1JNRB

Structure of adenylylsulfate reductase from the hyperthermophilic archaeoglobus fulgidus at 1.6 resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
149
structure length
149
Chain Sequence
PSFVNPEKCDGCKALERTACEYICPNDLMTLDKEKMKAYNREPDMCWECYSCVKMCPQGAIDVRGYVDYSPLGGACVPMRGTSDIMWTVKYRNGKVLRFKFAIRTTPWGSIQPFEGFPEPTEEALKSELLAGEPEIIGTSEFPQVKKKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords adenylylsulfate reductase
publication title Structure of adenylylsulfate reductase from the hyperthermophilic Archaeoglobus fulgidus at 1.6-A resolution
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 21
structure length 149
sequence length 149
chains with identical sequence D
ec nomenclature ec 1.8.99.2: Adenylyl-sulfate reductase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF12139 APS-reductase_C Adenosine-5'-phosphosulfate reductase beta subunit
B PF12800 Fer4_4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1jnrB01
3.30.720.40 Alpha Beta 2-Layer Sandwich Signal recognition particle alu RNA binding heterodimer, srp9/1 Signal recognition particle alu RNA binding heterodimer, srp9/1 1jnrB02
1FD2A 1GAOA 2WB1D 3MM7A 1R27B 2O01C 3MMBA 2WSCC 1FERA 1FRMA 1H0HB 2FJAB 1H98A 3MM7B 2FGOA 3MMBB 1Y5NB 1B0PA 1GTEA 1JNRB 4L6V3 1GTHA 1XERA 2VPWB 4AYBD 1PC4A 1FCAA 5L8RC 1F5CA 2C3PA 1FTCA 3MM9A 1CLFA 1VJWA 4RKUC 2C3YA 1IQZA 2C3MA 3MM9B 1Y5IB 1FRJA 3IR7B 4ID8A 3C8YA 1Y5LB 2PMZD 7FDRA 1FRIA 2GMJA 2GMHA 2FJEB 1BWEA 4YDDB 1DURA 2FJBB 2ZVSA 3MM5A 5BYSA 1IR0A 5BYRA 1KEKA 1FRHA 2VKRA 3HKZD 1B0TA 1SIWB 3MM5B 2Y0SD 5BYQA 1D3WA 1JNZB 1C4CA 1FRLA 2Z8QA 1FEHA 2PA8D 1FDBA 2C42A 1K0TA 1DAXA 1SIZA 1FDAA 1H7WA 1JB0C 2VPZB 1BD6A 1B0VA 4OMFG 1FDNA 1FRXA 3PNIA 1BC6A 1G6BA 2PDAA 1KQFB 3EUNA 2VPYB 2FD2A 2C3UA 1AXQA 1FXRA 1Q16B 1Y4ZB 3GYXB 3MMCA 1G3OA 4DHVA 5CHCB 1KQGB 1FXDA 5FD1A 3MMCB 1ROFA 4CI0B 2FDNA 1A6LA 1BLUA 1C4AA 6FDRA 3MMAA 3LW5C 1PC5A 3MMAB 4XDCA 3OR1A 1F5BA 1DFDA 3OR2A 4XK8C 5E7OB 4Y28C 1WTFA 3OR2B 4KT0C 1FDDA 4OV1A 2IVFB 5CH7B 2WSFC 3IR5B 3EXYA 1FRKA 2XSJA 4XDDA 1HFEL 3MM8A 1H7XA 1SJ1A 7FD1A 3MM6A 2XSJB 2C3OA 1BQXA 3MM8B 2FJDB 3MM6B 3EGWB 1F2GA 2V4JA 2VPXB 1RGVA 2V4JB 2WSEC 2UZAA 1FF2A 3OR1B 2V2KA 1GT8A 2WAQD 6FD1A 3IR6B
chains in the Genus database with same CATH superfamily
