1JNNH

Crystal structure of fab-estradiol complexes
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
214
structure length
214
Chain Sequence
EVQLQQSGAELVKPGASVRLSCSASGFNIKDTYMFWVKQRPEQGLDWIGRINPANGISKYDPRFQGKATLTADTSSNTAYLQLDNLTSEDTAVYYCAIEKDLPWGQGTLVTVSVAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTI-ESTRADIOL 17E12E5 IMMUNOGLOBULIN KAPPA CHAIN
publication title Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jnnH01
2HKHH 3OJ2C 3GSQB 4UDUA 5IVOA 3Q5OA 2Y36L 5FO7A 1M71A 5B38B 1EA9C 3PXJA 5ETUB 3O2VL 3KNBA 4MSWB 4ZG1A 3IXTB 4DN3H 1VFBA 5EORH 4KKAD 2B0SH 3THMH 2LVCA 4ODVH 2IQ9H 3QFJD 3RKDC 3VFNA 4J2XA 4YHIA 4NZDA 2BJMH 3UROR 1Z5LB 1DBKH 1MEXH 2C4FT 5DMJB 4G6FD 2A6DB 1I4FB 1QSEB 2EXWC 5E94A 5I1HL 1T20A 5I6XC 1JHKH 4P5TC 5SX4I 1T5WA 5BV7L 2E7LC 3MA7A 5FYLL 4KJPD 1LO4L 2ICWB 4KUZL 2FWOA 3CFEB 1HHKA 2QSVA 3CSYB 5C0BA 2FB4L 1T6VN 4P3CL 3ARRA 4JHAH 4P2RA 1R3HB 1KCKA 3TNMA 3F7RA 2HT4C 1MPAL 1NH6A 1FV1B 3D1MC 1LO0H 3OJDB 4Y4KA 2XG4A 4APQB 5D5MB 3X11B 4FQHA 1FYTD 4Y4FB 3CFDB 4AH2A 4ZTPL 3D25A 1X5FA 3REWA 4Z78B 4RGOL 2P8MA 4YLQT 2XZCL 5TE7H 4ZAKB 2WZPD 3BMWA 5T1LB 5EA0L 4Z76B 4YFLF 3V4PL 5CJ5A 5IHZA 5DHYB 3KPRE 3A67L 2H6PB 4R8WH 2HRLA 1HHGA 3HS0A 4YDLC 3BZFB 5I16A 1EZVX 2UZIL 4KVCL 1I7ZB 1GGIL 1RU9H 1ZXQA 3GM0A 3BRGC 4LKXA 5HHPB 5ID0B 3FN9A 4PRHB 3SDDB 4MB4A 4XPFL 3KYMA 4IRZH 2HFGL 2AXGA 5F96L 3KS0H 1UH2A 3IRZA 2XN9B 2Y72A 3U7WL 1UYWL 4PLKC 5F9AC 4ZUVA 5GS0D 3QDJB 5HY9B 1NFDB 3IDMA 5DRWB 1L6ZA 4MQXC 1A22B 3WIHA 4P23A 1XF5B 3DMMB 4WJ5B 4YEEA 4ZFOA 5J11B 4QRSB 2BNQB 3MCKB 2F53E 2V9TA 1VACB 5J3HC 2DQEH 2F58L 5FYJE 3RPKA 5IHLB 1FE8L 1FZOA 3WD5L 2CMRL 1A7PH 4MD5A 3U2SB 5EU5B 2AEWA 4FQPA 4GJTB 1L0YA 3RVXC 4S1DD 4OLXL 5C0FB 4Y88A 5JPNB 3DX9A 1RZ8A 1UM4L 4W4OA 4QNPE 1I1YA 1NL0H 4MXWL 1MRDL 4R4FL 4NO3A 1LDPH 4LLVB 3OAUH 3TZVB 1MNUH 4D9RE 1U8LB 2APTA 5JW4N 2I60L 3GSWA 3TBSB 2NY0C 3MROA 4F58H 4JN2B 1DVFB 2YKLL 2HMID 3MOAH 4HT1L 1F13A 4PJ8C 2RCSL 5C0JB 1YN7A 2X4QA 4JZNA 1NCDL 1OPGL 3MRPA 4P2CG 3PP4H 4O2EB 3U0PB 3Q6FA 2OZ4H 1NSNL 1WTGT 2GEEA 3GSUB 2VL5B 4XPBL 4KPHL 1PBYA 2CUMA 4JPIA 5EBWB 4O58H 3O6KH 5E2VH 5CJXA 3A6OA 5DD0L 4MD4B 5F7HA 4FMKA 1FLTX 4OQTH 1Q38A 5AG8A 1J18A 3T09A 4WEBL 3K74B 4QRPD 4AEIH 1WVZA 3VDCA 4XCFH 5IJVA 4OGAD 5BV7B 3I3DA 3OSKA 3ZTNH 5BCAA 5IB2A 1JWUB 4M7LL 4PJFA 4P5KB 4NHCL 5BJTB 4Y2DC 4PJEF 1XF4A 1JV5B 3KYNB 3AREC 4KRLB 3N9GL 3JVGC 4M7KH 1T21A 4KRPD 1LWRA 1G7JA 2O5XL 1JZ8A 5DHXB 4EDXA 1X5IA 4WFEE 5KVEL 2QKIB 3BYTA 1GGBL 4H1LA 3FTGA 1KJ2B 3X12B 5HBBA 2VYRE 1JYVA 3P40A 4U1HA 1KN2L 2E8YA 5MENA 5K9KB 4OM0H 4KDWA 5EU7E 4WU5B 5I1DB 1FL6B 3U48A 5T1DH 2VLME 1RHHA 1NGWA 3KVQA 4WI8A 2HA1A 2XFXA 4R90H 4U1GC 2BY0A 4Z7VA 2CXKA 3GBNL 2PW2B 1NFKA 5KOVC 4N0CC 4IBLT 4M4RA 1JGEB 1U42A 3C08H 1KN4H 3C8KA 1E4XI 3PHSA 2YRLA 4P2QE 4U1KB 3QIWD 2AK1L 5MEQB 3S6CA 2IFFH 2EDJA 2FEDC 3G5VB 2VAAA 3LKNB 1E27B 2ZKHL 4ZQKA 4LPWA 5EO0B 1VGEL 4OCXL 4DKEH 4UAOB 1NMAH 1WCBB 4JO2L 2J8UE 5JORA 1JL8A 2EIEA 4JE4B 2W0FB 4KMLB 4KHTL 4UDTA 1C1EL 3H9SD 4PJBB 3N1PC 4JFDA 3GM8A 2YA1A 5FK9B 4HWBA 1UM6L 4ENEC 2A6KB 2YXMA 1DLFH 2VQ1A 4AMKL 4JCLA 4BYHA 3RZWA 4K94L 5EIVA 3HG1A 4U4BA 3MR9A 5HGHB 1KELL 4GAGL 5D6DC 3CFBB 5BOPA 1GOFA 2M26A 5BS0D 2CKBA 5KVFL 2EIDA 3HE7D 3ZKND 1DN2A 1XGYL 1T83A 1G6RH 1ZEAL 4MJ5A 1HSBA 2HKHL 2VZVA 2C5DC 1U93B 2H1PL 3QDHA 3D39A 4NFDA 4S1SH 4U1LA 3ULUF 1FC2D 2AJXH 4DN3L 3RL2A 4AT6B 3VXSB 1GC1H 4OIBA 1CDBA 2NY5L 1ZT1B 2AK4D 2UWEF 2ZUXA 1UWXH 5F1KC 3ZDZE 1DSFH 5TDOA 4JDTH 1JHKL 4WFGD 3QDMD 4OGYL 3C5ZC 1VHPA 2VZTA 5CINL 4PTTA 5ACLA 4OZIE 3B3IA 1CFTB 2QADB 1G7MA 3MRQB 1S5HB 3PWPE 3C09B 1AIFB 4ETQA 1K8DB 3UTSA 1A9BA 3LRHA 4XVSL 3Q6GL 1LO0L 2XNAB 1YEJH 1RY7B 5SWSA 1AQKH 2EECA 4LCWB 4OGXH 5F89B 1FH5H 3MPCA 4WNQB 4O5LH 4BH7A 1UQSA 5AZEH 3CZFB 5EZLB 1H9VA 1SEBA 2NLJB 5F21B 1A7RH 3B6SA 5GGUA 43CAA 1HSAA 4O2CA 4YPJA 4HIEA 3T0BA 4MS8D 3MJ9H 1JHTA 4WTZG 3BN3B 1BEYH 4CN4A 3BFOA 4LLYA 1XCTB 3B8SA 3FQUA 1FIGL 3LKOA 1RU9L 3O8XD 5DF0A 5I8EA 5JNYB 4HF5L 1KLFA 2HVJA 1AGCA 4IRZL 4XPTH 1Q72L 4GBXC 3BGFC 3BP7B 3U9UA 3MO1B 4MQ7A 4OD3H 4RBPK 3WUWB 1MRCH 2FBOJ 5CEYA 4DUWA 1UGNA 3HZMA 2N7AA 4V1DE 1OTSC 5TE6H 3MJ8A 1UA6L 1S8DB 3CVHL 1ZLVH 4YPGA 2ZZUT 3O6FD 4AENB 3NZ8A 2BOCA 3EDJA 3FQWB 4RWYH 5JOFA 2CJUH 4KGLA 4M7ZB 1D9KA 4X6DB 1FAIH 1U3HA 2DQEL 3MLVL 1INQB 3LKQB 2BVUA 1MHCA 4BJLA 4X6FB 3JV5A 1HE7A 1MVUA 4FZ8L 2P8PA 2GQHA 4JRXD 5IEHB 5IOPA 4ORGA 1M4KA 1TVHA 4XP6H 1M05A 3I3EA 5IB5B 1OD7A 3VWJA 3ZE2E 4QWWC 3MLSH 2A83B 1NL0L 5F7EH 5HVFB 4KJQC 4MDIA 3MLRL 3X13B 5GGVY 1FZJA 4WU7B 5DJZB 4J3UA 1KLGB 1L7IH 2AXJA 4F58L 3EO1B 4MX7B 1NCUA 1TNNA 3V5DB 5DTFA 3MNZB 4HH9B 1RUQH 2VUYA 3MOAL 1OP3H 4F2MA 4Z5RA 1PYWB 1MJ7H 5L2KE 5T3ZE 3MCG1 4FQXD 1CTOA 3TA3C 1FG9C 2OZ4L 3FT2A 4XMPL 5ICZB 5J12B 3HPJA 3WFHA 3G5XA 2F53A 4EDWH 2YC1B 4JG1L 4O58L 4Z0BH 1Q9KA 2YPLD 3O6KL 2NR6C 3IFOA 2AJZB 4LGPB 3BISA 3SCMC 2VC2L 4IIQC 4AEIL 2OQJB 4XCFL 5DA0B 4O2FB 4RMQA 4Y89A 1G7LA 1NCBH 2Y5EA 1FP5A 5DJYA 4JG0H 3HNTH 3SE3A 1Z6JT 3KLDA 1A1MB 4HG4J 4OLYH 1ZWIB 4LCUA 1CGWA 4RAVA 3DV6B 4IS6A 4XXDA 