1JNRB

Structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords adenylylsulfate reductase
total genus 21
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature ec 1.8.99.2: Adenylyl-sulfate reductase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF12139 APS-reductase_C Adenosine-5'-phosphosulfate reductase beta subunit
B PF12800 Fer4_4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jnrB01
3.30.720.40 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 1jnrB02
1KEKA 4YDDB 2XSJA 4XDDA 2V4JA 1Q16B 4KT0C 1G6BA 2VPXB 3MM5B 2FDNA 2O01C 2FJEB 1FF2A 2FD2A 1FERA 3MM9A 2V4JB 2C3OA 2PMZD 1FRLA 1GTEA 2IVFB 4DHVA 1FRIA 1FDNA 1JNZB 3PNIA 2WB1D 1DURA 4L6V3 3MMAB 1KQGB 1FCAA 1FD2A 4CI0B 6FD1A 5E7OB 1IQZA 1B0PA 2GMJA 3MM8A 1H0HB 2FGOA 3IR7B 1BLUA 1H98A 4AYBD 2WSEC 5FD1A 1FXRA 4OMFG 1Y5IB 3MMCA 2C42A 4OV1A 1C4CA 3MM7B 1BC6A 3OR2B 1PC4A 1CLFA 1Y4ZB 2UZAA 1FRXA 1FEHA 1SIZA 1AXQA 3MM6A 1B0VA 1RGVA 4ID8A 1F5CA 1JB0C 3MMCB 1C4AA 1ROFA 2C3MA 3EXYA 1B0TA 1GT8A 4XK8C 5CHCB 1XERA 1KQFB 3MM6B 1F5BA 2XSJB 1GTHA 4RKUC 3C8YA 3GYXB 2FJDB 1Y5NB 4Y28C 1K0TA 1A6LA 3OR1A 1G3OA 1VJWA 1D3WA 2ZVSA 3LW5C 3HKZD 1FRHA 1GAOA 2VPYB 1FRJA 4XDCA 2WSFC 1R27B 3MMBB 3OR1B 2WAQD 1H7WA 3IR5B 2V2KA 3MM8B 2Y0SD 7FDRA 3MM9B 2FJBB 2VPZB 1FRMA 2Z8QA 3MM5A 5BYQA 3OR2A 1SIWB 1IR0A 3EGWB 5L8RC 1FDBA 3EUNA 3MMAA 2C3PA 2C3YA 3MMBA 6FDRA 1FTCA 1BD6A 2WSCC 2VKRA 1DFDA 7FD1A 3IR6B 1BQXA 5BYRA 5BYSA 1JNRB 1HFEL 1FDDA 3MM7A 2FJAB 1SJ1A 1FRKA 1Y5LB 2GMHA 1F2GA 2VPWB 1DAXA 1FDAA 1BWEA 2PDAA 1WTFA 2C3UA 5CH7B 1H7XA 1PC5A 2PA8D 1FXDA
chains in the Genus database with same CATH superfamily
3EPGA 2VBXA 4YDDB 1G4CA 1UWBA 1ITPA 1UFKA 4XDDA 1PYSB 5SUHA 2I38A 2V4JA 1WOPA 5ETKA 2OJ3A 4LQ3A 5IT9U 5GADU 4FF1A 2IYIA 1D9DA 3DMJA 4DR4F 1S1TB 5EN1A 1SKRA 4CH7A 4LVNP 3MI7X 4MIWA 1S7HA 1FERA 3HXMA 4N47A 4URSA 3OVBA 4C11B 1UETA 2UVVA 1XK8A 2W24A 1PAUB 4UY8T 1DY3A 1J27A 2DR5A 1VOMA 1X5OA 2AEFA 2G0JA 3N4WA 3QT7A 5CZVA 1S99A 4OI3A 4PEOA 5LSRA 1Q7LB 1EETA 1ZM2A 2I6WA 1R8HA 4QBUA 5L38A 5E7OB 4JI6F 4LF7J 5DLFA 2HS0A 1H98A 1M5VC 3OTDA 1HNZJ 3SCJE 3AODA 3C15A 2HIQA 1Q86T 4XIUA 3E3XA 3JTPA 2RHSB 2JJ4D 4KV8B 5G0RB 2YY3A 2XZTB 5K8MA 4DR6J 4PR6A 3EZUA 2VFRA 3DRPA 5JVHQ 3ENWA 1CS4B 1TKTB 4RW7B 3IA0A 2C2OB 2OPSB 3CW2C 1S12A 2CJBA 4RNFA 3D1HA 1CJTB 5ADZA 3P6YC 3ILIA 1C4AA 1WOSA 2OD6A 4X62F 4OZ3A 5HANA 2KRRA 2VJUA 4OZNA 1RT7B 1GT8A 4XK8C 4ZPTR 2KHCA 3QSYB 1KS2A 2BQ3A 3MECA 2E7XA 4FXVA 1JX4A 2R8HA 2E9TA 3L9ZA 3TX8A 4MKBA 2HHHJ 1NRKA 2R7QA 3BR9A 2J0QD 2M8DB 3ZZPA 1DRZA 5A8RA 4DX5A 3BKFA 2EFNA 2BQUA 1RZMA 4NYPA 5D3GA 2HMIB 1P1TA 3M8QB 3KXDA 1SQGA 2AEJA 4I6YA 4MFBB 3V6HA 1IBLJ 2I5JA 3FSIA 2RQ4A 4PWDB 2PFDA 1WHXA 3BYPA 3HKZD 4HT5A 5IWAJ 3W2VA 3KLEB 3EJMA 4NZ6A 1GAOA 2V2ZA 1ZAXA 2EW9A 3IBFB 5LT5A 1NK8A 2K2PA 3HHNB 1N32F 4FN5A 3FFIA 5KFSA 3R5JB 4LSZB 3DRYA 4ZP6A 4I7FB 1RWPB 3MMBB 5D15A 3CPWR 1Q82T 3OR1B 2GHPA 1EJ7L 4WBFA 2V2KA 4I1TA 5DRKA 6AT1B 2R7XA 1IWAA 4LF2A 3PKMA 4I2QA 3OMSA 2Z2MA 1S1TA 2Y9HA 4JV2A 3M2UA 2IFXA 3CDWA 4LIRA 4PYAA 3NS5A 1XN9A 3GFYA 2GHWA 4KGXB 4WWSA 2AJ4A 2BYCA 2XWXA 3LGNA 4KB7A 2CQ0A 1PJ6A 4CQ1A 4OX7A 1WC5A 2L08A 1YRTA 3HSZA 1BD6A 3W2WB 5J2NA 4B3SF 1HNIA 4JI4J 1FJGJ 3NL0A 3R2DJ 2BVZA 4N8NA 4IUFA 4WXOA 1RWXB 2FY8A 2QMXA 3PX4A 3D6FB 5KFYA 2A2CA 3UE2A 2XSFA 3H7HB 3DRRB 3LAMA 5CD4H 4EO6A 3Q23A 1K8AT 1RXOB 1YJWS 4F2SA 5B7WA 3GCWP 2ZVIA 5ETTA 1FNMA 4GC7A 2FHJA 4N8OA 2W9BB 4RUAA 3BSCA 1YJ9S 3CDEA 3KLIA 4ZPDA 4NLDA 2GMHA 4TLQA 4WE1B 1VQPS 1S6OA 3S8SA 4DWIA 3DMJB 1FDAA 3QJJA 1U6BA 1U24A 4KHPJ 3MFIA 3T9NA 4USWA 3CJKA 2GJFA 4OQJA 1SB6A 2CWXA 2OMLA 2YPZA 3R1HA 2GC8A 2K1RA 3POTB 1S9EA 2FC9A 3K7RA 3MTJA 4P9SA 1BHNA 2B4PA 4K5SA 4LUBA 3HHLA 5H9FJ 1NJIT 4DSKA 2J5AA 4ALZA 3EGZA 3BO4A 2FDNA 2QA2A 3SCKE 2ZBPA 3J81U 1Y0HA 1NPKA 3BR8A 3KHGA 4NLGA 5BJRA 1KLMA 4HT7A 4HI1A 5JUMA 1NXIA 2P6TA 3GV5B 1K1QA 3DGPB 1HW8A 3M30A 2F65A 3NCPA 5HQMA 4ETXA 3TUPA 4KV8A 5G0RA 4DL0C 1RTDB 1H2UX 2FHKA 2V34A 2V50A 1WKLA 1L3KA 3LWLA 1N5YB 1OMSA 1U2CA 3OFEA 4UUXA 3ZZTA 3IR7B 3PDNA 3ZZZA 3Q8YA 4I7FA 2E9ZA 2GO9A 1VQ9S 4OV1A 2C42A 3QWUA 1RB0A 4R25A 4A8YA 3KG4A 2IMOA 1ZH5A 4TVAB 4XPEA 2DO0A 1RK8A 2IMWP 4F4KA 1ZAVA 3MECB 1HPZB 2CPJA 4JI8F 1Q8IA 1FRXA 3RYLA 1XMBA 3V2UC 4BHQA 1WF1A 4C98A 2VQFJ 3CCWA 3D0IE 2OAUA 3DDKA 5F3TA 2DHAA 2ZBQA 4U7CA 3JAMU 5A8RB 2QLJB 3WX8A 1R6YA 2CQIA 2HHVA 1RT6B 5A6WA 1LW2B 2HLUA 2P5VA 2HS3A 3I4HX 5JJBA 1FJ7A 3W2VB 3KLEA 3PW7A 2JVOA 2GVDA 2IRXA 5K8PA 4GZ3A 3DOLB 2MLZA 4N7TA 2HYIB 4USTA 5KFLA 5HROB 3TVZA 1U1NA 2G1DA 4KKOB 2MGZA 1TUGB 2YPYA 2BA9A 4HHJA 4R5PB 1IWGA 3OT9A 3VAMA 2QGFB 3DOKA 5IFMA 1N48A 1VJWA 2CFXA 2PMWA 4EYHB 2ZVSA 1JWWA 1U1RA 4B9MA 3RB6A 1WC4A 3GWCA 1VCTA 2R2UA 2UUCF 3K0JA 4TU9A 4E2FB 1JKHB 1YWXA 1RYRA 2C2EA 3SK1A 1YGYA 3TX0A 4F7VA 1X4HA 2B56A 4A8QA 4P6QA 4ZJQA 5KT6A 3QPIA 3P4UB 2IJRA 3GJRB 1BY9A 4O4GA 2N4CA 2CYYA 2HQCA 2LDIA 3IR5B 4YDXA 5DETA 5C25B 1IKXB 2H1YA 1JJCB 2ZNYA 2OFGX 2NS1B 5DZ7A 3NGKA 2B0GA 1A0OB 3VGVA 3MURP 3AOAA 1RLDA 2G9OA 4RW6A 2W7OA 3GMGA 3L95X 2KG1A 1AW0A 4ZVOB 2K7JA 2QL5B 2D74B 