4QZVB 3UN3A 3WIUA 5IT9Y 1H3DA 5K8MA 1R89A 2O1PA 4O3SA 3H4BA 2YNFB 1CLFA 2C3YA 1HI1A 5L46A 3J80Y 4ID8A 3BJYA 3MECA 5AJ3J 1YWXA 3PIPQ 2L08A 3OVBA 2R8HA 2W9AA 1X4RA 2IRUA 3QGHA 4U67Q 2DY9A 1C0TB 1KOHA 2E9TA 2MGZA 4OX9J 1RACB 4OZ2A 2B51A 2PT0A 2AIRB 4YFUA 1MN9A 1OPIA 4C0OC 5A6WA 3CJSA 5KFPA 1SKRA 4A47A 5DJBA 1HMVB 3E01A 2E5GA 1YJ7A 4GRSA 3KKFA 4BLGA 1EB0A 1P6TA 2KDOA 2QFIA 3D6TB 1Y0HA 2Z58B 4ZOSA 2Y1JA 1S1WB 4O3RA 2ZOMA 2YWKA 1NJXA 3CCES 2MDAA 2F4VF 5BXIA 5IWAJ 3SV3A 2RJZA 1EETB 2RILA 2MTLA 4DX7A 3M2RB 1H98A 2KYXA 5A8RB 3AH6A 4KJIA 1X7VA 4L3NA 3G6ES 4OJHA 2PC6A 1QE1A 1LWFA 4NLUA 4G65A 4ZVQB 5BYRA 5CYMA 3QT8A 3N5BA 1YITS 3V4IA 1LWEA 3PR4A 3M2UB 2ZM6F 2KJWA 2OP5A 1S76D 1CQNA 1VI7A 3PKMA 5ETKA 4ED1A 3HP6A 1UETA 1TP7A 5FLXU 2M9KA 3W62A 2J9CA 1QUVA 4M5NA 7AT1B 1IVZA 3BYRA 4RX6A 2XSJA 1IKVA 2PFFB 3CW2C 1U0HB 2AJ0A 4KIAA 2WSEC 5KFFA 2IAJB 2KFNA 5I3UA 2F4VJ 2M0GB 4K4TA 5HATA 3BGFA 1N36F 3H2LA 1A7GE 3NAHA 1SL0A 3GWCA 3FK4A 2Y0BB 2B5JA 4W90B 1IR0A 4PQUB 1RTHA 5JUMA 2JSXA 3TX8A 4N8NA 3L95X 2XWYA 2BRKA 2FYXA 3B6BA 5EWGA 1JB0C 3TAXA 2EKYA 2KM8B 4WFAQ 1ZPVA 4I1TA 2CDQA 1FXRA 1HIYA 1ZM3A 2UUAF 2ZM6J 2OI2A 1C1BB 1OIAA 1HBMA 4NXNF 4F0MA 2MKKA 4ZVTB 4TYBA 1QVGR 3W5XA 1NXIA 1XR6A 4B3MF 1RT1B 1OYDA 4DCOB 4NLPA 1REVB 3C3LA 5KG7A 1BQMB 1X5PA 4D3HA 1EX8A 3NNCA 2W9JA 1ZAXA 4JV0A 5A0YA 3O1LA 3EDRB 4N77A 2LMIA 3US5A 2AEMA 4Q2MA 1SKWA 1ULRA 3JTPA 3FSIA 3ILLA 4JB8B 2J8AA 1APSA 2ZZMA 2JEGA 1RTDB 4WU3A 1RP5A 4NCGB 5EX0A 4N3CA 2H5IB 1OQ6A 2EKNA 4L72B 1N36J 1UWBA 2HZCA 3FSYA 2ILZA 3DXBA 2VOPA 3FKBA 1SC4B 3S7RA 2VG7A 2ASDA 3I32A 1FDAA 3HVRA 2W2NP 1F1BB 4EMDA 3DMJA 1QTNB 4DSEA 1SL2A 2W01A 2DGWA 2FLOA 1UA0A 2EC2A 3DLKB 1RCOB 3T5HA 2UUAJ 4LF8J 4NXNJ 2V2QA 2JVRA 1BE4A 1S0OA 4R0EA 1UVMA 4B3MJ 5KFLA 4FXVA 5IFMA 1FD8A 3DOKA 2ROEA 1F6TA 4X4PA 4G1PA 4MFBB 2WW4A 1U1LA 4F0KA 1M5PC 4PQUA 3VVUA 1TUGB 4WK3A 4CLTA 2MY8A 4Q0BA 1AUDA 3EPGA 3GIKA 1WOSA 2OPPB 5KG6A 4DCPB 1NK8A 3D67A 1GXUA 3BN4A 4DU8A 1HYSB 1S7HA 5HMWA 3LP1B 3DCAA 2IPOB 1V3SA 1SJ4P 3NGUA 1UVLA 1SH2A 2MQLA 3EJMA 1NDCA 2K1RB 3UW1A 1NAQA 1FFGB 2ZZTA 2GO9A 4XPCA 1DFDA 4J9KA 4TY9A 5F8NA 2W1BA 4X66F 2I5JA 2QV6A 2PN6A 3BKUA 2Z4PA 3SSRA 1BQXA 4P73A 2GV1A 5K14B 1RAJA 2RUSA 3CCLS 3OL7A 1GX5A 1PJ5A 3CJTA 1VBXA 1KWMA 3VCXA 1JK9B 1EAYC 1YRTA 2J5AA 1RXOB 1KFDA 2CG8A 3MR6A 4YP3A 4RPFA 3IXQA 4FKXA 4KGKA 4JI0F 2GMHA 5EHHA 1TUWA 5HVHA 3CGIA 4CLPA 1TKTB 5KFNA 4TY8A 4P2MA 