L 2WUBL 5KVMC 2HYMA 2Q8AH 1GHFH 4JY6B 2R23A 5C08A 4QGTA 4WJ5B 4LEOB 3IJSB 1DJSA 2NY0C 4UDUA 1JZ3A 4R96A 1F42A 1S7TA 2PTTA 2UWEF 5JA9A 3DRTB 3D0VB 3VDBA 5F8RC 3RGHA 5DI8A 1F58L 3DX7A 3NIGE 4OJFL 1QG3A 4DAGH 2NTFA 1JPFB 4OUUB 5DO2D 5JOPD 4H8WC 5CLTA 3L9RB 3PGFL 1LE9B 1TLKA 4HLZG 1U8PB 5E8NA 4DZ8A 3IT8D 1A0QL 1X9QA 5T1LD 5I1IH 1I3VA 3HR5A 4Y0GA 3CCHB 2VR4A 4JFEB 4N0FA 4Q6IC 3UBXI 4FXLA 1TZHA 3HC0B 4PY8I 3LS5L 4MXVE 3QUZD 3G6AA 5J11C 3O41A 2ADGB 1Z0MA 3VCLA 5JHDD 1OAXL 2VLKD 3LDBB 4OGXH 4QRPE 5HVWA 1A9EB 1XAUA 2GFBB 2P8LB 2ZG1A 4ZOAA 4XBEL 1JGUL 2XNAB 3L5WB 4MA8H 4G9DA 3WIIL 1NAKL 5DJXA 4Z95L 5D5MA 2W0LA 4LSUH 4WW2B 1IGML 5CZXD 5HXMA 5ESVB 3GSRB 1TQBC 2VDQL 3U0PA 1C12A 1JMZA 3C09B 4YGAB 4JGMA 1NDGA 4OZHE 1S9XA 3CVIL 4HAGA 4AIXA 2WM0A 2ITDA 5GSRA 5I8OH 5FYKH 4W6WB 4YHLL 3QA3A 5I8CA 3EDDA 5I74C 4HHAB 2CRIA 5IP4A 1LO3H 3BQUA 3DVGA 1IAIH 4YZFE 1JTTA 3X11A 3ZKMC 5MHSD 4E0RB 3F65A 2P5WA 3IAPA 3MGAA 3OXSB 2X4PB 3JVGA 1S7SB 2Y23A 4MXWL 5EUKA 4ELMF 1SJEA 5IR1B 3VXTA 4O2CA 3JBG7 2VZTA 3O11A 3GJEB 4HGMA 5TJWK 3VXNB 5L6YL 4U6XA 2BC4A 1MCDA 3BE1H 1F4YH 5D6CA 4HJJH 1KB5L 1MEXH 1JP5A 3RPIB 1KBGH 3CZJA 4LCWD 5GGTL 2Z93A 3VFGL 5I1EL 1EEQA 2WBWB 5HI4C 4MDIB 4ZUWB 4KKCD 4X7SH 1KJ3H 4N9OB 1S5HA 1IGTB 3RVTD 1PG7H 4F2MB 4OZ4A 1LDSA 1T0NA 1B4JH 4BH8B 1R3IL 3A6CH 2JCCA 5F6IB 5JIIA 5BXFB 4XCYB 2ZUUA 5DMGD 1PSKH 1V5JA 3O8XD 4XHJD 2Q3AA 3BD3A 4DCQA 2BRQA 1ZHKB 4FA8A 3U7WL 4C55A 2UYLA 1OOAA 3UTQA 4FZ8L 4YDIH 1FVDA 2XT1B 1QFOA 1FP5A 1KLGA 3EOAB 4Z7NE 2AJ3A 3CLEL 1BLNA 3S5LB 2QSVA 5DD3H 4F9PC 1UWEL 3QUMA 1KXTB 3RWCA 5GRJH 1C5BH 1WEJH 3SO3C 2W07A 1FFQA 1NMBL 2FHBA 4QHMB 1WIPA 5B8CB 3GK8H 1W8NA 1EO8H 1IEAB 3ARBB 3O4LB 2YUZA 3O4OB 4F7EA 4MNQE 3ARDD 1KUMA 3LKSB 1X5GA 4PJCB 5DQDL 1AP2B 1S9WB 1U8JB 4X99A 3KAAA 1QRND 5CLWA 1KCVL 1NCCH 1JHTA 1U8OA 3VGFA 1XR8B 4Z5RB 4KI1A 5D2LB 3EIFA 5E0QA 1YNKH 1V8HA 1FG2A 4BSWA 1NCBH 3IKCB 2FR4B 1DR9A 5FGCB 2WWKO 3DXAA 1FYHB 4HIXL 4I3SL 4RQQB 4Y88A 5DUBA 1JK8B 2EC9U 3MFGB 3BN3B 3HG1A 1QHPA 3N0PB 4N8CH 1KXQE 1EVUA 1GSMA 3VXPB 4RAVA 5SWZA 3VWJC 3V52L 1G9NH 5HVGB 4ZDHB 1OB1A 1VGKB 4CVZB 5C0AB 2P8MA 4HIEA 3OX8B 3IVKA 3NZHH 3VRIB 4YHYC 4EI6A 3PXHA 2GT9A 4YFLI 1ZT7B 1NH6A 3R8QA 4NQDA 2ED7A 5IMMA 1ZHLB 4X80L 3HNSH 5D1XB 3VFTB 5I19H 4GBXC 3H9SE 5JW4N 3TA3B 2BVQB 4LCYA 3RUGE 3IDIB 4U6YA 1A2YB 1MI5E 3D3VA 4KTDL 5DMIL 1T5WA 1UM4L 4K7PX 2J3SA 2WAHA 2XG5A 2I5YH 5FYLE 1R5WA 2WWKT 3JUYA 5BS0D 2AGJH 4RMQA 1IKNA 3NFSH 2R56L 4EDWH 1QSVA 1V7NL 2BJMH 3WLBA 2B2XH 5E95B 2VUYA 3EDEA 3H3PL 4K55A 5DK0B 2ZUYA 2VLJB 3KPSE 5IFAH 4WHTB 2N56A 4P9HL 4OQ1A 1T7VA 3SDAC 3RI5F 3V0VB 1Q9KA 4MGXA 2GUOB 5TDNB 5GHWH 2AJSL 2DD8H 3PHOB 4KTEL 1CICB 3PGDA 3QXVA 4JJ5B 1RFDL 4KDTA 1K8DA 2W65B 2E8ZA 2O26U 4BZ1H 1HNFA 1FBIH 4RISH 5GIRA 4F15C 3BXNB 2PN5A 3UC0H 4R90L 4L4TB 3KDMA 5KBNC 4HD9A 1FNEB 3QEQD 5C3LD 4DFHA 1KACB 4Y89A 1MPAH 4PJ9C 1ZTXL 3WUWB 4ODSH 3SJVB 3NCJH 1QSFD 3ORJA 3V6OC 2WUCL 2XQYK 4NRYB 3TBVA 1FDLL 3L5XL 1A7BA 2FD6L 4G5ZH 3MXVL 4P3DB 4EKXA 1I1AB 3MPCA 4KK5D 1I85A 3VI3E 2AK4A 3CJJA 3UAJC 5FFLA 2FZ3A 2R4SH 1S5IL 2RBLA 4XB7A 1IVLA 4U1KB 3E6FA 1Q9OA 2UWEB 5TH2B 4G6AC 2R39A 3WJLA 4WW1A 5EOTB 4AZ8A 4HJGA 3MGOB 3DUSB 4XPGH 3QIWB 5EO1A 5C70A 2VZ3A 2ADIB 2YOCA 3I6KB 3TN0A 1RK1B 4XRCA 4PG9A 2VABA 1U8QA 1OCWH 5DRNB 1N5YL 3VRJB 4N8VG 1YUHA 1DUYB 5MI0B 1T20B 3D2UB 4UQ3A 4QXUH 4XNUH 5FKPA 5F21B 3P4MA 1G7MA 5TF1H 3ARFA 2H6PA 4Y4KB 3TPUA 4Z77A 1IGYA 1A4JB 3OKLA 4MHHI 4E5XB 2J6EL 5JPNB 4F58L 3T3PF 3U36A 5ESQA 3RKDD 5FKAA 1NBZB 3SBWC 3VGBA 3ULVE 2DLFH 1CL7H 3AB0B 1U3JA 2GY5A 1CDIA 4PJ8C 1TVBB 3CFJA 1GGBL 2FL5A 1ZGLA 5HI3C 1DQTA 1JWMA 3OXRA 1M71A 1QA9B 2F54E 1H3PH 4KK8D 4EI5B 5AZEL 5DQ9A 2BOBB 5DGRA 1IBGH 3EYOB 2AV1A 1KB5A 5AG8A 1MHHB 2JJUA 5C8JA 1U8KB 3FFDB 2MQ0A 4YFEA 4X0KB 1GOHA 4ZNEE 1OGTB 1MJ8H 2GCYA 5GGRB 1FO0L 5C0DA 4FFWD 1E4XL 3ARTA 3RJDA 5K9OB 1FAKT 1S9YA 2ERJB 2MCPH 4EIGB 3QUZA 2BZDA 2R1XA 5DURD 5I1LB 2VISA 3WJJC 2VLKA 5L9DH 3TCLA 4HFWA 3GZKA 3LEXB 1IFHH 5B4MC 2HJLA 1NSNH 3V4PL 3PDDA 2VDRH 1PW3A 3HAEG 1UQSB 2R0LL 1QBLH 4LIQH 1FYTE 2NXZD 4LVEA 5EUOE 1LO5B 2GTZA 5F9OH 5C0EB 1KLFA 2NR6D 1AGCB 1K8IA 4ODTH 3CFBA 3AVEA 5F89B 1XZ0A 2AXGB 4N90D 3MRQB 4QF1B 4C57C 1TVHB 5CJOL 1Z6JT 5IMKA 3QG6A 4NQCD 4NKOB 4XMLH 4ZFZB 4EUPB 5D7LE 1YY8A 