4M7KL 3UTSD 1GL4B 2P47B 2N4IA 2PW1B 2VMFA 4GG6F 1DANU 2EDFA 2FH6A 3O6LH 2MKLC 3TLRA 4EI5C 3UDWA 4AIZB 1XR9A 3O6MH 4JANA 2OSLA 1KPRB 3IFPA 5FYKU 5L2JB 1BVLB 4Y19B 5F88B 5E7FA 3RUGB 3T0XA 5FB8A 4KU1A 4OM0L 4MJIB 2QQLL 4NBZB 3DVIA 1FLRL 3F7PC 1A7OH 1A6AA 5T1DL 1QP1A 4U6YB 1WFOA 2C3XA 4YIQB 4QO1A 4L8DB 2CQVA 5C0GA 3VE0B 3LN5A 3ZYOA 5JR1L 3VXPB 1LP9E 2XIDA 5DD1H 2COQA 5A43C 1CLOL 4NO5B 3VFMB 1LK3L 3DX6B 4K7PH 1JZ6A 1CDGA 4ZMAT 1RJCA 3RGVC 4GW1B 4CVWA 2NY1B 4TUJA 5I8KL 4F33B 1B0GA 3QIBB 5CUSL 2WSKA 4EUPA 4M1DH 2GCYB 5JZ7D 2FX8H 4QYOB 3VWKA 2IFFL 5H2BA 5E2WH 1NAML 3L3GB 4P5MB 1I8KB 4C58B 4Z7OE 3EFDH 1NMAL 4YFDB 3MNVA 1I3UA 3CVHB 1T0MB 1U2HA 2XPGB 5DS8A 1C5CL 1JK8A 4NPYB 5EC1B 3WNMA 4J3OC 4XHJC 3VCLB 5J1TC 2R0KL 3HE6D 1MELA 5DK2A 3IKCA 4ZUWA 1BVKA 4XP1H 1OQOA 3ARVA 5K9JH 1F3DJ 1U3HD 4MA8H 4HCRA 1TQCB 1CYGA 3IS0X 2K9UA 2GFBB 2Y6SD 2X4UB 4NNPH 4UOW1 3EAKA 5DEZA 4IMLB 1CI5A 2ZUTA 3KPRD 4M48L 4PJ7B 4PRPE 2R2EB 3S3SA 2YBRA 3B8YA 3PP3K 4AEHH 1T4KB 1TZIB 3MOBL 3PWJA 2AXFA 2NPLX 5K33A 3NIGF 3CFKB 1OGAE 3MA9H 3PGDB 4JFOB 4P2QA 1XR8B 4XNMB 4MA3B 1FRGH 4S1SL 3UTZA 3QT2A 1S7TB 3E1F1 2BRRH 1BFVH 4QCIA 1GC1L 1HDMB 4D0CB 4KKCC 4G8IA 4U1SB 3SKNB 3ULUH 2VDRH 1QLFA 2AV7B 2CDEA 1DSFL 3VA2C 3V8CA 3FRPG 3MLXL 4XGZA 3QUZD 2F53D 2F5BH 1VESA 3P4OB 4PJGF 3UPRB 3LN4A 4BM7A 4FQ1L 4FXGB 1KXVC 1X7QA 2E5EA 4U7SA 1O7SA 4NN5C 1J0JA 3FB7A 4E9LA 3MODH 5DVMA 1S78D 1AQKL 5EUKB 2MHAA 2X1XR 3F5WA 4O5LL 1YJDH 2IALA 3T0EC 5JHLL 1GGYA 4M61B 1ZA3A 3DROA 4YFEA 4RQQB 1A7RL 4NKQB 4D9RD 1NCWH 4GKSA 4J7RA 3FB8B 4P5TA 2E7LA 3BIAX 4I4WA 4IOFC 1Q8MA 3GSOB 3KJ6H 4F80A 1A1NB 3RDTD 2ZUWA 4HIXH 4M1CC 5HPOA 1UXSA 3OHXA 4LVHB 4WI9A 1UWEH 3F6IA 4MHHI 1UB5A 3ILQC 2BNRE 4F7EA 5DK0B 4JHZA 2WUCH 1HKLH 4NO2B 3G6JB 3FFCB 1WTLA 4QRUB 1R24B 2YSSA 5EWIL 2A0LC 4OZIA 2WINB 1QRKA 3FJTA 1MRCL 4X6BA 5CGYD 2EXYD 4PV9A 1E6JH 4RIRA 3PWPA 5TE6L 3L7FB 5MEOA 1ZANH 5DYOA 4XP5H 5IBLD 4JO4H 4Y5YC 3MRRB 2LAGB 1T1ZA 5HDBE 5ESAA 1OSZA 3QPQC 5CSBA 4RWYL 3GSNL 4WV1B 3FRUB 1MSPA 5D6CA 1HN1A 4BUHA 1M6OB 5D2LA 1GYAA 4WHCA 3UTTB 2VDMH 1U9KA 2OCFD 2ZG3A 3VH8A 2DQIH 1KB5A 3KR3H 4JJHA 1PEWA 3VGAB 1YN6B 1X5JA 4WFED 1FFNA 5D93B 5DRXA 4ZS6C 3RWIB 3VD4A 2RGSA 4U1JA 1SEQL 3I3BA 1QFUL 1OTUC 4UOJA 1CIUA 1PZ5A 2P44B 4N0FB 1I8IA 5F9WB 2VLMD 1FNHA 1WWWX 5D71L 3QXDB 3AROA 3FO1B 4XMKH 1L7IL 15C8H 4RWHA 1I3RA 3K4ZA 32C2A 3FO2A 1RUQL 2R2BB 3R06B 3DXAE 1YPZE 5DJAA 3ZT7A 4POZC 4HDIA 4JKPH 1XZ0A 3PHQA 1MJ7L 4P2QD 4HGMA 1DBAL 5I18H 1Y18B 1F3JA 1EO8H 3DWTA 4TPRL 1FJ1B 4Y5XC 4ODSH 3TN0C 4I2XE 4DJMA 4FFZH 3S37H 4EDWL 5AYUH 4N0UA 2DF3A 4Z0BL 3C5SB 1RURH 4HX1A 2XRAL 1MUJA 1UJ3B 1BD2B 5FKAA 4PGEA 1ZV5A 1D6EA 3JV6B 3QH3A 5D96C 5GZNC 1KPUB 1R3KA 4JREB 5T1MB 2C1PA 5GS1C 2X4RB 5KSVA 4OF5A 1T5XB 5F97E 4ZXBC 4F7PB 4M1GH 4PJ8A 2ZNXA 1AP2A 1YC8A 2EH7L 1BGXL 3N85H 4OLYL 4JN1L 2DB8A 4MAYB 2Z35B 3QI9B 3K2UH 3TVMB 2OK0L 1AD0B 1T0PB 4HS8L 5EU4B 3WNKA 3HC4H 1WWAX 3RKDD 3U0TA 3VXRE 3O6ML 5I19H 1F02I 3JTTB 2VR4A 5IIEB 4GQPH 2QLVB 4G8GE 3UJIL 1AGEB 2EXWD 1FG2A 2ZUVA 3WJLC 5L2KA 5KSBE 1IBGL 1RFDH 4ZNEE 5J8OA 3RWFB 4XBGA 1FNSL 3V4VH 3U83A 4Y2DA 2D7NA 1M7DA 1JVKA 1I1AC 5D1ZA 1KG0B 3AREA 5JW4M 2HT4D 1BECA 3JVGA 2JJTC 1OCWH 3K8LA 3WL9B 3ARGC 4JDZA 5GSVB 2FX8L 1PY9A 4PJCF 3RWDA 1T04B 3QDJD 3S35X 1DQTA 2P7TA 4H0HB 5E2WL 3AS0A 2PTVA 3FZUD 1ITCA 4EXPX 4YXHL 3D87B 4L4TA 4OI9A 5KSAA 3EOAA 5E03A 5EZOH 5C0EA 4FOMA 4PD4J 4FFYL 1WEJH 1G7HB 2BSRB 3FQNB 4HUXB 4YBQC 5E8NB 3GSNB 4CADB 1OL0A 1Q0XH 4RMRA 4UIMB 5K9JL 1CG9A 1X5LA 4OV5A 4MA8L 2YA0A 1FNEA 1ZTXL 4WW2B 3C60A 2BNUA 4PLNC 1O0VA 2VLLB 2YPKA 5E2JA 5TDNA 4L29A 4MDJB 2XKNB 4PLKD 4NO0A 5BVPH 3NIFE 2Z8SA 1GPOH 3RHWK 4AEHL 3AB0B 3PIQB 4DVBA 3V79C 3GK8H 4ODHL 4MQXD 5F7UA 1KNOB 5I1IH 5K9QG 1PGRB 4G43B 1KJ3H 4DVRH 5BO1H 5EPMA 1IC4L 3GBLA 1ZS8A 3EKCA 2CLZB 2JB6A 4GUPA 5F3BB 2BRRL 3V52L 5I8OH 2WBJD 4I18C 4KVNL 5DRZB 4IMKC 1QBMH 5EUOF 5DSCB 3QAZB 2Z31D 2EYRA 3RWCB 5GS3A 1RMFH 4N5ED 4V1DD 5D2NC 2D0HA 4H8WC 1EEZA 2V2WB 3NIDF 5D6DA 2CLVA 5C6PB 3T0EE 2F5BL 4LSRL 4ONFL 1JZ4A 4OFKA 4K9EH 3WS3B 4Y8DC 5M7QA 2EDLA 4TRPL 2NYYC 3DHMA 3RL1B 3C9NA 2NY0D 2HG5A 3SDCB 2X1QA 1B4JL 4Z77B 3S36L 3MODL 3MRHA 4M6AA 3TO4D 2IH1B 3LCYA 3IU3A 4Z0XB 5A2IH 1YJDL 4P4RA 4WHYH 1GXEA 4PRPA 4JFYB 4LF3A 2VXTH 3N1MC 1ZGLM 3MRMA 2I07B 1OW0C 5EC2B 3G5YA 4RMWA 3U30B 1SBSL 3C5ZA 2P48B 2BOBB 3N50A 5ITBH 3KJ6L 5B39G 5HYSA 12E8L 3C6LD 3QA3A 2AQ3A 5I1GH 3PL6C 1VSCA 5DJ0A 4XRCA 3CLEL 2H3NB 1UWEL 5T3ZD 2ZUQB 4I13B 1F2XK 1DCLA 1SJHA 1WITA 4U6TA 3MRJB 5CSZA 1HKLL 4KC3B 2XWBA 3L9RA 4L4JA 3ARED 5GGQH 3ZDYE 3PHOB 2MMXA 5C0RH 2Q8BL 3H42H 5C8JB 1F45A 1X4XA 3SGDI 3QUYB 5C08B 2FNBA 1ZANL 4KI1A 4XP5L 3MBEB 4JO4L 1ONQA 5EBGA 3OAZK 2DLEA 3KPMB 4KHXL 2HJLB 5SV3A 3RY4A 2V7NB 2VZ1A 3VFWA 4NBXB 2JIXA 4NNXA 2UVFA 1HEZB 1Y6KR 3BT2H 1ZHKA 4L8CA 3G6DH 4XXCC 4GBXA 3KPLA 4IHOB 4G80B 3H6JA 1CD9B 5KBNC 1CLCA 2OJZH 1GHFL 1TCRB 1HIMH 1YEDA 2Q7YB 1DLHB 3IU4L 4HUNB 5HHOA 4G9DA 4KRNA 4RMTA 3QWRD 1BFOB 3OAYH 4LFHD 3RVVC 2LVEA 5GJSL 1D5XA 2UY6A 5EU6B 4OM1L 4XMKL 3MYZA 2Q86B 5DD6A 1DQLH 1UVQB 