4O44A 4IO9Q 5HLFA 4JOUA 2AYGA 1GMWD 2G2YA 4F4XA 1Q16B 2DNNA 2OELA 1Q82T 5DM6Q 3P5TL 5L1JA 2XI2A 1N5SA 1TK0A 1DHMA 2CIMA 2BMBA 1IJEB 4CYUB 1FNMA 2VFSA 4CT9A 3GV5B 4DN0A 4BWJA 1WTFA 3H2UB 4O3NA 4WP9A 4Q7AA 2LXIA 2ALZA 3I9ZA 3C2PA 4M5DA 4X66J 2NSBA 2VJVA 3V3LA 4DV0F 5DGAA 4U8VA 3CIMA 1BQNB 4QWBA 2J6UA 2I2YA 2UZAA 3R97A 3OR1B 1S1UA 5LT5A 3BQ0A 1JLFA 1LXJA 1WSVA 2YNIA 4LF7F 1FKOA 3HX9A 2DYAA 4DLGA 5KG4A 2B9XA 1EJ7L 2XZWA 4LMZA 2RDJA 2DXEA 1WC3A 3TZWA 4DOZA 3IM8A 2DK6A 2LQJA 4UW2A 2OTJS 1S1TA 4HI1A 5F0WA 1XN9A 5E3RA 2FY8A 4JI0J 3PXGa 3EGNA 4KHPF 4LUBA 1ZPWX 5A2QU 4KRWA 2W8KA 2MQMA 5DLFA 1MWZA 1FDNA 4OZJA 2FHKA 4UUWA 3FCVA 1XR5A 3KK3B 3TR5A 3CC2S 2J6TA 2NXCA 2HQGA 2ZJPQ 1Y11A 1HL6A 2OFGX 3KG0A 4USUA 2BZ2A 3V4MA 4BC7A 5KFXA 4F4AA 4N3AA 3LW5C 1X60A 4DLEA 4YB1P 4LFBF 3L4BC 2K7KA 2CVIA 1E6VB 4IG3B 3G6VA 2GIQA 5KFAA 5AE2A 1NO8A 2M4MA 4A8MP 3AD7C 4N39A 3FQLA 4K2JA 4CTAA 3OHBA 4ZVHA 1RWOB 1S49A 2V5HG 4ZVGA 2HPUA 4F26A 3MD3A 5KFIA 5CD4H 4EBCA 4DV0J 1VR6A 3BR8A 1BMQB 2DCLA 1GT8A 1Q8BA 3P49B 2CJKA 1EIYB 2VFTA 3SI8A 4C3MA 3SK1A 1VQ7S 1P1LA 4F2SA 1JJ4A 4LF7J 4Y6IA 1SL1A 2HRUA 1S77D 3WIVA 3GV7B 2HNDB 4MIWA 3KMSA 2OPSA 3MZIA 1UVNA 3KUEA 4N7TA 1S10A 4X4UA 4KHPJ 1HWKA 4ZLJA 1NK9A 2NZ4A 2CG4A 3CUNA 5KFTA 3RB0A 3C6TA 1H38A 4DXLA 1OQ3A 4W92B 2FDNA 4ECZA 3TQ1A 3WX8A 3MMAA 3FEYB 2XMKA 1NM2A 3BPDA 3IAS9 3TVKA 2W9CB 3ZZPA 3OR1A 2EG1A 3PJXA 3SXLA 3QJJA 1NMEB 1KHWA 4ICLB 1E8OA 4LFBJ 1YJVA 3R3TA 4NA3A 3WX4A 4A8QA 5BR8F 4EYIB 3BGUA 4ZA1A 2C2NA 1M1KT 2LQ9A 2XNRA 3D3CJ 2PI4A 2G1HA 1YBTA 4LRBA 2VC0A 2DNZA 2YQ0A 3BKFA 2ZOFA 1U1PA 3IBCB 2UVWA 2R7QA 3OTBA 4LQ9A 2CPJA 1Y9OA 2QLFB 4TU8A 2LDIA 2C3MA 3CULA 1NH7A 3KHHA 2BQRA 1UZDA 4C9DA 3JYTB 4PG4A 2DIVA 2W2MP 2KO1A 4F3OA 3W2VB 1UMJA 3QMQA 3VQTA 1DTTB 2IYIA 4CRJA 3OPKA 2HVHA 4ZJOA 2B6AB 4KE5A 6AT1B 1NSQA 5KG0A 2XCAA 3A4TA 4ED4A 1RWNB 3W64A 2LFVA 3I9V9 4B17A 2BDPA 4G6VB 4MK7A 1KFSA 3M9OB 2QGFB 3IR5B 2B7BB 4C8OA 4PCQA 3QRQA 2XGQA 1QAYA 5BR8J 1CJTA 3HHLC 4H4OA 4CLKA 4DR1F 1AFJA 2V9KA 3W2WA 4NYPA 3DNCA 1CSJA 1KP6A 1PO6A 1S6UA 5C42B 2FJAB 2R2RA 1B0PA 1C1CB 2DNRA 4QU6A 2VDHA 3D28A 3RB6A 2ZC3A 1IQZA 5C7PA 1JLAA 1DTQB 3AAWB 5FDLB 1VBZA 1T9TA 1KEKA 1R8CA 3KDOA 1RISA 2ABYA 2RF2A 2BOPA 2CJBA 3UD3P 1X8DA 4LSNA 4DSJA 2ADCA 2JLEA 1KQFB 2XC9A 2FB0A 1RT7A 4IH6A 3K57A 2CADA 2HQIA 2HVDA 2JZ5A 2VQEF 1IR2A 2D9OA 1FTRA 5DZ6A 2QZ8A 