The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
21
|
sequence length |
149
|
structure length |
149
|
Chain Sequence |
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6-A resolution
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
molecule keywords |
adenylylsulfate reductase
|
total genus |
21
|
structure length |
149
|
sequence length |
149
|
chains with identical sequence |
D
|
ec nomenclature |
ec
1.8.99.2: Adenylyl-sulfate reductase. |
pdb deposition date | 2001-07-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF00037 | Fer4 | 4Fe-4S binding domain |
B | PF12139 | APS-reductase_C | Adenosine-5'-phosphosulfate reductase beta subunit |
B | PF12800 | Fer4_4 | 4Fe-4S binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 2-Layer Sandwich | Signal recognition particle alu RNA binding heterodimer, srp9/1 | Signal recognition particle alu RNA binding heterodimer, srp9/1 |