3EZ5A 3N9UC 4KFBB 3T1YJ 1W25A 2GIFA 2G0IA 2YKNB 1U0HB 4DL6A 1FTCA 4RPFA 5A2QY 1QAJA 2OPPB 1SH3A 1NO8A 2MKJA 4OZ1A 3T5KA 2ZH1A 4W98A 2W9CA 3IWXA 4DOZA 4PZVA 2VBYA 1J5OB 2HHXA 1FDDA 2QLXA 1N6QA 4C8ZA 3A3NB 2DRBA 2FJVA 1VR6A 1HWKA 2OLWA 2MQLA 3DRPB 1REVB 2YQ3A 2UUBJ 1DQAA 3EDRB 3MWBA 2CQCA 4Z7YA 2JRSA 1TVRB 2Q6CA 1ZTWA 2HVZA 5J1EA 4J9KA 1KTQA 2PDAA 5F3ZA 3HVRA 3I5AA 1U49A 3SQOP 3ZXWA 1NJYA 2X1AA 2QG9B 3I55S 2RB7A 3QJLA 3KLFA 3ILJA 5BR8J 1UZDA 3H5UA 3M6WA 4UZCA 4Y0FA 3MR2A 1Q16B 4DV0F 1YHQS 1RWMB 2BW7A 4UOHA 3PO5A 5D0GA 1FVSA 3PJ9A 1AZSA 1WSVA 3MM5B 1CG2A 1MMDA 3V81A 3MMJA 4C7QA 2IBOA 4D3GA 1S1XB 2LYVA 1TV6B 2MKSA 3Q0AA 2D1CA 1CJUA 2IM3A 3CJRA 5EX3A 3PEHA 3D3CJ 4KKOA 2IVFB 5KFBA 1TL3B 2BJ9A 3PNIA 4QW9A 4AY6A 2K3KA 1B3TA 1KR4A 5DG9A 2VONA 3HHLC 4DQPA 1V6HA 2DXDA 1NDKA 2PD1A 3NLCA 5CXTA 2KT3A 1LWEA 4LF1A 4A4JA 4F4WA 1H6KX 1WKKA 2OMOA 1VC6A 2HGNA 4E0DA 3OJUA 1SL2A 1RAGB 1FD8A 2VD3A 1KKHA 1U2RA 2WZ1A 3DLEA 4QIVA 2CRLA 1NSQA 1T9YA 2W25A 4X4QA 5HP1A 1S76D 4DFJA 2P2CB 2RSFA 4FXDA 5F8MA 3TARA 1GX5A 2RHQB 1F9EB 2DH8A 2E29A 3NKYA 3OR2B 2VG5A 2KM8C 2N7YA 5B08A 4F25A 2B9XA 4NLVA 4ERDA 4PPDA 5G4DA 1QTMA 4KFBA 3QJPA 3CC4S 2CXEA 4B3OA 1UPMB 5KFGA 2IRUA 4QW8A 1T05A 2OHDA 2OPPA 4R5PA 1B0TA 2CKWA 1LFPA 4J9MA 1K1SA 3PCOB 3H2VE 5EWFA 4Y2KA 3CNQP 2ZHBA 3BB5A 4ELUA 2F4VJ 4DBQA 3ICLA 2NXJA 2FZKB 4DV4J 3CD6S 1OWXA 4ANCA 2DYAA 3I96A 1VBZA 3GPAA 1AB8A 1D09B 2ILZA 1VQSA 2UU9F 2F4VF 4K0KJ 2EG1A 2EXUA 4CRJA 1G3OA 2HVIA 1HBMB 5F0UA 1C1CA 4QCLA 2CPZA 1D3WA 2XO6A 1NK0A 4K8RA 4GYYA 2NQPA 2VPYB 4KYZA 4P7TA 1J5EF 1NLKL 5AXNA 2V68A 2UV8G 1S9EB 2N4DA 4WXWA 3M32B 5CCMA 4FYXB 1I5OB 2BJ3A 3NY0A 2VICA 3AJ1A 4HVZA 1U0HA 1IKYA 2X1BA 2VF3A 4K5RA 2ZHOA 3PO4A 4OYPA 4URQU 1HIYA 2UV8A 1AZSB 1EB0A 2NSCA 3MM5A 2BE9B 4YB7A 5BYQA 3S1TA 3CCUS 2VB6A 3UO0A 2DD8S 1FO1A 4LSLA 2PA3A 1K0TA 1VQKS 4C48A 4DUYF 2DEIA 4WYWA 5J2MB 3C14A 2CPFA 1DLOB 3RGIA 5HL7Q 1NDLA 1R7IA 1S9GA 4ED8A 1HWJA 2YNHB 1Q1KA 4A47A 4YP3A 1VQOS 2KI2A 5BYRA 1TUVA 3SIPB 3M6XA 4WFYA 3R27A 4F4YA 3SV4A 2XNQA 3KLFB 4KY3A 1JJ2R 2YKAA 1VQ8S 1JK9B 1GMWD 2X51A 5IV3A 1R8PA 4CNYA 2DT9A 2GQ2A 1S5ZA 3CB4A 1R0AA 4P74A 3KK1A 4JI3F 4IDKA 5LSOA 1BWEA 4H4OB 2EC2A 1T9TA 5CH7B 2F40A 3CJ8A 1TV6A 3GIKA 2ZH2A 3VAKA 4OI2A 1T05B 2FLPA 2J7KA 1RT3B 1RUSA 2KU7A 2BMBA 3EM1A 3I5BA 1TL3A 3IG1B 1T0TV 2CZ9A 2MHNA 1S6QB 3QO9B 4LRDA 5KFZA 4RUHA 4H4KA 3EPIA 3KTQA 1WG1A 5F8JA 1TR0A 4JUZA 5HQ8A 2G1HA 4U6PA 1JLFA 1EIYB 4F4XA 4JI1F 5CQGA 4LR7A 1QE1A 2QMUB 1VHIA 2FD2A 2XI2A 4TN2A 3SDEB 2V4JB 3D5MA 4WPAA 4A8MP 4IH7A 1GTEA 3WBZA 3OL6A 2HBZB 1TU0B 3AA9A 3BGLA 3ISZA 1HBOB 5B0GA 4ECVA 1RAOA 2O3DA 3FKBA 2LA6A 5HP1B 1WEYA 4MTPA 1S59A 1DBDA 3SSSA 3C3LA 4FYDA 3A13A 3A8EA 2DH9A 1VJQA 2AP6A 5I3PA 4FF2A 4KPCA 2DHXA 1XTZA 2LDYA 3AJDA 3HD1A 4I6AA 1RA6A 1CJKB 4YFUA 2CQGA 5A8KA 4OJHA 3IXQA 4P73A 1T3NA 5F8NA 4WZMA 1Z4UA 2DCUB 4RW9A 2ACYA 4DFPA 1ZETA 1V3RA 1Y10A 3AFGA 3ZTSA 3ZTRA 3G87A 1N88A 2KXHA 1RAAB 2IM2A 5IQQA 3UNYA 1RE1B 1Y7PA 2PIIA 1R8CA 1VQMS 3IGNA 2CVIA 4O44A 4BC9A 2V4QA 3GIMA 5K14B 4G3IA 2HHWA 2UVUA 3NBPB 4XI9A 1LK7A 2A10A 1HKAA 2V67A 4IG3B 3UR3C 2SXLA 1F5CA 1HNXF 3E51A 1OIAA 3U27A 5J2MA 5K8NA 3CJQA 4ATNA 1AROP 4PG4A 1ZM4A 2WVEA 5KFXA 1TKTA 4USIA 1HA1A 4I0WA 3BN7A 3QATA 1SC1B 3DCAA 1E8OA 2MQ8A 3NS7B 4OFZA 1RT7A 2M3DA 5MLCV 2POKA 3FJ2A 3JSMB 2GMLA 1CJTA 3GSDA 1NJZA 4DF4A 1NBEB 1KRPA 4WP8A 4DQSA 1LW0B 3AD9C 3G6XA 1RDRA 1YQHA 4ECZA 1QSYA 2ZKTA 2FHOB 3HX9A 4MT1A 4ZP8A 3MUMP 4DR2J 3ONQA 2DXEA 4NLYA 5EX0A 4MKAA 4IR9A 1UVIA 3G8SA 4ECYA 1U7IA 2QSFA 4Q7AA 2VJVA 3MCOA 2CZ4A 4UOGA 3TQ1A 2DY9A 2HMIA 5JXSA 3ZZRA 4JI7J 2B6AB 5F8LA 2WAQD 2ZH7A 4A8WA 5J2PB 2W2QP 4OYXA 1F5AA 1RQ0A 1I51B 2YNHA 4QPXA 4OHVA 4PQUB 2IY5B 3MEDB 3KWMA 5KFUA 2B9YA 4ZCLA 3VGUA 3MMBA 6FDRA 1X4CA 5KFEA 2NPIA 2L9NA 4JI2F 2LQ9A 2VG6B 3NS6A 5CA5A 3BM7A 4KE5A 4CYUA 4ES1A 4JB8B 4FF4A 3T19A 4ZLPA 3GJQB 3PHEA 4ZVQB 1GFWB 5LXYA 3M2UB 4Y00A 3R2CJ 1X4RA 4RNOA 2XWYA 3B6BA 4CLUA 2MZQA 2X1FA 2V8VA 3BSOA 1TFYA 3SFGA 2ATLA 2UUBF 4RW9B 2IIHA 3M2VB 2FJWA 1QMOE 3K17A 3CCRS 2VA2A 3ILOA 5KFMA 2V2VA 2IDLA 2NXUA 2YWKA 1VRUA 2QLFB 3MR6A 2RRNA 4Y2IA 3W63A 2K06A 4DR1F 2JC1A 4URGA 2RU9A 4FKXA 2AU0A 4NLXA 4KO0B 1X8DA 4CIOA 2XCPA 5K5MA 1NUEA 2J9CA 3KLIB 2KXFA 2A18A 2HQDA 4B3TF 2C2KB 4J5OA 1KSPA 1UKUA 1PBUA 4NLUA 5DGAA 3M8RA 3LANA 5KFWA 2JSXA 3U1NA 2H65B 3KHRA 4HR2A 4N41A 2VPXB 1IJFB 4EI2A 3HP6A 1QUVA 2E7VA 4IG0B 2ZHAA 1WTBA 1E8OB 2CA9A 1IBMF 3DM2B 2HNYA 4JOUA 1Y00A 4GVBA 2HQ3A 1FRLA 2HFVA 1MWQA 1D8ZA 2MLXA 3EZOA 2KG0A 4DPTA 3AA8A 2AGPA 4JI8J 2DTJA 1O8BA 1YTYA 1LOUA 5M2RA 2B9EA 1UA0A 3V6JA 2FZGB 4H4KC 5KFHA 1HBUB 2DRDA 2YKQA 3WHIA 5FDLA 5KFIA 1YZ7A 4AXJA 1QVGR 4RWWA 1LK5A 1P9YA 1UMJA 2QYCA 1S1VA 1VBKA 2LU1A 2F8EX 3BKUA 5A6PA 4LSNB 5D8HB 3H8YA 3ULHA 2J6UA 2NUUG 2OUGA 3DGPA 1NDCA 2VKZG 2CQ1A 1BGXT 1M1HA 4K4VA 1EAYC 1WELA 2Z58B 1PSDA 1SL0A 3H0PA 3KLGA 2Z2ZA 2WK4A 2AYBA 2DIUA 3J80U 4LR9A 1Y4ZB 2M70A 3CCTA 4YB6A 2KO1A 3GJTB 1OYEA 2YNIB 3VZHA 4LBHA 1RGVA 3H2UB 5T7LA 5HN0A 2IYGA 1H2TZ 4KGMA 1HI0P 2AYMA 3AJ2A 4GZ5A 3CC7S 2C22A 3UDLA 1N0VC 5KG6A 