1OLZA 2FGWH 4H0GA 3DVFA 3CUPA 2FBJH 4AY0A 5JMOC 4JKPL 2IPTH 1GZQA 4J6RH 1I1FA 1EO8L 4ODSL 1A6PA 4NWTH 1BMGA 1RJYB 3GJFA 4PJIF 4ENED 4FFZL 5IKCB 2VITB 3GMMA 4KJWC 5C0AE 1LD9A 5AYUL 3QWOB 2HYMA 4WENB 1AGDA 1CFNA 2F5AL 3RA7L 5IQ9B 4YHLH 3ULVD 1KC5L 2H32A 4X8XA 5CSGA 4NGHH 3VFGH 4A2LA 5BZWA 3W82A 1NGYB 3QHZH 1YECH 5IP4A 5JXEC 1U8MA 3OL2A 5CKAA 1CL7H 4XX1G 4YDKL 3NOIA 3O4LB 2AI0L 2A73B 1D6VH 3KPSB 4HGWB 4UIKL 5T3XH 3TA3A 2GUOB 2P42B 3L3JA 5DJ2A 3HC4L 4OLWH 2EKJA 2Z92A 5I19L 4M62H 2ICWJ 4XCNB 1AGBA 4MD0A 3CDYA 1W0WB 3DXAA 3SCMA 1OGAD 4X7TB 2VXQL 3MRCA 4IIQA 3TWCH 4LSVH 5JUEH 4NJAL 3MJ6A 3P9WB 5E9DA 4KKBD 1CD8A 3V4VL 4LLWA 5C09B 3W0WB 1OGTA 4MA7L 5FF6B 3WXVL 1MI5E 2H8PB 1EERB 4YXLH 5ID1A 4X4XB 5ISZE 4EI5A 5GHWH 3IFLL 4NQVB 5IB4B 3KXFE 2X41A 1U8PB 3EO9H 3IDYB 4HLZG 3MRFB 3MRKB 4K3GA 4Y4FC 1QPXA 1TETH 3U7YH 5EZOL 1TJIH 3DRQA 5TGBB 4WCYH 1F4YH 2X4SB 4XH2A 4ZAKC 3PDOB 1NLDL 5C6TL 4O02H 4EN3B 2E27H 3W39A 1JZ2A 4HZLA 3JSSA 2Z4QB 4JGMA 2NY2B 3RGVA 1QD0A 2JKXA 5A16A 2JIXD 5E1HB 3BQUB 1INDL 4G8GA 3SJVA 2I9LA 4JRWA 4U0QB 2DTSA 1Q94A 3OKOB 3IDJB 3S5LG 2DQDH 2NXYD 5I1LB 5KSBA 4NHUB 3WFBH 3SDDC 1UXWB 4JPKH 1Q9OA 1IM9D 4UU9B 2XG5A 5TDPB 5D2NE 2BVOA 4PJEE 3T77B 4YHZH 4R9HA 5CHNB 3SGKC 3IXAA 2Y7QB 1LEGA 2APXA 2BNRD 5SX5K 4X6EB 5DHVA 1JNHB 4TVPH 3UZQA 4Q9QH 1MAML 1VERA 4CDHA 5FA3A 5JOPE 1KJ3L 4DVRL 1QVOB 1FORH 2GIYA 4G5ZL 1MIML 3DMMC 3RI5K 4RZCA 1TQBB 4XNXL 4TNWK 5J1SC 2QQNH 2BY3A 1T1YA 1FSKB 3M1BA 5DMYA 3PGCB 3U4BH 1OQXA 1WBXA 1S7QB 2A74B 1C5DB 3VFPB 3S96B 5FDWB 3W9EA 2KH2B 5FHBH 3X3FL 3ECBB 5EZIH 5E24E 3MV8A 5DT1H 2VZUA 4HJGB 4XNQA 4K9EL 2FSEA 2HT2C 3ZYIA 5FKPB 1EHNA 2D7TL 1YC7A 2DKUA 2L0DA 3SDXB 1T2QH 5CS7A 3TZVC 1QO3B 4X4MA 2QSQA 4JM2B 5DMKA 5L8JB 3SBWC 1GGUA 1DVFC 4IRJD 3T2NL 3UYRH 1SM3L 3VXTB 3BE1H 3H0TA 3TA3D 4YXKL 1FFPB 3MSPA 4PJHB 1L0QA 1U8QA 1P6AB 5ITBL 5JIIA 2APFA 2YD8A 4PJ9B 4KK9C 1OOAA 1D5ZA 3EO0B 3DXAD 1RZFH 3SCMD 2IG2H 4GG6B 2PYEE 5IBTL 2VJXA 1LEKA 2K7QA 1NC2A 4LSTH 4KRMB 3MZTA 5CEZL 5C7XH 3CAFA 4IOIA 35C8H 5I30L 3T0EA 1HK6A 5BV7C 3QUMH 4P46B 2G2RB 2WANA 4Q2ZA 3H9HB 1A7BA 2ICEA 2Y07H 4PLOB 3RX7A 3GUTA 3AAZA 1JWSA 4X7DC 2R2HA 4LSQH 3CDCA 1D7FA 3FHQA 3V6FA 3HI1B 2P24B 2O61B 3KDMA 1T22B 1P53A 2PN5A 3P77B 2DQFB 3P73A 1MLBA 4PGDB 5IVXB 4HS6A 2VLRE 4TSBH 1WZ1H 5HYIA 3OKNA 4URTB 1IGJB 2UWEE 1G0DA 3IETB 4EXKA 3BT2L 1OTTC 3VXRD 2AJYL 3G6DL 4ELKB 4WO4D 3RZCB 3OXRA 5I0DA 3U0WH 2OJZL 3WLBA 3D18A 1J8HB 1HIML 5GS2H 2GT9B 4K3DL 3GMPA 4Y5YA 3VXQB 2YUVA 1CTNA 4P4KB 3BKML 4PRNA 1DQLL 3OR6A 4ELMB 4G42A 1VFMA 5CBAB 3ZDXF 4WFFD 2UY7A 2ZNWA 3G08A 2FGWL 4GKZA 4HKZB 1ERNA 1R5IB 1MFDH 4HGKC 2ADGB 4UAOC 4XHJD 2IPTL 4L3EE 4J6RL 1BIIA 1GVIA 4Z7UF 1FO0L 2VLKE 2Z8WC 5E00B 3DYMA 4O51A 4BSVA 1PX4A 4UQ2B 3LRSB 5J06A 4WI5A 5HGAA 4OIIH 4Z9KB 2B1HL 2ZUSA 3HMWH 3CD4A 1UCBH 4PS4L 4NGHL 3NH7H 4L3AA 5DRNA 1CK0H 3MGOA 3QHZL 1VADB 2YD9A 1YECL 1W0VB 5ACZB 2IAMD 4PJDF 4X80L 4QT5B 4P9HH 1D6VL 4WWKA 1CICB 4Y5XA 1NDMA 5ALBL 5LG1A 2FZ3B 1QSEE 2APWA 1BP3B 3STLB 1A4KA 3GSRB 4NUJB 2PYFB 2ESVA 4KKCD 1Q9WB 1FVEB 5IMKB 1ZGLP 5GRVK 3PJSB 1HNFA 3DIFA 4RGND 1YNTB 3L5IA 1X5YA 3TP4A 2ZOKA 3TWCL 3LPFA 2NY6C 3MXVL 4DKFL 3T0VA 3QEHA 4NWUH 5GS1A 5IWLC 1OT1A 4ZXBA 1WFTA 3ET9F 3QJHB 5C07B 5E1AA 2UYLA 5HJ3A 4KROB 4NSKB 2YK1L 3IJSB 3K81A 3QULB 4YXLL 4WI6A 1QBBA 4LBEB 2YZ8A 1KIUA 2DWEB 5GHWL 3T0ED 5EBMB 5HI3C 4XT1C 3WHE1 5C0IA 1W72H 4FTVB 2APVA 3H7BB 4UQ3A 3VRIB 4GS7B 5HHNB 4OZ4B 4WUKH 3PNWA 5EO9B 4ZUTB 2EYSB 3O0RL 4NQEB 3WJLA 1TETL 1HZHH 2EE2A 3NCYS 4JZOB 4MNGB 4PRHE 4IOFD 1INEH 1BLNA 3DLQR 4OCSH 1IGMH 3WDIA 1MREH 2P4AB 4NQCB 1T7ZA 1I1AA 1YYML 4HLZH 1X9QA 3SO5A 3SHSA 2WV3A 5DVLA 2JE8A 1E4KC 2JJTA 3BW9A 3P9LB 3BPCB 3DUSA 3ILQD 1OP5K 3ARGA 1BFSA 1A14H 1NFDE 4XNUH 1NKOA 3KYKH 5TH2B 4FQIL 4N68A 4KWUA 1NCTA 2DQDL 2EDEA 4NDMB 1ZLWK 5F72S 2A0LD 1QFWH 3EDEA 2XOTA 1SYVB 3MLYH 3WJJA 1H15B 3RWHB 6FABH 3SOBH 2GTWB 2CRYA 1MI5A 3KPNB 3KWWA 1AGFB 4YHZL 4ODTH 2PO6B 4YBHA 5E2UH 1U2CA 4PRDB 4RA3A 4DQOH 3BD3A 4RNRB 4M7ZC 2QQNL 1AH1A 1AFVH 2ZOLB 3VXOA 4UTBH 4ZS6D 4PRAA 4QTHB 4OBRA 1S5IL 4NUGH 4JRYD 1OTUD 4HBCH 3RNQA 5DT1L 1MFBH 2BXZA 2F54B 5J13B 2XZQH 1F6AA 1CGVA 5FGSA 1F4HA 4MVBD 4G3YL 4K94C 1KPVA 4JFHE 1ZVHA 1IILE 3FB6B 1GGCL 3CH1B 3STZA 4YX2L 1V5JA 3QNZA 2OL3H 4OD1L 3QDGB 3NCJH 2BX5A 3K1KC 4ALAL 4I18A 4K7PY 4IMKA 4YAQA 1K3ZA 5GSRB 3VGDA 3UYRL 4R2GB 3MV11 3BE1L 1JGDB 1WBZB 5D2NA 3ARBD 3D0LB 1S7SA 3TN0D 5SWZB 3TC9A 5I1JL 3MRGB 4GG8A 1KTKE 2NXZB 2NY3D 4ESKA 3VFVA 4CBPA 1KF9B 2R9HC 3ZKXB 3BDXA 4X5XA 5FYLE 3RNKA 4GMSH 4I5BB 4YHYC 3GMLA 4X7FC 5J12C 4X99B 1TZGH 2EYTA 3NCEB 2C3VB 2R23B 4I0PD 2NY5C 5JW4Q 3CDGA 3MV7E 2F9BT 3K4DA 3CFCH 1IC1A 1IGYB 1IQWL 2FDBP 2DJSA 1BQSA 5F3HA 4MNQE 1JWMB 5C0AD 1KSRA 1G0YR 3TBYB 3GJFK 4X6CB 2WWKT 4HEPG 3OGCA 4ZO7A 1SBBA 2DMCA 1OW0A 1A47A 4K2UL 1A4JA 4EI6A 3HFML 4PR5B 3LN9A 4JVWA 4KXZH 5E6ZA 3PL6A 1JJUA 4F15B 2XICA 2AP2A 3MREA 1Z2KA 1MHHA 3PWNB 4OKVA 3JV4A 5GIRB 3T0DA 4LK4A 4OTXL 3KYOB 1WBYA 4D94A 4PJXA 1I8MB 2AQ2A 4HWEL 2WIIA 3BHBB 1CS6A 2VLJB 4PJGE 5D1QB 2NW3A 4FRWA 2CIKB 4NNYB 