5EBMB 1JZ4A 1FCGA 3ZDZE 1KCUH 1UB6A 4PPTA 2R2HA 3MBED 4PUBL 1R24A 4ZUUA 3OG6B 3MRJA 4EZMA 3O3BA 4X4MA 5L8KB 3QHZL 4X7EC 3TBYA 3TO4C 2XZAH 2JJSC 5HD8C 1BAFL 3SKMA 1CG9A 3EFFA 1ZAGA 4QHLB 2JB5L 4Z7VA 4P23B 4MQSB 1YNTB 1IKFH 4DQOH 4F7CB 1UM5L 2NMSA 1FL3B 1GZPA 5FYKE 3MLTA 1RIHL 4GO6B 1WITA 3BKJL 4LCWA 4HWUA 1EEZB 3MYZA 1ORQB 1YPZA 5EZLA 1NLBL 1OAUL 1DFBH 4UB0H 5HGDB 4UI2A 2NXYB 2C4XA 1CLOH 1CIDA 4YHOH 4X4YA 4L9DA 1NANH 1CS6A 1EEUA 4L5FL 5FEBA 3KXFE 3VGAB 4NRXB 2YSSA 2IBZY 3O8XA 2OI9C 1BGXL 3MSPA 4YDKL 5CJXA 2BNRA 4NM8L 5F93C 5GZOD 4K3DH 3F7YB 4J7RA 4MXQC 4MA7L 3QIBB 1JWSA 5DD6B 2HFTA 1MSPA 1NCDH 4P2OB 1IC5L 1GPOL 3C5SA 3F7RA 5JUEL 4JQIH 5IVOA 4NO0A 1J8HD 5IQ9B 1MCWM 4JFQB 2P48B 1N0XH 2B4CC 3O2DL 3U82B 5C0CD 4NDMB 1IAIM 2AXFB 1JRHI 4LVHC 4Q9BA 5IUSA 1Z9LA 2X1WL 4NKDA 4XVJH 2BNQD 2ICEB 2I07A 4N8VB 5LWYL 3MLSH 4W4OA 4OD1H 5F7KC 4OLUH 4RIRA 1IE5A 5KTEH 2K7PA 3ARDA 4XI5C 3BRFA 5CP7B 1QFWH 2NY6D 4HJ0D 3K4AA 4AM0A 5HYJB 5F97E 2ZOLB 3MJ9H 3N9GL 1QRNA 1OSZB 2JK5B 4BZYA 5HPOA 3MQIA 2GJ6B 3NCMA 3W81A 4RBPH 2FLRT 2BDNL 4NJ9H 4M6NL 2VL5B 4JHAH 5K33A 4RGND 1I7TA 4RSVA 4DK3A 1VHPA 5KSUB 3FKUS 3ZT6A 1XR9B 4IOIB 5HYFA 1MCCA 2EXYC 3LSOB 4LSQL 3NCYP 4YIQB 1H0DB 2GITB 5AYUL 3VMOA 1NJ9A 1S8DA 4FQXC 1A7NL 1JIBA 5GS2D 3BO8B 4U6TA 4J6RH 5EO0B 4AIOA 2DQGL 5HGBA 4UTAL 2BOCB 1KTLB 1AI1H 4JPVH 4PJGA 5I2IB 4QKXB 1YQVH 3RL2A 2Q7YA 3NFPA 3MA9H 3MTRA 4UINL 3NAAL 4JY4A 1H3TA 4M8VA 4NJAL 4L8SA 3LEYH 4OM0H 3VRLF 3BZDA 3WLWC 3KJ6H 5H2BA 4UNTA 2A73A 1CGVA 2ED8A 2RAMA 1T4KB 5E4IA 2ADFH 1J18A 1JZ7A 4BZ2L 5JMRA 5TQ0H 3LB6D 4U6VL 4PRDB 5DEFB 4X4ZA 2OL3L 3HPLB 5F72S 3EO9L 3IKKA 4JZNB 3WFHA 3OKKA 3QFJB 4FQQB 4I0KA 5D7JC 2YEZB 2H32H 5E1HB 3PWPD 3VFVB 5GJTH 2QADD 2YUWA 4LARH 4PS4L 4OZIE 3HAEA 3W0WA 1CCZA 4PRHD 1ERNA 1WF5A 3RNQB 4RNRB 5IJKC 3C6SB 4LRIC 3QXDB 4K8RC 5MERB 3UYOD 1FO0B 4JANB 1ZT1A 4RAHA 4S1DC 1LP9E 3QEQA 5DGQA 2AJUL 1PYWB 2VL4A 4UTBL 1FE8L 5ANME 1RZKH 4JHWL 1ZS8B 2V5SA 1HILB 4GSDL 2WZPD 3MCKA 1AJ7L 1VFAA 5DDHA 2NCMA 3UMTA 1AO7E 3MRKA 4D0BA 5FYJL 1X3DA 3Q48A 1WCBB 2JF1A 1CGUA 5GGVH 4POZD 1J05B 1CLYL 3T2OA 1MIEH 5ICZA 1LDPL 1AGFB 5FK9A 2BFVH 3MUGA 3RWJA 1Z3GL 5DJ8A 1K5NA 4MX7A 4S0SD 2VXVL 2JB6A 2EIZA 3I3DA 4O02L 5E4EB 2HFFA 2ZJSL 4MVBC 1LEIA 3GMPA 4HWBL 4BUGA 4K3EH 5ICYB 1VESA 5T5FL 1FNSH 4WEMB 3M45A 4DTGL 4LPXA 4YX2L 5GPRA 4O2FA 4LLDB 4OM1H 4D2NA 1EAJA 2OZ4L 4ZAKB 2ZSWA 3EYFA 3C60A 2ZPKH 4HWNA 1RY7B 2AJVH 3SDDD 5J13B 1FN4A 5DJ6B 5F3HB 1B0RB 4JAMB 4ZS6D 5JDJA 5IEHB 4NYLA 4D0CB 3TP4A 1UEYA 4YBHA 4LNRB 5GGSY 3ESUF 1H3XA 3ZO0A 3MRMA 5E2VL 1XGTA 1G7IA 3D85B 4YPGB 2OJEB 5JIKA 2XXMB 1NC4B 3DI3B 4S1RL 5KS9E 1WBZB 1ZHNA 3L3IA 5FGBC 3SDCD 5ISZB 1NGZA 1ZA6B 2EIBA 3SCMD 4A6YA 2X1PA 1LE5B 3ZE2F 1T7WA 2JIXB 3FB5B 4M5YH 3RY4A 4GRWH 3VXSA 1EFXB 1J87A 2ZUTA 5JA8B 2RHEA 1OAKL 3KS0H 1MFBL 5IV2B 3MLUH 4LHUG 3UEZA 4I9WD 1UACH 1BZ7A 1CF8L 5J7CC 3D1MC 1WZLA 3HNVH 5ETUA 3WXWL 5M95B 1URLA 1NC2A 3QUYB 4QOKE 2EDXA 4R2GB 1FLRL 1BJMA 5CIPA 5FHAL 4WY7L 4MA1B 4N8PA 4KAQH 5GRVL 1R5VB 1YC7A 3RIFK 1T83A 4KVCH 3OV6A 4K7FB 2CGRH 3MLXL 4Q6YA 1R0AH 1KJ2L 1KT2A 1X5XA 3MLZH 3PL6A 3TM6A 4PJ5B 3OPZL 3K4ZA 3BSZH 3LDBC 2Y7QA 4UIMA 2H8PA 4GAYA 5C07D 5EC1B 3NIFF 4OCRH 3RVVC 5H37G 5GJSH 1ITBB 4NZTL 4XX1E 2QSTA 4L4VB 2OXHA 4QT5B 3VXQB 4PD4K 4XNYL 3S37L 5IF0B 4WW2C 3F7VA 3I6LE 3FT2A 2W92A 3MOQA 4R7DB 4JRYB 2C4FT 5DD1L 3C09C 3REVA 3QWRD 2KH2B 3H7BB 3ULUD 3O2DA 3GI9L 4JFDE 2A77L 4LF3A 4JKMA 1OGAB 3IJHA 4WV1B 2M8XA 1FV1A 4XT1C 4XAKE 3T4YB 1BJ1H 4U0RC 1UH4A 4NFBA 3O2VH 3I50H 4UIKL 2X9YA 3CFCL 3MBEA 3DX6B 4QRUA 4ZXBD 1HI6B 1VGEL 2YA1A 3DO3A 3GUTB 1OM3L 2FGWH 5D5MF 4LIQE 2E9JA 5LAXB 2IH1A 3QEHA 1A4KB 2C9AA 1JPSH 3VWKB 5C92A 1I1RA 4LQFL 4Y7MA 4FG6C 1UA6L 3IDNB 1ORSA 4OSUH 4MNQD 2EDLA 2CLZB 5EZIL 5CMAB 2HN7B 1KGCE 4RFEB 5GGSA 1A7QH 1A6UH 2FX8L 2EDKA 3SGJA 1YEFL 5IHLB 4Y4HD 3MOAL 5LGJA 7FABL 1Q1JH 2CIKB 2HT3C 4HS6B 4OCYH 5T1KB 3VI4F 3OKEA 3KWWB 43C9A 2DQHL 2EZ0C 1GGIH 1YEEL 3LKQB 4EN3C 1KJVB 5F6IC 5I18L 3DYMA 4PP1D 4PJDF 1YY9C 2X9WA 2MOVA 4F3FA 3VFRB 5ACLA 3GKWL 1QKZL 2DDQH 3GJFK 4Z0XA 4HKXB 5IVZA 2NX5B 5AYQA 1UWGH 4O5LL 2MWCA 1U8LA 4XZUA 4JQVC 1QO3B 3EGSB 5FA3A 2DQFA 2O5YH 4L3CB 5IM7A 5C9JB 4P2RE 3PWUB 2ENSA 3BWAA 4R7NB 2W9EH 1D6VH 4U7MA 1YYLH 3ZHDA 1MCOL 4PYGA 2OL3A 