4QYZJ 4ECUA 3ENVA 3AOCA 2DVIA 5HAOA 3FK4A 3LP0A 4TY8A 1SJFA 1FXLA 1XQIA 2XSJB 3F73A 3L3CA 1LV5A 1X4DA 2CJYB 3GYXB 3GYGA 2FJDB 1I1GA 1XMQF 1RTJA 3MEGB 4DPYA 1NJWA 2EEYA 2CG8A 4ZIVA 2H4YB 1RT6A 4N76A 4AL6A 1NNDA 2GJIA 4FS1A 3HKWA 2E7WA 1WG5A 2FZCB 2QT7A 3GSIA 4UT4A 4PABA 3VGSA 3LUYA 2RH3A 3DDIA 3KNAA 5GVQA 2MDAA 2JWNA 4IO1A 3UN5A 2GHVC 2HURA 1N5SA 2B8PA 3C2PA 4ZVRB 1GMVA 4Q8EA 1UJRA 1RAIB 4ZS6A 3KUGA 5L9NA 3A3OB 5I3UB 5IC6B 2ROGA 1QE1B 7FDRA 4RUCA 3MM9B 3PY8A 3V5RA 2MZ1A 1RABB 2J9DE 2X7IA 1V3ZA 3D0GE 2MKIA 4A48A 3W5ZA 4O0IA 2XM3A 3KMQA 2YWEA 1NAQA 5C25A 4C11A 3UDEA 3VAJA 2Y8WA 3O6QA 1WEZA 3O2IA 1T3OA 2BUNA 2WSCC 2XBPA 1DTTA 2V8PA 2JLFA 3TA2A 4CZCA 2H5IB 5HVHA 4A8KA 1HD1A 2KTQA 3UWTA 2ZDOA 1SVDA 3O1LA 2NXEA 3I4PA 4NLQA 5ETOA 3A4TA 4RZRA 1UVJA 4Y2MA 2AIRB 2MKKA 1B7YB 2IA6A 2PO4A 3CMES 3QQCD 2UXCJ 4M5MA 2XHCA 4GYWA 2J6SA 3O44A 2KT5A 2YKNA 3C15B 5DO2A 3A8JA 1PAEX 2E1MC 1Q4RA 2WOMB 3R5AA 3BSNA 5K14A 2BW2A 2XMWA 1L3SA 1KLNA 5FLXY 3EGVA 4IG3A 2CJXB 3CD7A 4LFCF 1RAHB 2LQ8A 1YRXA 3Q2SC 2V8DA 3SQGB 3VHQA 4ENOA 2RDJA 5JVGQ 1I6JA 2KB2A 1IVZA 2B43A 4Y2AA 1ZM3A 4NL5A 4YN3B 4WP3A 5D4NA 3PV8A 1TTHB 2ASYA 2H54B 1GXUA 5D4LA 1CVJA 3OSPA 1V3SA 1HBUA 1WSRA 3JSMA 2I0XA 2IHR1 3BF4A 4GVLA 4C8MA 3W9JA 3DNCA 1WC1A 1JLQB 3T9ZA 4ETZA 5C24B 4LREA 1S1VB 1URRA 2FVCA 2QLBB 3FNNA 4NLRA 4DX7A 4N39A 4A8FA 1VMBA 1U1KA 3P5TL 3LP2B 3GIJA 1NSAA 1SI9A 3M8QA 3KLVA 3MGJA 3V81B 2X5TA 3VQSA 1HNWJ 2C28A 1QAXA 2J8SA 3D67A 2HRTA 1LWCA 3N6MA 5AJ3J 4X4PA 5E5NA 4ZVEA 2NYHA 3QAUA 6FD1A 2JOQA 3OTCA 4U8YA 5C2CA 4EEYA 1NJXA 1VFJA 2CQHA 4M8LA 4MAKA 3GV7B 1BQNA 2B5JA 4JP8A 2YBVA 2E9RX 2E66A 1EKSA 5IT9Y 1Z2ZA 1RCOB 3H42A 2J7WA 3PRDA 4TU8A 3GV8B 1AFJA 4UOFA 4OZ0A 1UW4A 4L3KA 3TAMA 4ZCMA 4ZDNA 3OVSA 3NEKA 3QT8A 2V69A 4DI6A 2G4BA 4PQUA 1U7LA 2U1AA 3N6LA 3PEJA 4M5JA 3TOQA 4ELVA 4IQXA 2OTJS 3I87A 1CC7A 1LWEB 2VHGA 5M2PA 2X3GA 4QOTA 2XLJA 1SIZA 3CF5Q 3WZ0A 3AQOA 3CSKA 4WP9A 3VAHA 3OW2R 1FNXH 3DLEB 2GGPA 3JTNA 4B9NA 4KH0B 3UNGC 2DGSA 4DPWA 3KJFB 5IT4A 2HHSA 3W8PA 3W61A 4J9RA 1HNIB 1X60A 1F60B 1HMVB 3G86A 3SBMA 4QU6A 1YJRA 2GNKA 3OSNA 4IYQA 1VQ6S 1KOHA 3FQKA 3R7SB 1IKWA 3BH6B 1KWMA 3W9IA 4NOHA 1KVKA 4TKTA 4JV5J 3DLKB 3M05A 3PHTA 3TWZA 1BE4A 2LEAA 2WTFA 5KFAA 3C19A 3N0VA 5I3QA 1HHTP 3IAM9 2EBGA 2OIHA 3TZYA 4L75A 4FXWA 1TAUA 4Q44A 4ECSA 1FRHA 1ZM9A 5LMNJ 3BS9A 2UVWA 1MMNA 1R0BG 2GJ2A 1FRJA 1WF0A 3SQGA 5KT5A 3T5JA 1LQ9A 4J37A 3T1HJ 4FPIA 2UUAF 5KT4A 3V4IB 1C1CB 2V5HG 3F41A 4C8KA 1WC0A 1NKCA 2ZH8A 4U7UD 3M9OB 2FY1A 1HWLA 3VAGA 4F3QA 4ECRA 2I8EA 1AUSL 1GMUA 3PW4A 2VOOA 2BM1A 2BANA 2WBMA 3DM2A 1K73T 3GU0A 2FJBB 2VPZB 3OLAA 5C24A 3VQTA 2DHHA 4HDGA 1FKOA 3EUNA 1UWAA 2IDEA 2V63A 1U1LA 3CCSS 4NWBA 1C0UA 3IC1A 4A8XA 2CADA 3IRWP 2V4RA 4J9NA 2KFYA 1RHJB 1DFDA 4LVOP 4LSNA 2W4DA 3RUBL 1F1BB 4X2BA 4M5LA 1RYSA 4CT9A 2VA3A 4ANEA 4DS5A 2YX1A 2R2SA 4P2SA 4DSIA 3R7BB 5D4OA 2FLNA 2XY5A 1DLOA 3NMRA 3PACA 2XO7A 3ENQA 4P2FA 3T3FA 2CVEA 2XGQA 2W4CA 1YJVA 2DPIA 1RADB 2DPJA 1W7WA 1I3OB 1FRKA 1CS4A 4UW2A 3K8WA 1VIOA 4U8VA 3G6VA 2DJWA 3QLHB 4HH0A 1SV5A 2VASA 4F26A 1LXNA 3AB2B 1ZZFA 3E01A 4AQYF 1WTFA 1Q53A 2EVZA 3D6TB 1SC3B 2PMZD 2WW8A 2CWKA 2WONA 1KEKA 1U6FA 4DV0J 1XNQJ 2AQ4A 4YR0A 3HJVA 3OL9A 1RTJB 1NHUA 3MEGA 3KK1B 1R0AB 4IRKA 3E2EA 3SCLE 5B0FA 4OI1A 3HVTA 3HHKA 2JEIA 3WC0A 3MXHP 1ZA1B 1LFWA 3MD1A 5T41A 3UD3P 1W2BR 3DC2A 4NLPA 5HROA 3UVJB 1RT3A 1BXNA 1GXTA 2V0NA 1X4EA 2QL9B 4W4MA 3SV3A 1RAEB 2M0GB 3KG0A 3ZO7A 3A12A 2BEFA 3RR7A 1VI7A 3FFIB 4AD6A 4F0HA 3B78A 5K8OA 2CNLB 3H5SA 1IM6A 3CTRA 1VIXA 1UVMA 2AGOA 1RP5A 4AYBD 3NNAA 4QYZK 4CCHA 4ZPAA 3PYFA 4PG7A 1HBOA 4USVA 4O4GB 1R8AA 4ECWA 4CO4A 4MK8A 4BLGA 5F8HA 1Z2LA 1FKPA 1MROA 4K4YA 4DV2J 2P9GA 5A8KB 2HVHA 2LXUA 4AKXB 1OS5A 2CQ3A 3W66A 1H74A 4JI0F 2WBRA 2PC6A 3K5OA 4XTTA 4X62J 1WHWA 1A7GE 2K8GA 2LMIA 3US5A 1OSDA 5H9EJ 1S57A 1JB0C 3THTA 3WIUA 2GX8A 4QQBA 4IOCQ 4DR7J 2HG4A 1X4GA 2ACMA 3AB4B 4PXEA 1E6VA 1MU2B 1T03B 1D9FA 1X5SA 5CHCB 3DRRA 5KFTA 4DPOA 5E3QA 4DDFA 2MY8A 3OL8A 1RHUB 3FVYA 3ETOA 1SUQB 3CJSA 3CO9A 4LQ9A 5K9FA 3BH7B 3R9LA 2CPDA 2DGWA 2RS8A 2UP1A 2ZITA 1JLEA 3GIRA 4IH6A 3C6UA 3RBXA 3PFEA 5F8GA 2VDIA 4GKKF 1W2IA 3H59A 4K2JA 1LWFA 4WFNQ 4NRUA 4DR2F 2D3OR 2HBYB 2KDOA 4WKYA 3CJKB 1NCLA 2RKIA 1SJ3P 4ZHRB 4K50A 2KVQE 4YUDA 4G1QA 1HL6A 1OO0B 3T6BA 4XDCA 1R27B 2FB0A 3UDCA 3M1VA 1AUDA 1GX6A 1GK8A 1PYOB 2YQ0A 1C0UB 1LW0A 4A8OA 4DJBA 4OHYA 3KUEA 4USKA 3Q8QB 1FWLA 1N33F 1R3NA 4NE9C 3OTOF 2RRBA 3Q2TC 4YR3A 5EHHA 4UOCA 3W60A 4C4WA 3VCXA 3GYNA 3VWSA 3IN5A 1NU4A 3LF0A 3UVJA 1LWCB 1T94A 2Z2YB 2ZBCA 5EWGA 2B6AA 3DRXA 5IZHA 4ELTA 4OX9J 2VKRA 4J9OA 2RVJA 3PVXA 2LKZA 1K9MT 1WNEA 1C1BA 4OYBA 3Q8RB 3RRKA 3QLHA 1HBNB 3H2LA 2OPQA 3IR6B 1TZ0A 2VG6A 5IC4B 2BOAA 2KYZA 3ISND 4CYUB 3PW2A 2PI5A 3PR4A 3MEKA 4ITSA 3PTWA 4RUBA 1VLOA 4NX9A 3UCGA 1ZBTA 2E5GA 3RW6A 4AY5A 1LKZA 4QIEA 1SKSA 1HQ2A 1Q8BA 4OX8A 4DLEA 4B9VA 4LFCJ 3GCXP 1EP4A 3FZ2A 4KHPF 2VPWB 3LPEA 4NLSA 1RTZA 3L7PA 5GMEA 4NASA 3L7UA 3QGPA 4NCGB 2EG2A 3D68A 3M2VA 1VQLS 3E8OA 4LF9J 2C3UA 1CBKA 3BGOP 1QDUB 3K5PA 3TQEA 3DRSB 4DF8A 1U1PA 3CULA 