2JHEA 3EGZA 1T03B 2H51B 4DPYA 4X4QA 2E29A 2ZH1A 4UY8T 2LP4A 1U02A 5D0RA 3UR3C 4RW4B 1S9GB 4XDDA 3DGPB 1SJ1A 4NLXA 3DKDA 4HTIA 3IRWP 2C2KB 1VLOA 4CP5A 1YJUA 1CC7A 3BEGB 2Q6BA 4UYKA 1F9EB 1DARA 1NHVA 4DR1J 1D9DA 1RT3B 2L9DA 3SSSA 4L6V3 4OV6A 3NOCA 1V3RA 3CO9A 1S48A 4MTPA 3O3LA 4PUOA 3JSMA 2HEKA 1H6KX 1RBLA 2XMTA 1RWVB 1VDHA 4DR6F 1UVIA 3GJRB 1JLQA 1RAFB 1SJRA 3EXCX 4JI4F 3NWGA 1WEZA 3QO9B 2GGPB 1YDLA 2MYFA 5JMNA 2OEMA 2RU9A 3SZ2A 3NGSA 5IV3A 1VGYA 3UQSA 4NXMF 1FXDA 3QWPA 4NI2A 1SC1B 4E2FB 2DNGA 2CJ9A 2BKPA 2PFDA 2KZMA 2BUNA 3W60A 1TVRB 4ZMMA 2VQEJ 4NLYA 3D5MA 1KRPA 4H4KC 2JLFA 4HL9A 5C42A 1CULB 1QDUB 2YX1A 4PQAA 5D0GA 2F65A 2OPQB 2WTFA 3P6YC 1T8EA 1Q78A 2JFKA 2MY7A 1VIXA 1U1KA 2W2QP 2CNLB 4DFPA 1EZZB 4OZ3A 5KFQA 3LANA 3R7NB 3IG1A 2EI5A 2XMUA 1G1XA 1M5KC 1ZTWA 1ZAWA 4X2BA 2OPRA 1RADB 1KVKA 3H59A 1HHQA 3MM9A 5KFYA 5A76A 5D3GB 4N56A 3TEGA 3PX0A 3KK1A 4B9SA 4F67A 2L41A 2OMLA 3K0JA 2I1RA 2OD6A 4ZCMA 3CJ8A 4DR6J 2X1GA 1IUJA 1PYTA 4JI4J 1RHQB 2GJFA 2YWHA 3RR7A 1WHVA 4YMEA 5THWA 2W25A 4NXMJ 3HM9A 2IC3A 2IVMA 5H1SV 4CIOA 2KRRA 4FF3A 4S0MA 2CQPA 1KLNA 4URGA 3PZPA 1VFJA 2DO0A 2B9WA 1RT4A 4C8KA 3AJ1A 2CZVC 3MMBA 1RHRB 4FF2A 1YK9A 2HMIA 5K9FA 5F3TA 3AD9C 1RT6B 1YJTA 5J1EB 3DYAB 2V94A 1YG0A 2ZKTA 2GC8A 1IKXA 2HQ3A 3GYGA 2WONB 3W9IA 4DL3A 2CFXA 1VQ5S 3OL6A 2BE2A 1BWVA 5E3AA 1R0AB 3QSIA 1NKCA 1G2EA 2EFVA 3NAIA 4C7QA 3M9MB 2QTWA 1U2RA 2VL1A 4C48A 4DZDA 3V6DB 1ZETA 1GX6A 3PJWA 3WC2A 4ZPBA 3C19A 4DR2F 1D1UA 4OX8A 2AKWB 1YI2S 3T1HF 3OFGA 4F4YA 1QUPA 2JWNA 5EGYA 1NPKA 3KLHB 3G87A 4QWAA 2OKQA 2BOAA 3CMQA 2JC1A 3VV2B 1L5UA 3DDNA 3ULHA 1I51B 2Z30B 4U7UD 2B8PA 1WOPA 3GFYA 4DF4A 3K58A 2VODA 4WYLA 2FQQB 5FLXY 2HLUA 2AF6A 3ZTOA 3MPUB 4P10A 1WTBA 1P1TA 1QAIA 5ETSA 5DETA 3BZQA 4HH0A 3EVWA 3T9NA 3HT3A 1KLMB 3ZNJ1 1W2BR 5RUBA 2E1CA 1PKUA 2HWTA 4O3QA 2XI3A 2GHWA 4K4ZA 4G3IA 2ADBA 4J9SA 3PE3A 2ZH9A 1LFWA 4NLTA 2L48A 4ZVSB 4KGVB 5KFSA 2J0XA 3NKYA 2H9ZA 2LEBA 3OW2R 2GNKA 2P6TA 1VK3A 1VQLS 3NG8A 1HQEB 4DR2J 5J2NB 1ZYQA 1S6QA 2R8JA 4WTYA 1N88A 2I6WA 1CEZA 3K59A 3T1HJ 3G82A 3JS9A 4USIA 3S01A 2POKA 2WB1D 1RLDA 4AE5A 3FMBA 2DD8S 4JV1A 4LREA 4DX8H 2KYZA 4EO6A 3VAIA 4I7FA 1K1QA 4LQ3A 4IG0B 4AKXB 5L1KA 2O5DA 2QJ3A 1N0UA 3W8GA 2HFZA 2XY5A 4WF9Q 5ETLA 1CS4B 3VAKA 3MM5B 3QLHA 2OHDA 1U6ZA 4FVCA 2C42A 3IBFB 3KLIA 1YRUA 3H8YA 2UUTA 1UJ6A 4NZ0A 3PHEA 1U8SA 4M63A 4U9RA 