2I9LA 2Y5TB 3NH7L 3BP4A 3H9SD 5ADPL 5AG9A 5HDBE 4OT1H 1MAMH 1SQ2N 3PWVA 1U93B 3P2TA 3CPLA 3F12A 5C09B 5FYLD 1N4XH 4XB8A 1KEGH 1N6UA 5B8CC 3AREC 3UPCA 3DGGB 2NY5H 3ARBC 1YEJH 4NQXA 3O4OC 5JZ7D 1KELL 1DBAL 2XN9B 3FQRA 1RIUL 2FX9L 3T77A 3KPSD 5DVOA 5ICXB 4IJ3B 1IC1A 3Q6FB 4NN5B 1A6ZA 5EU4A 5J89A 4CKVX 1W0VB 1S78D 4UNVA 1JPGA 3QJHB 5DC4B 2IEPA 1P7QB 4WWKB 4K71B 3MRRA 4U3CA 3ARZA 5KOMC 2W38A 1KEMH 3EOBB 5CUSL 2EXWD 2CO7B 4NUGH 3ZZ1A 1V7MH 3MJ6A 1T1XB 1BBJB 1RHFA 3OZ9L 4I48A 1OTUC 3GSVA 2OQJB 1B9ZA 3U4EA 3OWEA 1DQDL 3U46A 4KMTL 1C5DA 1YN7A 5D9SB 5E00B 2QTEA 4IRSD 3QUXB 2GJZA 1NLDH 3MXWH 1G7QB 2HG5B 3X3FL 3HI6L 4IMLB 1IC7L 3GMNA 2D4DA 2D31B 4LDEB 5D8JH 5DD0H 3WDIA 2V2XB 3FRUA 1UZ8B 4KI5D 4TVSa 5HDQH 3W9DB 2JLLA 4MD5A 4LHUA 4TULH 1CD1A 3DV4B 5DJCA 5F7WC 5D1XC 5KVGL 3OR6A 3TA3C 2PYEA 4ZYKA 2HJFA 1Q72L 5CEXA 4IRJA 2LTQB 4QO1A 5FO7B 5SWQB 1TJHH 5JW3L 4PJBA 5IT2H 4D0DB 3CUPA 1TFHA 3FOLB 3GSWB 3QWOB 5J0BA 3G5YB 1P1ZB 2Y07L 3QHFH 3RVUD 3SJVE 1QACA 4K3JL 5ID1A 4A2LA 3ZT7A 2NLJB 4JDTL 1KB9K 2Z92A 1XGPB 5I1AB 4NN6B 1EJOL 4HUMB 2XQBH 4Z0BL 2J8UF 1F4AA 1FSKB 1I9RL 2QHRH 1VSCA 5D6DC 1OWRM 3ESVF 4JN2A 2CD0A 4HXAL 3WFDL 3EO0B 4JRXD 1BD2D 4OBRA 1IGJB 4XVSL 1CICC 3ROLA 4KHXL 3DVIA 2D7NA 1AGBA 5D2NA 4JZJA 3D25A 5FUCE 4M1GL 3DYPA 1DBMH 4DKEH 1KJ2B 3GGWA 1M6OA 3BJ91 3DHMA 4ZUSA 3ULVD 4H5SB 2UUDH 1TJIH 5F9DC 5C0BB 4FQ1H 2F54D 3V4UH 1I1AC 2YPLA 3SN6N 1ETZB 3U7YL 2XKUA 1YECH 4LU5H 3GNMH 5DMKA 5IB4B 1LD9A 3LKRA 3ET9F 1BHGA 5HGHA 3W5MA 2V7HA 1Q94B 4HDIB 1UXSA 3JTSB 1JNJA 2SEBA 4OD3H 4OGZA 4U2ZA 1CK0L 3CH1A 3KYKL 4Q0XL 4ORGA 1MUJB 1NFDE 1OSPL 3QIWC 1UKSA 3LOWA 4P46A 4OAWB 3TO2B 2A0LC 3OMZA 4MAYD 5I1JL 3SDDA 3S9DB 4HBQA 4NO2A 2A83A 5HGAB 1BQLH 2HTLC 2XKNA 3CU1A 3HPJA 1P7KA 2A2QT 4PGDB 4RZCB 4JFXB 5MI0C 5I15H 1FYTD 2QLVB 3AAZB 1ZV5A 5CZVH 3W9EA 5CILL 4BQ6A 4PJAF 1ACYH 3UTTE 1UCBL 4Y4KC 3BPOB 2ZKHH 3EOTH 1I4FA 1B6UA 1FH5H 4ZFGL 1NFIB 4HS8H 3IGAA 2VAAB 3S3SA 4HGWB 2B39A 5B3JF 3P9WB 2PO6A 3SCMA 2X7LB 1ND0A 5D7LD 4ELME 3C5JA 3CLFH 3AB0C 4G8IA 3VFWA 3J7HA 3O9WD 3TBSA 1X5JA 3BP7A 2VIRA 1NAMH 5FOJA 2VAJA 2HLAA 3LKPB 3BI9X 3F6IA 4EI5C 2FSEB 1RZJC 3F7QA 4U1HB 4YQXH 1P9MA 2AEIT 4R4BB 1B4RA 1AD9A 5F3BA 4GQ9H 3UTPE 3AROA 1QBML 1VFMA 1J5OL 4G6JL 2ERJC 5LCVL 5FYKD 4PJHF 1MJUH 4QEGA 5FA4A 3TCXA 1CU4L 2A74A 1XT5A 1T1WA 4XMKL 3ZYOA 4HBCH 5C07A 2XICA 3UX9B 5I1DB 2G5BB 4Z76A 4NHUB 2HVJB 1AFVH 4ONFL 1IGFH 3Q6GH 3DIFB 3M1BB 5LXGH 2FHFA 3RWIA 1KXVC 5EU6A 3KXFD 2AK1L 2DQCL 1FVCB 2P45B 3K3QA 4YHKL 1YEKH 5L8LB 3CK0L 1KG0B 1FAIH 4TSBL 2ZSVB 1NGPH 3QIUD 4DUWA 1GGTA 5DHVA 3OAUL 4JRWA 1BVZA 3MR9B 4XVTL 1K4CB 2BY1A 4Q9RL 1C7TA 2VQ1B 3HLAA 4PJDB 2PYFB 5C0GA 2NY1B 3FJTA 2COQA 1V3KA 1CFTB 4DFIA 4BUHA 4H1LG 2IGFL 2H2PD 2VJXA 1IAMA 2WK2A 4U6XB 4UOJA 2E8YA 5HJ3A 2HTKC 1C08B 1U3HD 3O6FB 4NO5A 2VDPH 3FN0H 5I8KH 3A6BH 1QLRB 1E27B 4P23C 5I16A 3R8BB 2YMXL 5DQJB 5LJYH 5E2WL 4AG4H 3WFCH 1F8TH 3U2SB 5IWLC 4Y4HA 1RZIB 2ZOKA 3G08B 4D9RE 1MNUL 5C2BL 2NXYC 2HFGL 4G3YH 4TSAL 5ALCL 5K9KA 2IBBA 1WVZA 3Q0HA 4M7ZB 5EULV 4ZSOA 2UZYB 4WUUB 2BSRA 2FX7L 3C08L 1RUKH 5TQ2L 4Y5VA 3VGAC 4JM4H 4X6DF 5T33L 3MOBH 4PJIE 1HHHA 3FQNA 3NFNB 1CFQB 1MHCB 1XF5A 4GMSH 1HH9B 2YBRA 1U8MB 2XTLA 3QIBC 2FDBP 2NY7H 2IH3B 4QXTA 5EU5A 1ZSDB 2NQCA 4HUXB 1U95B 2XWBA 3X13A 4P2OC 3WNKA 4FTVD 3CDGB 5ESAA 3AMLA 1MCKA 2YS4A 3GMLB 3BPLB 1A14L 2PXYA 3TT3L 5IMLA 3VH8G 5F88B 1MRDL 3GSQA 4U2YA 5DC9B 3PQYE 3FFCE 5JR1L 5IIEB 1FNGA 1MLCA 5FUOH 4QRQA 2EYTB 3RAJL 3O81A 2VDLH 4WEBH 1XGUA 2NZ9C 5C0FA 2CLRB 1YZZA 3DVNB 4PV9B 3RWHB 5BRZE 4QWWD 5GS0C 1HXMA 3VFNA 2YA0A 1DL7L 1HDMA 3V7AG 2R2BA 4NOBA 3O0RL 3KGRA 4XAWL 3KPOB 4KY1H 3V4VL 3ZYIA 4QCIB 5D71L 4J23A 1Q0XL 1OD9A 3E6HA 5DD5H 3DBXA 2V9QA 5INCA 2CK0L 5JW4R 4FNLL 2VLRA 4N0YL 5MP6H 2YHGA 3PWLA 1E4XI 5MEQA 1XGYL 4JPIA 2CIIA 4JM2D 4OCMC 5EOCJ 4POYA 1N3NB 2J8UB 4QTHB 1DN0B 4NBYB 3VW3H 4J8RA 4GRMA 3B9KB 3MLYL 4QNPF 1AO7D 3GRWL 4CDGC 5TFSL 2DLIA 4YAQB 2Y06H 35C8H 4PLNC 5GS1A 1YEIH 2HAZA 6FABL 3DV6A 1R5WB 3SDYH 3NBNA 5DMYA 3V95A 5D7IE 4HG4K 2D7QA 4ISVA 1FC2D 5IW1A 3GIVB 3IAQA 4F57H 4JFFE 1QLEL 5EORL 2X1OA 2D2OA 3KLSA 4LLQA 2G5RA 4HC1L 1MFCL 2CRZA 3CXHJ 3MBXH 4KWUA 4F7PB 2R2EB 2VLLB 3TVMA 2CJUL 3PGDB 3BZ4A 4UQ2A 3KLHC 1DQJB 1NGYA 3MV11 1YYMH 3T3PE 2P5EA 1NFKA 3OKOB 