1FXDA 2P6SA 2J6TA 4R0EA 4ZKAA 2CNKB 2J9DA 3TANA 1U8WA 3EMTA 4CTAB 4IO9Q 1Y9OA 3V6DB 2Q1LA 2XMMA 1VRUB 4GO5X 2ZE2B 3CC2S 2XZWA 3JTOA 3TAQA 1B64A 2I2YA 2YQ1A 5KG3A 1M90T 2G2ZA 3AOBA 3DOKB 2FVPA 2PGCA 2D3O1 1JLEB 4O3OA 3UCZP 3OHAA 1HNWF 4CP5A 3M8WA 4ZITA 1RWKB 2OKQA 4KH1B 1VHFA 1CPZA 3NP5A 1YBTA 1NHKL 3RZAA 3M9MB 2HZVA 2JEJA 4UYJA 4ES2A 1RBAA 3W1YC 4OI6A 4CT8A 4LMZA 1ZS6A 2KN4A 3TA1A 3I31A 5C42B 4PRFA 2CJQA 4O3RA 1RT5A 1KHVA 3CVKA 5GAGU 1M5HA 2AJ1A 4C6AA 2LFVA 2M88A 4M5DB 2QFJA 3KJVA 2FQQB 4X4VA 2BRLA 2Q79A 3OBIA 2DK2A 1UZHA 1HQUA 2VC1A 5AE1A 2DNQA 2JHEA 2Y3YA 3FMWA 5GAGI 2OGUA 3M2RB 1XNRF 5L9XA 1P8GA 3FGVA 5EDWA 5KG4A 4WFAQ 2ERRA 3Q8PB 4J90A 1JJ4A 1PC4A 4IRCA 4PQAA 3FRZA 5HVFA 3M6UA 3R6LB 4KSEB 4U9RA 2B4UA 3IGVA 4PG6A 4LSLB 4OYMA 2OEKA 1FFWB 3JB9k 2F7VA 1ROFA 3G82B 2HQFA 4NXMF 3Q86A 2AYEA 2W9CB 4P72A 3K5NA 2F1FA 2YH1A 1S9GB 1KQFB 3G8QA 3T6JA 4ZCIA 1QLNA 2RKIB 3FEXB 2V94A 1RT1A 1QSLA 4C8OA 1T11A 3GE9A 4P10A 4AUKA 1VQYA 2YWGA 2B4OA 3JSRA 5KFPA 3GZ7A 2BR0A 2IAJB 2DBBA 1ZAWA 4OYIA 2EFVA 2HFUA 5CD4A 1YBAA 5DDPC 1HHQA 3IFEA 2F9DA 1N5QA 3OFHA 2ZDPA 4B3MJ 3PXGa 2KZZA 2PFFB 1RISA 3AD8C 3S01A 4GKJF 2HEKA 1PBAA 2VQFF 1NDPA 2B4VA 2VL1A 3ZTPA 8RUCA 3CJ2A 3DGVA 5J2QA 1XBWA 2AX1A 3FC9A 3HFKA 3N79A 4H4OA 3TVYA 5CCLA 3CUNA 2NSBA 3HFZB 2I5JB 5ETQA 3M8SA 3ETMA 4C3KA 4PXBA 3EX7B 3EE3A 3VCDA 2VIHA 4LFBF 2CIMA 1KDNA 2ASJA 2MPUA 5GAEI 5B09A 2GZOA 2HNDA 1S1XA 5K20B 1S9FA 1C1BB 2PT0A 2DNGA 2R3VA 3CCLS 4F04B 4I2PA 3TEHB 2FFGA 3TI0A 1HBNA 3MFHA 5KFKA 1DHMA 2Z2LA 4Y2CA 2DNZA 4X65J 1C0TA 1DZ5A 1RSCA 3HM9A 2XMAA 2C3YA 4ZPCA 1SC6A 4ZN3A 4ECXA 3OTBA 1NKEA 2HSEB 5I42B 2B9WA 2HQGA 4ZPBA 1X31C 4JI2J 2NPFA 2F3JA 5BR8F 3SYZA 1RT5B 3MPWA 1N4LA 2ZWOA 2W01A 1L3VA 4WK3A 4AL5A 2FJXA 4Q2LA 4N77A 1XMOF 2MB0B 3P49B 1Y3JA 1AT1B 1QJHA 2CNNB 2UXCF 1GQEA 2ZFHA 4CLLA 1NZ8A 3CCES 2XC9A 1SJ1A 4LF8F 1Y5LB 3RAMA 4NI2A 3UPFA 3THVA 4LF4J 5HMWA 4YY3F 1NB7A 1DAXA 2ZE2A 1Q78A 2F5GA 4B08A 3W8GA 4E8UA 1M0SA 2JH3A 2MZJA 4O3NA 4YS2A 1TL1A 4YY3J 3VAIA 4XAKA 3NWRA 2M52A 4AE5A 1HYSA 2CQBA 4IOBA 1XMQJ 4FF3A 1XNQF 2HAFA 2QX0A 1UVKA 2APOA 4CLYA 3N01A 2AJ2A 3RR8A 4OZLA 5C42A 2QA4G 1YSJA 4PXCA 4ECQA 1VK3A 1PJ7A 2DR7A 4CO0A 1WI8A 4JBCA 3L09A 3GQCA 4GRSA 1OPZA 3H5XA 1JJHA 2CPIA 3HHLB 5E3RA 5KTQA 4ZCKA 1FRIA 1HNVA 3BGFA 1Q7YT 4PG8A 4L6V3 3K5LA 3H25A 3UD4P 2GAGC 1R8BA 2C1EB 3NGDA 1FD2A 3BO3A 4DL5A 2ZC3A 3I9ZA 3ITHA 1CQMA 5EUHA 4NCAA 1KNZA 1IKYB 4ZK7M 2O67A 2EFQA 2QTWA 4WZQA 2VFVA 3R7NB 4FS2A 4NA1A 4C9DA 2ZH9A 1KOOA 1S77D 4WKRA 5FD1A 4G65A 4OMFG 3TO8A 1NPRA 5KOXA 1UEVA 2C2NA 4WIQA 2YKPA 4RU9A 2ZNZA 3CIMA 1JXLA 5D6GA 1WEXA 4IQMA 5IQ6A 4YEAA 2XGPA 2YTCA 1U8SA 2COLA 3FBFA 1NKBA 2DNMA 1I94J 3AXMA 1FX2A 1FHTA 3GB0A 2QC3A 1D0EA 1RKIA 3TAMB 2RD5C 1B70B 3DKDA 3HT0A 3O5TB 4J91A 3AAWB 3UFCX 1J2VA 4NYZA 4BC7A 3FBEA 5DS7A 1M1GA 1HWIA 2PMHA 4FYWB 5F9NA 3NAIA 1UJ5A 2D3UA 5DDQC 5SZTA 1HLWA 2GGPB 2UU9J 2HPUA 3MUVP 2ATCB 1IXKA 1WF2A 3H4DA 3HI9A 3U02A 1HQEB 1VYAA 4EWTA 1FFGB 3DLKA 1RAFB 5RUBA 3DOLA 1NB2A 3Q83A 4DUYJ 2HW3A 1H3DA 1IKWB 2UUAJ 3D28A 5KOWA 2WB4A 1FFSB 3UI3A 1FI4A 1YDLA 2HQIA 5LMNF 3RRHA 2J76E 2IBKA 2YNGA 5A0YA 2O66A 3D9BA 3OXFA 4O4RA 3B54A 1RWOB 3HF5A 4CO2A 4MYUA 1N5TA 1JKHA 3BREA 1IN0A 4DUZF 4DV3J 3C66A 2ZOGA 3DHXA 4RBVA 3MAQA 4LF5J 1URNA 2H3EB 3CGIA 4IFVA 4KRWA 2XULA 1FDBA 2ZUAA 2A3JA 2E1RA 2XG8A 3PYGA 5ETNA 1HNXJ 2EWHA 2GFFA 1IKXA 5CYJA 4DSEA 2R2TA 4EZ6A 3DLLQ 3HVAA 1LWXA 4HDHA 2R7RA 1LNQA 2R7OA 3HSGA 1JQGA 4FYVB 1N36F 3O8WA 3T1HF 3LA0A 3ITHB 3MAAB 2DR9A 2F8HA 3BBFA 1TKXA 2IVYA 1FKOB 1TELA 1UPPA 1F9HA 4LJMA 1PGZA 1T95A 3CEDA 2P9EA 4CWBA 1N56A 3P8BB 2UXBJ 2J8AA 3ET6A 4FDFA 1CULA 4O44B 1UAWA 3TUZC 4UY85 2D9PA 2R7SA 1ACMB 4X66F 2C2DA 2FIUA 3T5LA 2QL7B 3IWLA 5B0EA 3W65A 5J1NA 2CQ4A 3OFFA 4LF4F 1S1UA 2LVWA 3ZTOA 4UZBA 3BGRB 1REVA 3TA0A 4ECTA 2CJAA 3Q8SB 1PC5A 3MR7A 2ZH3A 1G7CB 1X0PA 1H72C 2QRRA 1O5JA 1L3UA 3ELHA 2W2OP 4QYRA 4DU7A 4DL4A 1B99A 4NCBA 1KTVA 2PSZA 3E01B 4NRTA 1IJEB 2E5IA 4TY8B 2KH9A 1SV5B 3CD5A 3FMBA 3OXGA 4WFZA 1MG7A 5A76A 4JI5J 1M5KC 2E5LJ 2WONB 4RNMA 2FJEB 3LPYA 1WJ9A 2MQNA 5HJYA 1UA1A 3GG0A 1XC9A 2XHWA 2FC8A 1FWPA 1C2PA 2ZH6A 3PW5A 3Q89A 1GMWA 4DZ6A 4K4UA 3A8KA 2WB1D 3UR0A 2B7CB 4LIWA 1KQGB 4DSJA 3PE3A 1X9MA 2EI5A 3NNHA 4HTJA 3MPDA 2V2QA 3QT6A 3CE8A 2CPHA 3Q8VA 3RW7A 5EGYA 5AJ3F 3CMQA 1RT4B 1K44A 1NEEA 1N54B 2KJZA 2GV1A 4QJVA 2YNFA 3Q24A 2OI2A 3DXSX 3G6YA 2ZJQQ 3H5YA 1IR1A 1XIQA 2J0XA 2ZC4A 3TJ9A 1IBKJ 2J0SD 1Y11A 2JZ5A 3MM7B 1O51A 1BC6A 3O3LA 2NCKL 4JI0J 3I9V9 4IFVB 2RU3A 4DV2F 1GNKA 3MPYA 1S48A 2BXJA 3MCNA 3TUJC 2YH0A 4X4SA 1AXQA 2DY1A 3CT9A 2DGVA 3MM6A 4PXDA 4ED7A 1TKDA 2I9SA 4EBDA 4IR1A 1YJNS 4OZ5A 2HHUA 1YG0A 2ZD1A 4KGKA 1NMEB 1P9QC 2OFHX 1DTTB 5E41A 2QSWA 2L41A 1IBCB 3KK2B 1S97A 4ED4A 2HKEA 2QEXS 2W2PP 3TRGA 4DPXA 4Q2MA 1M1KT 3OXLA 1XR5A 1SJRA 4NA3A 4RKUC 3I0SB 3NOGA 4U96A 2W7AA 1A9NB 4L3NA 4S0MA 4Y28C 3J80Y 3OPKA 3VTIA 2W9JA 4ZVHA 1NPPA 3SI8A 3AQPA 5IWAF 1XJWB 2CQ2A 2DGUA 2G13A 3D1OA 2DNHA 4DR6F 4N3AA 4M5IA 2BKPA 3PJWA 4K7QA 3CCQS 1WI6A 2O1PA 1RWNB 2B8QA 1LEOA 2LQ5A 3JS9A 3ZZYA 4CM2A 