1JNRB

Structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenylylsulfate reductase
publication title Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 21
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature ec 1.8.99.2: Adenylyl-sulfate reductase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF12139 APS-reductase_C Adenosine-5'-phosphosulfate reductase beta subunit
B PF12800 Fer4_4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jnrB01
3.30.720.40 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 1jnrB02
2C3UA 1FDNA 3OR2A 5E7OB 4OMFG 2C3MA 2XSJA 3PNIA 4DHVA 1G3OA 1FTCA 1FD2A 1FDAA 3GYXB 2FJDB 1SIWB 3C8YA 5BYSA 1FF2A 2ZVSA 1FRJA 2VPYB 1FRXA 1Q16B 2Z8QA 1F2GA 5FD1A 1KQGB 3EXYA 6FDRA 1BD6A 1AXQA 1FRLA 1H7WA 2C3OA 2WSCC 3LW5C 2FDNA 1FXRA 2PA8D 5CH7B 3HKZD 7FDRA 3MM9A 1FCAA 3OR1A 3MMAB 3OR2B 1WTFA 2GMJA 5BYQA 3MM6A 1FERA 5CHCB 1FRIA 2GMHA 3IR7B 3IR6B 1B0TA 1F5BA 3MM8A 4XK8C 1RGVA 1H0HB 1Y5NB 3MMCA 1KEKA 1Y4ZB 1DFDA 1BQXA 1DAXA 3IR5B 1C4CA 1PC5A 4Y28C 2FD2A 1BLUA 2VPZB 1CLFA 2VPWB 1XERA 1B0PA 2VKRA 3MM5A 2UZAA 1K0TA 1Y5IB 1H7XA 5L8RC 1R27B 3EGWB 1FDBA 1GTHA 3MM7A 3OR1B 2V4JA 3MMBA 1FRKA 1F5CA 1FXDA 1Y5LB 2WSFC 1FRMA 2WB1D 4OV1A 1G6BA 1KQFB 4YDDB 4XDDA 2FJEB 2XSJB 3MM8B 4KT0C 6FD1A 2C3YA 5BYRA 2WAQD 4ID8A 4L6V3 1D3WA 1IR0A 1JNZB 1HFEL 4CI0B 1FRHA 2PDAA 1B0VA 2FJAB 2Y0SD 2C42A 3MM9B 2V4JB 3MMAA 3MMBB 2C3PA 1H98A 1SIZA 1SJ1A 1VJWA 2IVFB 1BC6A 3MM6B 2WSEC 4AYBD 4XDCA 2FJBB 1JB0C 1BWEA 1ROFA 3MMCB 1FEHA 1FDDA 2V2KA 2PMZD 1IQZA 1JNRB 1GAOA 3EUNA 1GTEA 1GT8A 2VPXB 3MM5B 1PC4A 1A6LA 7FD1A 2O01C 1DURA 1C4AA 3MM7B 4RKUC 2FGOA
chains in the Genus database with same CATH superfamily
1R8BA 5BJRA 3HLUA 1V3SA 4WIQA 4R8UB 4LRBA 3V4IA 2ASYA 4GZ5A 2D3OR 4PG4A 2KU7A 3C8YA 4KE5A 3MFIA 2H3EB 2IJFA 4DQPA 2Q43A 4A46A 3PR4A 3BSAA 4RBVA 3CD5A 2R8HA 4P2MA 4Q0BB 1LFWA 2OPRB 2NQPA 3GMGA 4CP5A 2FC9A 3AJDA 3M6VA 1Q95G 1FVSA 4IFYB 1F6TA 3SQOP 2IRXA 2RRAA 2HLUA 3HSGA 1SJ3P 1NSPA 1VIXA 2V68A 4C4WA 3ZTOA 3C16A 2KT5A 1RYSA 2G1HA 1AROP 4KC5A 1PJ7A 1BGXT 1KBRA 4DQRA 5DG7A 5J1EA 2CZVC 1T03B 2AZ1A 4ILMA 1TL5A 2QX0A 1MWZA 3DRPB 2RF2A 3H0PA 2KG0A 1B4SA 2VC1A 1NDKA 4DV3J 5E2QA 2XCPA 2VQEJ 1M1HA 1EQMA 2VBWA 1D8YA 1YLXA 1W2IA 1YVFA 2FLOA 3IGVA 2VZ9A 2POKA 5BR8F 2HQGA 3BBFA 1F5BA 1SKSA 1X4GA 3LGHA 5J2PA 1Y4ZB 3EVMA 3CC4S 2V0NA 5KFWA 5I42B 3EICA 3D3BJ 4UYJA 2BJ3A 3HSDA 3NMAA 3M9NB 1B70B 1IJEB 3MFHA 2DGVA 3FSYA 3CPWR 2RDJA 5GADU 1LV5A 1B7YB 4WZQA 4ZLJA 3ZZZA 3H5SA 3IGNA 4OZ5A 1MMLA 2ZBQA 1LW0B 3WC2A 4UOHA 1NSQA 2MY8A 1IBKJ 4O3SA 2IFXA 1VGYA 4USMA 4YHHF 2UV8A 3FEZA 4DV1J 2W9AA 1RTHA 4DBQA 1CS4A 1Y0HA 4WU2A 2CNOB 2B4UA 1LXJA 4LMZA 5T7LB 2HGMA 1Y9OA 1UPMB 1TL1A 1GMUA 3CUNA 4TU7A 4ITSA 1U6BA 4WYWA 4IRKA 1SJFA 4CO2A 2BACA 1DAXA 3OL9A 4JI3F 1S4FA 1W7WA 2Q1LA 2UZAA 3BZQA 3EMTA 4L73A 2DNLA 2ADBA 2V8DA 2B8PA 1RA6A 1U2RA 2WB1D 4ECQA 4K5RA 1U0HB 1FE0A 2ALYB 1N0UA 2R8JA 1NM2A 5F8LA 3PO4A 4RO0A 4QU6A 3CE8A 5A76A 2G2OA 2NXUA 1JLAB 1KS2A 4EO8A 3M1VB 3V3LA 4IO9Q 1N34F 4RW4A 4KFBB 2R8KA 1VIOA 4EMDA 2Y1IA 2MKIA 1ZM3A 2HHXA 4DL7A 2FHJA 1P8GA 4J90A 2J0WA 5C25B 3Q23A 1QVGR 1X4RA 2H48B 2BRLA 1WC5A 2ZZTA 3RRGA 1IBMJ 3CJQA 1NDCA 3EXYA 2I5JB 3MR6A 1HNVB 3CCZA 2W9CB 4JI8J 2XC9A 4FVCA 3HKWA 4X2BA 1SJQA 3HZEA 1ZTWA 2OSRA 5CYMB 2VPWB 3EGWB 1R8HA 1P9YA 2XY5A 1XR5A 2K4NA 2AJ4A 3AB4B 3OL8A 4IG0B 2XHCA 1G6BA 9RUBA 3V6DA 4IDKB 3DOLB 4B9MA 4P2SA 4PZVA 2KM8C 3PJWA 4JUZA 4FF1A 3POTB 4GYYA 5KFKA 3UR0A 4F3OA 4G3IA 1HBUB 1S12A 1NB7A 3C6UA 1HW9A 3EZ5A 1V5VA 4OYBA 2XMJA 2KRBA 2VHGA 4DPTA 4LF4F 3U7JA 1JLCA 2HNDB 5KFXA 3L95X 4X65F 5AT1B 3GR0A 2PC6A 1S9FA 4ED2A 4USTA 2AWZA 2M3DA 2B56A 4LR7A 1WHXA 2QLWA 2HFUA 2BM1A 1IKXB 4XIFA 4P72A 5C42B 2JHEA 1S72S 2DBBA 1YSJA 1WJ9A 3OXLA 1DLOA 3QPIA 4WE1A 3ZFVA 3QFHA 2RD5C 1FVQA 2ZH1A 3ILJA 3LP0B 2E44A 3W61A 1W25A 2F8EX 1FRMA 2DCUB 1OIAA 5HQMA 1CJKB 3CTRA 4KAIA 4U7UD 2X7IA 2K1RB 4U67Q 1RWKB 4QR0A 4RBUA 3N6LA 2CJAA 2MLXA 2MKSA 4X64F 3D68A 1QTNB 2DR9A 1NK5A 2XB2D 2NZ4A 2RU9A 2V50A 4K8RA 3J7A1 1VQ5S 4F4ZA 3I96A 3AJ1A 2L08A 4UZBA 3IMQJ 3ISZA 4GO7X 5HBMA 2ZD1A 3B6BA 1DRZA 1UVMA 1C1BB 5KTQA 1VMBA 3H2LA 3I9V9 2U1AA 4PUOA 1I3OB 1NHVA 2HK2A 1ZH5A 1DTQB 1B0TA 2VFVA 2CQ0A 5E3CA 3TO8A 4ZHRB 1CLFA 3QRRA 3FZ2A 4CO5A 3HT0A 1X31C 3VVTA 3QT8A 2XZWA 3BV8A 1XMQF 4EI2A 3CMES 4L6V3 4WFNQ 1XJWB 2DPIA 2D9PA 1EAYC 2UVWA 3OTCA 4DR1J 2GW8A 2DVIA 3QT7A 1N0VC 2IA0A 1SUQA 5KFHA 2P6TA 1SC4B 3JSBA 1WORA 4NLSA 2CIMA 3QQCD 4RWXA 2XO6A 2CDRB 1V6HA 1NH8A 4FXWA 1CJUA 2VH7A 1IN0A 5KFEA 4PYDA 4K5SA 1FJGF 4MKVA 5IT9Y 2XG8A 4URGA 4B3TF 4X4OA 2FJDB 4TLRA 1FF2A 1E8OA 2QL9B 4RUHA 2ZZMA 2YKOA 4ZA1A 1HKAA 4IOBA 4HI1A 3W9IA 1JWWA 5CYQB 4OI2A 4M5MA 2F9JA 3ET6B 2G4BA 5KG0A 1HYSA 2V94A 4Y28C 1VYAA 1HMVB 3AQOA 2KZZA 4DPWA 2N7CA 3K8VA 3AOAA 1RAFB 2UXDJ 1G7CB 2IRUA 2J7KA 1OO0B 4CRJA 2E29A 2MXYA 3CIMA 8RUCA 4DR3F 1H72C 1JXEA 3IG1A 3KOAA 3LUYA 5LT5A 2XLIA 3GCXP 4ECVA 1S1WA 2KXNB 5AJ3F 5ETOA 4DG1A 5A8WB 1VR6A 2P9EA 2RDIA 5HO4A 5KG6A 4I4BA 1PYOB 4WCEQ 2XS2A 4O4GA 4PWDB 6FDRA 2C3OA 1K44A 4C0HA 2LA4A 1S9GB 4NCBA 2RKIA 