1NFIA 4XCEA 4FFVC 4CVXB 4NZRH 8FABB 5KN5A 2NY1C 2DM3A 4PUBH 4PJBE 3QIBC 1AKJB 1UENA 1UCTA 3GKZA 1U3JA 1UKTA 4RGMB 1LEIB 2VRAA 5C0CE 1GH7A 4F7CB 3TIEA 1WAAA 4JFED 3BP6A 2VZOA 1MFDL 4YBQD 5ISZD 3DTXA 3HB3C 1OARH 4XXCA 5I74B 5JDSB 1IGFH 3KXFD 1Q9LB 3HZKA 1JPTL 1A9EB 3U46A 1AR1C 5HHVL 4OIIL 4PRID 4IEFB 2RHEA 2AEPH 2IGFH 2W0LA 3HMWL 5DEGA 3BI9X 3N1GC 4LHUA 4HG4K 4RSVA 3SGEH 2OXGA 3I6GA 3NH7L 3QG6A 4ZSOB 2IH3B 4KKNA 2KZWA 4YK4C 1Z0MA 1ND0A 2PCPB 1JTTA 2AEIT 4YDVA 1N64H 3L5XL 4OZFH 2ZJSL 5FYKH 3A6CL 3DUUB 5MI0B 4PRBA 3JWNC 3EOBB 5DC9B 5MP6H 1EFXB 1RZIB 3I6KA 5JDJA 4JO3H 2K3TA 3TO2A 2Q20A 3LS5L 1A6UL 1X5XA 3LKSA 4GMTH 3SDYH 2XA8H 3MRIB 1G7PB 3GMOB 3D85B 5FO8A 1DJSA 4AZ8A 5GRUH 4XCYA 4BSWB 3OKYA 3TIDA 2X7LA 2ITCA 3F65A 4Y16C 1LE9B 1R3IH 4L3EA 5HHME 5E6IB 5ABDE 3PWUB 4NKMB 2AABL 2VLKA 5JXEA 2YWZA 3QBTB 3TBVA 1HXMB 4H20L 2NYYD 2ZCLH 3H8NA 1CFVH 1QACA 2W1NA 5FUZH 4RBPH 1N59A 1U8OB 4PG9B 5B38A 1N5AB 3DNKA 2HP4A 1B88A 5ETUA 3LQAH 1AQDA 3IXTA 4PJFF 4QOKB 4XZUB 3AXLA 4JY4B 2P5WB 5EIQA 3NAAL 5IFJB 1LO2H 4MLIA 3MUJA 4HIIB 2H26B 1Z5LA 3BKJH 4H1LG 3HTLX 1INEL 2A6DA 1IGML 1QSEA 5C3TA 2EE3A 5J89A 2V9QA 1IT9L 1KIPB 1CIDA 3IFNH 2ICWA 3CFEA 3CSYA 1WZLA 2VZ3A 4MYWB 1A14L 4XC1H 4X98B 1H3GA 4ZUSB 4XNUL 4TOYH 2JB5H 1HWHB 3LV3B 4QRTA 5JHDE 5I17B 1FV1A 2Q8AL 3OJDA 4LNRB 4APQA 3QHTC 4Z7VF 5D5MA 3X11A 1QFWL 2E6PA 4PY8J 3HC0B 2LU7A 3MLYL 3CFDA 4LCYB 4Y4FA 4WDIB 6FABL 3SOBL 3TESA 4Z78A 5J6GB 4A2MA 3HMXH 1S9YB 1N8ZB 2PYED 4JLRB 2GJZA 3L3IB 3ZE1F 1WV7T 3EIFA 5EN2B 4ZAKA 5IMLB 1JGLH 3VRLF 1QLRB 5T1LA 1NBYA 5I0ZA 4Z76A 3EYFB 5D8JH 4C56E 2KUTA 1Y0LB 2V2TA 4CUCA 4OB5L 5GS0H 3CFIC 3E8UH 4DQOL 4NQSB 2H6PA 1MFCL 2G5BB 3L1OL 3BN9D 1ZAGA 4D0DB 1CFSA 4PBWD 3CIQA 5ID0A 3LRGA 4PRHA 3SDDA 4MXQD 4OCMC 2FHCA 3BUYB 3ULUD 4UILH 3VGAC 5DI8B 4HBCL 5D7SL 3BSZH 4N1EA 2VLRD 2H9GB 3RVVD 3SGKA 3DBXB 3NN8A 5GJTL 5HY9A 3RRQA 1NFDA 2R1WB 1U8IB 2KL6A 4TNVK 1XF5A 3DMMA 4WJ5A 1U0QA 4JPVL 4MJ6A 4D9LL 4QXGH 3MCKA 4XTRC 2Y4SA 1VACA 4DAGH 1H3VA 3QP3A 2I5YL 2AV1B 3HI5H 3S35H 4QRQA 4R26H 6CGTA 2XA3A 2M1KA 2XY2A 3ESVF 3VG9B 4LOUD 2AS5M 1S3KH 3U2SA 5EU5A 4JM4L 5IROC 1ORSB 3KPOB 3ZYJA 2FLRT 4GMSL 4CN6A 5C0FA 4FQLH 1JE6A 2A9NH 1A6VH 3IKKA 4S1RH 5JPNA 5ICXB 3MNWB 2YEZB 3CFCL 2XWTA 4RISH 4LLVA 3ZKMC 2XT1B 3TZVA 1UJ3C 2VLKD 1U8LA 5BRZB 4HC1A 3TBSA 1YEIH 3ARXA 1KXQE 4OLUH 3SBWA 4JZJB 1DVFA 4EBQH 5L88H 5HVWA 5EZJB 4JREC 3DV4B 3I2CH 1PW3A 4G8FB 1J1OH 4P99A 4X8JB 5E8DL 5GRXG 4MJIE 5C0JA 4NRYB 3S97C 5HGGS 4UT9L 2IBGA 4MAYC 3QI9C 4O2EA 3TVMC 5M94B 2DL9A 3U0PA 5F1SA 1VFOA 2J2ZA 4U6VH 3O9WC 3GSUA 2VL5A 3JV0A 5K59E 3QCTH 5EBWA 1OAKH 2GY7B 4HWUA 4KDTC 2FCBA 1JPSH 4MD4A 5EUOE 2JCCE 3WSQH 1A6ZB 1FL3B 2GKIA 3NIDE 3BWAB 3VXME 1D5IL 3RAJH 1I7UB 2GTZA 5EULV 1P84J 1JWUA 4P5KA 3RIAK 5BJTA 1AXTH 1JV5A 1WZKA 2XTJC 4LAQL 5L0QB 3PP3H 3P3YA 3KYNA 4AIOA 2AXHA 3T0WA 1B6DA 1ETZB 1JFQH 4N9GB 1N4XH 1K6QH 3PV6B 3AGVA 4K7FB 4GAYB 5EOQH 2QKIA 4MNQA 4MCYB 3X12A 1KFAH 3IT8D 1Q1JH 5K9KA 3LIZH 4JB9H 4WU5A 5I1DA 1FL6A 2V17H 5GGRY 1IGFL 3TPUB 2EH8H 4PJ7E 3MV9B 3HCVB 2PW2A 3MXWL 3S34H 4BQCA 4M7LT 4LU5H 1QR1B 4HHAB 3WNOA 1JGEA 1ZHNB 4WW2C 1DTUA 5E8PA 1U8NB 5IM7B 1NEUA 4U1KA 1PZUB 5F93C 4E41E 4YR6B 3WFDH 1QSFE 3LKNA 3BH8A 4MMXC 3BEVA 5AWNL 1E27A 5CLWA 4KZDL 4E5XB 2FRGP 3QEGH 1N64L 1WCBA 3AB0C 2A6IB 4XVTL 1AI1H 4Z7NE 5FYKL 2W0FA 2X09A 2OL3B 3QIUB 4ZODA 2EC9U 4PJBA 3ALPA 4WGWB 3QQ9D 3JWDL 2G9HB 5AUMB 4HUVB 3SDYL 1OM3H 4LVEA 5FK9A 2A6KA 4HK0B 4GT7A 4GAJH 3OJVC 3ESUF 2BFVH 3DX7B 1N3NB 3V4UH 1IJ9A 2VAJA 3WKML 1R3IL 4P57A 4NCC1 3SKUD 5HGHA 3FN0H 3CFBA 3PQYE 5CZKA 5DD3L 3T1FA 2OLDA 5ANME 5BQ7B 2ZCLL 4X0KB 5ADPH 5FUZL 5D7LE 3TJHC 3BAEH 1NMCB 2M8XA 5JQ6H 1UJTA 4I3RH 2UVEA 1L0XA 4TULH 3RWGA 4NKDB 1QRNE 3EBAA 2BVEA 5HD8C 1EEUA 4XPHL 3OKKA 1LO2L 1ZT1A 4ODWB 1YEGL 4LIQH 1PKQB 4JFHD 4NJ9H 4O4YH 1W2KT 3IJHB 4M9PA 3LEYL 5IWLA 1WFNA 3U30C 4PJIE 2ZG1A 1BQHA 3V9FA 3U1SL 4HULB 3WEXB 1XGRB 4IJ3B 1CFTA 1KLUB 4Q9RH 3MRQA 2JB5L 4H1LH 1AIFA 1K8DA 4Y1AB 1A0QH 4M93B 1A2YB 4YHPB 3T65B 5DMIH 4LCWA 4IRSC 5F89A 1HINH 3D2UA 4M7JH 2WQ8A 4KKLC 4EUPG 3O2DH 2EDXA 4M8QB 3EYQD 1EX0A 4YNYB 3MV7D 3FHAA 4J1UB 5FA4B 1YMHB 3SGJC 4NYLB 2NLJA 3QQNA 4XX1E 2EDYA 5I1CH 1QNZH 3NA9H 4NT6B 4UNVA 1TVBB 4U7MA 2YN5A 2IANB 1SVZA 4WRLA 4ERSH 4MNQD 2ED7A 3WIIL 5GS0L 4OAWB 1XCQB 1E4KA 3TBTB 1BF8A 3L3KB 1XCTA 1X5KA 3EYVB 4X5LA 3MGTB 1Y6MR 4P48A 4LSSH 5DD5L 4Q97A 1UM5H 1J0HA 4UILL 5IBUB 3BP7A 1C8PA 1JZ3A 3MO1A 3QWQB 3WUWA 1TXKA 1DQQA 4XPGH 5DZNA 3EJJX 5L8LB 2ATPB 5LBSL 1P4LB 4GRLB 2CDFB 1S8DA 3QHFH 4LEXH 3SDAB 4M6OL 4YWGL 4AENA 1EGJL 1NUDA 3FQWA 5E5UB 4DAGL 1RZJH 3BGMA 1P7QD 5E56A 4NKIH 1YQVH 2IBZX 2W65B 4OZFB 4X6DA 2CIIB 5HHQB 2ZUUA 1CL7I 3HI5L 3S35L 5F1IB 4AM0B 4FABH 1JZ5A 4R26L 4X6FA 1IM3B 1WICA 4BZ1L 1BD2E 1RZ7H 5ESQB 2CKBH 3SPVB 5FUCC 1VPOH 5IEHA 3ZL4L 2P5ED 5FIEA 4NC0B 3SE8H 5C0CD 1MCPL 5IB5A 4GQ9H 1A6VL 4S1RL 1PG7X 3WDJA 4LDLB 2A83A 3SE9H 3X13A 3QFJB 4RISL 3DJ9A 4WU7A 1KLGA 1U8KB 4MX7A 4EBQL 5DJ8B 3V5DA 1R0AH 3I2CL 4G6FB 4HH9A 1J1OL 4X7EC 5C86A 5IVZA 1C7TA 2LTQB 3DUHA 4J3VA 1PYWA 