2W8KA 3C46A 4PUOB 2ZOFA 1S4FA 3PX0A 3D2WA 1F0XA 5H9FK 1QD1A 4H4MB 2XS5A 1HBMA 3KHLA 2WSFC 1FJCA 3BV8A 1V5VA 2WVDA 1TKZA 3QNWB 2X1GA 3G6ES 1WACA 4FZVA 4HL9A 4NYOA 3QGGA 1YX2A 2RSQA 4Z2XA 2Y0SD 1T9WA 4M95A 4F67A 3AXKA 4NMLA 2BOPA 3RRGA 4GVBB 2CQDA 4DMZA 4ZHRA 1F3FA 1L3TA 1TKXB 4R0JA 2JLEA 2DNYA 2Z57B 4G1QB 4KBIA 4ZA1A 1HNVB 3CMAS 2HNZA 2MXYA 1UFLA 4USUA 2AEMA 3LP2A 2C3PA 3QYYA 4C3LA 3UQSA 4ILLA 3HSDA 2VFSA 4J9SA 2H5EA 2H9ZA 1E6YA 1VRTA 3AY0A 3MPVA 4HYKA 1WC3A 4MKVA 5D77A 4LBIA 1KC8T 4C8LA 5HO4A 4YMEA 2ZJRQ 3MTKA 2BBEA 1T02A 1WOOA 3QMQA 3K5MA 4MIAA 3QBCA 3TJAA 4P75A 2LXFA 3NCRA 3DYAB 3C14B 1S0VA 4NZ7A 4WE1A 3BQ1A 1Q0NA 1CJVA 1JNRB 1OYDA 3MPUB 4FKYA 4NZ0A 2FVSA 2CPEA 1SC4B 4RWXA 2DNRA 3NAHA 5ETPA 2LECA 3ADAC 5ETMA 5T7LB 5EWEA 4QIFA 4HEA9 1RT2A 2OPQB 2J9EA 4TY9A 4Z7CA 4ZN1A 2MQPA 3MUTP 3PYDA 3QFWA 5L1KA 4CLFA 1U26A 3HSJA 4O3PA 3CO0P 4CLTA 1Q81T 4OX6A 1FJGF 3QZ8A 2AJQA 5IS2A 2MSTA 3KOAA 4CDRA 2XSJA 3GG1A 1GH8A 1MMLA 2Y8YA 4LT6A 2MZTA 3VF0B 4OYWA 3R5BA 5KFDA 1MLAA 2JX2A 3EVOA 1WUUA 4DCOB 3RJMB 1S0NA 2DXFA 3QO9A 1FWKA 1FF2A 1YLXA 1DQ8A 4DCJB 4EMDA 4DG1B 3G96A 1VBXA 1RTDA 2Z30B 3KLHB 3V6DA 4ZJOA 2J0WA 2EK1A 2YNFB 5AE3A 3OHBA 2FGCA 3OUYA 5AXMA 3BBBA 4KIAA 3PX6A 2MQQA 4ZP9A 1S6PB 3MMAB 4CH0S 4MKYA 4N3CA 3LAKA 3PRBA 2ZWPA 4X4TA 1IKVB 2ZM6J 1RWUA 1OSCA 4AQYJ 5HLFA 1U45A 4Q0BA 2ILYA 5M2UA 5KG7A 2HHTA 3OTEA 1MWYA 2FGOA 4F3MA 1BLUA 3CCMS 1HR0F 1PO6A 4U7UK 1Q95G 4WCEQ 2JLGA 1QAIA 2AT1B 3ISNC 5E3PA 1SQEA 1RHMB 4LRCA 2ZD1B 3D66A 3GFZA 3KG1A 3W64A 4F4AA 5KT7A 4DL7A 3C6TA 3OQ2A 3TZZA 4EYIB 4DR4J 3I0RB 4L76A 4F50A 5FJ4A 3KJVB 1C4CA 1TMJA 2CJ9A 2RF2A 4B3MF 2RDIA 3LH2S 1H73A 2H4WB 2BX6A 1KFDA 1REGX 1OQ6A 2ROEA 3M2RA 5ETRA 2H5JB 3KDNA 4C3MA 4EK2A 1R89A 5C2GA 1HQUB 1XR6A 5LM7E 2FTRA 3I82A 4LRAA 4MJKA 3VGTA 1E6YB 1VRTB 3MCMA 4XPCA 3RB0A 1JMTA 2C3MA 3EXYA 3HFVA 3TZWA 4A46A 4AT1B 4DX6A 4C8NA 3UW1A 1CEZA 3DLGB 3QAEA 4NXMJ 1TAQA 2AZ3A 1BUXA 4ZOSA 3GIIA 4PUOA 2X5GA 2C2MB 4EO8A 4BCAA 1UVLA 1RAJA 3DU6A 3FBBA 1U1MA 1Q79A 2HBRB 2DB1A 1S79A 2WRMA 1QTNB 3QFHA 3QWPA 3ZFVA 1TKZB 3V6KA 1VK8A 3CDBA 3RB3A 5F9LA 4QIWD 2DR6A 3WIVA 3JAMY 3LW5C 2ZH5A 2F9JA 5A2QU 1TMMA 1RT1B 2KL8A 1KD1T 1RTIB 3R3TA 4UUWA 5DG8A 1QM9A 1PYTA 3BJYA 3R5DA 4GKJJ 1SJQA 4DFKA 3PIPQ 2PEBA 3HD2A 2M2BA 4QWBA 4OJ3A 4DL2A 3BN4A 2MKYA 4DUZJ 4DV3F 1U02A 4NLWA 4K59A 2GQCA 4OI4A 5HQLA 4LF5F 4RW4B 1S0MA 2HS4A 4QWCA 2D41A 2AYGA 3DHWC 1F2HA 3QGHA 2DO4A 3R5CA 2MZRA 3M9NB 1B7FA 4LRBA 4NA2A 4KHRA 5HMXA 2VZ9A 4WYLA 4UQGA 2ABYA 1U1OA 3KLHA 2DR8A 1UFWA 4EUVA 4XIFA 2KRBA 4P71A 2XB2D 2ASLA 2BE2A 4DV7J 2OH2A 1RT4A 2ZKUA 4OLOA 1C0TB 4JI4F 1U09A 3CJ0A 1YJ7A 1RBLA 2BJ7A 1G2EA 3GFXA 3EYZA 3PW0A 5I4MA 1ULRA 1GEHA 3MM7A 2AGQA 2DKOB 1FK9B 4QZVB 2GAHC 1KVJA 3HULA 3RBZA 4B02A 4Q5VA 3TZXA 2CQPA 1EARA 3P45B 2WVCA 1BQMA 4OV6A 4X64F 1T7PA 2EC0A 3EGNA 3IO1A 4J9VA 3R8YA 4GMKA 3SSRA 4EBEA 1APSA 3VAFA 3PYEA 4ZJLA 3SSQA 4NI2B 2RJZA 5D0EA 3CDAA 2XEXA 4DV7F 3B82A 5CYMA 3OUYB 4U95A 5IV4A 2V9KA 3IS9B 1NM2A 4KGVB 4KO0A 4FBTA 1JXEA 1G6BA 3FRYA 2XYGB 1SUQA 1X7VA 4I4BA 2WHOA 1F6TA 2WW4A 3DLJA 2C3OA 4IFYA 3NGUA 4OHZA 2F8MA 3HHLD 3C6UB 4KGZB 4TXSA 5DDOC 4HH1A 4J9QA 1RWWB 1ZA2B 1UW9A 1DURA 5DLGA 3OJSA 5HVGA 9ATCB 3V4IA 3DI6A 1PILA 2RUSA 3N5FA 4DSFA 2ZZTA 4I64A 4OYOA 1WWHA 2YKOA 4DQIA 1O6XA 3IM9A 3TYTA 4W92B 4Y6IA 3MF5A 5D4PA 1QVFR 3P5BP 2WSEC 3NXZA 4K2XA 4C0OC 2HFSA 3RBEA 1IBKF 2DK6A 2FHJD 4GZ6A 1BMQB 3R6GB 2MTLA 2PI4A 2HNZB 4XO0A 2EKYA 3J7A1 2E1CA 1VQ4S 1N52B 4C0HA 2ZBRA 5BXIA 5KG1A 2H48B 1FKAF 4IOAQ 4Q45A 1SH2A 1X4BA 3KYLA 1KONA 3ENAA 3H4BA 2HWHA 3KFWX 5F0WA 3RAXA 3PIOQ 1CC8A 4L72B 2AD9A 4ID8A 4J9UE 3TR5A 1TL4A 3MR5A 2BE2B 2IM1A 1NZAA 2CNOB 4DN9A 4R8UB 4JYAF 2FPHX 2QV6A 3HLUA 5ETVA 3MOZA 1CQNA 3BDEA 5KAKA 4IH5A 2YNIA 1S7IA 2BQRA 3N5BA 4JV5F 2BM0A 1RACB 3VR1A 4TYBA 3VVUA 4QU7A 2KJWA 1GTHA 4V19J 5KFQA 3MOJB 4DXLA 3H40A 3X3UA 3HJFA 1S1WA 2N3LA 2DGQA 2MYFA 3M8PA 4M5KA 5HI7A 4O3SA 3G9CA 3CJTA 2NR0A 2A90A 3M8ZA 3LALA 2XYPB 2BJ8A 3AHPA 3D4JA 3PM9A 1FEEA 2K7KA 2R8KA 4KR0B 4ZLJA 2MZSA 5KFVA 2G2YA 2VH7A 3LP1B 4NCGA 1FJEB 4F8RA 3N6NA 2Z0GA 4OI0A 1RTHB 2DISA 4X4OA 2W4PA 2LXIA 2UUCJ 4N3BA 4CM0A 2X5HA 3ZC4A 4YOEA 3DRSA 1WKJA 3BQ2A 1SL1A 1P6TA 3HZGA 3MEEA 3U1LA 4DSLA 1HQEA 2Y1IA 3K59A 1N5YA 3I56S 3ZNUA 2RQCA 2CJKA 3HO1A 2UXBF 2HK2A 4DG1A 1YITS 1HARA 3KK3A 1SPBP 2Z8QA 3BPDA 1SIWB 1IR0A 4O23A 5L8RC 2R8GA 4V19X 1EQ0A 1RKJA 4OHWA 4MK9A 4UTGA 5I3UA 4JI3J 1S6PA 3MMAA 2OPSA 3I32A 3M6VA 1RWVB 3CXCR 3G2XA 3F0NA 4ED6A 3T1YF 2VU5A 3J7Z5 4YHHF 3J7AN 4X4NA 2Q3PA 2CUYA 3W5YA 2E5JA 3L7OA 3SCIE 1JIHA 4V1Ak 4DPUA 2VFUA 5IXUA 4ZVFA 4F2RA 1FT8A 3GFHA 3I0RA 1FKPB 1MROB 4OZ2A 2RF2B 5U47A 4ICLB 3HT3A 4TQRA 1HI8A 3L4BC 4QR2A 5HSPA 5D3GB 2L48A 2DRAA 1T9XA 2RILA 4RJVA 3J81Y 2E5HA 2HVDA 4OHXA 2NREA 5LMUJ 1F2GA 4F3OA 4B3RJ 2LEBA 1RHQB 4ZLLA 4YB1P 3D3BJ 4HACA 4DZDA 4IRDA 2F4FA 2JDJA 2VV5A 3ET6B 2XLIA 3LWMA 1CULB 1FESA 4OYZA 1OQ3A 1UTAA 2WOMA 3AH6A 5L1IA 2ASDA 1VQ5S 3TAXA 4F36A 4IFYB 3IBWA 3TNVA 4M94A 2JL9A 2XI3A 3EVMA 2KHDA 3FCHA 2FVRA 2B3TB 3BKTA 1ZYQA 1W26A 1HNZF 3R97A 4Z37A 