4KGMA 2ADCA 4F4WA 3WHIA 5IM0B 3G6YA 4RUCA 1ELOA 3MI7X 4LF5J 2UUBF 4JI4F 2QC3A 3RU0A 2UUWA 4F7VA 4WFZA 2CPFA 3V6KA 1T9XA 2V4RA 4OZ0A 4NPOA 3TI0A 4CT8A 2HBZB 5KFUA 3KK1B 3D5MA 1N5VA 3KLGA 4PRFA 3RB3A 2C2DA 2L3MA 4N76A 2LEAA 2FYXA 4QW8A 3W7BA 1WWHA 3NBPB 4N47A 2IY5B 2UXCJ 3MAQA 3T9ZA 5BXIA 4DLGA 1KVKA 4O3RA 5KFSA 3AD9C 1ZZFA 5FIIA 1O8BA 2XZTB 5IWAJ 3JXOA 1WC4A 3KKFA 2CJKA 3GJTB 3I0SA 3MECA 5E3QA 1NLKL 3DRYA 2ZWPA 2VQFF 4JOUA 2YNIB 1UZHA 3GZ7A 1QSYA 3ELHA 1WSVA 3TJ8A 1U02A 4NI2A 1IBCB 3K5LA 2GMHA 3NAHA 4OJGA 2A0FB 1MU2A 1YJ9S 3NWRA 3ILOA 4B08A 4FYWB 2EI5A 5HJXA 4KRWA 1S7HA 3A4TA 2WVDA 4DL2A 3I5AA 4A8MP 4AUKA 2ZM6F 4H4KC 4KT0C 2CQHA 3JTNA 3ZZPA 3B54A 1KOOA 4ID8A 5ETMA 2BQRA 3PX4A 1UJ6A 2GX8A 3VAKA 1WI8A 3WQPA 1N6QB 3D9BA 3I56S 3TUZC 3PG9A 4LSZB 1NPKA 1R89A 3PO5A 4LRFA 2WSEC 1KKHA 2AYBA 2A10A 1M5VC 2GVDA 4UUWA 1PAEX 4CCHA 1B99A 1S10A 2F8MA 1KFDA 1REVB 2I9SA 3IS9A 2V8PA 5ETLA 4KPYA 3B8HA 4MH8A 4JYAJ 3EJMA 4L3KA 2GVZB 1RSCA 4OYZA 2HFNA 1ZA1B 4KO0B 2W8LA 4LF6F 5HLFA 3P45B 1NNDA 3I6PA 2G0CA 2Q6BA 4WTYA 2NXCA 1ZM2A 1NJZA 3FGVA 4B9SA 1ACMB 2LU2A 2IC3B 2BJ7A 3UI3A 2XMKA 1TUVA 4UY8T 2JH3A 4R8UA 4I2QB 5KFIA 5CABA 2XNRA 3EDRB 4E0DA 1WG5A 3J7Z5 1RHRB 3QGHA 2CDQA 4M1KA 1VJWA 4PR6A 2IYGA 4PG7A 5K8OA 3TEGA 3IBWA 3GIMA 1UTAA 4X62F 2FY1A 2YTCA 3D6HB 2UP1A 4NLWA 3VCDA 5D3GB 2CUYA 5IFMA 2E9ZA 4J9OA 3VAMA 1KLNA 2M88A 3P6YC 3TA1A 2ASJA 2OI2A 3PW7A 2YKMA 1KC8T 1RQ0A 2WTFA 2ZH5A 1N36J 2ILYA 1T03A 1BXNA 4X4NA 1UEKA 3G8TA 3DRPA 2DR5A 2ZC3A 2V2ZA 1EZZB 3IRWP 3MEGA 3FQKA 3PM9A 1FEEA 1GMWA 1XK8A 2EFPA 4LRCA 3GU0A 3M8RA 3WBZA 2FVCA 2BKOA 5IT9U 3SI8A 4ZDNA 1I94F 3RAQA 5E41A 4RW8B 2C42A 1DHMA 4DV6J 4IG3B 4HLBA 2QFIA 1K8AT 3IAS9 4ZVRB 1WI6A 5I4MA 2CA9A 3A8KA 5I42A 4I0WA 2I2YA 4ETZA 2ZOGA 5F8GA 4X4PA 1URNA 3QWPA 5IV3A 4GC7A 1ULRA 2G1DA 2VUGA 3W8GA 1RWMB 1T11A 1L3KA 2YWFA 1PJ5A 3WDOA 2MZTA 5D0EA 4P9SA 4HH1A 5D8HB 1FJCA 3D4JA 3KJVB 1S4EA 1LW0A 4RPFA 3MTKA 2MQ8A 1VQYA 1HQ2A 1YJTA 2X5TA 1AA1B 5KFAA 4PQAA 3NXZA 3UE2A 4ED3A 3MDFA 2VA3A 2NXEA 3QIDA 4ZVPB 2H4WB 3ZXWA 2KHCA 5T7LA 1S48A 4JI6F 4RUBA 1LWCB 4C0OC 3KHHA 4ES3A 4HACB 1GX5A 1FHTA 4DV4J 2HZAA 1VCTA 3EE3A 1U49A 1U7LA 1JLFB 2MZRA 4O0IA 1T3OA 5F9LA 1HW8A 1ZETA 4NLYA 2E1RA 3I9ZA 2E1AA 2VG7B 5SZTA 2E5GA 2MTLA 1C2PA 3GE9A 4OMFG 1BMQB 2BYCA 1YGYA 3PJ9A 2HQDA 1IR2A 5HSPA 2N4DA 2XEXA 2EC0A 1U0HA 1HR0J 4B9NA 3RYLA 3M05A 3HCXA 3BQ1A 4Z37A 5DM6Q 3BH7B 1G4CA 1FRIA 2BE9B 1JLAA 1FWLA 5KOWA 3HHLB 3FC9A 5KFMA 2GO9A 1QUPA 4KFBA 4BHQA 3CWJA 1XERA 5HP1B 2ZH7A 1S6QB 2X3GA 1HWJA 2ZEJA 2H54B 1V3RA 4XDDA 3DLJA 1HQUB 5DQHA 5BYRA 4DCPB 1VQ8S 1SJRA 3PE3A 4DI6A 3IBCB 4K4ZA 4Y2KA 2KT3A 1U1OA 1XNRF 1HNVA 1Q0NA 3CVKA 2FLPA 2G0IA 5KG3A 1SJ1A 4M5DA 1UJ5A 2PMHA 1ROFA 2XWYA 2LQ9A 4F4XA 2CWKA 1NSKL 4F4KA 2GIRA 4DL3A 1FJEB 3MM7B 4WWSA 4IG0A 2W7PA 1T8EA 2LEPA 4FYXB 4YB1P 4X65J 2VBXA 4IDKA 3ENQA 1IXKA 4CT9A 4AE5A 1UW4A 3TAQA 2FVSA 4C3KA 5HANA 2EFVA 4LFCJ 1AXQA 2V8GA 3T1HF 3OL7A 4NL5A 3POTA 1AZSB 2DNYA 2JVRA 2GMJA 5BYQA 3CCVS 4F04B 3M8QB 4DV5F 3MCOA 1W26A 4DCOB 1VQOS 2R2UA 3AD7C 1T9TA 1VOMA 2KFYA 5KFQA 2KB2A 3SSRA 1QAJA 2C2OB 1WD6A 3SFGA 2MMYA 1XMBA 3OFFA 3HF5A 1X0PA 2M70A 3OLBA 3GIIA 3OQ2A 2BJ9A 1XTZA 4IKAA 1S5ZA 4ZPWR 3CJKA 4NWBA 3ZZYA 3C66A 4B3MF 1S76D 2ZJQQ 3LAMA 3K0JA 1B0VA 3OHBA 2ZKTA 3CO0P 2ZH9A 1L3VA 4O23A 4X4VA 3TA0A 4MIAA 2QMXA 1OY8A 2EW9A 3GJRB 4HVZA 4ILLA 1YBAA 2J76E 3WIVA 4MIWA 5IT0A 1QY7A 1UVJA 1RBOB 3IM9A 1RT1B 1CPZA 4DQQA 4BC9A 1HHQA 3AT1B 2C2KB 2UU9F 2CNKB 1HBNB 4I6AA 1FK9B 2K1RA 4I69A 5KFZA 2VOOA 3UNGC 3CCUS 3QAUA 1HBMA 4ICLA 4Q2MA 4DJBA 4P2FA 2BDPA 3CCJS 1RT6B 2B4PA 2HIQA 2HZVA 2E5LF 1SV5A 4XO0A 5HJYA 2RUGA 1X60A 1FDBA 1ZAXA 2BRKA 3A8IA 4ERDA 4K4UA 3VAFA 3EXCX 2DK6A 2XSJB 3MUTP 3J80Y 2FHJD 1YJWS 2DNRA 2R7UA 3T1AA 4DSLA 3BGRA 2QYGA 1S0OA 1KOHA 1NKEA 2DNZA 1VQ7S 1TL7B 1HBOB 3H5YA 1EB0A 3MM6B 1DTQA 2X1BA 1WC6A 1RHKB 5AE2A 3QATA 1N5TA 3DDNA 2HPUA 1NDLA 1UA0A 4OLOA 3AA8A 2IDEA 1QVFR 1ZPVA 4TQRA 3CF5Q 3VGTA 2ILZA 2DNGA 3HPOA 2BZ2A 4ZIVA 3H2UB 4XAKA 2GGPB 4TYAA 3AXMA 2WSCC 2BW2A 4V1Ak 2AQ4A 3OR1A 4G1QB 5DGAA 4DQSA 3TVYA 3V6HA 2J6SA 3DGPB 3JSMB 3W1YC 4OYWA 1F5AA 1S1TA 1AFJA 1ZAWA 1N56A 5HROB 4N5SA 2CPDA 2X1GA 2DPJA 2DGSA 5KAKA 3R27A 3HSZA 5I3PA 4FVMA 4F0HA 3AQPA 4NLRA 2O1PA 2WVFA 2H65B 2F1FA 3RBEA 2V4QA 5KFLA 2KO1A 2B6AB 4OX6A 3ET6A 3MMCB 3P4UB 2Y8YA 2LXFA 1HMVA 2AYGA 3NGRA 2FJXA 5THWA 2DD8S 3KNAA 2O01C 1DBDA 2L9DA 3RBDA 2CXEA 3TVKA 1HNIB 4JV5F 1Q4RA 1SPBP 2DRDA 4OI6A 3F44A 1RT5B 4X4SA 3QO9B 3PX0A 1RTJB 5K14B 1URRA 1TL4A 2GS8A 5D4LA 2I6WA 2L48A 3Q8UA 2ZBPA 1TV6A 2WK4A 2CWXA 1EETB 1CC7A 3IA0A 1BWVA 3KLEB 2J6TA 1X5OA 3Q24A 3KDOA 1C4CA 2RSQA 1HARA 2L41A 4NMLA 3U1MA 5A8WA 1YZ6A 2I38A 5GMKa 2VKRA 1K0TA 4JI4J 2NXJA 1VRUA 1Y00A 2FPHX 3VAHA 4GVBA 3PKMA 4DMZA 1FFGB 2C3YA 4NLQA 2DGOA 3WZ0A 5A0YB 3OPKA 4OYAA 5DS7A 3VGUA 3W5YA 1R3NA 5C7PA 2W9JA 4K0KJ 3GG1A 4H54A 4TVAB 3UDCA 3UO0A 4TYBA 1S9GA 2CQDA 2CPIA 2GAHC 4CLZA 1GMVA 4D3HA 3FVYA 3R1HA 3PW2A 2J9CA 3B82A 2R7WA 3OUYB 4N7TA 4OYIA 3H42A 3T1YJ 2YY3A 2G2YA 2ZH2A 4USWA 2GQ2A 3KHGA 3RBXA 2EBEA 3MAHA 4ZN1A 5F0UA 