4PTUA 5E99H 4JRXA 1BD2A 1KFAL 5FUZL 1ONQB 3VFUA 5T1MA 3HE7D 1FIGL 1G7HB 4D3CL 2KZWA 1RV6X 4PLJD 5C6TH 3MV8A 1RUMH 3FT4B 4XXDB 4KZDH 4KTYA 3IFOA 4H1LB 4TUJB 4BM7A 3QDJE 2JELL 1OW0C 1ZEAH 4BFBD 5JNYA 3T0ED 4L3EA 4HZLB 4XPHL 4PRPE 3UTSA 3ZKSD 1JZ2A 1X4XA 1BFVH 1QOKA 4JR9H 4PJAB 4OCSL 5CJBA 3T2PA 4M7JL 4J4PD 1N5AB 1N8ZB 5MEPA 3DPBA 4S1SH 4Y1AD 4HJGB 4BQ9A 4TTDD 4BFIB 1OLZA 1ADQL 4LAQL 3FZUC 3IXTB 4XWOD 1N2RA 4PJEF 4QOKD 4MNGB 1IL1B 1AQKL 4NRZB 3K2UL 3HS0A 4XCCL 2NW3A 3UYRH 3B83A 2AI0H 3A0OA 4TRPL 4WGVB 5LGHL 4JHBA 5CBEA 3WFBL 5AUMA 5EWIH 2EDEA 1TVDA 4PJ7E 3VGGA 4F8TA 5T3ZL 3TIDA 5I1KH 3TEUA 1F3DJ 1KENL 4MJ6A 3ARPA 4MAYA 2DWEA 4FFZH 5BJTA 4UUJB 4ZAKC 1LO0H 2Q20A 3G6JE 2R1YA 2IAMA 4NQSA 5J13C 3CZFB 4PGCA 4OZFG 3RQ3A 3M17B 1PKQB 1QVOB 4PJHB 3BZFB 4MQXC 4KRMB 1E28B 3I6LD 4F80A 1EK3A 2X41A 4FFYH 5GQBA 2JJVA 3HUJE 3LQAC 5IB5B 4H26B 1CDGA 3MRDB 4JFDD 3U0TA 2M2DA 2HH0L 3Q1SH 2CRMA 3NN8A 1KJMA 1J1OH 5EU7E 4XAKD 5T1LB 3SGDI 3LMJL 5A2JH 1KN2H 1NCTA 3K8MA 1FGNL 4X6FA 2Q76A 4MS8D 1YMME 1UJ3A 3QEGL 4OV5A 2J2ZA 4K9EH 2ZNWA 3VH8A 5JHDB 1KN4H 1CGTA 1WJ3A 3CVHL 4CU8A 1RURH 2IQ9H 1JNLL 3KNBA 4GW1B 4R2GC 1MFEH 3QUYC 4MNHA 3WNMA 3MMEA 2IPKB 4BKLB 4I18B 4M6ML 3RL1B 2C1PA 3CSBA 4MA1C 1KNOB 1UYWL 3P73B 1G84A 2VDMH 1BX2A 5F8QC 1U8HA 1UWXH 4N0CC 3F5WA 5AWNH 3SY0B 4LKXA 1HK6A 1I9IH 2IQAA 4MWFA 1WAAA 2DL2A 4IHOB 3IU4L 3FB7A 3LPGA 3JV6A 2XYCA 4JO3L 4CN4A 3GO1H 1N26A 3K4DA 3CAFA 5EBWB 4XNXL 2VTFA 2BVOB 3G6DL 4RBPK 5C6WH 3I75B 4JEGB 1HH6B 3AS2A 1F11A 1X5LA 5IJVA 3QP3A 3QUMH 4Q2ZA 3MRFB 4NGHL 3EYQD 3RGVA 4UT6L 1CVRA 3QIUA 1V3JA 1I3GH 3P11L 1DLFL 1ZLSH 1XCQA 1LO2L 4PRIA 4F7MB 3L3DA 5KVFL 4I2XE 3UPRB 4WV1C 2CKBA 4X9GA 4P2RD 1CZ8L 3RTQD 1HINL 2P49B 5L2KE 1BM3H 4X6DB 1DLHA 1WZ1L 3GIZL 4G7YL 2DBJA 4HF5H 3RRQA 2OR9L 3FQXB 3AGVA 4U33A 2R15A 3H8NA 4X5XA 3BRDA 2PW1A 3EDJA 3OJ2C 4QHKJ 1QLFB 4HUUB 3RBSA 3VWKC 3MUJA 2PTUA 3GMOA 4KGJA 1UB5A 4RWHA 4Z7UE 2Y6SD 1HHGB 4JO2H 3IFNH 5EN2B 3FONB 4URTB 5IESL 2OCFD 2CO6B 5F44A 4CDHA 3LS4L 9CGTA 1Y6NR 2CDEA 3OHXB 2DLEA 4XP1H 3CDFA 1IZKA 5E5RB 4PLKD 2UVFA 1G7JA 1Q8MA 3ABZA 3FTGB 4QRTA 1XF3B 3CC5A 4QY8A 4F7TA 3MODL 3W11C 2YC1B 4LSPH 4HIHA 3EYSL 4XPAH 3VXMA 5IW6B 4KRNA 4BH7A 1ZA3B 4JFHE 1FFOA 5HSFA 3BESR 5DRXA 2VERN 4O00A 2A9NH 2VXQL 1N6QH 5T3XL 4YDJA 2XN9E 1ROWA 2VO5A 3QO1A 3VXRE 2HRPL 3E1F1 4OZGF 1EA9C 3SOBH 4FTVA 4GAGH 2XA8L 4MZ3A 1ULVA 1HWHB 4KQ3L 4L1HA 4HC1A 2HJKA 1MRFL 4BYHA 3H9YA 4N0UE 4KHTH 3ARWA 4XMPH 3LKOB 1O7SA 1INDH 2R4RH 1B3JA 5DK2A 3GFUA 3GEWB 5DSCB 4L8BB 1JN6B 2CDFB 2WUBH 2WLYA 1AY1L 3I9GH 4U1JB 4XXCC 3QRFM 1A8JH 2VSCA 3WHXA 4IMKA 2IBGA 5EU3B 3UO1L 4AH2A 5HHOB 3W2DH 4TPRL 2LE9A 3SE3C 3S36L 4IJ3C 4OJFH 2EH8H 3QPXL 4NN5C 4WO4A 5AD0B 3LQMA 3CDCA 2XWJA 3PGFH 3C87A 3BN9C 4R0LA 4B53A 2N7BA 2V2TB 4OZFA 1CDBA 1I1FB 4WWKC 4K71C 1A0QH 4ZFOB 5HGBB 2HKFL 4Y5YA 2I60L 5E9DB 2X6MA 4PG2A 2HKHL 3SDXF 3LIZL 2MNUA 5IVXA 4M8QA 3LS5H 1G7LA 4J3XA 3PNWA 4MDJB 5JOFA 1D5IL 1WFOA 4F8QA 1OAXH 3QUXC 4X98A 2ORBL 4U31A 3ZDYF 2W0PA 1G7PB 2J5LB 1JPTH 5FM5O 3B3IB 4JDVB 2JKXA 5HDLA 4QHKI 3T2NL 4XBEH 3OR7A 5BS0B 4Y19E 1X7QA 3DO7A 3PIQB 2I9TB 1ZT4A 3MV9A 4HUVB 2DBLL 3WIIH 1NAKH 4Z95H 4Y4FB 1P4LB 1IGMH 1TNNA 3VXOB 2VDQH 2BXZA 5DJAB 1KIPB 4JGJA 2LTQC 4NKMB 2F8VA 2Z31B 3CVIH 1EX0A 2F53E 1AKJD 1D9KD 4YHLH 4J1UA 5JLZB 4HWEL 4PJEB 4P59L 1VADA 1INEL 4TVPE 1HQRA 5C0BE 4NN6C 5JDSA 4LLMB 4C83A 4ONGL 3LKNB 1FSKC 3INUL 3S88L 3IJYA 4X7TA 3KPRE 5HYSG 1E6JH 4F33A 3CVHB 2LV4A 3QCTH 4MXWH 1XF4B 1QSFB 1F4WH 4NCDA 3UTTD 1IARB 1U91B 4QRRD 3IDXH 4E41A 1T80A 5KVDL 2OYPA 3VGEA 4NKIL 2VE6B 3X12A 5L6YH 3MRCB 2FEEI 2L4OA 2G75A 1S7RB 4HK0B 4AL8L 1A9BA 4OD2B 2D7OA 5BZDB 1KB5H 3T0EA 2A6DA 4YXLL 5I1EH 3VFGH 5GGTH 4KKAD 1DBJL 3KPTA 1WT5C 5ITBL 5IHZA 5CP3H 3D39D 4U1NB 3WIHL 3M07A 1PLGH 4Y1AA 3SPVB 2FIKB 5C08E 4IS6B 3HA0A 3GB7B 4WUKL 4AMKL 3MV7A 4PJFF 3RHWK 5ILTL 3VD7A 2AV7B 4U3XA 4HKBA 3D0LB 1Y6KR 2BCKB 3EJJX 4ZUTA 3V2AR 1T21B 3HE6D 1YEDA 3NIFE 2WQRA 2R9HC 3MJ7A 5ERWB 3BGAA 5C86A 2ZCLH 5EA0L 3VFMA 1F4XH 1X5FA 3LN9A 4OI9A 3U7WH 3V5HB 5T5NG 1ZANL 3NIGF 4EQ3A 2RGSA 4NQUA 3CLEH 4XPBH 3U6RB 1UWEH 1AXIB 4XNQB 3VD5A 4X9FA 3T8XA 5IFHH 3FO9B 3DWTA 5FGSA 4YHIA 5DHYB 4LCUA 4F9LA 1DQLL 3IDMB 4PRNA 1CFVL 2L7UA 3MO1A 1NMBH 2Y1VA 1MVFA 1RZGA 4LLVA 4XCEA 