4KMTH 3RKPA 1W8NA 2X4NB 4ZTOH 1JGVH 3UAJD 1VGKA 1P1ZB 4U6VL 3VMPA 4EOWH 3W11C 1HI6B 4KK8D 3LKRB 2XTJE 2YC1A 3QCTL 5FGCB 4PBVC 1FNFA 2I9TB 5BXFB 1JPSL 2NY6D 2AJZA 3GHBL 1FYTB 3NACH 1MIEH 5L8KB 2DDQL 2JJSC 2KQNA 2OQJA 4X5WB 3RAJL 4O2FA 3OGOE 4LCIL 1MCEA 4R4BB 1G7QB 1T1WB 2I26N 3OR7A 2YXFA 1AXTL 2GHWB 1A1MA 4M6MH 1ZWIA 3UX9B 4G6JL 3IAGC 2QHRH 3RI5F 3DV6A 1OAZH 5HHMD 2PW1A 4K3HA 4GRWB 1CDYA 1JFQL 5IFAL 4PJAB 4AIZA 1K6QL 1I1RA 3D2UD 1CLYH 2W9EH 4RAUB 1KPRA 5L2JA 1BVLA 1L4IA 3IDYC 4Y19A 5F88A 2XQBL 3RUGA 1LK2A 3P0VH 4MJIA 3MUGB 5IFHH 2HJFB 2MCPH 3O45B 3S4SA 1HQ4A 4L8DA 4XCCL 1N26A 4HJJH 1WWBX 2EH8L 4TTGA 3RFZC 3VXPA 4EN3C 3VFMA 4L9LB 3DX6A 5C1MB 3VH8G 5D2LF 4HFWA 1G7IB 3OF6D 4N8CH 3DSFH 3B9VA 4XVJH 4XAKE 3QIBA 4CAGA 2GCYA 2JCCA 5K9QI 4AJ0A 1WC7B 3L3GA 1P9MC 3B43A 1I8KA 3E0GA 2VABB 2I27N 1OLLA 1AI1L 3CVHA 1T0MA 2XPGA 5JHDD 2H2PD 3VCLA 3PG2A 5T3XD 2IPKB 4UI2A 2OYPA 3B9EA 4PP1D 3W5MA 3MACH 3F58H 1OM3L 2NTFB 1TQBC 1HH6B 1DUYB 4XNYH 4NQDE 3V4UL 5FO9A 2WWMC 1ZVSA 2X4UA 4I3SL 4ONHB 3D69B 5I1AB 4IMLA 2R4SH 4PGBB 4UDUB 5AYQA 5FO7B 2Q6WB 4C56D 1JHLH 2V5TA 4PJ7A 3FO0H 3GEWB 3LPGA 3KNBB 1UWGH 3L5HA 1VFBB 3R4DA 1T4KA 4XI5D 3CFKA 3PGDA 4JFOA 1XR8A 4XNMA 4BK5A 1CE1L 2ENYA 4H88L 4I3RL 4MA3A 4Y8AA 5JIHA 5FYJH 1BF2A 1G9ML 5DJCA 2B2XH 43C9B 1B6UA 1H3PH 3OAZH 3CFJB 1T20B 4QRPB 5DA4A 1HDMA 1QKZL 2D4FA 3VW3L 1KENH 4D0CA 4U1SA 3MA7B 3SKNA 1EVUA 1YEFH 5D7KE 1YNKL 2FWOB 1NGXB 2OZ4A 2AQ1A 4Z7UE 1CGSH 5HYQB 2V5SA 3P4OA 1JCKA 3UPRA 5I1EL 2MPAL 4KRPB 1MH5B 1T7YA 4FXGA 2IFGA 3GIVB 1G9NH 1XGUB 5CJOH 2XWJA 3D25B 3QO0A 1I9EA 3REWB 1A0QL 2ZPKL 3D3VE 4OCYH 5J1AB 5HYJE 3OKEB 3PQYA 4R0LB 4YE4L 3ARYA 1TZHB 3O2DL 4UINH 3UBXG 3V5KB 4M61A 1E4XL 1C5BH 3O11A 4RQQA 3MRBB 4JR9H 2WW8A 4J3WA 1IC7H 1QNZL 3FT3B 3Q1SH 3G6AA 4ZO6A 3FB8A 3RBGA 5I16B 4LPXA 3ES6A 4L3CB 3E2HB 4TVPD 5TE4L 2FJFB 3GSOA 1QA9A 1A1NA 1FGVH 2PR4H 3T4AB 3QIWB 3MLWH 2GJ6D 2AXGB 4OD2A 2CUIA 4PPTA 1B2WL 4W4OC 2EICA 4F3FB 2FL5A 1IAIM 2V5YA 4LKCB 4N9OB 4ZUVB 5DK0A 3JBG7 4LAJH 1NMBL 4X7CC 3G6JA 3FFCA 4QRUA 1R24A 4HJ0C 3RZCC 2AJVH 5F8RC 2WINA 1J1XH 1LO3L 4PJ5E 3H9SB 4DZBB 1RZKH 2R29H 4K7PX 3L7FA 3QHFL 3I02B 4LEXL 3VXMD 4Z7WB 4LRIC 1AO7E 1NAMA 3GMNA 3FRUA 4P4KC 4Q7DA 5MERB 3DI3B 1JPFA 2HKFL 5KVMC 4CU8A 4LRNL 1DL7L 2XKUA 1M6OA 1P4IL 4KZEH 3UTTA 5J6HB 4YQXL 1AE6H 5BS0B 5FUOH 1NAKH 3HE7B 4LASH 4UT6H 4OZHE 3RWIA 1IGCH 1SJXA 1IEHA 3SE8L 3MLZH 4GQ9L 1FPTL 5GQBA 3KPSE 4N0FA 5E7BA 1EEYA 3SE9L 5AEAA 4RDQG 2W9DH 2NX5D 1QEWB 4WTWA 1H8NA 3QXDA 1JBJA 4RDQF 2AK4B 1V7MH 2DBLL 4JFPB 3OX8B 3Q6FB 1R0AL 1U6AL 3EZJB 1VEMA 1I8LC 2ARJB 2R2BA 3R06A 4NN7C 5JXAH 4B0MM 2W9LA 3QDMB 2A1WL 4KMTL 1BBDH 1Y18A 5A3IC 4LSDA 3P4LA 5IROA 1SHMA 3LOWA 4KK6D 1FJ1A 3ARDD 1WWCA 2J6EH 3HR5B 4ZTOL 4E41D 4QHMB 2AGJH 1QSFD 1U58B 3W0WE 4QXUH 2WM0A 2F8OA 4Y16D 2EE9A 3C5SA 5I2IA 4QY8A 25C8H 3PGFH 4PJFB 1UJ3A 3L7EB 1MIEL 1BD2A 3JV6A 3T2PA 1YEEH 3QUXD 5DLMH 4OI8A 1A7NH 1KPUA 2X4RA 1T5XA 1XIWC 4F7PA 4K8RL 4JGUA 3LH2H 1EHAA 4M6ML 2VSDA 2NCMA 3QUKB 4KROC 4MAYA 2Z35A 3L3OA 3QI9A 4LVNB 3TVMA 1UG9A 5A2JH 4HPYL 1AD0A 3O9WA 1JRHH 1TJHH 3PQYD 5SX5H 3BZEA 3EUUA 2DRUA 3JTTA 1UB6B 3O8XB 1QFWI 4KDTA 1CR9H 4GS7C 4R96A 5D7LD 4LARH 1AGEA 3CMOL 3VFSB 3HAEH 4K3JH 1CDUA 2WP3T 4P2OD 2Y06H 2MCPL 1C12B 1K4DB 5F7YC 1EFQA 4LQ1A 1QRND 5KS9E 2BZDA 4MWFB 4CJ0A 4GLRI 3W81A 3PWLB 2YD2A 5DR5H 3O6FB 4N8CL 5HPMB 2J88H 2W38A 3WL9A 3WV0A 4J4PC 2AVGA 4E42B 4MB3A 1NUFA 5GSVA 4NFCA 2FATH 1ADQH 1F5WA 2BHYA 2JF1A 3EOTH 3WXWL 1KB5H 5C0BE 3IF1B 1V8HA 2UV3A 3QRGH 3GDBA 4JRXB 1K85A 2B4CL 4P2RE 1A6TB 2XXMB 5D7JD 2DKMA 1L7TL 1NBVH 3SEPA 1WK0A 2PO6C 2BSRA 3FQNA 4HUXA 5KTEL 5E8NA 4JPWL 5T1KD 3GSNA 3RU8L 5H37G 4CADA 4FQJH 1YMMD 4UIMA 4X83A 1K8IA 3GI8H 4N8VB 4WW2A 4NQXB 3VGFA 3B9KD 1X4ZA 1Z3GH 2GYSA 5CCKH 1FZMA 2CKBB 2VLLA 3P11H 3TEUA 4MJ5B 1HSBB 5HDBF 2JELL 1V7NH 4G9FE 3ZHDA 4MCZB 4OT1L 3I9GH 4MDJA 3HZYA 1ZLSH 4S1QH 1FFRA 4FQXB 2VISB 4JO1H 3VFTA 5DJ6B 4CVZA 4HD9A 1RULH 3JWOL 3QO1B 1KNOA 1JGUH 4YDIL 1CVRA 5IG7B 2B2XL 5F3BA 5IQ7H 1YYLH 4BZYA 1BAFH 2X9YA 3NCYP 5DRZA 5DSCA 4HKBA 5FOBA 1KENL 5BOZG 5K9OB 3RWCA 1WIUA 4R2GC 3ZT5A 2AJUL 2BERA 3MUHL 2NXZC 1HNGA 3VD3A 2F8XC 1MFAH 5GZOC 1CGSL 3ZKXC 1AHWC 3OKLA 3UTSB 1A9BB 4U49A 4KXZI 2EKSB 1U36A 3ZKMD 3TBWB 1G9NL 1NGPL 5CJOL 5ELIA 3RL1A 4ODUB 3S88H 3DETC 1T7WA 4OCYL 3ZKQD 1HKFA 2IH1A 5EOCH 1WISA 3B6SB 3P2TA 5IVXE 43CAB 3C8DA 4L8SB 4UTAH 2K1MA 5T3ZH 4JFYA 1FDLL 1QG3A 1R3JB 4O2CB 3VD9A 1KULA 4BKLB 1C5BL 4GFTB 1A3QA 1JHTB 4I77H 4YUEH 3GHEL 4NCC2 5EC2A 3O9WD 1IC7L 3I6LE 4Y0GA 5DUPH 3FQUB 3AMLA 2BOBA 5DDHB 1F8TH 3RVUC 4GXVL 2G60H 4V2BA 1J8HE 1FGVL 2BSTB 3U9UB 1LGVA 1KUMA 4RFEA 2H3NA 1BX2B 1KCSH 4ZOEA 5CEYB 2OMBA 5DK3A 3MRJA 5HGBB 4IRSA 3O4OB 3KLHD 1T03H 3C6SA 3MJ8B 4MZ2A 2D0GA 2AJVL 2B5IB 3CK0H 1BQUA 3SGJA 3PHOA 3M8OL 1L9MA 3HE6B 3ILPB 5KSBF 1AXIB 3UO1H 2DTMH 1BVZA 1NCNA 4WIQA 2R29L 3MUY1 1U3HB 5EOTA 5C08A 3VI3E 2VDKH 3MBEA 3SGEI 3BKCH 1K3IA 5CWSA 5HYJA 4PIRF 3KPMA 1NLBH 5HYEA 2HJLA 4RGMC 1XF3B 2V7NA 4ORGB 3V7MA 3HRZB 3KPRB 4KZEL 1M05B 4P59H 1HEZA 2GK0A 2FR4B 1AE6L 