3BGRA 1KQKA 4TLRA 2NXNA 3RBDA 5C7PA 4CLZA 2OPRA 3K2YA 2W2NP 1R6VA 3GR1A 3DI6B 5H1SV 4ED1A 1TUWA 1FX4A 4CLPA 2IC3B 1WORA 2XTJP 1NH7A 5HMZA 4JI5F 4E98A 3D0HE 3TAPA 1R43A 3M8PB 1MN7A 2FUG9 4DHVA 4EGLA 2MKCA 1KQSR 4FBUA 5C1DA 3OFGA 4MYTA 2E1PA 4RW6B 2ADBA 3W2WA 2FLLA 1JLQA 2WCXA 2R2RA 1YI2S 2VDHA 2M5YA 1HHSA 2HWTA 4RW8A 5J2QB 1RTHA 4USJC 1IQZA 2QFIA 2HWIA 5HBMA 2MY7A 4Q43A 1KFSA 5LSLA 3RB4A 4HKQA 1PG5B 4DV4F 2XZDB 4DR5J 4Y65A 1SXLA 2KKHA 4CLWA 3BDPA 1BQNB 1Q5VA 2XLKA 2R7TA 1OPIA 4I2PB 1LXJA 3FUYA 4PYDA 3WX4A 3K57A 1DTQB 2VG7A 4MH8A 2YWFA 3RAQA 3CJ5A 1RU1A 1UEKA 1YZ6A 2XYHB 5AXKA 3LGHA 3J7YU 1TVRA 3HHDA 3F44A 4WTYA 5J1PA 1L5UA 4FYYB 4UYKA 5AT1B 3OLBA 4LR8A 3P3DA 4FNHA 4KQZA 1X9SA 3KJQB 3CD0A 2P9CA 5CAAA 2F63A 3MM6B 2AWZA 5T14A 1F5BA 4I69A 4WU3A 3OVAA 2W7PA 4I67A 2UXDJ 3VV2B 1YJTA 2LU2A 5AXLA 4N56A 2IJFA 3G8TA 3KK2A 1AA1B 1NK9A 1HMVA 1NSPA 2B51A 4DV5F 5DDRC 2IA0A 3LTOA 1TL7B 2A6OA 2Q43A 1NK6A 3LOUA 3M7VA 3NGTA 3MEEB 2A0FB 3I0SA 4OX9F 1NSKL 4B9UA 3AD7C 3KMSA 5CYQA 2XMKA 1S72S 1NH8A 4DL3A 1ICEB 3QIPB 3W62A 3I5CA 1Q5YA 5J2PA 4OJGA 5L1LA 2OO4A 2AX0A 2BE7D 4AXIA 5KFFA 2JNJA 5E3AA 2VFTA 2EKNA 3K8VA 4B17A 3IP0A 1H7WA 4P7VA 4ANDA 4RNNA 3OTOJ 3MEDA 3DOMB 2AJFE 2R7WA 1VC5A 4H4MA 2ZOMA 4RO0A 3NRBA 4CLKA 2DHGA 2K4NA 2XY7A 4DV5J 2R9LA 3PZPA 4EBCA 3T41A 3MDFA 2AZ1A 4CO1A 4DN0A 4UYJB 5DM7Q 1U47A 1K47A 4W90B 2I1RA 3NNCA 2BABA 1PCAA 1JLGA 3NCQA 2BDPA 2YX7A 2ROPA 4M5DA 3PFOA 5D78A 1J5EJ 3T5HA 2GO8A 2QYGA 1P27B 3G4SS 4ED0A 2ADCA 4YHHJ 1YIJS 1WDDA 2LQJA 4HACB 4RL1A 5GAHU 2OEMA 2GVDB 4NEZA 2P8IA 2XCAA 3QGIA 2QIFA 1UL3A 5BYSA 4JI1J 2CG4A 1Q8LA 2EPIA 2MKHA 4ER8A 3IRXB 3EVWA 4B9TA 2DNKA 2JFDA 1U6ZA 1O0PA 1WHYA 4WK1A 1U25A 2M8HA 4BDPA 2D3ZA 4G6VB 3ZZUA 4KTQA 1YJUA 2AF6A 2D7SA 4H54A 4EU0A 3V3LA 3B4MA 2VOPA 1NK5A 2RNEA 2R7UA 2OPRB 3GTYX 3UN3A 4G1IA 1WC6A 3TEGA 5LMUF 2HFOA 2R8JA 4B3RF 1Y3KA 2RUGA 2WVBA 3VZIA 1T9VA 4QWAA 1H7XA 5KT3A 4K4XA 2OTLS 4DQQA 2HVEA 2ZJPQ 5ETLA 1XWLA 3KJNB 2DGTA 2HNYB 2QN6B 4FVMA 3R1LA 2R4FA 2IAJA 5KG5A 4FVCA 3FZBA 1RT2B 2XMUA 4RW8B 1SBRA 4UQTA 1KHWA 4B9SA 3HHEA 2B7BB 2MLYA 4ED3A 5FDLB 1VISA 4DV1F 4CO3A 4QR1A 4HLBA 3QIDA 3HVTB 3FEYB 4FPRA 3NWGA 1QUPA 2XMJA 2XNRA 1T9UA 4CI0B 1RHRB 4M1KA 2DGXA 3FEZA 3J7YI 2GQQA 1TK0A 2KT2A 2R8IA 2BV3A 2GMJA 1H0HB 4OZJA 3MD3A 4ZVPB 3EDQB 3KLGB 2HNDB 1S6UA 2V9WA 4JI6J 3NGSA 4YR2A 1N6QB 3MHYA 3U7JA 1U48A 2PEHA 1P1LA 2DNOA 5E3CA 3D54A 4HHHA 5GMDA 4YB5A 4DUTA 1QSSA 1IBMJ 2KFZA 5HLFB 2CAJA 4Q0BB 2JC0A 1XR7A 1FA0A 1X9WA 3OL7A 1R0CB 4MIBA 1B0VA 2D69A 3MCSA 3MMCB 4AL7A 4X4RA 1U0SA 1JLGB 2OELA 2NUHA 4MFBA 8AT1B 2A1BA 3BT3A 1N5VA 1RJJA 1XERA 4HI2A 1S4EA 1U4BA 3MAAA 4BWMA 4KHMA 5B0DA 1UEUA 1VC0A 1HR0J 1S6QA 4I56A 3C8YA 3HMJG 1T03A 1E6VB 1MU2A 2LCWA 5E0OA 2W9AA 3DLGA 1FTRA 1IBLF 1KN6A 4X65F 1A6LA 1H2VZ 4DR3J 3OD2A 1X5TA 1FE4A 2L9WA 3TUIC 4CDIA 4DLGA 3OR1A 1X4AA 4NXNJ 2HHQA 3SDEA 2GCFA 2AKWB 4DR3F 3HPOA 4HHUA 2YXLA 1N32J 1YBUA 4I2QB 2DNLA 1S1UB 3FSXA 3Q22A 2HZCA 3HDSA 3NOCA 4QR0A 3DFEA 2BZ2A 5LL6d 1X4FA 3ZZ0A 3ILLA 2DIVA 3AT1B 2YWHA 3MM8B 2DITA 1CJKA 3BO2A 1ZZNA 4ED2A 1TQLA 3IM8A 3IMQJ 2XS2A 3BSAA 2VC0A 2QZ8A 1B4SA 4TNOA 4D3HA 3OV7A 4USHA 3JYTA 5CABA 2HHHF 3OR2A 4WFBQ 2ALZA 3EGWB 1ZPVA 2IVMA 4KC5A 3GONA 2J7UA 4TYAA 5DQIA 2HHPA 1ZOTA 4ZP7A 3T1AA 2W8LA 2DHSA 4NXNF 1BWVA 2LEPA 3PJXA 3QSIA 1PJ5A 4F02A 4DV6J 3GLJA 4X4UA 2DGOA 4B3TJ 3NBPA 3D6MB 2AMCB 4FNIA 5HBMB 1AYEA 5C5JA 4K4TA 4DV6F 2JEFA 4RLEA 2HFNA 3KHHA 2LQBA 3H20A 4USMA 7FD1A 4DEZA 2L9DA 2YVSA 1RLCL 4AFFA 1JLBB 3H90A 4RNHA 1VRQC 1HFEL 5FIIA 4J7CA 2A6MA 2G2OA 5THWA 3DLHA 4C8YA 1N33J 3FCWA 4BWJA 1OY8A 5KG0A 2OSRA 2XQCA 1EZZB 4NEYA 2W1BA 4DCPB 4B9LA 3VVTA 2MHEA 4N5SA 1DQ9A 5MAOA 2QLWA 3BEGB 1HWUA 4ILMA 3PE4A 4L73A 2HBQB 2PE8A 1QAYA 3CCZA 2D9OA 4CNZA 1VDHA 4DX8H 4B3SJ 2MSSA 4ZIWA 5DQHA 3BZQA 1EP4B 1FK9A 2W2MP 3GJSB 2IRYA 2PA8D 4PWWA 4QIGA 1TL5A 2EK6A 3C16A 4ID5B 4ZMMA 2U2FA 2VQEJ 1KP6A 2QMWA 3WQPA 1KLMB 5DJBA 1ZTTA 4M5NA 1TL7A 1BQMB 4KJIA 5IM0B 3MR3A 3H98A 4DFMA 3HK2A 2H51B 2O01C 4GC6A 1PKUA 3M30B 4J9PA 5KFJA 4ED5A 2KFNA 3IS9A 2YKMA 3THPA 1JLAA 4CTAA 4NMXA 5GADI 4LF8J 1MN9A 4F0MA 4M5HA 4EFAC 1N34J 1JNZB 4KAIA 5L1JA 1U1QA 4DV1J 2B5JB 1N34F 1XNRJ 2YNGB 1VGYA 2HRYA 2BJEA 4X84A 2OSQA 5A0YB 4DQRA 1S0OA 3NG8A 3B8HA 1YRUA 2V8GA 3QT5A 1Z1ZA 3QZ7A 1HPZA 2GVZB 3PRVA 3NGRA 3D7SB 2WVFA 4NPOA 4DS4A 2KYXA 2Y1RI 4PAAA 2VQEF 1FXRA 2RAQA 2ZUGA 3LO3A 3MMCA 2N82B 1EX8A 1HI1A 1DJ0A 4QWDA 4ZVUB 2VBWA 2EBEA 2VODA 2ALYB 4A8SA 3UD5A 1TK8A 4P2MA 3R5GA 1TP7A 4LBPA 4U67Q 1CLFA 2UZAA 3BYRA 2M9KA 4IDKB 2C2RA 4K4SA 1IR2A 5DGBA 1M5PC 2RQKA 1SJ4P 2NXCA 2ZH4A 4JYAJ 4P2XA 1VLYA 1MNEA 2Z56B 4QPTA 2VBZA 3CJ4A 9RUBA 2MGZB 3SXLA 2MQOA 4LFBJ 2EFOA 2JFKA 2ZM6F 4CO5A 5JMNA 2BJDA 2GS8A 2IJNA 4O0NA 5KFRA 1HW9A 2V6AA 1F3VA 2HK3A 4NLTA 1RBOB 3HCXA 3UN2A 5BNWA 5IT0A 4WF9Q 5F41A 1X0FA 1UWBB 1JLFB 3G82A 3EWGA 3M4XA 2HLTA 2RRAA 1JLCA 3BBCA 3FQLA 3X1LB 1JXVA 2XMVA 4C0BA 5B0BA 4LF6J 2FHMA 2VUGA 1914A 5L46A 4R8UA 1IM4A 5DQGA 3PG9A 3Q8UA 1IUJA 3EICA 5KG2A 2QJ3A 2E1AA 1V5IB 2KM8B 2RS2A 4I6WA 3JYTB 1NK4A 3M8YA 4OJ1A 2G0CA 