4TY8B 3KK1A 3BKFA 1FRJA 3NOGA 4DR2F 4KHPJ 2VQFJ 2E1PA 2D3O1 4CO0A 4Y65A 3RRKA 1VLOA 5B0DA 3NBPA 2DHAA 1CBKA 1VRTB 4AXJA 3BO2A 1NK9A 3ISND 3QRPA 4DFKA 3J81Y 2G2ZA 3R2DJ 3DOKB 1VC6A 1RKIA 3R5AA 3ZTQA 3EGZA 1GTHA 4AL7A 2MY7A 1X4FA 2XTJP 5C2CA 2ZM6J 3AODA 4IRDA 4QCLA 2KYXA 4QBUA 5HQ8A 3BGLA 3D28A 3ZZUA 4J9LA 3KNGA 4IRCA 3LO3A 2OD4A 2YNIA 2VA2A 4YDXA 4B3RF 1QJHA 3GPAA 1TK5A 1JMTA 1F0XA 4QJVA 2WVCA 2FTRA 2HVHA 1FDDA 3LP1A 3C16B 4Z2XA 2EVZA 1VQ4S 4ED1A 4JI0J 2DNHA 3PW0A 2DEJA 3HI9A 1GXLA 3DC2A 4CTAA 1SH3A 2QV6A 2PE8A 5I3QA 2RF2B 2X1FA 3J7ZT 4KH1B 4MAKA 1FRLA 1IKVA 2KJVA 2KXHA 2YX1A 4C6AA 4LF6J 1RT2B 3EVOA 1VISA 4ZIWA 3ULHA 2PI5A 3ZTRA 4ZJLA 2RAQA 3W2VB 2AEMA 1BQXA 4GVLA 1J2VA 4RU9A 2GAGC 4E8UA 4KJIA 2DYAA 3PYGA 3QIPB 1YJRA 2YQ0A 1S0MA 4NLPA 4O4RA 4KR0B 5HVFA 5B0CA 5DDRC 3UN2A 2GVZA 1IQTA 1FWKA 1RE1B 1Q8BA 4KO0A 2OPSB 2HHUA 2KHDA 4DV3F 4DUTA 1VLYA 1OS5A 4GKJJ 2LLZA 5LOQA 3T6JA 3CEDA 5F8HA 2ZOMA 3U02A 1GX6A 3VV2B 1HHSA 2E5IA 2V9WA 2RHQB 1RU2A 3M2UB 3U1LA 3JTPA 3JSYA 2W4PA 3PNIA 5KFFA 4F0KA 1DQAA 2HNZA 2N3OA 3R5CA 3BN7A 3OJSA 2AJQA 1RTHB 5CH7B 3L9ZA 2YQ1A 3N5BA 2HK3A 2XMWA 1JLEB 2CJYB 2JEGA 2XMVA 3NS6A 4ZJQA 1IJFB 1FKAF 3BYPA 3FNNA 1TKZB 5J2MB 4M5JA 2DRBA 4L76A 2Y9HA 2YXLA 4EZ9A 3T5JA 3NCQA 1T94A 2CNNB 4KTQA 5D3GA 1Y10A 5G0RA 2VG5A 1IBKF 4O3PA 1I94J 3BGUA 3UPFA 3PCOB 4DV1F 3R9LA 3TZXA 1G2EA 3AD8C 2YH1A 2IIHA 4Z7YA 1VHIA 4J9MA 1EHWA 2V5HG 2W4DA 2M8DB 1Q7LB 1LNQA 1EP4B 3FZBA 4JI5F 2VDIA 5E7OB 3NL0A 1S6PA 2FVPA 1LW2B 3O44A 1RAIB 1XQIA 2Z57B 4J7CA 3K58A 3PTWA 3FBEA 4WJBA 4RW4B 1T0TV 4RW8A 1U6FA 1UFLA 4MKAA 4M94A 1Y3KA 3QFWA 1U09A 3CB4A 1PBAA 2BJ1A 3M32B 4ED0A 5GADI 2QA2A 2ZE2A 4C7QA 3HP6A 1TVRA 1F9FA 1PAUB 4TQSA 4A48A 4OL8A 2KZMA 5C2GA 3QSYB 2E1CA 2XMTA 2BJ8A 4IO1A 4B02A 2NLWA 3DRRA 5M2UA 5IXUA 4AL6A 2CQ1A 2W2QP 3BGOP 2DHSA 4DXLA 3KJVA 3UDVA 3SIPB 1SJ4P 5DDOC 2MHNA 3V6DB 3TOQA 1EKRA 3F56A 2UUAF 1S79A 1IBMF 2AJ2A 2KG1A 4BWMA 3MZIA 2DXFA 4CLFA 4JI8F 2FB0A 3OVSA 4LRDA 3HD1A 2W8KA 1F1BB 2RB7A 4WYLA 1A0OB 1LWEB 2WONA 5F41A 2GIQA 4DF8A 5BYSA 3NS5A 3IBFB 4ZVGA 2QGFB 1EJ7L 1FTRA 1I6JA 1LWCA 1JLCB 2HQ3A 1NJXA 4HACA 4JI2J 2N7YA 2QT7A 3GIKA 3W64A 2EFOA 1RWUA 1S59A 4A47A 3N01A 2J8AA 5HL7Q 4LRAA 2DITA 2V4JA 4WFAQ 2DNMA 1X4DA 2B9EA 1DY3A 4G65A 3OL6A 2P6SA 1XNRJ 2ROPA 3HULA 1V5IB 4WE1B 1F3FA 1XR6A 1IUJA 2VC0A 3UWTA 1WF0A 4YP3A 2U2FA 1C0TB 1HWUA 4NZ7A 4AYBD 2LECA 3IM8A 3RB4A 3HHLA 2LP4A 4Q45A 1OPZA 3H2VE 1JIHA 2E66A 1PC4A 3CD7A 5HP1A 2AIRB 3LA0A 2BEFA 1S6QA 1S6UA 1WEXA 3T5KA 4FS1A 3HM9A 4J9KA 3A8EA 1NSAA 4LF9J 1PO6A 5LJ3Y 3M9MB 2KM8B 2GFFA 2BQUA 1FXRA 2D69A 1PSDA 2I0XA 1AW0A 2L9WA 3JYTA 2J7WA 5KT5A 2LQ5A 3V2UC 5HBMB 4X4UA 2ZD1B 2BOAA 2J6UA 2QG9B 1RADB 4RL1A 2FHKA 3CJ4A 4WFBQ 4UYKB 1H7XA 3MM7A 2QRRA 2VG6B 1CJVB 1TMMA 3RB0A 3MEEA 2W2PP 2R8GA 2BE2B 6FD1A 4J37A 4GKKJ 4CM2A 5CZXA 4UT4A 2XMMA 4CDIA 4WTOB 3W9HA 4B3MJ 1RWVB 1T9WA 4P7TA 1AZSA 2HWIA 4PYAA 6AT1B 4AT1B 1AT1B 4OI1A 1QDUB 3UCUP 4ZCLA 1M5PC 2HBYB 3W62A 2WBRA 4NLDA 3PW4A 3KLIB 1RWXB 3S8SA 4N8OA 2HHPA 3M6UA 2AJ0A 2IA6A 2VV5A 3TQ1A 1NDPA 3MF5A 3TZWA 1WG4A 2V69A 3DGVA 4J9SA 5AXLA 3NNHA 3GG0A 4B3OA 1RLDA 2HMIB 1P27B 4I7FB 3DDKA 2C2NA 4DS5A 1Q5VA 3BBBA 2W01A 3DI6B 1MSWD 2E5LJ 3JQJA 1RWOB 4DR1F 1RT1A 4NLTA 3MR2A 2UXBJ 2V63A 4BLGA 2YX4A 5K8MA 2HFSA 3MTJA 4A8XA 4ZPVR 1QE1B 1HI8A 3NLCA 1ZM4A 1FK9A 4GC6A 2JC1A 3CJSA 4DCJB 4PPZA 2HLTA 1SVDA 4NZ0A 3SMZA 1AUSL 1R8PA 2DCLA 2BUNA 2QA1A 2QTWA 5B0BA 1RT6A 3H59A 5MAOA 4DU7A 3ZTPA 1R43A 1FEHA 3MOJB 2XNQA 4AY6A 3O1LA 3C19A 5T41A 4QWAA 3R7SB 3IG1B 2ZBIA 3TP2A 1D9FA 3GLJA 2E5HA 3PYDA 4DR5F 2XSJA 4UOCA 3Q22A 1JX4A 5F8NA 1S1WB 4RNMA 4UW2A 4DG1B 4ZPBA 1Q8IA 1RA7A 3IRXA 3W3SA 4E98A 4DL6A 1HBOA 4FF4A 3MM6A 4WK3A 2CZ4A 4DR7J 3O6QA 4WXWA 2RQCA 2HHTA 2FC8A 2CPHA 2V2VA 3TUPA 4F3QA 2HRUA 2P5VA 4ZPAA 2V34A 2A90A 2WSFC 2HHQA 2JVOA 4JV2A 2IM1A 3CCSS 5H9EK 2GGPA 4G1PA 2G13A 3BGFA 1OY9A 5HMXA 3V81B 1H2TZ 4G1QA 4UQTA 3SV4A 4C8YA 2EFGA 4NZ6A 4M5GA 5JVGQ 4CYUB 3D7SB 1Q86T 4DU8A 1FI4A 3TX0A 3SCJE 1OWXA 4YY3F 3I4HX 4HDGA 3DGPA 3JSMA 3NGTA 1C4AA 5DQGA 5LM7E 1MROB 5J2QB 5B0FA 3QZ7A 3NRBA 1L5UA 4N3CA 2HEKA 4LF5F 4TU9A 3LANA 2AYEA 3PIPQ 3BR9A 3ITWA 3DLGA 3MMCA 1GFWB 4ECZA 4ES1A 4DL0C 3R7NB 3JAMY 3O5TB 1R0AB 1O6XA 1R27B 2FY8A 2F3JA 4EBCA 2CQ4A 1HNIA 4Y34A 1S1VA 2C28A 1RKJA 2XS5A 3DHXA 3QBCA 1KRPA 1RT5A 3QO9A 4PG8A 1RTJA 5K14A 1LK7A 1CQMA 1O51A 2ROGA 1SH2A 2CPZA 5IWAF 3LGNA 2MHEA 3PFOA 3J81j 3QT6A 4HT7A 2AP6A 2EFNA 1KD1T 4Y2MA 3J7AN 3CCWA 3LWLA 3G8SA 4U7UK 3ETMA 1VDHA 4K2XA 2ZH3A 4DV7F 2EK1A 3M9OB 1TKTB 3O2IA 2DIVA 3K57A 5A0YA 3VAJA 4DR2J 1RAGB 2WBMA 4KYZA 4QWCA 4GZ3A 3OJUA 3ADAC 4RW7B 2RRNA 3IN5A 3GILA 3FSIA 4MK7A 2HKEA 5GAEU 2WHOA 2MYFA 1RHUB 5HLFB 2X1AA 3JQKA 4RJVA 2MSTA 2FJVA 2PD1A 1SI9A 2ATCB 4TY8A 3CC7S 4C0BA 1HNXJ 4FBUA 3FRYA 4FF2A 1UA1A 1KHWA 4WFYA 1RWWB 2XMUA 4CIOA 5D6GA 4CNZA 4B3RJ 3RTVA 2KI2A 1VRTA 2VOPA 2F40A 2HAIA 2OELA 4U96A 4PPDA 4NXMJ 4O0NA 4V19X 4JYAF 3PW5A 3OFHA 3DOKA 3US5A 2COLA 2CNLB 2ZZNA 4KGXB 4K4SA 3N0VA 3L3CA 2FGOA 4P2XA 3W2WA 3KLVA 2ZKUA 4RNHA 1GQEA 2B5JA 4NEYA 3IC1A 2GJ2A 