3LQZA 4GAJH 3TFKC 3QUKA 1DVFD 3B5HA 3BPOC 1OTSC 5CEYA 4YC2B 4MXVF 4KKNA 1RIVH 4X6EB 5DQDH 2BVPA 5D5ME 3ZSTA 2BNUB 1PBYA 2CLVB 4GUPA 1KCVH 3QJFB 4X6CA 4X6BB 3DMMA 1EERB 3H42L 3G04B 4WCYL 3KR3L 5C0JA 1SYVA 3LZFL 3MV01 5BQ7B 3PHQA 2A6KB 2F19L 3SKNB 3PP4L 2W60B 4HKJA 2QR0A 3IXAA 3S35X 4OV6F 2V17L 4HIXH 4I3SH 3PDGA 4OZHF 1MH5B 3RVWC 4NSKB 3DX8A 4G6KL 3FAWA 2P5WE 5DF0A 3V52H 2AABL 3WNPA 2NXZB 1MHEB 1EUTA 4I0PB 4XC1H 2Q87A 2WP3O 5A3ID 2EDYA 3NA9L 4YZFF 1YN6B 4D9RD 5LBSL 4JFOB 4GRLD 4AJ0A 4NHCL 4FABL 3N1GC 2HFEB 4X80H 5BZWA 2OP4L 2EC8A 3DURA 4NQCB 4WFGD 2IADA 3U9PL 1HIML 4QHUA 5DMIH 3ILPB 2ARWA 2WIIA 3DOSA 4HIJA 3L3KA 3V6FB 4AEHL 2AJXH 3T1FA 2R56H 4ESKA 1OHQA 1V7NH 2CDGA 4LCCA 1R5IB 4UNUA 3H3PH 5KN5B 2JCCE 1C1EL 2WP3T 5DRWB 4P9HH 5F96L 5HY9B 4J3OC 5D1QD 5MENA 1P4IL 1B2WL 1QSED 2NY1C 2UY7A 2AJSH 2DQTL 2F58H 4KTEH 3DUUA 1HXYA 4JFPA 4MAUH 1RFDH 2HVKB 4NQED 3NGBB 4YXKL 3RZCA 1X5KA 3MRBB 4OZGB 3BFOA 3O6FC 2A6JB 2X4SB 5DJ0A 1SEBB 3ULUF 2A6IA 3I02B 1ZTXH 1QHOA 1IAOA 2VR9A 1YEGL 4P4KA 3PE9A 5BRZD 4Z7NF 2ITCA 1JWUA 4Y2DA 4MSWA 3SGEI 5IOPA 1RJCA 1DBBH 1HHKB 4NC1E 3W82A 1FDLH 5ALBH 8FABA 2FD6H 3QCUL 3MXVH 1VPOL 4HFUL 1F3RB 1BVKA 4PRBA 3RNKB 5DJDA 3PGCB 1T03L 1BZ9B 4M61B 1S5IH 5HYSA 3RWFA 4Z8FH 4NQVB 4RFNB 2DAVA 1KB9J 2LVCA 3KG5A 3VG0L 1GZQA 4HS3A 4J3WA 5F7HA 5FA3B 3E2HB 1J8HB 4WHYG 1D6EA 4PGEA 3ES6B 1KYOJ 4XP5H 5GGVY 1P4BL 3F7PC 4X7CC 5C0CB 1BWWA 1I1YA 2EYRB 4MZ2A 4WENB 1SJHB 4CW1B 2O5XL 2BNQB 1N5YH 5GSVA 3SDXB 4MYWB 3DXAE 3WNLA 3RIFF 2EDFA 4Z78B 1K6QL 3HG1E 2X70B 3BPLC 1F3JA 4PY7A 5SWZE 4GG6F 3FQRB 4I4WB 2UUDK 1HZHL 5E6IA 2H45A 2J6EH 4F58H 4KK6D 1B90A 4ODUB 3C5ZD 5KSBA 1A6VL 2RR3A 4DN3L 3HAEH 2ICWA 4NQDE 4RGNB 43CAA 3QQ9D 1RJZA 1Y0LB 3RU8L 2YD9A 1I3RA 1T2XA 2C3VB 3D3VE 1GGBH 2OTUB 2OMNA 2OTWB 4M93B 1DDHB 2NYYD 4TUKL 3UAJD 5AZEH 5D7SH 3RUGF 1ZWIA 3KPQB 2UVEA 1YN7B 1XCTA 2BY2A 4XH2A 1I8MB 1JGVL 2YXMA 3QNYA 5J1AA 3L7FA 4ZPVA 1FO0H 5E7BA 1E4XH 4JPWH 4Y8DC 4KJQC 4NO3B 1KIQB 4OGYL 3T0VA 1F6AB 3GSNB 2D0FA 3QDJD 4R3SB 1HSAA 3QEUB 1EHNA 4ZOCA 4B50A 2ATKB 1F90L 1EVTC 4PRPD 2H32A 3W39A 3TNNB 3B9KC 3DNKA 1RD6A 2DQDL 5L0QC 1K2DA 3DUHA 4H0IA 5GRWA 3V4PH 1OARL 4ALAL 5I66A 4ELKB 5FF6B 3JWDH 1OVZA 4PR5A 4NCC1 4G42A 1TZGL 2H1PL 3QO0A 1VFOA 2H9GA 3GSOB 2R0LH 2VDKH 1HHJB 1NBVL 3WS6A 4GKZB 4TSCH 3PWPB 5GGQL 1T66C 2APBA 2QADB 2Q86A 2AK4E 4PRHB 4PBXA 3IF1A 2XXCB 5CJOH 3QSKB 3MRHB 1D5XA 3UTZA 1NDMB 3KYOB 1YDPB 4PJFB 4Q6IB 4NNPL 3UPAA 1A1OB 1O5DT 5IFJA 1AIFB 3VI3F 5JXAL 1HYSD 5J11B 5I76A 4PUBH 1LK2A 1XFPA 4EEEA 5I17A 3S35H 1M6OB 5JQ6L 2YN3A 1QSZA 3QHZH 5SWSA 4A6YH 3TNMB 4QRRA 3QI9D 3FAXA 2X05A 4ENEC 2JB5H 4YO0A 4QXGH 3WEXA 2Z0BA 3RDTD 3QULB 1UM5H 1I85C 4D8PB 5TGBA 1I7RB 1RIHH 3BKJH 1GJIA 2ZCHL 1SEQH 2VKWA 1NKRA 1NLBH 1OAUH 3D39A 5CIPH 1YEHL 1YMMD 3QDMD 1UXSB 2EE2A 3WJLC 2IAND 1CFNB 3QISA 2ESVA 3CX2A 4ODXB 1ZK9A 2LAGB 4L5FH 5F9AC 2OLDA 1T1ZB 4PV8B 4QRPB 5FOBB 2V7NB 3FQTA 5HHVL 2E7LA 4P57A 2MHAB 4X5WA 3N85H 5JOPE 4YDKH 3QBTB 4NM8H 4IDJL 3C8KA 5F7EL 4YBQD 4MA7H 2DI7A 2O61B 5JIPA 3ULVF 3CFKA 3BUYB 1IC5H 3MRGA 1GPOH 3BHBB 2EE6A 4GKOA 5JUEH 4JKPH 2E9IA 1J0YA 4BA8A 1BPVA 4OZHB 4JDZA 1EFQA 4WWID 5IBTL 3HMXL 3O2DH 1FZJA 4IM8A 1I7ZA 3SDCB 3V5DA 2ARJA 2VLKE 3IS0X 1RU9L 1QRKA 4WNQB 3WUZA 4R8WL 1F4HA 1TDQA 5LWYH 5KZCD 2CR6A 3UJIL 1ZHBA 3BP5B 4NFCA 2YPKB 3GSUA 3HR6A 5DO2C 3OGCB 4KJYA 2BY3A 2E7HA 4S0TD 3RPKA 3WE6A 3C6LB 3AY4C 3LRSA 3N9GH 3ZE0F 3BH9A 1AD0A 1ZLVH 4G9FD 2GK0A 3SGDH 4P2QA 5TDOA 4JLRA 1YC8A 5EPMB 4L3AA 1HQ4B 2DKUA 4LBEA 2BDNH 4FXKB 1JHKH 2E9BA 3BIBX 4MJ5B 5DWUL 4WDIB 5EUOF 3Q2CA 1KLUB 3KPLA 4RMVA 1ITCA 1PAMA 5C0IB 3ULVL 1KPUA 2OSLA 1NMAL 3O6LL 1DZBA 3IU3B 3OF6A 4QRSA 4LSQH 1W0YT 3AXLB 5ECJE 2VC2L 5AYUH 3ECBB 4HUWB 5MHSE 2RB8A 5BVJB 1R3JB 5C0RL 4I18C 2YPVL 3MACL 1A7NH 4JG1L 3FT3A 4F37K 1JF1A 2YD4A 4X4XB 1ZE3C 2DQGH 4UTAH 4X4ME 3KPPB 4F9PA 5CZXC 4LGRB 3ZDZF 1FZOA 3V6BR 4UINH 3NAAH 3MNZB 2FJHA 4NJAH 3BZEA 1A7OL 1B0WA 1DUZA 3QNXB 4Z7VE 3T4AB 1MAKA 3L3JA 4JFZL 5TE6L 3RY5A 3G5VB 5EBLA 1NEZA 2Y72A 4LCWE 1G9MH 1U8NB 2DI9A 4JFHD 6CGTA 1YPZE 3V5KA 5GGUA 3L3GA 4BZ2H 1BOYA 1CE6A 2PW2B 4NFDA 2OX5A 1VFBB 2OL3H 4G6MH 1OD7A 4ZXBB 3EO9H 3VXRD 3BEVB 5FCUH 5DVMA 2GSIA 3KYNB 3EO1B 5D1QA 5I1IL 3A67L 1MCHA 3PDOA 5F1IB 2B5IB 3K1KC 1WAAF 1Z0NA 