5FUOL 1MCOL 1NAKL 2OR9L 4CKVX 4UT6L 4IHOA 4G80A 3WKNA 2AW2A 1MCIA 1T3FB 1CDIA 1IGCL 2VKWA 5MENE 3FQRA 1I9IH 3MLZL 2Q7YA 1DLHA 5KZCD 1BFOA 4TTDD 3CXDH 4Z5RB 1E6OL 4U1IB 3UDWC 2ARJQ 5CD3B 4MXVE 3ZTJG 1UVQA 2PUQT 5IB3A 3FT2B 3RVWC 3WFHB 4KDVA 3QUZB 2F53B 5L7XH 1V3LA 3ZE1E 3OXSB 3DYPA 1Q9KB 1Q0YH 1BM3L 1ZT7B 5MI0C 2J6EL 2EDNA 1RJYA 1FCGA 2AGJL 3GRWL 3NIFF 1AO7A 5IKCA 3U6RB 3VJ6B 2VITA 3ULSA 3OKDB 3G9VA 4UT7H 4M43H 3DX8B 1BBJA 3DECA 4JFZH 5DJYB 4BH8B 2HTLD 5JTWA 5IQ9A 1OP5H 5CEZE 4JFDE 1JNNH 1TJGH 3EJYD 4XXDB 5C9KA 4OZHA 4KAQH 4WUUD 5DLML 5C3LD 2R39A 1NGYA 1ZLWH 2ZUYA 5T33H 1LE5B 1NEZB 4JANB 4NQDD 3O4LA 2A73A 1MCWM 3KPSA 4HGWA 3GSVB 4J8RB 4XMLH 5C0DA 1CE6B 1FVCA 3RDTB 4NQTA 1AXSB 1JRHL 3GI9H 5B22A 1CGYA 1A6AB 1P7HL 4ZFZB 3MYJB 5A1AA 3TYGH 5A2KH 4XCNA 4FZEL 2FHBA 5KW9L 1KCRH 4LARL 4PGZA 5F6IC 2LAAA 4I1NB 2JJSA 2VDOH 2Y06L 5F7MC 5HDOA 1SY6L 2VR9A 5F7DB 4F9PC 4Q0XH 2OTWB 3V7AG 3R1GL 1BZ7A 3MJ7B 5C09A 3W0WA 2HVKB 2FIKA 4TNVF 3P9MB 2QQKL 5H2BB 2NNAB 2J88L 4QRRE 2X42A 4IRSD 3HC3L 4KKLD 4NQVA 1VCAA 5IB4A 1ADQL 3PV7A 2GSGA 1U8PA 4PP2B 4R7DA 3AMKA 3MZGB 1JK8B 3EOTL 3MRFA 4XNZB 5BMFL 1FBIH 4LSUL 2Q3ZA 5DK2B 2DM4A 1BVKB 3QXWA 4ZDHB 5D7IE 3L5JA 1B0WA 4B7IA 1A6WH 3D3VD 4LDEB 3PDOA 5IEKA 4EN3A 5HYJD 3QDAA 1YY8B 1DFBL 3QNYB 5E95B 2GAZB 4FQJL 3ZDYF 2Z91B 4QHKJ 3GMRB 3BQUA 2OBGA 4UBDC 1EMTH 4MQTB 1M7XA 2V5RA 3OKOA 3IDJA 5E70A 1B9ZA 2CLRB 5HSFA 2CK0H 3C8HA 3DHJA 3PWJB 2AXFB 4GRMB 4NHUA 3VXUE 3I9GL 1UXWA 4S1QL 1P9MA 4P2QB 5KS9A 3UTZB 4HUUB 3QR2A 4CNIB 5GGSB 5TDPA 1RULL 3BH9A 5CHNA 4ODXA 2Y7QA 1JGUL 4X6EA 3QG7H 1JNHA 4OLZL 2OI9B 2J8UB 1QVOA 4J12A 1EEQA 4B41A 4MJ4A 2CDEB 1UKSA 1JNLH 3RTQD 1T89C 1YYLL 1OT2A 4PJ5D 2H32H 3H3BC 3PGCA 2Z9TA 3C2AH 1S7QA 2A74A 2DQGH 3OZ9H 2ZCKH 3QXUA 3RIAF 5FDWA 2N56A 1AO7D 3ECBA 5GRZA 1MFAL 1A3RH 5LQBH 4HJGA 3FT4B 4X6CE 3UJTH 1KJ2L 4F7TB 2O5YL 3C5JA 5FKPA 1UH4A 1GAFH 4ISVB 3SDXA 4Z95L 1IAOB 5EOCL 4G9FA 4JM2A 1D5MB 3K1DA 5LWYL 2FX9H 4JZJC 5TF0A 4UTAL 5T3ZL 2DQTH 4I4WB 1J8KA 4YUEL 1FFPA 4ZS7H 4PJHA 3BVNB 1UB5B 2BMKA 4HAFA 1DQML 4LLQB 5CZXC 1W8OA 4NM4H 3HAEB 1RJLB 3O3AA 4YH6A 4DN4H 4OZIB 4YHKH 3MX0A 1HYSC 1HHIB 1IC5L 4Z8FH 5J4MA 2C3GA 3OB0K 4U0RB 2HH0H 3TNNB 3H9HA 1OAXH 1T1ZB 2D31B 2PXYC 1DDHA 3CLFH 4WY7H 5FGRA 3R8BB 1I9JL 3VFUB 5L0QC 3HI1A 2P24A 2O61A 2VDKL 1T22A 5CIPH 3CPLB 2DQFA 3P77A 5CJBA 1J12A 3BKCL 3UZEA 1VEOA 4PGDA 5IVXA 4NP4L 2IEPA 1KB5B 2FECI 1NLBL 3IDXL 3U7AA 5DRXB 1KCUL 2EZ0D 3N1QC 1JUFA 5GRVL 2YZ1A 4P59L 2FO4B 2X89A 1XMWA 3BYYA 4ELKA 1IGTB 1CZ8H 2C1OB 1DE4B 3RZCA 1MHPL 3L6FB 1KGCE 1J8HA 2CRMA 3B5GA 2GT9A 3FO2B 1MJJB 1RJZB 2WBJB 3KPQB 4Y4HC 1N5YH 4LRIA 5DJAB 4U1MB 3VXQA 3CXDL 1XZ0B 3PHQB 1HHJB 2Z31B 3U36B 4P4KA 5JW5B 4V1DB 4ELMA 5CBAA 5IVNA 5IJKC 4DW2H 1BFTA 2R0WL 1IL1B 3ULVL 1S7WB 2OM5A 3EYSH 5SV4A 4CVUA 1Q0YL 4HX1B 3WHXA 2B39A 2UUDK 2VNCA 4JQIL 5E00A 4JY5H 4GSDH 1F97A 5FOJA 4PGEB 2NY0B 4UQ2A 5C0BD 3LRSA 2WWMD 4OUUB 5D1ZC 1R3KB 3TO4B 4P2RD 3UTQB 1P84K 5F7LB 1K4CB 5HI5D 3MGAA 1OB1A 3HNVH 4Y4KD 1BQLL 5HHXL 1JNNL 3IDIA 2JTDA 4QOKE 1ZLVK 3WLWC 1N6QL 4KAQL 2FD6H 1FNAA 3NTCH 1I8LA 1GZPB 1VADA 1W0VA 5ACZA 3U0TB 5FM5M 5T33L 4HKJB 3UP1A 3V0AC 5KSAC 4OCNC 5GPRA 4R6UA 4XMLL 5FGBC 1ZGLA 5KOMC 3C6LB 2FZ3A 1NMCC 4G9FD 5FHAH 3O3DB 3GSRA 4NUJA 4QXTB 3W9DB 1OHQA 2FH8A 2PYFA 1Q9WA 1FVEA 5JA9A 4H25A 5IMKA 3M07A 5IW6B 1OAQL 1KCRL 3RIFF 1YNTA 2R56L 3C60C 1WUNT 4UNTA 4R97B 3S9DB 1PSKH 3AREB 1HXYA 4XC3L 3DGGB 3BWUC 1XIWA 4JDZB 3QJHA 4N5UA 5C07A 4NRZB 1ZA6B 4PLJC 4NSKA 1GJIA 3BZ4A 1H3XA 2JK5B 3E6FA 3IJSA 4IJ3C 5CP3H 3QULA 3HN3A 4YEFA 4P23D 3EYUL 2DWEA 2HT3D 4PJXF 3LS4H 1PG7H 1S7UB 3EOAB 2BVPB 4YBLC 5EBMA 4FTVA 3QXAA 1A21A 5HYFA 5C0EB 3V0WL 5HHNA 3PF2A 4OZ4A 1FNGA 1NBZB 1JPGB 5EO9A 5TJWK 1FBIL 4ZUTA 4TSCL 4TSAL 5FM8A 4NQEA 3QEQE 3RX8A 1FNEB 3OPZH 4JZOA 4MNGA 1A6WL 4ORZC 4HXBH 2BNUB 1J05A 4NQCA 5FV2A 3LB6C 1WAAF 3GSXB 3P9LA 3BDBA 2KZ1B 3BPCA 4J4PA 1QFPA 1LP9B 4XPAH 2UZXB 5TH2A 3I6LD 3MUZ1 3K8MA 2W0KA 4NDMA 5EORL 2B0SL 1RUAH 4U6XA 3THML 1KJMA 4ODVL 3IDNB 1ES0A 2IQ9L 2FO1A 1IAMA 2IBBA 4LHUG 2GTWA 4LPUA 4D3CH 2BJML 3KPNA 1ZS8B 1AGFA 1DBKL 2PO6A 5IESH 1MEXL 1VDGA 5KVGH 1RD6A 4QRRA 4UMGA 3SDAC 4PRDA 1Z0NA 1M1SA 1JNLL 2XZAH 3S98A 1MHEB 4RNRA 4MGXA 1CVSC 5EFIB 1X3DA 4XWGH 5KSUB 2V2XB 2ZOLA 4JHAL 4GO6B 3LEXA 5D7IA 4QHNB 1FO0A 3CXHK 3OZ9L 5BRZE 1DBBH 1CD1A 1JNJA 4KJYB 4QTHA 2NZ9C 4MZ3A 2VN7A 3JWDC 4RRPA 1A3RL 4PTUB 5DZLA 2F54A 1QQDA 3MRHB 5J7CC 4QLRA 5D2LE 3QPXH 5TE7L 4RFNB 4OZGE 1RVFH 3FB6A 1GAFL 3CH1A 3NGBC 4LF3B 1MLCB 1UT9A 3QDGA 3MRMB 3VXUA 1OAUH 3OB8A 1OGAB 5B38G 2CGRH 2ITDA 1SMAA 2FX9L 5MEND 5GSRA 4R8WL 4UB0H 2E7BA 4HXAH 5A3ID 4PGCB 3BESR 3UZVB 5TPWH 1JGDA 3D0LA 5HYSB 1NDGB 5SWZA 3MRGA 1BWMA 2VUOA 1EJOH 3NMEA 4ZS7L 2Y9RT 4KJPC 4PV8B 4U6HB 2VH5H 1AHWA 3VA6A 4I5BA 1RK0B 1G9EA 4X99A 1IRAY 4MNHA 2IWGA 5I8CB 2C3VA 2R23A 4NM4L 3TT1H 1K5NB 2X40A 5DMGD 1FFOB 1KCVH 3LD8B 1T7XA 3BDYH 2HLAA 4DN4L 1IGYA 2DIAA 2R0LH 1XIWD 4CU6A 4ZFFB 2E6JA 2MJWA 4CDGC 4OLVH 5ADOH 3ZYZA 2SEBA 4HZAA 4N0UE 3TBYA 3UYOD 2OX5A 1TFHA 4X6CA 4BQBA 5D9SB 5I1KH 