4QIFA 1IBLF 3G4SS 2DEIA 3N6MA 1N32F 1PG5B 4F8RA 2W7AA 1FKOB 4KHMA 4Y00A 2D1CA 1KVIA 3LALA 1QLNA 4CH1A 5LL6d 1WOSA 2YKMB 1RAOA 4R5PB 4PCQA 2OIHA 2OJ3A 1JLQB 2R4FA 1UP1A 3FCHA 1SC6A 4MYUA 1ZZNA 1M1KT 4UZCA 4FF3A 2WVEA 4DUYJ 1NH7A 3MEGB 3VVUA 2K8GA 3PACA 1RT2A 3T9NA 1VQSA 2FGCA 3MR3A 4ED8A 4U8YA 4UY85 1PIEA 3UDEA 3W2VA 2HAFA 2H51B 4ZPTR 4NYOA 5JMNA 1KQSR 2V6AA 2DY1A 2E9RX 3IP0A 2LA6A 1RWPB 2DB1A 3QIPA 4ZVFA 3T3FA 3OVAA 2DRAA 2Y0BB 1KSPA 1N36F 2WVBA 4O44B 3THPA 2NS1B 4RZRA 1HQEB 2CQIA 5D77A 1SBRA 2YWEA 2IVYA 4NLVA 2Z8QA 2FUG9 2MGZB 4KSEB 3VQSA 1DQ9A 2OPSA 2DR6A 5LMUJ 1R8AA 1NK0A 4MFBB 3OHAA 3CDBA 4RNNA 3HFKA 4ID5B 3K5OA 2D3ZA 5F3TA 2C2ZB 3D1QA 3UD3P 3KXDA 3DU5A 3PRVA 1B0PA 3QRQA 2KRRA 3M2UA 4DV6F 1FXDA 3BH6B 1K1SA 2CJXB 3VAIA 3T19A 2RHSB 1IR0A 3NCPA 3CDWA 3ZZOA 3RW7A 3X1LB 1HNWJ 2ZOFA 4I6WA 1JLEA 4M5LA 3MMJA 4ZITA 3BEGB 3H7HB 3MR7A 1WNEA 1TKZA 2D74B 5J2MA 4JI5J 2AV5A 1NPPA 3L7UA 4TXSA 3UR3C 3OMSA 4QQBA 2B9WA 2IAJA 2CPXA 5A6PA 4PKDB 2XO7A 2CVEA 1KVJA 2GQQA 2RMLA 4I2PA 5IC4B 1X4HA 2NXNA 4HTIA 2QLFB 4OYPA 2DR8A 1Y7PA 2B3TB 3OTEA 3OVBA 4DQIA 1NAQA 3EX7B 4Y2AA 4W98A 1EP4A 4JV0A 1T9YA 3GFXA 3R1LA 3LPEA 1FRKA 4OJHA 5LSLA 5L46A 4DSKA 1LW2A 4DV4F 2WAQD 1RYRA 5F3ZA 4FYVB 4TKTA 2CPJA 4ANEA 5DM7Q 1NJIT 2LDIA 1AUDA 4X84A 3UW1A 3M32A 2CG4A 2JL9A 1OYDA 2BA9A 2EKNA 1QAYA 1QUVA 4BCAA 2UUAJ 2Z2ZA 2ZWOA 2PMZD 5CA5A 3CSKA 1HR0F 3R6GB 5F9NA 3JAMU 2BKPA 4Y3CA 1QTMA 1JLBB 2OUGA 2BR0A 3D54A 3NNCA 4M5DB 3MHYA 3PE4A 1Z2LA 2DO0A 1OYEA 2B43A 2DNPA 3GJQB 3SYZA 2Y1JA 3K89A 3CJ8A 5E3PA 5ETTA 3A3PB 4YMEA 4M63A 4C3LA 2W9BA 2GV1A 7AT1B 4A8FA 2HS4A 1NPRA 4IOAQ 1JJHA 4OHXA 1RTIA 1OJ4A 2CG8A 2LFVA 3EZUA 3TAXA 4ER8A 2MLZA 4G6VB 1DJ0A 1LWEA 2JX2A 5KFJA 1LKZA 3QGIA 5J1NA 3ZNJ1 2LVWA 4F02A 1VI7A 1P1LA 4XDCA 5HVHA 1TZ0A 3E3XA 5IQQA 3CJKB 1OSDA 4OI4A 4LFCF 2R3VA 2RVJA 3L7OA 4OJ1A 3M7VA 5H1SV 5HMZA 2JFDA 5JVHQ 5L1IA 1VFJA 2OFGX 1FX4A 5L9NA 1J5EF 3GONA 1TTHB 4HHUA 4FKYA 2J9DE 3W8PA 3VZHA 4GZ6A 5KFYA 1VS3A 5F8MA 1N88A 3GV5B 1C0TA 3NCRA 4L75A 3IXQA 3R5JB 2HW3A 4ZLPA 3CJ5A 4B9LA 4N3AA 3GYGA 4B17A 1R0CB 3PXGa 1HWLA 3W63A 1HBMB 4ICLB 3AA9A 4YDDB 1TFYA 1YJVA 2HIYA 2OEMA 4A8WA 1SV5B 3PV8A 1UEUA 2HRTA 1PYSB 1JXLA 1B64A 3V5RA 2FLLA 1SL0A 2J9DA 2KH9A 1U8WA 4KV8A 1M90T 2PEBA 5KFBA 3BGRB 4P52A 3MM5B 4UYKA 2JNJA 3A3NB 4ZS6A 3MR5A 4ZMMA 4OX9J 1UKUA 2AT1B 2VG6A 2UVVA 2CJQA 1CJVA 1Q78A 1UVNA 4D3GA 3UD5A 2RQKA 3KFWX 2BE2A 2GHVC 4F67A 3FFIB 1U4BA 1FRXA 1BQNA 4LF8J 2RT3A 4ES2A 2V8VA 3HKZD 4QOTA 2BOPA 2O5DA 2R7TA 4I68A 2MEWA 3SSQA 1RGVA 4EBDA 4MKYA 1PBUA 4ED6A 5HMYA 4DPOA 3KLIA 3P5TL 1H3DA 3OR1B 2LU1A 5A2QU 1XMOJ 3AFGA 4LFBF 5B0EA 1N52B 3TEHB 1RCXB 3PEJA 2H5JB 1RHMB 3M4XA 4J91A 3I31A 1Q53A 3M30B 2C2EA 2KL8A 3TVZA 1S1TB 1RAHB 1YRXA 4WK1A 4Y2CA 2HMIA 5DQIA 2HWHA 2VFRA 4I7FA 3GV7B 2HVEA 2WB4A 2EFQA 3DI6A 3MD1A 1RB0A 4K7QA 4IQXA 2EWHA 4C11A 2OKQA 4DR5J 1QE1A 4W90B 4OZNA 3CNQP 2PI4A 1SIWB 3CJTA 3I82A 3BSNA 4NEZA 2KTQA 5RUBA 5A8KB 4I1TA 4NX9A 3KG4A 5CHCB 5K8NA 3DRSB 4XK8C 2HS3A 5AOXA 3R5BA 3V4MA 2NUUG 4LBIA 3TWZA 2Z30B 3HHLD 1TV6B 4ZN3A 2X5GA 1NMEB 3C14B 2QLJB 4DWIA 1JNZB 5DRKA 3P5BP 1FNOA 5E5NA 3PYFA 1MG7A 1U1KA 3GCWP 4BC7A 1VRUB 4FP9A 1T7PA 3QGGA 1U1NA 3NP5A 3ZZ0A 1W2BR 4GVBB 4USIA 1RWNB 2VU5A 1U47A 3E2EA 5I3UA 1S1XB 3BPDA 3MAAB 1OPIA 3HVRA 2PMWA 1JNRB 1T3NA 4YY3J 3TW0A 2VPXB 5H9FJ 5GAHU 2QSFA 2A1BA 3NGUA 2EBGA 1CSJA 2GC8A 1IVZA 2CFXA 2F4VF 2OO4A 4CLLA 3UDLA 2UUTA 3HFZB 3LW5C 3V81A 2VJUA 3TAPA 2EC2A 2B7BB 1R6YA 4HDHA 4JI1J 1LK5A 4ATNA 4CYUA 1E6YB 2CKWA 1F60B 1U0SA 3MCSA 1Q79A 2AEJA 1KP6A 1RT7B 2JSXA 3GB0A 4K0KF 2OPQB 3QYYA 3MMBA 1SL1A 4ZVTB 1SC3B 2YX7A 5LMNJ 1MROA 3BKUA 5J2QA 3N6NA 4QYZJ 3HDSA 2XYHB 4RW9B 4TU8A 3T1YF 3IFEA 2PDAA 3BB5A 3LH2S 4P10A 4DLEA 2IHR1 2BJDA 3BF4A 3CO9A 1REGX 1BC6A 3CT9A 4J9NA 4KHPF 1WF2A 2IYIA 3SXLA 1YRTA 1R0AA 4RKUC 3DKDA 4I67A 3N4WA 4DV7J 1OMSA 1V3ZA 2CQCA 2HGNA 2F65A 2HFVA 1EKSA 3LP1B 4K4XA 2J0QD 5HAOA 4HT5A 1DARA 2ATLA 3G87A 1KTQA 3F0NA 3MCNA 2OSQA 2UV8G 3BKTA 4CTAB 2QZ8A 4TN2A 2AEFA 3NOCA 4B9VA 3IR6B 2EPIA 1C1CA 5EDWA 1WKLA 4A8YA 1HL6A 1UWAA 1IKVB 4NA1A 1S7IA 5DZ6A 3OTOJ 3OFEA 4ZP6A 2R2SA 2AF6A 1VQKS 5K9FA 3Q8VA 4NYZA 4OHZA 3FDSA 1TKTA 4OX7A 3MOZA 2IBOA 1ZYQA 4PABA 2HVIA 1LEOA 1YKWA 1D8ZA 1S1UB 1XBWA 4JI0F 5KFNA 2AGQA 1UJ4A 4RW7A 1RACB 4DPYA 1HPZB 1RAEB 1C0UB 1RBAA 2XWXA 3Q86A 1N5QA 3QAEA 3W5XA 1HD1A 5L38A 3PFEA 1TK8A 4ECWA 5E3AA 1Z1ZA 1YK9A 4ELTA 1F9HA 5KFPA 2C2MB 3A13A 4DHVA 1YQHA 1MMNA 4LREA 3DU6A 1UEVA 1QAIA 1FE4A 1YJ7A 4U95A 3D0GE 4NYPA 1IBLJ 1N48A 1N32J 5EN1A 3GTYX 4YFUA 4GMKA 4EO6A 2AX0A 2XZDB 3KLFA 3MMAB 3FK4A 3KUGA 1WTFA 5L39A 1Q8LA 3DLLQ 3D0IE 4FS2A 4FN5A 2JRSA 2HNZB 1HI0P 2KFNA 3HD2A 3DN9A 2FD2A 1MWYA 3DXBA 4KBIA 2CQ2A 3SQGA 1CG2A 4J9RA 2JEIA 1GK8A 4ZP8A 2CQBA 1RISA 4H4KA 4GKJF 4B9TA 4Q5VA 2BE7D 2Q3PA 2IDLA 3D1OA 1UVLA 3NGDA 1VBXA 3TU3B 5KFCA 1EX8A 4TNOA 1FXLA 2P9GA 3I5CA 5BNWA 1FKOA 3NMRA 1TK0A 5G0RB 4ALZA 2ASDA 3DOMA 2VG5B 3DYAB 1ZAVA 3M8YA 1T9VA 2AGPA 2B8QA 4MTPA 4CLWA 2G0JA 2ZHOA 4EZ6A 1UMJA 3QJPA 4DX8H 2O66A 2WRMA 5JUMA 1CC8A 3G86A 2I8EA 3PVXA 4R5PA 1JLQA 