1QSEA 3OJMB 5IG7B 1SVZA 1U3ZA 1U8IB 2BNRE 5HHNB 4PS4H 1MQKL 4MNQB 3D6GA 1OTTC 1XGRB 3O45A 5J9PA 2BMKA 5L88H 3VG9B 4NQEA 3QPQD 3KHOA 1Q38A 5IB1B 1GC1C 5EFIA 4OGXL 2FO4A 3BH8B 4M03A 4FQXD 2AJUH 4KKCC 4U1LB 3FB8A 4UTBH 3VWJA 1FE8H 1JGEA 4JHWH 4GSDH 5CSZA 1AJ7H 3SKOB 5FV2A 4GG6B 1WBYB 4KKBD 1IM9A 5FYJH 3H9ZA 3STZB 3G5XB 1WSST 4N9GA 2AJZB 2Y5EA 4P5TD 5J6HA 3QYCA 4G8GD 3MUY1 3O8XC 1LDPH 1BEYL 4GBXA 5CJXC 1L6XA 4Q9CA 3WLWD 3AM8A 1NGWA 1Z3GH 5FYKL 1H3UA 1QRNE 3HZKB 3T0WA 1AGDA 2VXVH 1MCNA 2E6JA 4O02H 1IAIL 2BERA 2ZJSH 4O51A 1EO5A 2B4CL 1N64L 1XH3A 4DWHA 4HWBH 1CFSA 1I8KA 3H9SB 4W6YB 5T5FH 3BEWB 2JJWA 3RUGB 3IETA 3TZVD 4YX2H 3ZDXF 1MI5B 3SDAA 4WI5A 2FECI 4C56A 4LPTA 4U1IA 2D4FA 4L8CA 4Y19D 3KYAA 3D18B 3D9AL 3WL9A 3VE0A 4CNIA 3FQWA 4QTIL 1XGUB 1E0OB 3KPSB 4OLVL 1X5ZA 4PJGE 2FH8A 3LAFA 5E2VH 4FQJL 1T0MB 2BSSB 2V9RA 4DKDC 1MJJA 4PJ9A 3KYMB 4AENB 5H37H 3V6OA 5I1HL 4LKCB 1A5FH 5F7LB 3QB7C 2HLFD 1RJYA 4ZPTA 4KV5E 1JF6A 1IAKB 1FHGA 3HI1A 4DZBA 1MFBH 1JVKA 4UMGA 1JGDA 2B0SL 3KPRD 3L3HA 4IRSB 5CAYB 3WXWH 2MQ3A 1FLRH 1X6NA 1D5BB 2AXHA 1J12A 3RWDA 5IKCB 4WY7H 4MVBD 1OF2A 1RK0A 1R3HA 2FB4L 2Z8VC 3FO1A 3W0WE 5GRJL 4EVNB 1C5BL 1EBAA 3GJFB 1W72L 1KJ2H 2MTPA 2VDOH 5C6PB 4M7KL 4MJIA 3VXUD 1CIUA 1J0JA 2J5LC 2CUHA 3QEQE 3VMNA 3OKNA 2NNAB 5C08D 3FMGL 4NZTH 1E6OL 3DRQA 5L2JA 1H8OA 4XNYH 4XGZB 4Y4FC 3S37H 4GG8B 1CXKA 1LP9F 1NUFA 3BDYH 3RWEA 4JM2F 1A6WL 5FB8A 5JTWA 3EZJB 5KSAB 5DD1H 3SBWA 3HC3L 3GI9H 4K8RL 2Z31C 4PJ8A 4G43B 1CWVA 2Z4QA 3BW9A 4P5MB 5IB2A 5JORA 4UIKH 1EZVY 3CFCH 1DQMH 1EMTH 1MOEA 5FO8B 4YGVB 3UDWC 1YJDL 5EC2B 4J3TA 1VGEH 2Z35B 4OI7A 3P30L 4XNMA 1UWXK 1G9NL 1PZ5B 2LAAA 1INQB 3U4AA 3QI9A 4RWYL 4JFED 1MFNA 1WZMA 1UM6L 2J88L 1T0PB 1UCTA 2F54B 5EZIH 2FATL 4KK5C 5EIVA 3WJJA 4H25A 5DEGA 5I19L 4XPFH 1RSFA 2H26A 1YEFH 5JPMA 2X4QA 1RUQL 3ELAT 3MOAH 3QDMA 1R3LA 4LNVA 3NFSL 4KXZI 5C7XL 3TWCH 2BJML 4KH2A 4TYUA 3B6SA 1BQHG 2DQHH 1WZKA 1WFUA 5EZOL 1JYVA 1VEOA 1Q9WB 3DECA 3VXSE 3BIKB 2APFA 2X44D 5EZJB 3GKWH 2Z91A 2NY2D 4CMMB 2A9ML 3OTTA 2MPAL 1EHLH 2ICWJ 5KS9F 1QKZH 1XIWB 5B39G 4NNYA 4XP9L 1TCMA 4O5LH 2OXGA 1FYTB 1MREL 5EUOB 5GRZA 2PF6A 1RZ7L 4CADB 1S7VB 5K9JL 4RAUB 1G6RA 3PABA 5I1GH 1A64A 3K46A 2R29L 1MCOH 1JBJA 3NH7H 4OGAD 3S96B 4NT6B 4HKZB 4G7VL 3TO4A 1F6FB 2JJSA 3NCJL 5DHVH 1BFOB 5D7LB 5HHQB 3O9WB 4HUNB 5IVNA 2H3NA 4QHNB 5DYOA 3LPWA 5F7MC 2P8PB 3QH3B 3QDGA 1KELH 1DBAH 4YC2C 2FX9H 4KK8C 4G9FA 4HK3J 1QP1A 2K3TA 4L1DA 2VZUA 3DETD 3P4OA 4WFHE 3ALWA 3IDJB 1BFSA 2XFXB 1CFBA 4MNHB 5IBLD 4ORZC 5FYKU 3CSYB 5HYQA 2EZ0D 2R69L 5CGYD 5CUSH 5BV7H 1JJUA 4JZOB 1PDKA 1OCWL 5TDPB 3OZ9H 3S7GA 1DQDH 2J1KA 4RDQF 4LSSL 3WO3B 4XNUL 4OI8A 4HCRL 2X4TB 2XRAH 5JW5A 3KXFB 3X3FH 2O5ZH 5ID0B 3HI6H 5EG6C 2NXZC 4I0PC 1IC7H 3DTXA 1CT8B 1RPQA 3WFEL 4HWZB 2NR6C 2WW8A 5LVEA 1HEZA 5BVPH 4OCWL 4ZO6A 4JO1L 1S7WB 3JTTA 4MQ7A 5INDA 3GHBL 3MRNA 1AC6A 3HZYB 1BQUA 2B8OT 3L6FB 5KVGH 1PX3A 4YNYB 3O4LD 1UVQA 4K94C 3PWJB 1QQDA 1HHIA 2W9DL 1P2CB 2X4RA 1U58B 2IPTL 4FQCL 4NCC2 2Y07H 5JO5B 4K3JH 1YMHA 4U0QB 1R3KA 2LFGA 4OQTL 1U3HB 3OJDB 4JDTH 1T22A 4AIZA 5MEOA 1EJOH 1LO4L 3J8F7 1IJ9A 3MNWB 3DXAD 4Z0BH 1FL5A 3GSXA 1I9RH 3DHJA 3BYYA 4V1DA 5DJYA 2FHCA 1AXSB 4O9HL 2ICWI 5IMOB 3WFDH 1DEEB 4GLRI 3CFEA 1IEBA 4K2UH 4XVSH 4KHXH 1JPST 4UV7H 3BKYH 1IFHL 1J8HE 3X14B 1NSNL 4M1GH 4FQXA 4KRPB 2WBJB 1OT1A 2MQCA 4NQDD 3NACL 2GAZA 2GSGB 1W72B 4Y16B 2C1OB 5IB3A 5CJ8A 5I8EB 1UEMA 3EYVB 1IGCL 1QBLL 4IOFD 1PG7X 4LIQL 3D3VD 2AKRB 3SGEH 4HT1L 2BNQE 3MRIA 1MIML 2J8OA 4G8GA 1ZKAA 2UV3A 4APQB 3GMRB 4PTTA 1DBKL 5HDBF 4XX1G 5D7JB 5GZOC 3U7YH 3KLAB 5D1XD 5IBUB 5IEKA 1M7IA 4TUOB 3ARQA 3H9HA 3ARSA 5I73B 3V6ZA 3WD5H 1W0WA 1QBAA 3HCVA 4RFNC 3FCTA 1H15B 5DK3A 4TN9A 4OKVA 3E2HC 4EDXB 4ODVL 1CXFA 2ICCA 1CK0H 3U9UB 3KYKH 1BQHB 3L5HA 4Q0XH 3TZVA 1OSPH 2BHYA 3C8HA 5I71B 5D7KE 5FYJE 1WLHA 4P4RA 4BQBA 2Q6WB 5IJKA 5B39B 32C2A 1T1YA 4DQOL 4LRIA 4PRAA 1CICD 4NZRH 1NQBA 3O3UN 4O2EB 4HJ0C 2DQUL 1SMOA 5CILH 5TE4L 4UILH 1UCBH 3QXWA 1FFPB 3BPCA 2VUOA 4L4TD 4UB0L 3S34L 4KZEL 4OZIB 2AK4D 1CLOL 4K7PL 2WWMD 4RGNC 4OFYA 3JV0A 4LPUA 3HZVA 2DWDA 4WU7A 3Q3GB 4XBPB 4CVXA 2LU7A 1LP9B 1BIIA 4JM2B 4PJBE 1F2QA 4CU6A 5F1NA 4M93C 2GHWB 3LV3B 1FVEB 4K3DL 5ANMB 1CLCA 3TN0D 2I27N 5DLMH 1H5BB 1AO7B 3H0TA 4GKNB 3HFML 1KF9B 3FHQA 