1ZZNA 1UFLA 1O8BA 3POTA 2V8VA 1CG2A 2ZOGA 1FNXH 2J9DA 4FPIA 1PAUB 4OYMA 2CNOB 4WFNQ 2WSFC 2ZHOA 1NPRA 3RAXA 4TN2A 4LBPA 4M94A 1VRTB 2HGLA 1TAUA 5A8KB 3TZZA 2AWZA 1EQ0A 1R3NA 5HP1B 5HMZA 1FWLA 3MEGA 4P7VA 1KLMA 4RUCA 3GONA 3M8SA 4CM0A 4FDFA 1UEVA 3HHLB 2KB2A 4GZ3A 3ZZ0A 3ELHA 4OYOA 3TA1A 2BRLA 2DGTA 2XLKA 1VHIA 2AMCB 4O4GA 3TZYA 2R7RA 3TYTA 2HSEB 5J2QB 2PO4A 2ZJQQ 1CPZA 2X5TA 1QSSA 2GIRA 1WJ9A 2A3JA 2XMVA 3JSYA 4NYZA 2C3UA 1XNRF 3TJAA 1HWJA 3QJLA 1GK8A 4RNHA 2BR0A 3BPSP 2V68A 4EZ6A 1WKJA 4OFZA 2JH3A 5AE1A 1HI8A 2DT9A 2DR8A 4RUAA 4K4SA 1X4FA 4L74A 1BY9A 1D8ZA 3BQ2A 4DS5A 2CQ3A 4DV3F 2FJXA 3NBPB 5LJ5Y 4IG0A 1NJWA 4F0HA 4J9QA 3ISZA 4RLEA 3RW7A 1F2GA 2DHSA 4QIWD 2E66A 2GW8A 2L3MA 2DY1A 1VLYA 3CO0P 1HNVB 5CQGA 3QAUA 1I3OB 2ZBPA 3F41A 1KONA 2CZ4A 4Q45A 4CM2A 3C8YA 2HAFA 4OZ5A 2V50A 4CLZA 1GMWA 4G1QA 2ZVSA 3JSBA 4XPEA 4LIRA 4CH1A 3W5ZA 5LMUF 5J2PB 1U1QA 4HHHA 3MOZA 4RW8B 1OSDA 4OI4A 3OLAA 1L3TA 3M8QB 1WACA 5BJRA 1X4AA 4K7QA 5DGBA 3TP2A 2ROPA 3KK2A 5A8KA 1XNRJ 6FDRA 2JFDA 1IWAA 4R25A 1FE0A 3TX0A 4NZ7A 4ZVUB 2V8GA 4LT6A 1MW7A 3ENVA 4I67A 2XEXA 4DV3J 3C15A 2VFRA 2BJEA 2GX8A 5IT4A 4R8UB 4HACB 5LXRA 1F60B 2NR0A 3IMQJ 1NCLA 3OD2A 2YNGB 1U6BA 6FD1A 1VRUA 4CQ1A 2AW0A 1Q8KA 3CJQA 1NKBA 3UI3A 2LU2A 2F4FA 4P71A 4LVNP 2XLIA 5L8RC 3LOUA 3AB4B 4V1Ak 3LGMA 2KHDA 2AHOB 5M2PA 1EHWA 4BDPA 4XIFA 1NK0A 5IZHA 1P9YA 2HHXA 1914A 5LMUJ 3BBBA 1HBUB 2DHHA 2X51A 3CJRA 3JAMU 4MYUA 2CPEA 3LAMA 3MDFA 2Z0GA 1DBDA 2J7WA 4LF5F 1WC4A 4ELTA 4OI6A 1NJYA 3CCTA 3B78A 3KFWX 2DHGA 2HFUA 2MKJA 2ALYB 4OQJA 3AB2B 2RB7A 4Y2IA 3FMWA 3W1YC 4YR2A 4DUZF 1VOMA 1JQGA 2PEHA 4PG6A 1GXLA 2JX2A 3IP0A 3AOAA 3PRBA 3HVAA 5A2QY 1C0UA 3EVOA 5DDPC 1H73A 3D0HE 3A3NB 3IR6B 4PPDA 4A8FA 3D4JA 4E0DA 3EMTA 1V6HA 3T41A 2WRMA 4NRUA 4MYTA 2BYCA 4ECXA 1WWHA 1MLAA 1FCAA 2V67A 3VGUA 4WZQA 2MKIA 2W9BA 3IWNC 3M8PA 3M6VA 4HYKA 1GFWB 3ZZYA 1FEHA 3GLJA 2EG2A 2HZAA 2AJFE 3I55S 1H2UX 4LBIA 4LF9F 4O0IA 1Y00A 1T9VA 3MWBA 2HHUA 2YPYA 3ADAC 3IRXB 2KI2A 1OY6A 3M6UA 3R1LA 4LF5J 3DRSA 3TOQA 1PBUA 3DRRA 1ZZFA 2YNHB 2R7WA 3RUBL 4IDKB 3Q8QB 4B02A 3UNYA 4ZHRB 1RWPB 3DLEB 4NA2A 4DUZJ 1UJ4A 2VBZA 4RW7B 4NEZA 1W25A 2NLWA 1ZA1B 3K5LA 1K1SA 3TAMB 1VC5A 5E33A 4C8LA 2G1DA 3ISND 1RBAA 2O66A 1Y5IB 1XEZA 2RMLA 3RRGA 4IH7A 4OZ1A 2HGMA 2QIFA 1DZ5A 3CCSS 5BYQA 2XM3A 5EX3A 3GB0A 4MJKA 4CT8A 5EN1A 4DR4F 4C2MA 1X9WA 1SJFA 4DF8A 