3OSPA 1G3OA 4OIXA 4UUXA 5CCMA 3TYTA 3GSDA 2JDJA 1U1PA 3KUHA 1G1XA 3VAGA 2R7VA 4YB6A 4NOHA 3MPUB 1DTTA 2E9TA 1S6PB 3CJ3A 5H9FK 4WF9Q 3DNCA 2MB0B 3MM8A 2DKOB 4PXBA 1PC5A 3F41A 3FQLA 4OI0A 2NSCA 2V9KA 3THTA 3U1NA 4KGKA 1LXNA 2VF3A 4O44A 2GQCA 2R7SA 1TU0B 2MZSA 2VFSA 4QZVB 3M2RB 3IWNC 2ZE2B 4DV0J 1TVRB 4NMXA 1HQEA 4HH0A 2XCAA 2HQFA 4EBEA 1QAXA 2MGZA 4MJKA 1FFWB 4ED5A 1I1GA 4ZLNA 2QA4G 3G96A 4MFBA 2KJWA 2HVDA 4CLYA 5IOLA 1XN9A 1LFPA 4QR1A 4LF2A 1H2VZ 4ID5A 4BDPA 3DRRB 4RLEA 2CADA 3HVAA 4ECSA 1NJYA 2YWKA 3H5XA 3SCKE 2JC0A 3TZYA 1OQ3A 1O0PA 4QYZK 5KT7A 2D9OA 2NPFA 4O3NA 4WKYA 2VFTA 2ZH4A 2QSWA 1EIYB 2HZCA 2Z2LA 2JEJA 2ZH6A 2YNFB 3DLEB 2Q66A 3EPIA 1VBZA 1FCAA 4LFAF 2MQLA 1NKCA 3P3DA 3QT5A 1WDTA 1RT3B 4URSA 3GFZA 2WONB 1HA1A 5KT2A 2IM3A 5DDQC 2PN6A 2VPZB 1SB6A 3UFCX 2WOMB 3ZTSA 5L8RC 2RS2A 1LWXA 5GVQA 2DGTA 3SZ2A 5K20B 3L09A 1NZ8A 4ZP7A 5HVGA 3RGIA 4KY3A 4NE9C 1BQMB 2QEXS 4RUAA 2V4JB 2LKZA 4ANCA 3VALA 3QMQA 4CLSA 1YG0A 4DOZA 2MQQA 3MUMP 3W66A 4K59A 1HLWA 2B4OA 1PKUA 2NPIA 1B3TA 4URQU 2RQMA 3OR2A 4HTJA 2HNYB 4JI2F 4CLPA 3J7YU 4ZKAA 1CJTB 1NXIA 2PT0A 3M2VB 3PHTA 3RR7A 3UCZP 3QLHB 2QN6B 2M2BA 1YBUA 2H5IB 5C24B 1RTZA 4DUZJ 2B0GA 3OSNA 3G82B 2BANA 5KG5A 2DNKA 3ENWA 1E6VB 1U2CA 2XM3A 3PRBA 4HI2A 4N8NA 2FLNA 2FHMA 2M4MA 2YNHB 3Q8PB 1JLBA 2ALZA 1U1MA 3JYTB 4G1IA 4UF4A 1HFEL 3KK2A 3R2CJ 2GIFA 3LPYA 3I0RA 2B51A 5L9XA 1SIZA 4P7VA 3MEEB 2XQCA 1UAWA 4Q8FA 4LF9F 2GCFA 4KB7A 3FSXA 2DH7A 5KFOA 4JI7J 4N56A 4CWBA 4QIVA 1ZM9A 4NA3A 1UFKA 1FT8A 2C1EB 1YBTA 1J5EJ 3FBCA 3SDEB 5CYJA 4U9RA 5C5JA 1XWLA 3PY8A 2G9OA 3HVTB 4B3SF 3P96A 3VWSA 1H38A 4PXEA 3EGVA 5EX3A 1ZA2B 2KVQE 3VZIA 4GKKF 1APSA 2RSFA 2J0XA 3BBCA 3KTQA 1UJRA 5DDPC 4B3OB 3K5MA 1K73T 5CZVA 4USJC 3MCMA 3H90A 1K9MT 2FJEB 4EU0A 3A12A 1MN7A 4CQ1A 3AHPA 4EGLA 5DJBA 2VB6A 1RHQB 2QLBB 4ECUA 4ZCMA 1JJCB 4X4QA 3W65A 2FFGA 1FKPB 2XYGB 1RP5A 3AOCA 2NZCA 4KKOA 4LSNB 4AD6A 5IS2A 1YDLA 5HI7A 2FVRA 1GAOA 3SBMA 3R8YA 5CCLA 1I51B 3FCWA 4WZMA 4WKRA 1QD1A 4PAAA 1HWIA 4Q43A 1ZBTA 1LWFA 4RNFA 2MKHA 2XHWA 5ADZA 4EEYA 4ILRA 3TQEA 2LCWA 1YIJS 3MGJA 1KQGB 3HHDA 3RAXA 4NXNF 2ROEA 1KFSA 4DSFA 1IKYB 3IWXA 1WTBA 4OYXA 2UXBF 1TQLA 4JV1A 4CLKA 4JP8A 4PEOA 2OPPA 4KPCA 2OEKA 5KFTA 3QGPA 2BMBA 4BS2A 3IRXB 1HWKA 3MM5A 2DH9A 1RT4A 1YZ7A 4LQ3A 4ECTA 4OV1A 1TUGB 1SKUB 5F0WA 2PO4A 2W25A 4TY9A 4LFBJ 3FFIA 2MZQA 2W24A 4V19J 1RK8A 1D0EA 3ISNC 3H8YA 1IWGA 2C3PA 1VRQC 1YHQS 2RILA 4UOGA 4RNOA 3CD0A 1RUSA 2ACYA 2I1RA 4WXOA 1GTEA 1MWQA 2CRLA 1XIQA 1MMDA 4CO3A 3DFEA 1Q82T 2K7KA 2RH3A 1CULA 5GMDA 1QMOE 4C8NA 2E7WA 4DR7F 4ED7A 3S1TA 3M30A 4QU7A 4ZCKA 1S9EA 1JLGB 1KN6A 4YB5A 4F36A 4FZVA 1S77D 4M5NA 5LXRA 4AQYF 1X4BA 4PXCA 1QSSA 3K2YA 4QWEA 2XI2A 2RS8A 3LGMA 2EG1A 5SUHA 5J1PA 3DLGB 4OV6A 2Z56B 3Q83A 2OHDA 5A8KA 3M8PA 1YI2S 1GXTA 3MM9B 2C22A 4MMOA 2LMIA 1S1VB 4GYWA 4ZOSA 3DM2A 4UOFA 3DRSA 4N39A 2NUHA 3KHLA 2M52A 4KQZA 3PIOQ 1UZDA 4P6QA 4C48A 1YWXA 3HJVA 1WKJA 2F4VJ 4Y0FA 3C14A 2QIFA 2B7CB 3BSCA 3CCQS 2O67A 3GYXB 3G6ES 2ZNYA 5M2RA 2W4CA 4BBYA 1U1LA 3KMQA 2BX6A 3P8BB 3Q2SC 3WX8A 1N8RT 5G4DA 3TANA 1OQ6A 1RDRA 1M5HA 1S1XA 2D7SA 1KEKA 3MAAA 2IRYA 3DRXA 4ZVUB 5KFVA 4KH0B 3HK2A 2W2OP 1SKRA 2HFOA 4ZK7M 4WP9A 1H73A 4LF1A 1TR0A 2GHPA 2DGUA 5DG8A 2IMWP 4DV2F 3C15B 1J27A 4CM0A 5DLGA 3FEYB 4DFMA 1JXVA 3T6BA 2QMWA 3NKYA 4F3MA 1E6YA 3NNAA 3I4PA 3ILIA 1RT7A 3N79A 4FPIA 3MPWA 2DXEA 2A2DA 2OPQA 1SQEA 2MKKA 1RAAB 3GP9A 1NCLA 1VBKA 2XYPB 5KT3A 4ZPDA 4IR1A 1FD8A 4RW9A 3K8WA 4YN3B 2OTLS 1U45A 4DSIA 4QYRA 3UN5A 1YTYA 4A8KA 2J0SD 3W2WB 4IOCQ 2J7UA 5D78A 2A3JA 1NUEA 3BYRA 2B5JB 5HN0A 2H5EA 3CULA 2B9XA 2NYIA 4X66J 1HNXF 3W9JA 3CCLS 3KLHA 4GO5X 4H4OB 1RLCL 4MKBA 2PIIA 1M5SA 2ACMA 5KT4A 3EVWA 2GZOA 4NA2A 1KQFB 1NK7A 4OHWA 4NXMF 2N4CA 3QJLA 3QWUA 2BBEA 3EM1A 2HYIB 2P8IA 3OXGA 1LOUA 2VKZG 3KK3B 1N5YA 1RJJA 4KGVB 4B9UA 1JJ4A 2MKCA 2CAJA 2E5JA 5KG7A 2B9YA 4ZCIA 2EG2A 4NLOA 4QWBA 2PSZA 2LYVA 3F73A 1UWBB 3OTDA 5GAEI 3CDUA 3LF0A 2PFFB 3GYNA 1FD2A 2Z0GA 2ZVSA 4MK9A 2D41A 1Q1KA 1S1UA 3ENVA 3H5UA 3VGVA 2W7OA 1TKXB 2DGXA 1TL3B 2FZGB 1HPZA 4F26A 1C0UA 1GEHA 1RTDB 4A8OA 3OD2A 4DUYF 4AY5A 4RW6B 5F8JA 3GFHA 3KWMA 5L1KA 1F9EB 3MEDB 5KG2A 2F5GA 2PEHA 4PQUA 4OI3A 5KG4A 1SKWA 3MPYA 3DXSX 5EWFA 1VK3A 2AKWB 3BQ2A 9ATCB 2KVIA 1VQMS 2ZUAA 1SL2A 1FO1A 4C2MA 4IUFA 3MMAA 1GNKA 2HHHF 3NWGA 3OXFA 2CQGA 1JB0C 2DT9A 2DH8A 2LQ8A 1KLMA 4MYTA 3BREA 1S99A 2BW7A 5LMUF 2PGCA 2XY7A 2IJRA 2UVUA 3Q8RB 2ZJPQ 3VHQA 1FWPA 1FDNA 1TMJA 4R0JA 4M5IA 5ETPA 5L1JA 2DTJA 4EFAC 2LQJA 2H4YB 3WX4A 1NB2A 2HQCA 2RUSA 4PWUA 2E7XA 2V8HA 2UUCF 1H7WA 3CDAA 2HS0A 2QL7B 4DR4F 2IAJB 3VF0B 3SSSA 2R7OA 1I5OB 2Y8WA 3RUBL 3DYAA 5KFGA 1DFDA 3KG0A 2V2QA 3MXHP 4I2PB 1MW7A 4C97A 2QJ3A 3H40A 5F8IA 2H1YA 1HNWF 1RHJB 4CLUA 1VQNS 1R8CA 1X4AA 2P9CA 1NEEA 3HHEA 2DIUA 4LJMA 1HNZF 1P9QC 4HEA9 4PWWA 1Z2ZA 3HJFA 2QMUB 3NS7B 5IC6B 1KONA 1ICEB 2DR7A 1OY6A 2LXUA 3BSOA 5KFDA 5ETRA 4ZVHA 1KTVA 2CJ9A 4ETXA 2O3DA 2CPYA 1VBYA 4YR2A 2C3UA 2WW4A 3M2RA 4Q0BA 5A8RB 2OPRA 2YPYA 1RAJA 4DN0A 2YNGB 3EGNA 4IH7A 4YUDA 4Z7CA 1CQNA 5KOXA 4IFYA 1T9UA 2QLXA 1VC5A 2FDNA 4LFAJ 1X4EA 