5IMOB 3CLFL 5FV1L 4WY7L 3AFLA 4W4NA 4KK5D 2V7HB 1A7PL 4JFDD 5D5MF 2QV2A 4OFIA 2E3VA 4D9QE 5I76A 2JIXB 2DN7A 1NCCH 3OG6B 1ZHKB 2NXYB 4L8CB 1N0XH 1RIVH 3HG1D 3ARWA 3D6GA 1LDPL 3REVB 3OAUL 1AJ7H 2D7MA 3PWNA 1MNUL 3G04B 1OWRM 1IM9B 4JAMB 4LPCA 1EIBA 4N90E 4ZUUA 5GIRA 4RMUA 1AY1H 2VQTA 2D7OA 1CZ8L 2D7QA 3KYOA 4M9OA 3ZZ1A 5GS0C 2VIRB 2BNRB 3BHBA 2VLJA 2VKXA 5CJQH 2P1YA 1RZGB 4J4PD 5D1QA 2E7CA 3BRDA 3D39D 3GJEA 4CVXA 1WCQA 3PP4L 1WGOA 3MMEA 5IT2H 1BOGB 1BJ1H 5F71A 1AKJA 5TQ0H 2BK8A 3ZE0E 3GBMH 5E2VL 1LEIA 4F7CA 3NABH 1NFDF 5CMAB 4OQTL 4QRRD 4S1DC 4LQFH 4EIGB 2VXUH 3VG0H 1IKFH 1Q9LA 4PFEA 1CFNB 5CP7B 5EBLA 1A9EA 3ZTNL 5FM4A 4L4TE 1S7XB 2HFFB 4KUCF 5ILTH 5BZWB 1YY9C 4DGIH 4QHLA 1YQ2A 1U8MB 1X5ZA 2R1XA 2A2QT 1LILA 5SWSD 4IRJB 5DUBB 3SKJH 4M3JA 5FEBA 3RP1A 3X14B 3TA3B 4H8WH 2FD6L 4ZSOA 3NTCL 5F7WC 1LDSA 5CZVH 1FC1A 4UOW0 2CH8A 4G8EB 4G6MH 2PCPA 1PKQE 3QISA 3QFDB 3DUUA 3EOBA 5DXWA 3VXUD 3DXAB 1RZIA 1YPZB 3SCMB 1NJ9B 4R90L 5FHAL 3SN6N 4IIQB 3BJLA 1BIHA 5HGDB 3MRIA 1G7PA 3GMOA 3D85A 5GRJH 4BUGA 4I2XB 4EQ3A 3C08L 1KN4L 4WEMB 1LE9A 1OGTB 4OGAC 4KQ4H 2CR3A 1U95A 1CFQA 3PWUA 1HWGB 2R0ZH 4NKMA 4X4ZA 5ID1B 5DWUH 5CBEB 1I1CA 4BZ2H 5MHSE 3RWJB 1PVHA 4DKEL 4YC2C 3UPAA 3FOMA 1E0OB 1U8OA 4PG9A 3VRJB 3DETD 4DK3A 1N5AA 4CMHC 1MCKA 3LS4L 2GITB 2OP4H 4LCCC 4QOKA 2YD4A 1D9KD 3DRQB 4JY4A 4XH2B 1UEYA 1DLFL 1I7RB 3QCVH 4R0LC 4Y2OA 5IFJA 3VXRB 5GGSY 4XB7A 3GMQB 4WO4B 1OVZA 4LPVA 1DEEB 3NFPB 2H26A 2QSCH 4F9PA 5C9JB 4HFUH 5CIPB 1S9KC 3VWJD 1KIPA 2HFEA 2C3WA 5KSBB 3E2HC 1G6RL 2IADB 3QIWC 1G1CA 4X98A 5KJRH 1EAJA 3IB4A 4M6NH 3LV3A 2BVOB 4BQ9A 3QNXB 5IV2B 2AJXL 2PF6A 4ONGH 4LNRA 5JIPA 1LEGB 2EIZB 3HC0A 5D72H 4LCYA 2B1AH 4WDIA 4OF8A 3ARFC 5DO2C 3FKUS 5J6GA 1N8ZA 2H2SD 3FFDA 3L3IA 5IMLA 5EN2A 5KVGL 1NGQH 1QLRA 1T1YB 3BD5A 1MY7A 5F9JA 2ZCHH 4JDTL 3ELAT 1Y0LA 2ADJB 1TPXB 2VDQH 5INCA 5FYJD 4NQSA 3NFNB 4NOBA 3QYCA 4HWZB 1IAKB 2G5BA 3QEQA 4PJBF 5J9PB 2FSEB 1R5WB 2IAMB 5DUMH 1YEJL 1J5OH 3NVQA 3E6HB 3HE7C 3ZKNC 4OGXL 1FH5L 4YO0B 3QSKB 5DI8A 5DC0A 3D9AH 1O7VA 2EDKA 5AZEL 1JTPA 2DKSA 2H9GA 3DBXA 4LDOB 5KG9A 2R1WA 1E4WH 1U8IA 1RK1A 1U8JB 3H0TB 4RGNB 1T89A 3MJ9L 1KGCD 1BEYL 3HI6H 1U8QB 2AV1A 3G5ZA 4JFFE 5HHOE 5TPWL 3MFGB 1MJUH 2P8LA 2X4TB 4ACPA 2Q7NA 1EJOL 3MRDB 4XPTL 4NN5B 2ZSVB 1ORSA 2VH5L 3KPOA 1JRHI 2C26A 1G9MC 4KGJA 4OD3L 4AYFA 4U3HA 1CXIA 2MWCA 1VFUA 2ADIB 5CJ8A 5FFLA 3T0EB 4G6KH 3MNWA 1BQHG 5D1XC 4GRWE 4HUWB 3VWKD 5BRZA 2J3SA 1MCFA 1CU4H 4JZJA 2CJUL 5I73B 4XAWH 5EZJA 3M17B 1FAIL 5I1KL 4HIHB 4IDJH 4X8JA 7FABH 5DFTA 2DQUH 1CQKA 1EJ6A 4OZGA 1Z9OA 4LVNC 2YRZA 4OGZA 3OQ3B 3ROLB 4XP6L 3UPCA 3EJZC 3B2UC 1N0XL 2W60A 3O8XC 2P49B 1RHFA 3MLSL 5F7EL 1F42A 4LLAA 5DZOA 2VE6B 1A6ZA 1FL3A 3BWAA 2BCKB 3GMPB 2DOCA 4Y5YB 3KLSA 1I7UA 1T7VA 2PKDA 1G6RB 2VWEC 2PXYA 1J0YA 1MCWW 5CJQL 5F7FA 4HUMB 1RUPH 4P3DB 3AS1A 4PB9H 1G6VK 3O6FC 1FL5B 4WWKC 3WUWG 5TQ2H 2F74A 1ETZA 5LCVH 5IT2L 5E9DE 2Z8VC 4N9GA 5TQ0L 3PV6A 1S7RB 4RFOH 5ESVA 4GAYA 4MCYA 3GBML 1LNUA 5JW4R 1M7IB 2EE6A 2AJ3B 4QGTA 3KJ4B 4JRYB 3Q5TA 1D5BB 3NCBB 3S36X 5JLZB 3EGSA 1P7KB 3BEWA 4LLUA 3TPUA 2FJGB 2XKSA 4X6DF 5JPMB 1PFCA 1NCBL 3MV9A 4JG0L 1T1XB 3HCVA 4UBDD 4NZUH 1RPQA 3HNTL 1QR1A 2WLZA 4HHAA 1MF2H 3QEQD 4YHMH 4DGIL 2J7LA 4Y4HA 1U8NA 3LZFH 3O6LL 4WVRA 3ARBB 3GGWB 4YR6A 3TN0B 4KV5F 4L9DA 5CZVL 5IJKA 2NY3B 4H0IA 3NA4A 3T3PE 1EAPA 4FQXC 4WI2A 1C08A 4WHDA 3SJVE 4E5XA 3Q3GB 3WNPA 2MOVA 3F7QA 2A6IA 2C4FU 1A7OL 4XP4H 3TJEH 1UC6A 4P5TD 3BPNC 4L5FH 5GGTH 3DIFB 4I0PB 5DD1L 2G9HA 5AUMA 4HUVA 5D96B 4K7PL 3QEHB 5GRJL 3RPIA 5E08H 3X3GH 1A7QH 4YHNA 4HC1H 4HK0A 4J3SA 4DGYH 3DX7A 1N3NA 5C0AB 4KQ4L 4M1DL 2UYLB 3UBXA 5C2UB 5JIKA 3T1WA 4YJZL 1UACH 2MQCA 2Y36H 4MB5A 4HEME 5DWUL 3LHPH 1XF2B 3O2VH 4BZ2L 5BQ7A 3WFZA 3WJJC 5FXCH 3L3HB 3EFDL 5C0IB 1DANT 4BFEA 3PWPD 4X0KA 4UQ3B 4LEOB 5FGBA 1ZLUK 3ARUA 1BOYA 4JVUA 2HN7B 3MV8E 3TT3H 1FIEA 4DWHA 3RWEB 1MFEH 4NKDA 4XP1L 2W92A 4GW5B 1BLNB 1DP0A 2EDOA 4HK3N 4K8RC 4L8SC 3WO3B 4ODWA 5BV7H 1PKQA 3WO4C 2OR8A 5FYLH 4NNPL 1LO4H 2WP3O 2QSCL 2DM2A 3IJHA 4NOFA 4X4ME 3ARGB 2X4OB 2FB4H 5DEFA 4S10A 3RUGF 1ZHBB 1MPAH 3HLAB 3S4SG 4KI5C 3X17A 3WEXA 1XGRA 2BVQB 4FFWC 2BVYA 5JZ7C 1BREA 3RVTC 2DJUA 2GK2A 3SKOA 4D2NA 1KB9K 3MA9L 3T0AA 1HYSD 4ZTPH 1FRGL 4NRXB 1IKNC 4A6YH 4YHPA 3T65A 2XZCH 5GRWA 4JFEB 5J3HD 3TM6A 5K59F 2PXYD 5ISZB 1BFVL 3O4OC 4OFYA 3V6ZA 4PYGA 5EA0H 3WIFB 4JVPA 4M8QA 4YNYA 4H5SB 3KXFB 1V3KA 2B5IC 1YUHB 4J1UA 5FA4A 1YMHA 1E28A 1XGPB 3ULUL 2VDRL 1QUNA 2JCCF 3A67H 5BS0E 3HE6C 3RVXD 4NT6A 1IARB 1U92B 1TVBA 3HUJE 1GGIH 4PRIB 3WS6C 4OAWA 1XCQA 3TBTA 4QHUB 1YEHH 4Q6IB 1H5BB 3H9YA 4X9FA 5FECA 2B4CC 3QEUA 3EYVA 3U7WH 1UYWH 4JHBA 3QXVA 4D9QD 4ZD3H 2AK4E 4TUOA 1KPVB 1PX3A 1CXLA 3STZB 4PJ8D 4W68A 3QNZB 3D9AL 1ZVYA 4Y5VB 3V7AE 5E8EA 2ATPA 4ZNCD 4Y4HD 4I18B 4HW6A 5J56B 1PD6A 1P4LA 1EH9A 1C7SA 1NCWL 4N90D 2CDFA 1EBPA 4FXLA 1Z9MA 3BMVA 5D2NB 3SDAA 4PJ7F 2EEDA 4PJEB 1S7SB 5IR1B 1KJVB 3F6LA 4HIXL 4OZFA 3RNKB 5HHQA 2CIIA 1ED3B 4OLXH 3JWOC 5F1IA 4AM0A 5L2KD 1IM3A 3QUZC 2EYTB 5ESQA 4DOHB 4OCRH 2WUCL 2ATKB 1MRDH 4Y2DD 4AQ1B 4JFXB 