3WKNA 4HK3N 4NZUL 3X3GH 4MJ2A 3VD9A 3QQ3A 5DVLA 3ZE1E 2DQIL 1QBMH 4OIIL 5H35A 1J5OH 3JZ7A 3MLRL 1CQKA 3MA7A 5LCVH 5CGTA 3QIWD 1A1MB 3LD8B 1LQSR 1ES0A 2BSTB 2FBJL 3ARFD 3VXUA 1SYSB 4Y5XB 3JWOC 5D2NE 3S4SG 1LNUA 4U1SB 3MLSL 2FWOA 4Z7WA 4XP4L 1I7UA 2UZXB 4J2XA 3LB6C 4ONFH 5HHPA 3MJ9L 2DYPA 5E56A 1RZFL 5F7DB 2AK1H 4GKSA 2DQCH 4LLYB 4HH9B 4HMEA 1WICA 2VQTA 3TYGL 1RJLA 4WRLA 4YHKH 2VSDA 3V8CA 3CK0H 1JHLL 4KMLB 2OJZL 4JY6A 3P3YA 4JHAL 1B0GB 2QADC 1FPTL 2BX5A 2YPLE 4LEOA 4WJ5A 5FGBA 3IJSA 4JGUA 3O2WL 5I1CL 2G9HB 2Y36H 3OAUH 3DRTA 3D0VA 4ZFFB 4XVTH 1MFAL 3HE7B 4Q9RH 4LCIL 2L7JA 4RRPG 2R0ZL 1JPFA 4OUUA 2C7UB 3WN5B 1U92B 4ZO9A 3L9RA 1LE9A 5D2NC 4JZJC 1U8PA 3WSQH 4EI5D 4G80B 5KS9B 2DLHA 3F58L 5IK3B 1TPXB 1T89C 1WWAX 3CCHA 4JFEA 5KANI 3TT1L 1X5YA 3KLDA 3QHTC 5I0DA 5B38B 4U1MB 3HC0A 3LEYL 3QFDB 4POZC 3RX8A 4L9LB 1NFDF 2EKJA 2YMXH 1CDUA 2ADGA 5E2WH 2XOTA 2DOCA 4QOKB 1A9EA 5E6ZA 1TMCB 1XEDA 2GFBA 2P8LA 3TV3L 3T65B 2OK0L 1MNUH 2XNAA 1MVUB 3L5WA 5BMFL 5TQ0L 2G2RB 5ALCH 4HCRA 4P2YA 4PJXF 1J0IA 4WW2A 2EKSB 4U0RB 5ESVA 1QD0A 2YUVA 3GSRA 2WINB 2FX7H 2VXUL 3C08H 2APTA 2J8HA 1ZLUH 1JYWA 2FH6A 4WTXA 3MNVB 4I9WE 3WUWG 2M1KA 3P77B 1IM3B 4ZS6C 5DJ2B 4HHAA 2HRLA 1I8IB 4AT6B 2V5TA 1UXWB 1RAMA 1WWBX 4K7PY 1KCRH 4DVRL 1ED3B 4JVUA 5ADOH 1NGXB 4E0RA 2QV2A 4C59B 4LSVL 4UAOB 3NCYS 4JFDB 2HTKD 3OXSA 2CR3A 2DIBA 2X4PA 1S7SA 5HGGS 3ARVA 5IR1A 3OB0H 3SDCC 3BRGC 5C07E 3LN4B 2CKBH 3GJEA 2F8OA 2EDOA 3VXNA 1CD8A 4P23D 1FJ1B 2X4NB 3RAJH 1RZJL 4LDOB 4EN3B 4YHNB 2QSCL 3RPIA 3VFOB 3C6LC 4YHPB 2YA2A 5EU6E 1D5ZB 4GRWF 1DL7H 4MDIA 2UY6A 4ZUWA 1C7SA 3O0RH 2BNRD 2AQ1A 1IGTA 1QZ1A 3V4VH 4JPKL 4F2MA 3C9NB 3ULUE 5SX5H 1Q0XH 4BH8A 2AJYL 3PG2A 4HQQL 1BZQK 2CK0H 5BXFA 4XCYA 4N0YH 4NO0D 2ZPKL 4G8FB 1XGYH 3ISWA 2AJVL 1AXTL 3EJZD 4CN6A 1ZHKA 4AQOA 1XF2B 4JQVA 4NZJA 2AQ2A 3MLYH 1QEWB 3T0BA 4WI4A 3AREB 1F00I 3PXJA 4P99A 1B88A 3EOAA 2XWTB 5TFSH 3ZTJG 3S5LA 4ONOA 6FABH 1DE4B 3IFLL 1A6AB 3NABH 4QGYA 3K2MC 1SVCP 3ULUC 3OKMB 5A2LH 5E08L 4QHMA 5B8CA 2OR7A 3S4SB 3O4LA 1IEAA 1QLEH 3ARBA 4M5YL 5EORH 4M5ZL 3BISA 4P2RB 1VKXB 3RTQB 4LMQI 1KTDB 1JE6A 4HC1H 1MFCH 2VMFA 4ETQB 2CKNA 3LKSA 4PJCA 1L7TL 1AP2A 1S9WA 1U8JA 3G9VA 4GG6E 4ZXBC 3UP1A 3RHWF 4ZSOE 2GJ6D 3TH2T 4RMUA 3EFDL 5F7NC 2B5IC 5DS8B 1XR8A 4Z5RA 1KFAH 5FUZH 2D03L 5D2LA 1R0AL 1TETL 2EE9A 3IKCA 3VG9C 2P46B 1FIGH 1HSBB 4D3CH 1SJVA 3BSZL 4PJIF 3EYUH 3AS1A 4RQQA 1JK8A 5FECB 3VXPA 4OZFH 3WXVH 4ZDHA 1VGKA 4CVZA 2VWEE 2R0KH 2LQRA 4XPHH 5C0AA 4EUPG 3OX8A 3SEPA 3VRIA 4OCSH 4HS3B 4WU5B 4PP1C 1NKOA 4M7JH 1ZT7A 1ZHLA 5JXEC 2P7TB 2YKLH 4P9ML 4B5EA 4DVBB 5D1XA 3VFTA 4FFVD 2AVGA 3TA3A 2BVQA 4LAQH 1D5MB 3IDIA 1A2YA 2BHUA 1AQKH 4UV4H 4OCXL 3K2UH 4XCCH 2EE3A 2LABA 3UBXG 3W0WD 4TRPH 5LGHH 4QYOB 4FMFA 3WFBH 4NWTH 1OAZL 1MWAL 4AEIL 5DK0A 2VLJA 2FGWL 4W4NA 3KLHD 5B22A 1KENH 4WHTA 1T7YA 3S98A 3DJ9A 2VLRE 4PB9H 5A2IH 3V0VA 1L9NA 4TTGA 2GUOA 4XTRD 5TDNA 4D9LL 1KPRB 3WCYA 3PHOA 5DTFB 1Y18B 1MCIA 3CMOL 5AZ2H 1CICA 1A7QL 4GXUM 4JJ5A 5GGRY 2W65A 5GS0L 5JZ7C 3CDYA 1LEKB 1S7UA 3BXNA 1TTFA 4L4TA 3RWGB 4YDLB 4OB5L 1FNEA 1WC7B 4KI5E 4S2SB 3B43A 1S78C 4MD4B 1Q1JL 2VITB 4OCYL 3WUWA 4WIQA 3SJVA 1ZGLP 2HH0H 3LMJH 2G60H 4NRYA 1FGNH 1NL0L 2GJJA 5GISL 1JV5B 4P3DA 1I1AA 3DROB 3QEGH 1LHZA 3NPZB 5D7IF 5CHNB 1FNAA 3FZUD 2IPUG 4I5BB 1UWGL 4BQCA 4U1KA 2PNDA 4DN4H 2UWEA 3CVHH 4IRSC 4M7LL 3C60D 5TH2A 1JNLH 1L7IL 3P9LB 1SBSL 5EOTA 3SQOL 4NUJB 2ADJB 1S7XB 1BMGA 4M6MH 1UYWH 2W9EL 1MCWW 3MGOA 3DUSA 2P5EE 4FQPA 3QIWA 4JRXE 5IQ7L 1BD2E 3L3OB 3I6KA 2ADIA 5FM5M 1RK1A 4WTZG 1XMWA 2IMMA 4L29B 2VZOA 5F9JB 5DRNA 4ZAKD 4YFLF 3D69B 3MV8E 1KEGL 2Y25A 1DUYA 1T20A 3D2UA 4HPYL 4JO3H 4PGBA 1KPVB 3REWB 1CTOA 4MQTB 1EGJL 1ZLVK 1AKJB 1NFDB 3AU1B 1D9KB 4XNXH 1HKFA 4L3EE 3G6DH 4Y4KA 3UTSE 2QQKL 1A4JA 4E5XA 1JUFB 1Q0YL 3VXSD 5JPNA 4KGLA 3D85D 5HPMB 3BP6B 3CXHK 4NGHH 4UT6H 1NBZA 3MJ8B 1GXEA 1NC4D 5KSAC 2PCPB 5F1OB 5GGTA 4LLUB 1LO2H 4PJXB 2VOTA 3KPNB 1TVBA 1NC2D 4M4PA 5KVFH 4QXWA 5CP3A 3UTTB 3L95B 1EFXD 1WZ1H 3GIZH 1QA9A 1VFUA 2H2SD 1XGQA 4EI5A 2OR9H 2BOBA 3EYOA 3TYFB 1MHHA 3PL6D 3ZE0E 1U8KA 3FFDA 4X0KA 3TBTB 4ELMB 3ULVC 4HUKB 1OGTA 1FL6B 5GGRA 1AGEB 1JMXA 2IMNA 4TNVK 5K9OA 4H0GA 4JO4L 3QNZB 4E9LA 4KROD 2AS5M 5J8OA 4PJ7F 4TULL 3GMMB 5I1LA 4N0CD 3THMH 3LS4H 4PJ5D 4WFHD 