3QSIA 1D9DA 1RCOB 1FERA 5IT4A 5LSOA 3RB6A 2VBYA 1X4CA 4C8KA 1D09B 1XEZA 2IM0A 5HK4A 2W9BB 4C8ZA 3DLKB 5BR8J 3AB2B 3HMJG 3GSIA 1RTIB 2YNFA 3HZGA 1BUXA 3DLEA 2XI3A 4CI0B 3ETOA 2FZCB 2A2CA 1BY9A 3TZZA 2MJUA 1FESA 1JKHB 4FXVA 1RT3A 4C8MA 2YKNB 4OZ3A 8ATCB 2KN4A 2WOMA 4WBFA 2ZJRQ 3IAM9 3X3UA 4Q44A 1NZAA 4FNIA 2ZDPA 3D3CJ 2VD3A 1BQMA 4AXIA 1VHFA 1IR1A 5EWEA 4YHHJ 5HQLA 2DGWA 3I55S 2BQ3A 3IWLA 3BJYA 4QPTA 4YB7A 4FYYB 2RRBA 5D4OA 4P74A 1WC0A 4U8VA 4MT1A 4MIBA 3PHEA 2KFZA 3OV7A 1A7GE 2YQ3A 3OFGA 4M5KA 3CC2S 2HNYA 1L3UA 3M8SA 4NLUA 5J2NB 1CJTA 1J5OB 3M2VA 3P49B 3QLHA 3H4DA 4JI3J 3PR5B 5C24A 4ZVSB 2DHHA 2AD9A 2N82B 4DDFA 1JJ2R 1TAUA 1GMWD 3G82A 1E6VA 5EX0A 3GIJA 4DL5A 3DLBA 2FVQA 2M8HA 1K0VA 2YNHA 4NCGB 2W2MP 3G9CA 2V67A 1UL3A 1U25A 4WP3A 4CZCA 2JZ5A 5B7WA 3GWCA 2R9LA 2ZVIA 2DGQA 1RI7A 1TUWA 3CDEA 2VASA 4KV8B 1N34J 3SCLE 2VPYB 1Q81T 2XGPA 4AFFA 4B3SJ 2CVIA 3BN4A 2PA8D 2X51A 4IFVB 2QYCA 1XR7A 3IR7B 4DX7A 1U2FA 3QNWB 2DHGA 4ZPCA 3M6XA 4ZVOB 2HG4A 3CJ0A 1BQNB 3CCRS 4DF4A 2R7XA 2BM0A 3UNYA 4OJ3A 3SDEA 5FLXY 4OYMA 2YKPA 5FJ4A 1JK9B 3M1VA 1K47A 1N5SA 1SXLA 2YWHA 3HVTA 3Q0AA 4OX9F 1WELA 1NHKL 1CEZA 5D0GA 3G6VA 4CO1A 1L3TA 1H98A 3EWGA 2GHWA 5C25A 4DX6A 1U1RA 3GQCA 1S49A 1UVKA 4E2FB 2ASLA 1U6ZA 4P73A 3SK1A 2MQMA 4C9DA 1VQPS 4ZVQB 2I5JA 4LF8F 1A6LA 3AH6A 2W9CA 4OZ2A 2VIHA 4EUVA 4KGZB 3BDEA 4H4MB 3H98A 3Q8YA 2K2PA 5KFRA 1Z4UA 2GJFA 3DMJB 4NXNJ 5CYMA 3QJJA 1KDNA 4LF4J 4I64A 7FDRA 1FKPA 1XMOF 4ZP9A 4C11B 4WU3A 2IVMA 3N28A 4F50A 5D15A 4LSNA 2VBZA 2MJNA 3DOLA 1V9OA 2CPEA 2F8HA 4F4AA 4ANDA 1AB8A 3ZC4A 1WACA 3TNVA 4DPUA 4C8LA 2VDHA 3MWBA 4F2SA 3TR5A 3AY0A 1WDDA 5AOXB 1UCNA 1HBUA 3FKBA 3V6JA 2E1MC 2M0GB 3C3LA 1M1GA 4ENOA 1IKYA 2OFHX 1SQGA 2BKNA 2MDAA 2HNDA 1B7FA 2EK6A 3TX8A 2XY6A 2ZBRA 5FDLB 5LXYA 2ZBCA 2MZ1A 2RU3A 1P6TA 1NK6A 2DNOA 4QIEA 2A6MA 2RIJA 1Q5YA 4ZLLA 4LQ9A 4X64J 1IKXA 5I3UB 4OHYA 4M8LA 3JQMA 2ZNZA 5C42A 2RNEA 1NBEB 1WHWA 3I87A 3CCTA 3BDPA 2MKJA 3CJRA 2KDOA 4WP8A 2MLYA 1VQ9S 3LP0A 5E3RA 3K59A 3NGKA 2IMOA 1Y5NB 1CJKA 2MKYA 2MSSA 1KQKA 4AQYJ 2AX1A 4OHVA 4ECXA 3OW2R 3K7RA 2DXDA 4JBCA 3LP2B 2OH2A 4LSLB 3GJSB 5GAGI 3C6TB 2NCKL 3BT3A 4LF7F 3ZO7A 4JB8B 4IR9A 1JLGA 3MMBB 4L72B 1UFWA 5LJ5Y 3LWMA 1XMQJ 2JLGA 1M5KC 3VQTA 3UCGA 2MQOA 1U7IA 1C1BA 2EXUA 4JI1F 5JXSA 1T95A 3ITHB 4ZHRA 3BS9A 3E01B 2OLWA 4OLPA 3A1YG 3MM9A 1FJGJ 3L7PA 4O3QA 2R7RA 2H9ZA 2FHOB 3SV3A 4Y6IA 5LMNF 4B3TJ 1PCAA 3K5NA 1CVJA 3RBZA 3OT9A 3KG1A 1NJWA 3M6WA 4C8OA 1F2HA 4L74A 4YOEA 1C1CB 4DV2J 1FJ7A 5GAHI 4AL5A 3SCIE 3D0HE 3H4BA 1IWAA 3PYEA 2OEJA 1MLAA 1ZS6A 1IKWB 2BABA 4J9VA 3VTIA 2YWGA 2M5YA 1UW9A 2V2KA 2XLKA 4R25A 4DR3J 4HHJA 4FXDA 3W5ZA 8AT1B 4LBPA 2KYZA 5CYQA 5D0HA 4FDFA 3E8OA 2K3KA 1XNQF 4K4YA 2YBVA 3C15A 3DCAA 2A6OA 5EWGA 5AJ3J 2YVSA 2FIUA 1T05B 1P1TA 5K8PA 3OTOF 1KHVA 1U8SA 1H0HB 4DR6F 2KKHA 4PG6A 3THVA 3D6TB 2F9DA 2FQQB 3TJAA 4LIWA 3KLFB 4IQMA 1F5CA 5D0RA 3TUIC 2PFDA 2AU0A 3SQGB 1F3VA 3JSRA 2JLFA 4QWDA 2AZ3A 2GMLA 2UUBJ 3IO1A 3EYZA 5EUHA 3MEKA 4F25A 4F4YA 5K5MA 3CMAS 4HHHA 1RBLA 4N3BA 3UVJB 1Q7YT 4K2JA 4PWDA 4H4OA 3OLAA 4AKXB 2GJIA 2OAUA 1IM6A 4F2RA 2QO3A 1WOOA 1VJQA 3DOMB 4DEZA 3CMQA 3RJMB 3AXKA 5FLXU 3A3OB 1N33F 4HR2A 5IM0A 1F2GA 2A18A 2IM2A 2XS7A 2LXIA 1ZOTA 2EKYA 5D4NA 4WPAA 4NLXA 4DN9A 4CNYA 3KK3A 2WW8A 2HRYA 3TAMB 1N54B 3LAKA 1SCJB 1R7IA 2ZH8A 2RJZA 4PG5A 3GV8B 2ZC4A 1UWBA 2BV3A 1EARA 4NRTA 1DTTB 3MM8B 3V4IB 5D4PA 3WIUA 5ETQA 1D1UA 3OBIA 4C98A 4FYDA 1FRHA 5A2QY 5ETVA 5MLCV 2QFJA 3C46A 1TKXA 3LOUA 1TL3A 3MPDA 2HHHJ 3KJFB 2HFZA 1RTDA 2VONA 1TKDA 2FJWA 1X9SA 1S97A 4RW6A 1HIYA 3R97A 1QM9A 3MEDA 4HL9A 2DHXA 3D2WA 3UN3A 4RBTA 3CD6S 3H20A 2XSFA 3RZAA 1FFSB 1WOPA 5CD4H 2UUCJ 3G6XA 2HSEB 3ZNUA 1BE4A 1NRKA 3D66A 2P2CB 2ZUGA 3N5FA 3H25A 4DR4J 5DETA 5ETNA 1N4LA 3LTOA 5J1EB 2BXJA 4DV0F 2IBKA 5E33A 1D9AA 3T5LA 3R3TA 5KT6A 1N6QA 2F7VA 1KR4A 4P71A 2NSBA 5B0GA 5IQ6A 3BO4A 3R5GA 2DJWA 1BHNA 3N9UC 3U27A 1SC1B 4YS2A 1HNZJ 2Y0SD 2ZDOA 1REVA 2DISA 5AXMA 1IM4A 5J2PB 1UETA 1MNEA 3EUNA 3FJ2A 4UYJB 4NLGA 4FBTA 1A9NB 4WFXA 2MZJA 3HHKA 7FD1A 1YJUA 4YR3A 5M2PA 3TUJC 2VQEF 4XI9A 1H2UX 3B78A 4M95A 3CXCR 1RABB 4OZJA 2AGOA 1U1QA 2IC3A 3S7RA 3KUEA 3Q8QB 4DZ6A 4X62J 2AW0A 4CH0S 3MPVA 3PEHA 3OR2B 4ELVA 4W92B 2L9NA 4I2QA 3AAWB 4LVNP 3G2XA 2R2RA 3J80U 4ZJOA 3HVWA 2LQBA 2RDDA 3TA2A 1Y5IB 3GFYA 5B0AA 2AJFE 3E51A 5CD4A 1CS4B 2CQ3A 1H6KX 2BANB 2D3UA 2Q6CA 3EPGA 4OZ1A 5A8RA 1Q8KA 2F63A 2ZFHA 2YNGA 3VGSA 2NR0A 4NRUA 4TLQA 4U7CA 3MD3A 5DG9A 2LEBA 1NK8A 3NG8A 1TL1B 2Z4PA 2XMAA 2XBPA 2Y1LB 2FJBB 4DSEA 2JOQA 2JJ4D 4ECYA 2PA3A 3KK2B 4L3NA 1ZTTA 2OTJS 4LBHA 4LT6A 3SEOA 2HHVA 2WZ1A 1QSLA 4RR5A 3I0RB 4DUZF 4N41A 5IZHA 2C3MA 3DLKA 2EEYA 2GO8A 1YX2A 4DFPA 2W2NP 1M5OC 1DZ5A 4OZLA 3FUYA 4IH5A 1Q16B 4RWWA 4RU2A 4K4WA 1JKHA 3ZZTA 3S6EA 3QZ8A 2YWWA 2YKNA 2ZITA 1RXOB 4XIUA 2BVZA 1BLUA 4EWTA 5EGYA 2MPUA 1WC3A 2XULA 4IG3A 2CJBA 1S0VA 1X9MA 3D6FB 3VR1A 4S0MA 2LDYA 2DNQA 4JI7F 4OX8A 2HBQB 1SH0A 2J5AA 2YPZA 1O5JA 3J7YI 1L3SA 1HHTP 2AHOB 1BWEA 2VFUA 3GIRA 2J8SA 3HHLC 4N77A 3FBBA 2Z2MA 1Y3JA 3AOBA 1DURA 3NGSA 2RQ4A 4JI6J 3GR1A 4KKOB 4YR0A 4X4RA 