1ZPWX 2BANB 3IAS9 2RIJA 4P52A 3KUHA 4RBTA 1S1WB 3CJ3A 2R42A 4ZVTB 3J81j 4K4ZA 5HATA 2Q6BA 3KNGA 3S7RA 2NLWA 3FDSA 1S49A 4WTOB 2XMTA 2OP5A 4RX6A 2RE1A 1QY7A 4UF4A 4PCQA 5HMYA 3JQKA 3LP1A 1FRMA 4NLOA 1YK9A 2CDRB 5IM0A 5GAEU 5AOXA 4ZPWR 1OJ4A 5CZXA 4LF6F 2BJ1A 4PKDB 4K4WA 2DNNA 3JQMA 1AFIA 1PIEA 2DCLA 2HRUA 2M4MA 4DU8A 2GW8A 3DU5A 2FVQA 5GAHI 1MSWD 3MAHA 4RW7A 1M5OC 2KJVA 1J5OA 3I6PA 1SH0A 4ZLNA 5KT2A 3KK3B 3WC2A 1IKVA 2LA4A 2FYXA 1U2FA 1KVIA 2FLOA 2Q66A 5J1EB 2BKNA 2HFZA 2IM0A 3TJ8A 5I42A 3B4DA 2BRKA 3LP0B 2E5LF 5IOLA 2A2DA 2GA7A 2QO3A 2N7CA 5D0RA 3TP2A 1XMOJ 2FJAB 3C6TB 1G1XA 3ZZOA 5H9EK 3C16B 2Y1JA 2NZ4A 2C2ZB 2RMLA 4OIXA 2KZMA 4O3QA 3FCVA 1OY9A 4WU2A 4WIIA 3PR5B 3CCJS 4PWDA 4EZ9A 1TFWA 1WHVA 3MZIA 1JLAB 1NHVA 4ICLA 2IPOB 3F56A 3HZEA 5B0CA 1EQMA 1RCXB 4IKAA 1K0VA 1TL1B 1FNOA 2PN6A 4KT0C 4PWUA 1CJUB 1HYSB 3DLBA 3A1YG 4DR5F 3RTVA 3PKYA 2O5DA 4C2MA 3EXCX 4BS2A 2HGMA 3N28A 3SFUA 2BKOA 2GIRA 3MM9A 1UCNA 4OYAA 1FVQA 5HK4A 4G1PA 3S6EA 2AJ0A 1FDNA 4J9LA 5E33A 3KDOA 2IC3A 3CIZA 3FBCA 4X64J 2M7SA 4MK7A 4GO7X 1FCAA 2XY6A 3P96A 4OLPA 1RTIA 4CLSA 3A3PB 2AHOB 3J7ZT 3QRRA 2VG5B 1RI7A 1XEZA 3GP9A 3D6HB 3IBCB 4WFXA 1B0PA 1FE0A 3MM8A 1VQNS 2MEWA 2OD4A 3FSYA 3ITWA 1IQTA 3WDOA 4F0KA 4I68A 2QA4S 3W9HA 1MWZA 3LQVA 3K89A 4ZVGA 1Y5IB 4B3OB 1WG4A 1EHWA 5AE2A 4RW4A 4TQSA 4QWEA 2RQMA 1SCJB 4TU7A 4Q8FA 3GILA 2N3OA 2RDDA 5A8WA 2YX4A 3LGMA 2AW0A 4F4ZA 1UP1A 5LOQA 4ILRA 2QA1A 2MJNA 2W9BA 1NK7A 1FEHA 2L3MA 3TU3B 1N8RT 1WDTA 4L74A 1MW7A 5HJXA 4DR7F 1JLCB 2UUTA 3JSBA 2UUWA 1D1UA 1F9FA 4WJBA 3ZTQA 3CDUA 1KBRA 1OY6A 5F8IA 7AT1B 5KFCA 4Y3CA 1JLBA 5DZ6A 3SZ2A 3DYAA 2DNPA 4JI7F 2UXDF 4Y34A 1CJVB 1DARA 3QRQA 2MJUA 5DG7A 1T8EA 1DTQA 1RU2A 2VG7B 2K1RB 3POTA 4IG0A 4OL8A 2OEJA 1LWFB 1D9AA 3V4MA 5GMKa 4FP9A 5LXRA 1Y5NB 4GKKJ 2R7VA 4UYKB 1CSJA 3UCUP 3IWNC 2DEJA 4RR5A 3GR0A 2CZVC 2Y1LB 1X5PA 4RU2A 3M32A 2KVIA 4M5GA 3M1VB 3TW0A 4K0KF 3DN9A 3BPSP 4MMOA 3RU0A 2ZBIA 2JVRA 5AOXB 1S10A 1RHKB 3G71S 1EETB 1I94F 4ZVSB 4ID5A 2X3DA 1WD6A 2BACA 4M63A 5KFOA 5E2QA 3CWJA 4JV0A 2JEGA 4PG5A 3HVWA 5CYQB 5KFNA 5CYMB 1R31A 4PPZA 1YVFA 1TK5A 3W5XA 2GIQA 2YWWA 2K3IA 1UVNA 2AV5A 3NMAA 3UDVA 2HAIA 4LRFA 2YKMB 5B0AA 3W3SA 5ITHA 3QIPA 3JXOA 3JSYA 2Y0BB 5LJ5Y 2CPXA 3D1QA 2NYIA 3CCVS 1D8YA 4KPYA 3DXBA 1RA7A 3SEOA 3U1MA 1UJ6A 2E44A 3DOMA 2HZAA 4ES3A 1SQFA 4RBUA 5FLXU 2XS7A 3KKFA 2HIYA 1HD0A 2QE5A 2Z4PA 4LF9F 3QRPA 1EKRA 1YKWA 2GVZA 3K58A 1H38A 2CDQA 2MMYA 5L39A 1M5SA 4YQWA 3BGUA 4ZPVR 2LP4A 5LJ3Y 1GXLA 5D0HA 1V9OA 3DDNA 1N36J 4JV1A 1LW2A 1BQXA 3JQJA 4CH1A 1VQ7S 4C97A 2NZCA 8ATCB 2ZZNA 3TVKA 1SKWA 5J2NB 1VS3A 4HTIA 3IG1A 2LLZA 2MQMA 1VBYA 2V8HA 2EFGA 4DR1J 5ETSA 2CPYA 4BBYA 2EFPA 5A8WB 3VALA 1Q8KA 1UJ4A 3BQ0A 3W7BA 1SKUB 2DH7A 2ZEJA 4LFAJ 4X66J 5DM6Q 1N0UA 2UVRA 3RG6A 4LF7F 3A8IA 4LFAF 3SMZA 3IRXA 2ZZMA 2KXNB 1ELOA 2RT3A 2HGLA 3ZNJ1
chains in the Genus database with same CATH topology
3EPGA 2VBXA 4YDDB 1UWBA 4XDDA 5SUHA 2I38A 2V4JA 2OJ3A 4LQ3A 5GADU 2IYIA 1D9DA 3DMJA 4DR4F 1S1TB 5EN1A 1SKRA 4CH7A 4LVNP 3MI7X 4MIWA 1S7HA 1FERA 3HXMA 4N47A 4URSA 3OVBA 4C11B 1UETA 2UVVA 1XK8A 2W24A 2DR5A 1VOMA 1X5OA 3N4WA 5CZVA 1S99A 4OI3A 5LSRA 1Q7LB 1EETA 1ZM2A 4QBUA 1R8HA 5L38A 5E7OB 4JI6F 5DLFA 2HS0A 1H98A 1M5VC 3OTDA 3SCJE 2HIQA 1Q86T 4XIUA 3E3XA 3JTPA 2JJ4D 4KV8B 5G0RB 2YY3A 5K8MA 4PR6A 3EZUA 2VFRA 3DRPA 5JVHQ 3ENWA 1TKTB 4RW7B 3IA0A 2OPSB 5ADZA 3P6YC 2CJBA 4RNFA 3D1HA 1C4AA 2OD6A 4X62F 2KRRA 4OZNA 1RT7B 1GT8A 4XK8C 4ZPTR 2KHCA 1KS2A 2BQ3A 3MECA 2E7XA 4FXVA 1JX4A 2R8HA 2E9TA 3TX8A 4MKBA 1NRKA 2R7QA 3BR9A 2J0QD 2M8DB 3ZZPA 1DRZA 5A8RA 2BQUA 2EFNA 4NYPA 5D3GA 2HMIB 1P1TA 3M8QB 4MFBB 3V6HA 3G9CA 4I6YA 2I5JA 3FSIA 2RQ4A 4PWDB 4HT5A 1WHXA 3HKZD 3W2VA 3KLEB 4NZ6A 5LT5A 1GAOA 1ZAXA 2EW9A 3HHNB 2K2PA 1N32F 4FN5A 3FFIA 5KFSA 3DRYA 4ZP6A 4I7FB 3MMBB 3CPWR 1Q82T 3OR1B 2GHPA 2V2KA 4I1TA 5DRKA 2R7XA 3PKMA 4I2QA 3OMSA 2Z2MA 1S1TA 4JV2A 3M2UA 2IFXA 3CDWA 4LIRA 1JWWA 3NS5A 1XN9A 3GFYA 2GHWA 3G71S 2AJ4A 2BYCA 2XWXA 3LGNA 4KB7A 2CQ0A 4CQ1A 4OX7A 2L08A 3W2WB 1YRTA 5J2NA 1BD6A 4B3SF 3NL0A 1HNIA 2BVZA 4N8NA 4IUFA 4WXOA 2QMXA 3PX4A 5KFYA 2A2CA 3UE2A 2XSFA 3LAMA 3DRRB 5CD4H 4EO6A 3Q23A 1K8AT 1YJWS 4F2SA 5B7WA 1FNMA 4GC7A 2FHJA 4N8OA 2W9BB 4RUAA 3BSCA 1YJ9S 3CDEA 3KLIA 4ZPDA 4NLDA 2GMHA 4TLQA 4WE1B 1VQPS 1S6OA 3S8SA 4DWIA 3DMJB 1FDAA 3QJJA 1U6BA 1U24A 3MFIA 3T9NA 3CJKA 4OQJA 1SB6A 2OMLA 3R1HA 2GC8A 2K1RA 3POTB 1S9EA 2FC9A 3K7RA 3MTJA 2B4PA 4K5SA 4LUBA 3HHLA 5H9FJ 1NJIT 4DSKA 2J5AA 4ALZA 3EGZA 3BO4A 2FDNA 2QA2A 3SCKE 1Y0HA 3BR8A 3KHGA 4NLGA 5BJRA 1KLMA 4HT7A 4HI1A 5JUMA 3GV5B 2P6TA 1K1QA 1HW8A 3M30A 3NCPA 4ETXA 4KV8A 5G0RA 4DL0C 1RTDB 1H2UX 2FHKA 1L3KA 3LWLA 1N5YB 4UUXA 3ZZTA 3OFEA 3IR7B 3PDNA 3ZZZA 4I7FA 2E9ZA 2GO9A 1VQ9S 4OV1A 2C42A 3QWUA 4R25A 4A8YA 3KG4A 2IMOA 1ZH5A 4XPEA 2DO0A 1RK8A 2IMWP 1ZAVA 3MECB 1HPZB 2CPJA 4JI8F 1Q8IA 1FRXA 3RYLA 1XMBA 3V2UC 4BHQA 1WF1A 4C98A 2R9LA 3CCWA 3D0IE 2OAUA 3DDKA 5F3TA 2DHAA 4U7CA 5A8RB 1R6YA 2CQIA 2HHVA 1RT6B 5A6WA 1LW2B 2HLUA 2P5VA 2HS3A 3I4HX 1FJ7A 3W2VB 3KLEA 3PW7A 2JVOA 5K8PA 2IRXA 4GZ3A 3DOLB 