2D3OR 4IQXA 1Y4ZB 2LYVA 1G3OA 4RNOA 2Z2MA 2M52A 4LF9J 3G86A 4C3LA 4FYXB 2RE1A 4GVBA 3PW5A 3FZBA 5D4NA 2ZH4A 1OSCA 2ZC4A 1KQSR 4ID5B 5F8MA 5L9NA 1RTIA 1VQSA 3CJ5A 2DITA 3N0VA 3ILOA 2V4JA 3SSQA 1DJ0A 1N32F 3F44A 2APOA 4EWTA 1TV6A 3Q83A 4ZVPB 1SXLA 3GG1A 1NUEA 1U8WA 4RW6A 4NLOA 1NDKA 2ZWPA 1TFWA 2GAHC 1IKWB 3CD5A 4PPZA 4NLQA 5HROA 2ERRA 3NMRA 3T1YF 1B0TA 3HHEA 4YN3B 1C4CA 2DISA 1WUUA 3R7BB 3BGRA 3UCZP 3MCOA 1D09B 1N5VA 2DGOA 3HI9A 4FYYB 2ZHAA 2VG6B 4DR4J 4M1KA 1JLEA 2IDLA 1VK8A 4ZHRA 3L7OA 1LWXA 4YY3F 4O0NA 3M32A 4M5IA 5KFWA 1J27A 1U47A 2SXLA 3WZ0A 4I6AA 4YEAA 2LXUA 3VZIA 3CJKA 1TL7A 2GQQA 1HNIA 3SFUA 1PG5B 3EICA 1RT5A 2QA1A 1FJCA 3MF5A 4CZCA 5DG7A 2YWGA 1TL1A 2K3KA 4LF4F 3C16B 1X4CA 1HNZF 4J7CA 5GAEI 5E41A 1N32J 3Q22A 1YRXA 2ACMA 2A2CA 1H0HB 3NGRA 2GIFA 3MMJA 1AA1B 3M6WA 3H5SA 2EXUA 2AJQA 3ZNUA 3MUTP 4GMKA 1ZM4A 1M1GA 3AT1B 2MMYA 1D3WA 2KL8A 3T1YJ 4FN5A 4RW9A 3H5XA 4KH0B 2BABA 4ENOA 2M5YA 3FQKA 3DRPB 2PMHA 2LQ8A 1TL3B 3I5AA 2O3DA 3HSJA 1TZ0A 2ZNZA 4YHHF 4MK9A 4EUVA 4ZLNA 2Y8WA 3Q8UA 3BSCA 2H5JB 4GYWA 4YY3J 2AEFA 5HMXA 1JLBB 1EQMA 2K3IA 1CJVA 1SH0A 3I31A 4QIEA 3BN7A 1U1RA 1XQIA 4OYWA 1RZMA 2OTLS 1JXLA 2CQBA 1SI9A 4UUXA 1LV5A 1RAOA 4RUBA 3EDQB 1X5OA 4LF4J 4LJMA 1VQ6S 1GAOA 3NCRA 4K4XA 1HNZJ 3SDEB 1NDPA 2X1AA 3OXFA 3H2VE 3HPOA 4Y2CA 3H5YA 3K8WA 2M8HA 1K0VA 4F02A 2DNPA 2Q43A 1YJRA 3OHAA 4C8NA 4W98A 5GAEU 3FFIB 1RT2A 2FIUA 4OYPA 4N8OA 3PEJA 1N8RT 2BANA 1QTMA 1FO1A 4HT7A 1B0VA 3PFEA 2AYBA 2QLBB 2PGCA 2R7VA 4TQSA 2IA6A 2VD3A 1WG4A 2OSRA 3M9NB 3M7VA 4YHHJ 2BEFA 2DNKA 2VIHA 1HBNA 3TRGA 2FTRA 2RVJA 3VGVA 4ZK7M 1FDDA 3CJ4A 1ACMB 1KC8T 3KLVA 5C25B 4WE1B 3MM6B 4MT1A 4DWIA 2YX7A 5H9FJ 2FVQA 3KOAA 1IR1A 3U27A 2AX1A 3QT6A 2DH9A 4DCJB 4WCEQ 3JQKA 1AFIA 3PYDA 1RHKB 2JRSA 1NNDA 1S9EA 2OD4A 4OYIA 3DOMA 1XTZA 4NE9C 4F3QA 3CMES 1HNXF 4OHXA 4WXOA 4AUKA 1YQHA 1SIWB 3MAAA 4EO8A 1DY3A 4ILLA 1FKAF 1TKXA 1H7WA 2V8PA 1F3FA 2OAUA 4YQWA 3I87A 1FI4A 4P6QA 1YKWA 3AA8A 3DOLA 2R2TA 2Z56B 4DL2A 3PM9A 1C2PA 1SJQA 2UXCF 2A6OA 5DQGA 2GVDA 4ILMA 3K7RA 3L3CA 4RO0A 3H5UA 2PMWA 4DV7F 2QG9B 4ZLLA 4M5HA 1UFKA 4DL7A 4WZMA 4PABA 3BF4A 3OUYA 3EYZA 4DEZA 1VQNS 1Y10A 2V4RA 3I4PA 1YBAA 2HK2A 4RNFA 3HVTB 4C97A 5GMKa 2Q79A 4TYAA 5C24B 3MM7B 1T3NA 3LP0A 3ZTSA 4AL7A 3QGIA 2C2DA 2VV5A 2WOMB 7FDRA 5GADU 1Q53A 3SYZA 2NYHA 3RR8A 3RBZA 2XO7A 3EE3A 3NOGA 1HNXJ 2LKZA 2DH8A 