5J2NA 1J5OA 3R5DA 3HFVA 1PILA 2JEFA 3G8QA 1OSCA 4UTGA 4XTTA 2OMOA 3SFUA 2OD6A 3D1HA 1LWFB 2R7QA 4P75A 3MURP 2J9EA 1AYEA 2B4VA 3C6UB 3FRZA 1SQFA 2QE5A 3DLHA 2VJVA 1X8DA 4NCGA 3CGIA 3O8WA 1914A 1WSRA 1PGZA 4OFZA 4LR8A 2APOA 1AFIA 4CDRA 3L4BC 3FCVA 5H9EJ 4USUA 2OPPB 4Q8EA 4LIRA 5C1DA 2UVRA 1JLFA 1RT4B 2K06A 4IFVA 2VG7A 1YRUA 2KJZA 3DHWC 4RX6A 1DLOB 2VODA 1X0FA 4DFJA 4QW9A 4IYQA 2GNKA 4K50A 4U6PA 1RZMA 3J81U 1NHUA 2OMLA 4DX5A 5HATA 1NK4A 2OP5A 4O3OA 1X5TA 3D67A 3B4MA 4USKA 3FMBA 4IH6A 3B4DA 4ECRA 1CULB 3HXMA 1HQUA 2VL1A 4KIAA 1MN9A 1EQ0A 3HO1A 3NAIA 3IR5B 2Q79A 3JTOA 2IJNA 3PDNA 3KJNB 3PKYA 5EHHA 1S9EB 3T1HJ 4QR2A 2ZHBA 4CH7A 2Z2YB 4H4MA 4J9UE 4DV5J 2YKAA 1K1QA 1WHYA 3DMJA 5JJBA 2R2TA 4CO4A 3D6MB 2FJAB 2MQNA 5GAGU 3BM7A 1T02A 4PUOB 4DL4A 1WKKA 3Q2TC 4Q2LA 2RE1A 3VCXA 2MQPA 2QA4S 2OGUA 1IQZA 4KHRA 4WIIA 5CQGA 4M5HA 1R6VA 4FKXA 2X3DA 1TFWA 1JQGA 4OYOA 3M8PB 3EDQB 4QIGA 3HX9A 3Q8SB 2NREA 2W1BA 2IPOB 3DM2B 3M8QA 4J9PA 3OTBA 5ITHA 4ELUA 1UPPA 1H74A 4W4MA 2HURA 4DPXA 3HHNB 1FX2A 4A8SA 2CYYA 5AE3A 3BO3A 4K4TA 1SUQB 2YKQA 2KT2A 3ENAA 3FEXB 2UU9J 2K3IA 5FDLA 2ZHAA 1NKBA 3O3LA 2BJEA 1R31A 1CJUB 3TJ9A 4EYIB 1KNZA 4USHA 5DZ7A 4DZDA 1E8OB 2SXLA 4A8QA 4X4TA 3CW2C 4LF7J 4LR9A 3CIZA 2CQPA 3RR8A 2DY9A 1NO8A 2IVFB 4FNHA 4Q7AA 2AJ1A 1HBNA 1HYSB 1WEZA 3CCES 3ILLA 2GA7A 2NYHA 1FNMA 3R7BB 2CZ9A 3R6LB 5A6WA 3JS9A 2HHWA 3LP2A 1WF1A 4LSLA 1X9WA 4PXDA 3C6TA 1WHVA 2K7JA 1TELA 5LSRA 3TRGA 4HYKA 3RAMA 1TP7A 3KMSA 3KJQB 4F0MA 2HQIA 4USVA 1WG1A 3KYLA 5U47A 3HT3A 2JFKA 1ITPA 4K4VA 2C2RA 3W60A 4FPRA 1TL7A 2R42A 1Y5LB 2UXDF 2DO4A 4C3MA 1DQ8A 3NEKA 4Y2IA 4O4GB 1D3WA 3ZZRA 3ITHA 4CLTA 2ABYA 3KLHB 3I32A 3E01A 3EZOA 1S6OA 5HMWA 5AXKA 3Q89A 5T14A 3M8WA 3RW6A 2RKIB 3WC0A 1U24A 3KHRA 5DGBA 4R0EA 4YQWA 1HI1A 2YH0A 1VQLS 5CXTA 3NY0A 4ZVEA 3PRDA 1N5YB 1XNQJ 2AYMA 4QPXA 1FTCA 3KLGB 4X66F 2JLEA 2WCXA 2ERRA 3PJXA 2X5HA 1BD6A 4NCAA 4OQJA 1FA0A 1WUUA 1YJNS 2M9KA 5DLFA 2FZKB 2VICA 5DO2A 2HVZA 4JV5J 5CAAA 2QL5B 1IKWA 1M0SA 2XGQA 5HROA 4DR6J 1NU4A 2R8IA 4EK2A 5ETSA 2XLJA 1RU1A 3S01A 4UQGA 5L1LA 1X7VA 2Y1RI 4DS4A 1FNXH 1HD0A 3HSJA 4XPCA 3TARA 2JWNA 5AE1A 2B6AA 4LVOP 1WC1A 4MK8A 4I6YA 2M7SA 3I0SB 3MECB 5B08A 1PYTA 1S0NA 5IV4A 1T05A 1U26A 3A8JA 5KG1A 1VC0A 4PQUB 3UD4P 4NI2B 3FMWA 2UXCF 5GMEA 3M8ZA 3AJ2A 3FBFA 1GH8A 1X5SA 1MU2B 2KXFA 3ONQA 4J5OA 4HKQA 2DNNA 4QIWD 3CCMS 3K5PA 3T41A 4LUBA 4BWJA 3PZPA 3PX6A 1ZPWX 1EETA 2Z58B 3DDIA 4ED4A 3KLEA 1FDAA 1WEYA 5B09A 1X5PA 1KLMB 1N33J 5AXNA 4XPEA 5FD1A 2Y3YA 3RG6A 4EYHB 1U48A 4J9QA 3CJ2A 2F4FA 3C2PA 2HHSA 3LQVA 2HGLA 4GRSA 1KWMA 4I56A 1YITS 3UVJA 2DK2A 2GVDB 3ICLA 4YEAA 3K17A 2HWTA 3UQSA 3IS9B 1PJ6A 2AMCB 1R0BG 3JB9k 1LQ9A 1S57A 3T5HA 5E0OA 3KDNA 1VK8A 3BR8A 3MUVP 3RRHA 3OUYA 3BPSP 1GXUA 3BQ0A 4NASA 4DSJA 5ETKA 3TAMA 1XC9A 1UVIA 2HBRB 1Y11A 3I5BA 1TAQA 2E7VA 3G71S 4A4JA 1GT8A 1VQ6S 2N3LA
chains in the Genus database with same CATH topology
2CJQA 1HNIB 1R8BA 1NZAA 4JV5F 1Q78A 5BJRA 3HLUA 1UVNA 1Q4RA 4FNIA 4D3GA 2RQKA 3KFWX 1V3SA 2BE2A 2GHVC 4R8UB 4OI6A 2ZDPA 2ASYA 3V4IA 4GZ5A 2D3OR 3F44A 4PG4A 2KU7A 3C8YA 1RT5B 4F67A 4X4SA 3QO9B 3FFIB 4KE5A 3PX0A 3MFIA 1U4BA 2VD3A 1BQMA 1FRXA 1RTJB 4AXIA 5K14B 1VHFA 1URRA 1BQNA 5EWEA 1TL4A 2IJFA 5D4LA 2DGWA 2L48A 3I55S 4DQPA 2RT3A 2BQ3A 2Q43A 4A46A 3IWLA 2V8VA 4ES2A 1TV6A 2WK4A 3HKZD 3PR4A 4QOTA 3BSAA 2BOPA 4RBVA 3CD5A 2R8HA 3BJYA 4QPTA 1EETB 1CC7A 3IA0A 2O5DA 4Q0BB 1LFWA 4I68A 4YB7A 2R7TA 2OPRB 2NQPA 3GMGA 2RRBA 3KLEB 3SSQA 1RGVA 1X5OA 4EBDA 2J6TA 3Q24A 2FC9A 4MKYA 5D4OA 4ED6A 1C4CA 2RSQA 3M6VA 1HARA 5HMYA 2L41A 4NMLA 3U1MA 1FVSA 5A8WA 4DPOA 4IFYB 2I38A 3KLIA 5GMKa 2VKRA 2KFZA 4MIBA 3PHEA 1K0TA 3P5TL 3OV7A 1H3DA 3OR1B 1A7GE 2LU1A 1VRUA 2IRXA 1Y00A 2HLUA 2RRAA 2FPHX 2YQ3A 3OFGA 3VAHA 3CC2S 1SJ3P 2HNYA 1L3UA 3M8SA 4NLUA 3PKMA 4DMZA 1VIXA 5J2NB 2C3YA 1J5OB 4C4WA 4NLQA 2DGOA 3M2VA 5B0EA 4LFBF 3WZ0A 5A0YB 3P49B 3QLHA 3OPKA 1N52B 2KT5A 3H4DA 5DS7A 3PR5B 1R3NA 3PEJA 5C24A 3M4XA 1RYSA 2AD9A 1AROP 4KC5A 2N82B 3I31A 1Q53A 3M30B 2C2EA 2W9JA 4DDFA 1JJ2R 3TVZA 1S1TB 1YRXA 1BGXT 3GG1A 4H54A 4WK1A 4Y2CA 3UDCA 5DQIA 4DQRA 2HWHA 2HMIA 4TYBA 1TAUA 1S9GA 2VFRA 4I7FA 5J1EA 3GV7B 5DG7A 2CQDA 2CZVC 2WB4A 1T03B 2CPIA 4ILMA 1E6VA 5EX0A 1TL5A 4D3HA 3FVYA 3R1HA 1MWZA 3GIJA 2EFQA 4DL5A 3DI6A 3PW2A 3DLBA 2FVQA 2J9CA 3DRPB 3MD1A 3B82A 2RF2A 2R7WA 3OUYB 2M8HA 1K0VA 2YNHA 4NCGB 2KG0A 3G9CA 2YY3A 2VC1A 2ZH2A 2GQ2A 5E2QA 2XCPA 1UL3A 3KHGA 1U25A 2EBEA 4IQXA 2EWHA 4CZCA 4C11A 2JZ5A 3MAHA 3GWCA 5B7WA 2R9LA 2OKQA 1QE1A 5F0UA 4TY8B 2DGQA 4W90B 3KK1A 1RI7A 4OZNA 2PI4A 1SIWB 3CDEA 2VASA 4KV8B 3SCLE 1FRJA 2VBWA 2VPYB 1Q81T 2XGPA 4DR2F 1D8YA 3I82A 4AFFA 3BSNA 1W2IA 1YVFA 2KTQA 4CO0A 2CVIA 4Y65A 3BN4A 5A8KB 4I1TA 3RRKA 2PA8D 2FLOA 3IGVA 5B0DA 2X51A 3NBPA 2DHAA 4IFVB 1VRTB 2QYCA 3KG4A 4NX9A 4AXJA 3BO2A 2VZ9A 1NK9A 3ISND 2POKA 1XR7A 5CHCB 5K8NA 5BR8F 3IR7B 1U2FA 4DFKA 1F5BA 3DRSB 4XK8C 1SKSA 3J81Y 1X4GA 2DHGA 2HS3A 5J2PA 5AOXA 1Y4ZB 3CC4S 4ZPCA 2V0NA 3M6XA 3R5BA 5KFWA 5I42B 2HG4A 3CJ0A 3DOKB 3V4MA 4UYJA 1BQNB 3CCRS 2NUUG 4DF4A 1VC6A 1RKIA 2R7XA 3R5AA 3HHLD 