2HYIB 5KFLA 5HROB 3TVZA 1U1NA 2G1DA 4KKOB 2MGZA 4HHJA 4R5PB 2BA9A 3VAMA 4UY8T 3DOKA 5IFMA 1N48A 1VJWA 2CFXA 4EYHB 2ZVSA 1U1RA 4B9MA 3RB6A 3GWCA 2R2UA 2UUCF 3K0JA 4TU9A 1RYRA 1JKHB 1YWXA 2C2EA 3SK1A 1YGYA 1X4HA 2B56A 4A8QA 4P6QA 5KT6A 3QPIA 5DETA 1BY9A 4O4GA 2N4CA 2CYYA 2LDIA 3IR5B 4YDXA 5C25B 1IKXB 2ZNYA 2OFGX 2NS1B 3NGKA 2B0GA 3MURP 2G9OA 4RW6A 2W7OA 3GMGA 3L95X 2KG1A 1AW0A 2K7JA 2D74B 3EZ5A 3N9UC 4KFBB 1W25A 4DL6A 2YKNB 1FTCA 5A2QY 1QAJA 2OPPB 1SH3A 1NO8A 2MKJA 4OZ1A 3T5KA 2ZH1A 2W9CA 3IWXA 4DOZA 2VBYA 1J5OB 2HHXA 1FDDA 2QLXA 1N6QA 4C8ZA 2DRBA 2FJVA 2OLWA 1HWKA 2MQLA 3DRPB 1REVB 2YQ3A 1DQAA 3MWBA 2CQCA 2JRSA 1TVRB 2Q6CA 1ZTWA 2HVZA 5J1EA 4J9KA 1KTQA 2PDAA 5F3ZA 3HVRA 3I5AA 1U49A 1NJYA 2X1AA 3I55S 2RB7A 3QJLA 3KLFA 3H5UA 3M6WA 3MR2A 4Y0FA 4DV0F 1Q16B 3PO5A 1FVSA 3MM5B 1CG2A 1MMDA 3V81A 3MMJA 4C7QA 2IBOA 4D3GA 1S1XB 2LYVA 1TV6B 2MKSA 3Q0AA 2D1CA 2IM3A 2IVFB 5EX3A 3PEHA 4KKOA 5KFBA 1TL3B 3PNIA 4QW9A 2K3KA 1KR4A 5DG9A 2VONA 3HHLC 4DQPA 1V6HA 2PD1A 3NLCA 5CXTA 2KT3A 1LWEA 4A4JA 4F4WA 1H6KX 2OMOA 1VC6A 4E0DA 2HGNA 3OJUA 1SL2A 2VD3A 1FD8A 3DLEA 1U2RA 4QIVA 5HP1A 2CRLA 2W25A 4X4QA 1S76D 4DFJA 2RSFA 4FXDA 5F8MA 3TARA 1GX5A 2DH8A 2E29A 3NKYA 3OR2B 2VG5A 2KM8C 2N7YA 5B08A 4F25A 2B9XA 4NLVA 4ERDA 4PPDA 5G4DA 1QTMA 4KFBA 3QJPA 3CC4S 4B3OA 5KFGA 2IRUA 4QW8A 1T05A 2OPPA 4R5PA 1B0TA 2CKWA 1LFPA 4J9MA 1K1SA 5EWFA 3H2VE 4Y2KA 2ZHBA 3BB5A 4ELUA 4DBQA 3ICLA 3CD6S 1OWXA 3I96A 1VBZA 2ILZA 1VQSA 2UU9F 2EG1A 1G3OA 2HVIA 1HBMB 5F0UA 1C1CA 4QCLA 2CPZA 1D3WA 1NK0A 4GYYA 2NQPA 2VPYB 4P7TA 1J5EF 5AXNA 2UV8G 1S9EB 2N4DA 4WXWA 3M32B 5CCMA 3AJ1A 4HVZA 2X1BA 1IKYA 4K5RA 2ZHOA 3PO4A 4URQU 2UV8A 3S1TA 2NSCA 3MM5A 4YB7A 5BYQA 3CCUS 2RRAA 4F4KA 2VB6A 2DD8S 1FO1A 4LSLA 2PA3A 1VQKS 4DUYF 4WYWA 5J2MB 2CPFA 1DLOB 5HL7Q 1R7IA 1S9GA 4ED8A 1HWJA 2YNHB 1Q1KA 4A47A 4YP3A 1VQOS 2KI2A 5BYRA 1TUVA 3M6XA 4WFYA 3R27A 4F4YA 3SV4A 2XNQA 3KLFB 1JJ2R 2YKAA 1VQ8S 1JK9B 2X51A 1R8PA 4CNYA 2DT9A 2GQ2A 3CB4A 1R0AA 3KK1A 4JI3F 4IDKA 5LSOA 1BWEA 4H4OB 3GIKA 5CH7B 2F40A 2ZH2A 1TV6A 3VAKA 4OI2A 1T05B 2FLPA 2J7KA 1RT3B 2KU7A 3I5BA 3IG1B 3QO9B 1TL3A 2MHNA 1S6QB 5KFZA 4RUHA 4H4KA 3EPIA 3KTQA 1WG1A 5F8JA 1TR0A 4JUZA 5HQ8A 4U6PA 1JLFA 4F4XA 4JI1F 5CQGA 1QE1A 2XI2A 2FD2A 4TN2A 3SDEB 3D5MA 2V4JB 4A8MP 4IH7A 1GTEA 3WBZA 3OL6A 3AA9A 3BGLA 3ISZA 4ECVA 4AY6A 1HBOB 5B0GA 5HP1B 2O3DA 2LA6A 1WEYA 4MTPA 1DBDA 3SSSA 3C3LA 4FYDA 3A8EA 2DH9A 2AP6A 5I3PA 4FF2A 2DHXA 2LDYA 1XTZA 4I6AA 1RA6A 4YFUA 2CQGA 5A8KA 4OJHA 3IXQA 1T3NA 5F8NA 4WZMA 1Z4UA 2DCUB 4RW9A 2ACYA 4DFPA 1ZETA 1V3RA 1N88A 2KXHA 2IM2A 5IQQA 1Y7PA 2PIIA 1R8CA 1VQMS 3IGNA 2CVIA 4O44A 4BC9A 2V4QA 3GIMA 5K14B 4G3IA 2HHWA 2UVUA 3NBPB 4XI9A 1LK7A 2A10A 4IG3B 3UR3C 1HNXF 2SXLA 1F5CA 3E51A 1OIAA 3U27A 5J2MA 5K8NA 4ATNA 1AROP 4PG4A 1ZM4A 5KFXA 1TKTA 4USIA 1HA1A 4I0WA 3BN7A 3DCAA 1E8OA 4OFZA 1RT7A 2M3DA 5MLCV 2POKA 3FJ2A 3JSMB 2GMLA 3GSDA 1NJZA 4DF4A 1KRPA 4DQSA 1LW0B 3G6XA 1RDRA 1YQHA 4ECZA 1QSYA 2ZKTA 2FHOB 3HX9A 4ZP8A 3MUMP 1UVIA 3ONQA 4NLYA 5EX0A 4IR9A 4MKAA 3G8SA 4ECYA 1U7IA 2QSFA 4Q7AA 2CZ4A 3TQ1A 2HMIA 5JXSA 3ZZRA 2B6AB 5F8LA 2WAQD 2ZH7A 4A8WA 5J2PB 1F5AA 1RQ0A 2YNHA 4QPXA 4OHVA 4PQUB 3MEDB 3KWMA 5KFUA 2B9YA 4ZCLA 3MMBA 6FDRA 1X4CA 5KFEA 2NPIA 2L9NA 4JI2F 2LQ9A 2VG6B 3NS6A 5CA5A 3BM7A 4KE5A 4ES1A 4FF4A 3T19A 4ZLPA 3PHEA 5LXYA 1X4RA 3M2UB 4Y00A 4RNOA 2XWYA 2X1FA 2MZQA 2V8VA 3BSOA 1TFYA 3SFGA 2ATLA 2UUBF 4RW9B 3M2VB 2FJWA 1QMOE 3CCRS 2VA2A 5KFMA 2NXUA 2YWKA 1VRUA 1XNRF 3MR6A 2RRNA 4Y2IA 4DR1F 2AU0A 2XLKA 2JC1A 4URGA 2RU9A 4NLXA 4KO0B 1X8DA 4CIOA 2XCPA 5K5MA 2J9CA 3KLIB 2KXFA 2A18A 4B3TF 4J5OA 1KSPA 1UKUA 4NLUA 5DGAA 3M8RA 3LANA 5KFWA 2JSXA 3U1NA 4N41A 3KHRA 2VPXB 1IJFB 3HP6A 1E8OB 1QUVA 4IG0B 2ZHAA 1WTBA 1IBMF 3DM2B 2HNYA 4JOUA 1Y00A 2HQ3A 1FRLA 3PE3A 1D8ZA 2KG0A 2AGPA 3AA8A 2DTJA 1O8BA 1YTYA 1LOUA 5M2RA 1UA0A 3V6JA 4H4KC 5KFHA 1HBUB 2YKQA 5FDLA 5KFIA 4AXJA 1QVGR 4RWWA 1LK5A 1UMJA 2QYCA 1S1VA 2LU1A 2F8EX 5A6PA 4LSNB 3H8YA 3ULHA 2J6UA 2NUUG 3DGPA 2VKZG 2CQ1A 1BGXT 4K4VA 1WELA 1PSDA 1SL0A 3KLGA 2AYBA 2WK4A 2DIUA 1Y4ZB 2M70A 3CCTA 4YB6A 2KO1A 2YNIB 3VZHA 1RGVA 3H2UB 5T7LA 5HN0A 2IYGA 1H2TZ 4KGMA 1HI0P 2AYMA 3AJ2A 4GZ5A 3CC7S 2C22A 3UDLA 1N0VC 5KG6A 4QYZJ 4ECUA 3ENVA 2DVIA 1SJFA 3LP0A 4TY8A 1FXLA 2XSJB 3F73A 3L3CA 1LV5A 1X4DA 3GYXB 2FJDB 1I1GA 1RTJA 3MEGB 1NJWA 1RT6A 4N76A 4AL6A 1NNDA 2GJIA 4FS1A 3HKWA 2E7WA 1WG5A 2QT7A 3LUYA 2RH3A 3KNAA 5GVQA 2MDAA 2JWNA 4IO1A 2GHVC 1N5SA 3C2PA 1UJRA 4Q8EA 4ZS6A 5L9NA 5I3UB 4RUCA 7FDRA 2ROGA 1QE1B 3PY8A 3MM9B 3V5RA 2MZ1A 2J9DE 1V3ZA 3D0GE 2MKIA 4A48A 4O0IA 3KMQA 2YWEA 1NAQA 5C25A 4C11A 3VAJA 3O6QA 1WEZA 3O2IA 1T3OA 2BUNA 2WSCC 2XBPA 1DTTA 2JLFA 3TA2A 4CZCA 4A8KA 1HD1A 2KTQA 3UWTA 2ZDOA 3O1LA 4RZRA 3I4PA 4NLQA 1UVJA 4Y2MA 2MKKA 2IA6A 2PO4A 3CMES 4GYWA 2J6SA 3O44A 2KT5A 2YKNA 5DO2A 2E1MC 3R5AA 1Q4RA 2WOMB 3BSNA 5K14A 2BW2A 2XMWA 1L3SA 1KLNA 5FLXY 4IG3A 3CD7A 4LFCF 3SQGB 1YRXA 3Q2SC 2V8DA 2RDJA 5JVGQ 1I6JA 2KB2A 2B43A 4Y2AA 1ZM3A 4NL5A 5D4NA 3PV8A 2ASYA 1GXUA 5D4LA 1CVJA 3OSPA 1V3SA 1HBUA 3JSMA 2I0XA 2IHR1 3BF4A 5JJBA