4ZQKB 4JCLA 5E8OB 3LEXA 4FQLL 4M62H 3G6JF 4ODWB 3HE6B 5E94B 1T5XB 1TJHL 5IT2L 1UQSA 3FB6B 3UROR 4KXZH 5EH1A 3O3EB 1YNLH 1IZJA 3MODH 4NBXB 2QKIB 1LO5A 3EYSH 3EHBC 5A1AA 5C0EA 1A3RL 1AGCA 3HUJF 3LVEA 4R4ND 4EJ1C 5F89A 1FZMB 2AXGA 4JRYD 3MRQA 4QF1A 2VXQH 1TVHA 5T3XH 1IEHA 1XIWC 4KJPC 4FS0A 1KIRB 2XIDA 3QG7L 4NKOA 4ZFZA 4EUPA 1UENA 3DSFL 5EBMA 3LQAL 3UBXB 4KQ3H 1DVFB 1QPPA 2RFXB 3MGTB 3SE9L 3HZMB 1DBML 3P9MB 3O3DB 1N59B 1JNHB 3NIDE 3ARXA 1TJGL 1WAAE 1T04B 4QHLA 3BUTA 5J12B 4P23A 3O9WC 1YNTA 3RY6C 1AY1H 4FQ1L 4F7CA 1FL3A 1CTNA 3UO1H 1YECL 4LU5L 3GNML 5IWLA 1EEZA 3KPMB 4TPRH 1ORQA 1M4KA 3S36H 1CGXA 5HGDA 3QPXH 3MFFB 4YBLB 4CRPA 4OD3L 1A6PA 2IC2A 1T2QL 5HVFB 2B7DT 4PRIE 5DJZB 2HKFH 2I60H 4NRXA 4L8DB 3TIEB 3VFSB 2HKHH 4KC3B 4GRLB 4U4BA 3LIZH 4X8XA 3F7YA 1MWAB 2F9BT 3F62A 3QIBA 5DRZB 5DD6A 1MLBB 5E1AB 1NMCB 4YJZL 2BRRL 2KKQA 5I15L 2R1WB 1D5IH 4MCZB 4P2OA 4BSVB 3UXFA 2DICA 1ACYL 1EAPB 3T2NH 4PJIB 4JFQA 4N1EA 3V5KB 4XCNB 1PZUB 1WBXB 2F74B 4HS8L 2DBLH 4NDMA 2AXFA 3QIUC 3ZDXE 4FQIL 1H8NA 2QQLH 2ICEA 2W0FB 4N8VA 4WI7A 3H2WA 3QXTA 3I6GB 4Z7UF 4C4KO 5DT1L 4M4RA 3B2UD 5CP7A 2CSPA 1RHHB 2YK1H 5HYJA 2ZOLA 3FO2B 2JJTC 1OSZA 2JK5A 5D7KD 5FYJD 1FFNB 2GJ6A 3PQYB 3FFCB 3VXME 4HWEH 4P59H 1U3HC 1INEH 4GQ9L 4E42B 2VL5A 3VU2A 5KVEL 2X4OB 4ONGH 1EV2E 3INUH 5KSUA 4GLRH 1KULA 1SBBA 1YA5A 3RP1A 3ZTNL 5BRZB 1DANT 1XR9A 4IOIA 3AS0A 5HHXH 5ACMA 1Z5LB 3FN3A 4FTVE 3LSOA 4MHHG 4YIQA 1H0DA 2GITA 4ODHH 4NKIH 2RQ8A 4XBGB 4C4KT 4KRPC 2WBJC 3BO8A 4LHUD 4GOSA 1PQZB 4AL8H 5EO0A 4Y16C 2BOCA 1KTLA 4MCYB 4YXLH 4ONHB 3WKML 4NZDA 2PYED 5I2IA 2EYSB 3STLB 4IRJD 2DLGA 2XKSA 5ITBH 2HT4C 3ZLQC 2F5AL 1RZ8B 1YEKL 4PREB 3WIHH 3ULSB 1T3FB 2MFNA 5ABDE 3HI5L 5HI5D 4APQC 4OLYL 4AMKH 1FORL 1UZ6E 2RJMA 4NC2B 5ILTH 2J6EA 1J86A 3SE4C 1T4KA 5E5MA 3L7EB 5I73C 5CEZL 3C2AL 4S11A 2AP2A 3WS3B 2D0GA 1P5UA 2D0HA 1TTGA 3R1GL 1Q9LB 5FDWB 4PRDA 3VJ6B 5DEFA 3HPLA 5D7IB 5EA0H 5D93C 4JZNA 1IQDB 2VNCA 4OTXL 3QFJA 4FQQA 1PY9A 1N7MH 1G0YR 1ZANH 2X5PA 4JFFB 4OF3A 1W8OA 2YEZA 5I71C 1GIGH 3VFVA 1K3IA 3C5ZB 4UU9B 3Q5OA 5IVXE 1YJDC 3RNQA 3T04D 4RNRA 2C3HA 4F37F 3C6SA 1UFUA 3QXDA 1DQLH 1G9NC 5MERA 1CDYA 1FO0A 4JANA 1F8TL 4QWWC 1OY3B 4H8WH 3ZYZA 4LSDA 4X9HA 5LG1A 2EICA 1PYWA 4NP4L 1OW0A 2YPLD 4OLEA 4AK1A 1ZS8A 3MV9E 1HILA 3ZMRA 3C2SA 4WFED 4R0LC 4Z7OE 3WDHA 3P4NB 5M94B 1WCBA 4M43L 5DUPH 1M7DB 4HIIB 4C58B 5HHMD 1J05A 5D1ZB 3FQUB 3MOBL 3KR3H 1AGFA 4JM2C 3LZFH 3EDKA 3QDJB 2XZZA 5CWSB 4IEFB 5F1SA 4LLWB 4PRPB 4R4FL 4P46D 1QR1B 1H5BC 3PP4H 3DI2B 1G1YA 2V17H 4Z6AT 2Q7NA 3MLVL 1J11A 5ICYA 5E2UL 4PIRF 1FRGL 2AABH 4LLDA 1JRHL 3LD8C 4ZAKA 3NA9H 4Y5XC 4E41E 5LBSH 3NA4A 5DFVD 5DJ6A 4NHCH 5F3HA 4FABH 5ITFB 1B0RA 1A21A 4PJ7B 5IEHA 1VCAA 1LMKA 4D0CA 2PO6D 3T0EE 2CQVA 4LNRA 1HIMH 5J6GB 3MRLB 3D85A 4YPGA 1MY7A 3G6JB 3GHEH 2OJEA 4AEHH 4Y1AE 2KZ1B 1IGIL 1NC4A 5KSVB 5C1MB 3DSNA 2VQUA 1WBZA 5ISZA 1ZA6A 3MV7E 3LRHA 1C1EH 1LE5A 5F96H 2JIXA 3FB5A 5DUMH 4EQ2A 1EFXA 1EEYB 3HE7C 1P4IH 1B2WH 3HUJB 2BSED 4PLJC 4WHYH 3WN5C 2DQTH 5IV2A 1P84J 3RDTB 3VW3L 4KUZL 3E3QE 3VFPB 1TPXC 5JHLL 1KCSL 1M05A 4TVPL 1NUDA 1YMMB 5E8EB 1R5VA 3G5ZB 5ENWB 3SDYL 4K7FA 4J4PC 4JQXC 4LDLB 2IANB 1S7QB 4HXBL 4L9LC 3SE8H 1YEGH 4TTDC 5EU6D 4PJ5A 4UOW0 5EIIB 4XWOC 4F57L 2ZG2A 4GW4B 3WHE0 1BF8A 3QCUH 5EC1A 1VPOH 1EHXA 1JGLL 3IDGB 2XG4A 2VZVA 2ZUSA 4L4VA 4QT5A 3VXQA 2YZ8A 3ZKND 3MROB 4GW5B 5IF0A 1S9VB 3VG0H 1FQ9C 4MA3B 3E3QC 4R7DA 4X6CE 3TBWB 4JRYA 1NAMB 1LEGB 4X8JB 1YYML 1KCKA 3H7BA 3CFDB 5KG9B 3PV6B 2FYYB 4PGJA 4RFOL 3QZWG 1OGAA 4WV1A 5CBAB 5DR5H 1C16B 4XPTL 3U0WL 2O5XH 4NPYB 1FZKB 4HX1B 2NY1D 5KZCB 4JN1H 3MREB 3DX6A 1K6QH 3QQ4B 3T0XA 4LPVA 1K4DB 4X83A 1HI6A 3GUTA 4UAOC 2X89D 5LAXA 4DOHE 1BVLB 4I2XB 1HZHH 1A4KA 3VWKA 4DEPC 1KOAA 1BFVL 5ELIA 1TITA 2XTJE 5L2KB 3MRPB 3IDNA 4XHQA 1A6VH 2CLZA 5CMAA 4DN3H 2IFFL 2HN7A 4RFEA 1IILE 4MS8C 3TJHD 2AAVA 3RVXD 2YZ1A 1U6AL 4FXGB 1CGSL 5C9KA 5EO9B 5HYIA 2OTPA 4G8EB 2FIRT 1A7PH 3OKDB 4M1CD 5ACZB 4TUKH 2CIKA 4Z7UB 2ZCKL 4HS6A 5T1KA 3KWWA 3LH2L 5EWIL 3NZ8B 2CXGA 2B1AL 4LRNL 3ARGB 3ROOB 3LKQA 1KJVA 5KW9H 1JCKA 1CR9L 1JGVH 3VFRA 5MENE 2WIMA 3ME0A 4NNXB 1LO0L 4OGYH 3FOMB 4XVUD 2PXYD 3BOVA 1OAYL 4WI2A 4HKXA 5H94B 1UGNA 5C71A 2NX5A 2JCCF 3CU7A 2IALB 2VLMD 1EBPA 1QO3A 3EGSA 2DQDH 1TZIB 3R06B 4L3CA