1TV6B 3EGZA 1GTHA 4AL7A 3NMAA 2MY7A 3M9NB 1IJEB 1X4FA 3MFHA 2X5GA 2BM0A 4QCLA 4IRDA 4OJ3A 3SDEA 2KYXA 5FLXY 2DGVA 2YKPA 3FSYA 4QBUA 5HQ8A 3CPWR 3BGLA 5FJ4A 1JK9B 3M1VA 4DWIA 2RDJA 5GADU 1LV5A 3D28A 1JNZB 3ZZUA 1N5SA 5DRKA 4WZQA 1FNOA 5E5NA 1SXLA 2YWHA 4J9LA 3KNGA 3ZZZA 4IRCA 3HVTA 3LO3A 3Q0AA 2OD4A 3H5SA 2YNIA 1U1KA 2VA2A 4YDXA 4BC7A 3IGNA 4OZ5A 1QJHA 4OX9F 4B3RF 1VRUB 4FP9A 1T7PA 1WELA 3QGGA 1U1NA 3G6VA 1CEZA 3NP5A 3ZZ0A 1MMLA 4CO1A 1W2BR 1L3TA 1H98A 1LW0B 4USIA 3WC2A 1TK5A 1JMTA 2GHWA 5C25A 1U47A 3E2EA 5I3UA 2MY8A 1U1RA 1F0XA 4QJVA 1S49A 1S1XB 3GQCA 1UVKA 2FTRA 2ASLA 2HVHA 1FDDA 1U6ZA 1OPIA 4O3SA 3HVRA 3LP1A 3SK1A 1JNRB 2MQMA 2IFXA 4C9DA 4Z2XA 1VGYA 1T3NA 2EVZA 1VQPS 3TW0A 4YHHF 2UV8A 3FEZA 2I5JA 2VPXB 4LF8F 5H9FJ 1A6LA 3AH6A 2W9CA 1VQ4S 4ED1A 5GAHU 2QSFA 2DNHA 2W9AA 1RTHA 2A1BA 4DBQA 3PW0A 4EUVA 2EBGA 1CSJA 2GC8A 1Y0HA 2CFXA 2F4VF 3BDEA 3HI9A 1GXLA 3DC2A 4CTAA 4H4MB 4WU2A 3H98A 2OO4A 2K2PA 1SH3A 5KFRA 2QV6A 2B4UA 3UDLA 1Z4UA 2PE8A 2RF2B 5I3QA 2X1FA 3J7ZT 2UUTA 3DMJB 5CYMA 1LXJA 4MAKA 1FRLA 4LMZA 1IKVA 2KJVA 2KXHA 2YX1A 5T7LB 1RT2B 3QJJA 3LW5C 2HGMA 1Y9OA 3V81A 4I64A 7FDRA 3TAPA 1FKPA 2B7BB 1XMOF 4ZP9A 4C11B 1R6YA 3ULHA 2PI5A 1TL1A 4WU3A 4HDHA 2IVMA 3N28A 3CUNA 1LK5A 4F50A 4LSNA 3W2VB 4ITSA 4ATNA 4WYWA 2VBZA 4TU7A 4IRKA 1SJFA 1U6BA 2MJNA 4CO2A 3DOLA 1BQXA 1V9OA 2BACA 1DAXA 2CPEA 1E6YB 3OL9A 1J2VA 2CKWA 1F60B 4RU9A 2F8HA 4JI3F 1S4FA 4E8UA 3MCSA 1Q79A 4KJIA 2Q1LA 2UZAA 3BZQA 1RT7B 3QIPB 2JSXA 3GB0A 4K0KF 2DNLA 1YJRA 2OPQB 2ADBA 3ZC4A 1WACA 2V8DA 3QYYA 3TNVA 3MMBA 4C8LA 3MWBA 1S0MA 1SL1A 4NLPA 3TR5A 1RA6A 4O4RA 4F2SA 1U2RA 2WB1D 4KR0B 4ECQA 3AY0A 2YX7A 5AOXB 1MROA 1HBUA 5J2QA 5B0CA 4K5RA 3V6JA 5DDRC 2E1MC 2M0GB 3N6NA 3C3LA 4QYZJ 1IQTA 3HDSA 1FE0A 4RW9B 1N0UA 4TU8A 1Q8BA 4KO0A 3IFEA 3T1YF 2PDAA 2OPSB 2R8JA 3BB5A 1IKYA 2HHUA 5F8LA 2KHDA 3LH2S 2OFHX 4DV3F 3PO4A 2MDAA 2HNDA 4DLEA 2IHR1 2BJDA 3BF4A 3CO9A 3CE8A 4QU6A 1B7FA 1VLYA 1BC6A 1OS5A 2EK6A 2LLZA 3TX8A 2NXUA 1JLAB 3T6JA 2XY6A 1KS2A 3CT9A 3CEDA 3M1VB 4EO8A 5F8HA 3V3LA 2ZOMA 3U02A 1GX6A 5FDLB 5LXYA 4IO9Q 2ZBCA 1N34F 1HHSA 4J9NA 4RW4A 4KHPF 1WF2A 2E5IA 2IYIA 3SXLA 4KFBB 1YRTA 2MZ1A 2RU3A 1VIOA 1R0AA 2V9WA 1P6TA 2R8KA 1NK6A 2Y1IA 2MKIA 2DNOA 1ZM3A 2HHXA 3M2UB 4QIEA 4RKUC 3U1LA 4DL7A 4I67A 3N4WA 2FHJA 2RIJA 3JTPA 1P8GA 2J0WA 1V3ZA 3JSYA 5C25B 4LQ9A 2CQCA 2W4PA 1IKXA 5I3UB 3PNIA 3Q23A 1QVGR 4OHYA 4M8LA 1X4RA 2HGNA 5KFFA 2ZNZA 2BRLA 1DQAA 2HNZA 3LP1B 5C42A 2RNEA 2N3OA 3RRGA 1WHWA 3I87A 3CCTA 4K4XA 3BDPA 3EXYA 2J0QD 2I5JB 3MR6A 3R5CA 2MKJA 1HNVB 4HT5A 3BN7A 3CCZA 3OJSA 2W9CB 2AJQA 1DARA 2KDOA 1RTHB 5CH7B 2XC9A 2ATLA 4FVCA 1KTQA 3N5BA 1VQ9S 3LP0A 5E3RA 2OSQA 2UV8G 3K59A 3HKWA 2XMWA 3NGKA 2QZ8A 4TN2A 4CTAB 4X2BA 4B9VA 3IR6B 1SJQA 3HZEA 1ZTWA 1JLEB 1C1CA 2EPIA 2IMOA 1Y5NB 5EDWA 2JEGA 2MSSA 1KQKA 2XMVA 3NS6A 1IJFB 4A8YA 2OSRA 1FKAF 1HL6A 3FNNA 1TKZB 5CYMB 5J2MB 1IKVB 2VPWB 2DRBA 4NA1A 3EGWB 1R8HA 3OFEA 2AX1A 4ZP6A 1XR5A 4OHVA 3NCQA 2R2SA 2AJ4A 4ECXA 2AF6A 3T5JA 2XY5A 1VQKS 3AB4B 5K9FA 3OL8A 1T94A 4IG0B 4KTQA 4NYZA 4OHZA 3FDSA 5D3GA 1G6BA 3OW2R 3K7RA 5G0RA 4JBCA 1TKTA 3V6DA 4IDKB 4OX7A 3DOLB 2VG5A 3LP2B 2IBOA 3MOZA 1IBKF 2OH2A 4O3PA 1ZYQA 2HVIA 4LSLB 5GAGI 4B9MA 3C6TB 4P2SA 1D8ZA 3BT3A 3BGUA 1S1UB 3UPFA 4LF7F 2KM8C 4DV1F 3PJWA 1G2EA 1XBWA 4JI0F 2YH1A 4JUZA 4IR9A 5KFNA 4J9MA 4FF1A 1JLGA 3MMBB 2AGQA 3POTB 1UJ4A 4GYYA 4RW7A 5KFKA 4L72B 3UR0A 2V5HG 2W4DA 2M8DB 4F3OA 4G3IA 1HPZB 1C0UB 1HBUB 1UFWA 2XWXA 5LJ5Y 1N5QA 3QAEA 3LWMA 1NB7A 3C6UA 1HW9A 3EZ5A 1HD1A 1Q7LB 5L38A 3PFEA 1TK8A 2JLGA 1EP4B 1M5KC 4ECWA 5E3AA 2XMJA 3VQTA 2KRBA 1Z1ZA 3FZBA 3UCGA 4JI5F 2MQOA 1U7IA 1C1BA 4ELTA 5KFPA 4LF4F 3U7JA 4DHVA 1JLCA 2HNDB 1YQHA 5KFXA 5E7OB 4JI1F 3NL0A 5JXSA 1S6PA 3L95X 1T95A 1LW2B 3O44A 4X65F 2FVPA 1MMNA 3GR0A 3DU6A 3K58A 1UEVA 1QAIA 2PC6A 1FE4A 4WJBA 3D0GE 1S9FA 3ITHB 4NYPA 4RW4B 4ZHRA 1N48A 4RW8A 1U6FA 1UFLA 5EN1A 3BS9A 4ED2A 4MKAA 4YFUA 2AWZA 4GMKA 4M94A 1Y3KA 4EO6A 3E01B 2AX0A 2OLWA 2M3DA 4OLPA 1U09A 3CB4A 2B56A 3A1YG 3MM9A 3KLFA 3M32B 3MMAB 1WHXA 3L7PA 2QLWA 4O3QA 4ED0A 1WTFA 5L39A 2R7RA 2BM1A 2H9ZA 1Q8LA 5GADI 3DLLQ 2FHOB 3D0IE 1IKXB 4FS2A 3SV3A 4FN5A 4XIFA 2QA2A 2ZE2A 2JRSA 4Y6IA 4C7QA 3HP6A 5LMNF 1TVRA 1F9FA 2HNZB 5C42B 1HI0P 2KFNA 2JHEA 3K5NA 1S72S 4TQSA 2DBBA 3DN9A 2FD2A 1YSJA 1CVJA 1MWYA 4A48A 3DXBA 4OL8A 3OXLA 4KBIA 1DLOA 2CQ2A 3SQGA 2KZMA 3KG1A 1NJWA 1CG2A 3QPIA 4WE1A 4J9RA 2E1CA 3ZFVA 3M6WA 2XMTA 2JEIA 2RD5C 4C8OA 1FVQA 4ZP8A 2ZH1A 2CQBA 4IO1A 3LP0B 2E44A 1RISA 1W25A 4H4KA 2F8EX 1FRMA 4GKJF 2DCUB 4B02A 2NLWA 3DRRA 1C1CB 1OIAA 4YOEA 5M2UA 4B9TA 3CTRA 4Q5VA 2Q3PA 4KAIA 5IXUA 4AL6A 2CQ1A 2K1RB 1FJ7A 5GAHI 3D1OA 4U67Q 4AL5A 4QR0A 3SCIE 4RBUA 2DHSA 3D0HE 1UVLA 3NGDA 3KJVA 1VBXA 3N6LA 3H4BA 3TU3B 5KFCA 2CJAA 4TNOA 1FXLA 2P9GA 3I5CA 1SJ4P 5BNWA 2MKSA 1FKOA 5DDOC 3NMRA 1TK0A 4X64F 1IKWB 2BABA 2MHNA 5G0RB 3VTIA 4ALZA 2ASDA 2YWGA 2M5YA 3V6DB 3DOMA 2VG5B 2DR9A 3TOQA 3DYAB 1ZAVA 1NK5A 2V2KA 3F56A 2UUAF 2XB2D 2NZ4A 1S79A 1IBMF 2RU9A 2XLKA 2AGPA 2KG1A 4BWMA 4R25A 3J7A1 3MZIA 4HHJA 4MTPA 2ZHOA 1VQ5S 4EZ6A 4JI8F