5D1ZD 4L4VE 1R5VB 1VA9A 5F44A 4P0DA 2I60H 1E6JL 4Z7NF 1BJMA 1TMCB 1KTLA 2YKLH 3WN5B 1S78C 5EDXA 3DGCR 3WLWD 4ONOA 2J8HA 1CT8B 1NCDH 1U8KA 3N0PB 4EI6B 5DJ8A 2DQCH 1T6WA 4L4TD 5KSAD 4CMMB 2XQYG 2CRZA 3FL7A 3NFSH 1NSNH 4EZMA 7FABL 4ZO8A 3RGHA 1JF5A 4O00A 1G9NC 2VDML 1U91B 2DQIL 2DAVA 3KR3L 2X4NA 3L3DB 3MREB 3RDTC 1P1ZA 3BP4B 2VWEE 3D48R 4N0CD 4OKVB 1HI6A 2NY4C 2YD5A 3LKRA 3JV4B 3C60D 2LV4A 3BXNB 2IMNA 4W70A 2I9TA 5BXFA 4UV7H 4JFFA 4BFGA 1FYTA 4NHCH 2FEDD 2XY1A 1NGZA 1NFIB 15C8L 4NO0D 3N9GH 5KN5B 2ESVE 2PYEB 5CGYC 3PABB 1S9WB 4R4BA 1T1WA 1HHHA 5KVEH 1GGBH 5IBLC 5I18L 2ZG2A 4KFZC 3ZLQC 5TQ2L 3TIEB 1CXKA 4ETYA 3VGHA 3G6JF 4PJAA 1JZ7A 3S37L 4RAUA 2MCG1 1RURL 1B3JA 3U46B 1JPST 3GBNH 5DQJB 2HJFA 3ARZA 2VLRB 2UWEB 4JKLA 4NKOB 5EU7C 1PKOA 4ZPVB 4M1GL 2AK1H 3I6GB 4NZUL 1ZE3C 5DVOA 2WBWB 4PGJA 3N85L 1MF2L 5E6YA 4YHML 3CCHA 3K2UL 2ZKHH 1VGEH 1T66C 1ND0B 5I9QB 2K7PA 1MRFH 2YPLE 3LZFL 1I85C 1PAMA 3ARSA 4PRPD 1MFNA 1WC7A 4PRBB 4KHTH 2O93L 3DYOA 3K8KA 3MC0A 1GRWA 3I6KB 1OF2B 1NCAH 2QHLA 1S7VB 3OKMB 3H3KA 2BY2A 4XP4L 4W6XB 3ZHLA 2DLIA 3C5ZD 1RFDL 3BO8B 4XCYB 4L5FL 5GGTL 1P5UA 2ITCB 3DVGB 4AMKH 1EGJA 1J87A 4YZFE 4S11A 4K94H 2IPKA 3P4NB 2DJ4A 3HPLA 2OI9C 3T8XB 1J86A 3SKMA 4GAGH 5E08L 2VLKB 3O41B 1MCLA 1HH6A 1DUYA 1OCWL 1V05A 2DIJA 4TUKH 3RY6C 5KVFH 1ITBB 3DO7B 1ZEAH 3D69A 5I1AA 4FN0A 1N59B 4PGBA 1UACL 2Q6WA 3CNKA 2H1PH 1MAJA 3LHPL 4APQC 3AU1B 1AQDB 3AXLB 5FYJU 4JFQB 3EDDA 1WEJL 3FB5B 2NY5H 5CEXB 3TT3L 1Q0XL 4KI5E 1MFEL 3QRFM 3I84A 43C9A 5ERWA 3CFJA 5IB1B 4QRPA 4Z7QE 4OGYH 3WMSA 5CINH 4U31A 1F6LL 4WTXA 3VFRA 4GBXD 1NGXA 1MOEA 1IQDB 4DGVH 3V5HA 5BVPL 5HYQA 4QRTB 1KT2B 1MCHA 4XVSH 1GPOL 3Q6GH 2CRIA 1XH3B 1MH5A 1OTSD 4JFFD 3GK8L 5HHOD 3GIVA 3WCYA 1XGUA 4H26B 1ORQB 5I1IL 2UZYB 3ZT6A 5LGHH 4UZGA 4LCCA 1P5VA 4A6YL 5BO1L 3FZUC 5J1AA 2GJZB 3OKEA 5J11C 4R0LA 1NBYB 4LL9A 5I8OL 1R3LB 1TZHA 5INDB 1F11B 1QBML 4OUOA 3V5KA 4U0RC 2V2TB 3I75B 2O5ZH 1HOCB 1RMFL 3MOQA 1AD9B 3MRBA 4I48A 4Q9CA 3FT3A 4LLMB 1F4AA 1FIGH 2GW5A 1WF5A 1CFSB 4L3CA 4OV6F 4QWWD 3ME0A 2FJFA 4HF5H 1YEHL 4HUKB 2VR5A 4KJQD 4OKDA 3R8QA 3T4AA 5ICYA 3QIWA 1Q72H 5DVKA 4GW4B 4F3FA 4LKCA 4ZD3L 3NN8B 2Y5TB 2QR0B 3CC5A 1UA6H 3CVHH 2A6JB 3ARFA 1IZKA 4WW2F 4PB0H 2VXTL 2CUHA 1T80A 3H9SA 1NANH 4MJ6B 4DZBA 1BZ9B 3BP5B 1X4YA 1P2CB 2G75B 1CGXA 5BZDA 4NN6B 2IBZY 3MLVH 1IEAB 3I02A 4QRQB 4PJXE 2WBJC 4Z7WA 2NR6D 4K71B 2Z31C 3BPOB 1RI8A 4FZ8H 4N5EC 5MERA 3VD5A 5I1GL 3U82B 2MSPA 5J6HA 5BS0A 2HAZA 5E9DD 5T5NG 2AEQH 3HE7A 4OCRL 3HUJA 2FJHA 3MLRH 5T5NF 2XWTB 1YY9D 1WAAE 5GGQL 3KPPB 5C0RL 2R1YA 2DIBA 2DYPA 3H42L 4EI5D 3TO4C 3NBNA 1QEWA 5F1OB 2V9RA 5EOCJ 5I66A 3FQTB 2AK4A 2Z0BA 2RB8A 2QTEA 4JFPA 4BK4A 4J3XA 3OX8A 2DQCL 3NFSL 1U3YA 1DN0B 2ARJA 2FEEI 4XMPH 4UUJB 4YHOH 4U3XA 3P0GB 3QDMA 3DOSA 4JG1H 1VFAB 3HR5A 3C6LC 4YGVA 4QHMA 1U58A 3RGVD 2VC2H 4G8GD 3SJVD 4BFIA 5F1NB 3SQBA 4UV7L 2AERT 2GTZB 5D1XA 3L7EA 1A1OB 4R97C 3MV7B 4L4VA 4U1NB 2E7MA 2FBJL 4U2ZA 4MNQB 3QUKA 2YS4A 3MFFB 4HKXB 2DI7A 3ZSSA 4A6YB 3EHBC 5AG9A 2R2CA 4NWTL 2QQLH 1FLRH 4GAFB 3O2DA 1UB6A 3O8XA 5JR1H 3D0VB 1N2RA 1CLOH 3O81A 5D70H 3WHE0 1LK3H 2RQ8A 3VFSA 4YHLL 1C12A 1K4DA 4YDJB 3MV8D 3VFGL 2NMSA 5I8KH 3ARTA 5E8PB 2CXGA 3LSOB 2P46B 4MWFA 5CUSH 5A40E 3V95A 4J23A 4LVOB 1WZMA 1CL7L 4O9HH 4FP8H 3PWLA 2EDRA 3O6FA 2DWDB 3BH8B 5HPMA 3BEVB 1NAMH 5GGRB 5T3XL 5JO5A 2JJWA 4PJGB 1TTFA 1P7QB 1MRFL 4E42A 4OLWL 3ARFD 4HIJB 5DO2D 4HBQA 1C5CH 4M62L 2X9WA 1NCAL 3IF1A 2R0KH 4JRXA 2HWZH 1A6TA 2P5EB 4LP4A 4LSVL 4ZFGH 2X1WL 5JUEL 5C0CB 4RX4A 5D5ME 5MEPB 4C54A 5JW3H 4P57B 4N8VA 4TQEH 4NQXA 1NC2D 4M48H 3JTSB 4TUKL 3ULVC 2QADC 3T1FB 4YFLI 3C09C 3MOBH 1EHLH 3KG5A 4HS3A 3AC0A 3EO9L 4MCZA 4BFBD 4OCLC 3LKPB 4FQXA 3UC0H 2VISA 2DYPD 5DJ6A 4B50A 3RWGB 3OB0H 3CX5J 3QO1A 3U7YL 4E0RB 1TJIL 4J3TA 4WCYL 1F4YL 3OKKB 4RFNC 4OZHF 4O02L 2E27L 2YPLA 5IG7A 3PWVB 2NY6B 2XN9E 4M1CD 3MRNB 5E0QA 1J10A 3MLXH 2YPVH 4OJFH 3MRLB 3QDJE 5K9OA 1BQHB 5EH1A 4CW1B 1QBAA 1S9VA 4FQ1H 4KKBC 2EDBA 1F2QA 3WFBL 5E8OA 2BNQE 4DGVL 4JPKL 5C71A 1KYOJ 5ITFB 4WHTB 5HHMB 2OXHA 2EO9A 5D1XD 1MCJA 2EKSA 3SO3B 5DQ9B 5B3JE 3D2UB 5H94B 3TBWA 1MCCA 5JHLH 5DVNA 1QFWM 4Q9QL 3LD8C 3QPQD 4TVPL 4ODUA 5LGHL 1FORL 4GLRH 4L4VD 3QZWA 1H3UA 2VDNH 4L8SA 1PJ9A 1R3JA 2QQQA 5FDYA 4BKLA 3H7LA 2O5ZL 3U4BL 3U4EA 4NFBA 4EQ2A 2DM7A 3WE6B 5FHBL 5EZIL 4P2YA 2G5RA 3EJZD 2LABA 3B2UD 5DDHA 2UUDH 1CWVA 4B5EA 2E9BA 4L8BA 1XGQB 4EKXA 2BSTA 2NXYC 3AY4C 5KANG 5EWIH 3DRTB 1EXUB 1DQQB 1BX2A 1IKNA 3UTPE 1T2QL 5HGBA 1DUZA 1EPFA 4Q74A 5F7NC 1FQ9C 5IW3A 4POZD 4PB0L 5JHDB 2CDGB 2H45A 4WWKD 4MMZC 3GSNH 3HE6A 3ILPA 3BGMB 5DJXB 3HKFA 5DFWH 4HV8B 5KS9F 3G9AB 3WS6A 2ESVD 1MCQA 2QSTA 1F90H 3T3ME 1S9XA 4PBXA 1RZFL 2IG2L 4C56B 1XF3A 4LLDB 3HRZA 4JDVA 1SEQH 3KPRA 4DZ8B 5GZND 4LSTL 3BRFA 1PDKA 4RX4D 1QFUH 2FR4A 2AEQL 4ZXBD 4C55A 5C7XL 35C8L 3AM8C 1T3FA 3QUML 5D71H 2Y07L 2E9JA 1QR4A 4ZO9A 4LSQL 1WFUA 2ZSWB 1PQZA 2E7HA 2LFGA 1TTUA 5IVZB 1EO7A 4U1IA 4IRJC 1DBAH 4TPRH 5CD3A 3FQXB 2DQJH 4TSBL 3M45A 1VGKB 1WZ1L 4YHYB 3EFFB 3IRPX 3KLAB 4YHOL 4PJCB 1ZHLA 3QUZA 3SDXF 3DO3A 2N1KA