3LWLA 2L9WA 3A8JA 1MU2B 1WC5A 2HFSA 2VPZB 2UUCF 1RAHB 2OH2A 2Q1LA 2RSQA 4OZNA 4HH1A 4WKRA 1RTJB 1U6FA 2A6MA 5HBMB 2KH9A 1XNQF 2H54B 4I0WA 1LWCB 2H1YA 3FCWA 4QQBA 2UXCJ 1N48A 1T94A 3RRHA 3CB4A 1HQUB 1IXKA 2L9NA 2K8GA 2OO4A 1MSWD 3W66A 4DV7J 4WFZA 1NH8A 1NB2A 1X4EA 2QMWA 1HFEL 3N5FA 4J90A 3QGPA 1U09A 2GAGC 3O2IA 3RGIA 2A1BA 1N6QA 3V2UC 3QQCD 3PO4A 2R9LA 3CDEA 4MKYA 4JBCA 4QCLA 3UNGC 2HNYA 2HHTA 1WC6A 4EBDA 4WTOB 3ILIA 4WIIA 5B0DA 3H25A 3PW7A 3Q89A 4PG8A 3SQGA 5EDWA 3OSPA 4Q2LA 3KHGA 5KFJA 4J37A 3DLLQ 5BYSA 3MECB 5HVGA 3UPFA 2GJIA 2RQMA 1S5ZA 2XB2D 2HG4A 2WCXA 3QZ7A 2ZNYA 2NQPA 5IM0A 2YBVA 3HKWA 4Y00A 1R8AA 4GO5X 2UXBF 4ITSA 2MGZB 1YJ9S 4ECYA 2UUCJ 5E5NA 4K59A 1FVQA 2CPZA 2XMJA 2FJWA 1XNQJ 1O6XA 2J0WA 2MQPA 4QR0A 4NYOA 2JDJA 2HRYA 4KKOA 3E01B 1YBUA 5E7OB 4Y28C 4N3BA 5C24A 1IBKF 4F8RA 2PI5A 2U2FA 1WG5A 2YKNA 2Z2YB 2FC9A 3FDSA 3OL8A 2F5GA 1S4EA 3KJQB 2BVZA 4EK2A 2N3LA 4DV6F 3KDNA 4V19X 2ASLA 5E2QA 1S79A 4B9VA 2VG5A 1VQ9S 1J5EF 4WYWA 1M5VC 2R2SA 3TNVA 1RTJA 2OUGA 4DQSA 5B0FA 4U6PA 3D66A 1OY9A 2FJEB 1QE1B 1LWFB 3CCRS 3CWJA 5CYMB 2W24A 3HSGA 1HKAA 4KO0A 4M5GA 4AXIA 2FLLA 4LR7A 2IHR1 3V4IB 2RIJA 1U1NA 1LWEB 4GZ6A 3W7BA 3R5DA 3EUNA 1YVFA 4K5RA 4HDHA 2UXBJ 3TEHB 1GXTA 4DQQA 2CJQA 4A8KA 3HFKA 1S1VA 3I5CA 3QSYB 4GO7X 1NSKL 4FF4A 3BO2A 2CQDA 4CDRA 1QSYA 5L9XA 2WBRA 2D7SA 4OV1A 1RYSA 2KXHA 3RTVA 1AW0A 1WELA 3HJFA 4WFBQ 2XSJB 4RNNA 4UOGA 1X5SA 1IBKJ 2QX0A 4N5SA 4P2FA 2F63A 3LTOA 1IKVB 2MPUA 3WHIA 3DI6A 3RBEA 2GS8A 3E8OA 3D1QA 3T6BA 4J9RA 1T7PA 3FC9A 3A8IA 4DV6J 4OHVA 4JI6F 5I3UB 1TMJA 3CJ0A 4C98A 3FUYA 2UXDF 1SV5A 3UD4P 3IS9B 2X1FA 4QIFA 2A10A 1J5EJ 5KTQA 4C8MA 2B5JB 1DRZA 2DR7A 2KT5A 5LSOA 4AY6A 2R7SA 1CJKA 1N5YA 1RTHB 1LW2A 1M5HA 2HBQB 9ATCB 5KT7A 1FRXA 1CVJA 3LP2A 5IQQA 3BSAA 1MROA 1E6YA 2MJNA 3KLGA 1Q81T 2D41A 4DPWA 2FJVA 1R0BG 1HBMB 2QT7A 4IRCA 3JQMA 2HQDA 4OLOA 4M5KA 1JX4A 5A0YB 4FS1A 1T11A 4DPXA 1W26A 1M5OC 3FCHA 4L76A 1KSPA 1B4SA 2VFUA 4BHQA 2D1CA 3BR9A 1NJZA 3NCPA 2CQHA 1R27B 3NL0A 2R8IA 2EK1A 4CO1A 4L73A 4OZLA 5HVFA 3DM2A 3MR3A 3W61A 1P8GA 4JI6J 3K89A 3HK2A 2UXDJ 1UWBB 3KJFB 2EPIA 5ETPA 1S0NA 5I42A 2FVRA 1VQ4S 2VB6A 3LUYA 2ZKUA 2VG7B 2NXNA 3VR1A 3DMJB 5K5MA 3M30A 1CC8A 4DFMA 4Z2XA 5J2MA 1UPMB 5HQ8A 4OHZA 4K4WA 5KOWA 1YGYA 4IFVA 2CQIA 3NS5A 3Q8VA 4KGXB 4ETXA 4B3OA 4YB7A 3DXSX 4TU7A 3CXCR 4DR3F 3VALA 1T3OA 2Y8YA 4ECWA 3SEOA 2QRRA 5AT1B 3CCZA 3FBFA 3IS9A 3DOKB 2OGUA 3R5AA 4Z7YA 3V6HA 2WAQD 2AGPA 1H2TZ 3JAMY 1JLCA 3GCXP 4MKBA 3PY8A 4ZVOB 4Q0BB 1ICEB 1VJWA 3J7Z5 3CMAS 1R31A 1IBCB 1ZA2B 4WIQA 2ZH5A 1BWEA 3M8RA 2VZ9A 1JKHA 4QPXA 4LF8F 4P52A 4DPTA 2RH3A 3NMAA 4NMXA 3UVJB 3EZUA 1DAXA 1VQPS 3CC4S 2E7WA 3HD2A 3CPWR 3PTWA 1AZSA 4UYJA 1J5OA 5H9EK 3PX6A 2QL9B 3S8SA 4H4MB 2MKYA 1RB0A 4QJVA 3KJVA 4P74A 2DEJA 3F73A 4OJ1A 5IC6B 2HNZA 3JQJA 2FY1A 2KXFA 2AYEA 3SBMA 2E5HA 2I5JB 2HQCA 3AOBA 1T05A 2U1AA 5ETNA 3WQPA 2ZFHA 1L3KA 2MB0B 4DR3J 3HSZA 1K8AT 4KBIA 1H2VZ 4PWDA 3MR5A 3ET6A 1S4FA 5CZVA 2X7IA 4R5PA 2XSFA 1NJIT 3MCSA 3Q0AA 1PJ6A 1YLXA 5IOLA 3RG6A 4OYXA 4ALZA 3CCUS 4CLUA 3FEXB 4CLFA 1R6YA 1WHXA 1U49A 2F8HA 4USVA 3KMQA 1F9FA 1QM9A 4TY8B 2BE7D 1I94F 1K44A 4AQYF 2MLYA 4O44B 4ECUA 5HLFB 3NLCA 4JI8F 3MMCA 1PBAA 3DN9A 1AYEA 4J9MA 3ZTRA 5EWEA 2QA4S 3DLGA 2GA7A 3A13A 2BXJA 4FYWB 3HDSA 2A90A 3CSKA 1T9XA 3RRKA 5LSLA 2KRBA 2G13A 2G2OA 1S97A 2IM1A 4M5DB 2MQ8A 2EFQA 2XGPA 3KLFA 3B82A 2V4QA 2UV8G 4HVZA 5D4OA 3TANA 5CD4A 4A48A 1RKJA 1KN6A 5DQHA 4IQMA 4EI2A 2KKHA 1S1UB 1X4DA 1XWLA 4AFFA 3QJPA 1JLFB 3R5BA 1N0VC 3CNQP 3UVJA 3MHYA 1VQKS 1GTEA 1JNRB 2YNIB 1FKOB 1OMSA 2IJRA 1ITPA 3KLEA 2V69A 1R6VA 2BJ9A 1UJ5A 1PCAA 1NEEA 2Q66A 4JI5F 1CBKA 2GMJA 4H4MA 3M8WA 1DURA 1S1TB 2VHGA 3QIPA 3CCQS 2BE9B 1R8HA 1UVKA 4OMFG 5GAGI 1RSCA 4QWEA 1IBMF 2ZBIA 4I4BA 4PWUA 1I94J 2CAJA 2DPIA 2J7UA 4AQYJ 2P2CB 5KT6A 2Z2LA 1YJNS 2B9EA 3NY0A 4JI8J 3KUHA 4ZP9A 3LF0A 2DGXA 2KFZA 3BQ1A 4A8OA 4KT0C 4M5JA 4OIXA 3OTDA 4GC6A 4J9NA 2HWIA 3OJUA 3BO4A 3SQOP 4JV2A 2V2ZA 4U7CA 3MM8A 4CTAB 1R43A 3IFEA 1B70B 2B3TB 5B0BA 1UPPA 1VQMS 4P9SA 5MLCV 4IR9A 1S1XA 3QRRA 3JTOA 3HJVA 3MCMA 2KHCA 4DUYF 1TELA 3VGSA 1R8PA 4PR6A 4CNZA 1F9HA 4K8RA 1PAEX 2EFPA 4QYRA 2IRXA 1RWXB 4JI5J 4YS2A 1LW0A 3DRXA 1N5TA 2R42A 1X4HA 4Y2AA 1NSPA 2OPSB 2LQBA 2QA2A 1ZM9A 1K47A 2J9EA 3KUGA 2DHAA 4NZ6A 4JI7F 3C6TB 5ADZA 3OTOF 1IBMJ 4ILRA 4X84A 3MMAB 4DSIA 5DLGA 3L09A 1S6PA 2LECA 4UOHA 2Y1LB 2IYGA 3RJMB 5GAGU 3LWMA 4WU2A 1E8OB 2KT2A 4RBVA 3VTIA 3ITHA 1LEOA 2GQCA 3JXOA 5IS2A 2DJWA 2Z57B 3D0IE 2OIHA 1WORA 3GIRA 4GYYA 2FGOA 1EARA 1ZM2A 2RQKA 1RWWB 3OT9A 1PC4A 2B4VA 1KHVA 4KC5A 4Q43A 1P9QC 3R5CA 4DUYJ 3Q8YA 1RHUB 1FXLA 2YVSA 3ENQA 1DLOA 2CKWA 1Y3JA 4FP9A 1FX4A 2MKCA 2MHNA 2D9PA 3GFHA 3ILJA 3VCDA 3DRYA 2DB1A 4AD6A 2Z8QA 1U1OA 4CO5A 2HVZA 1Q5YA 3P45B 1ZBTA 2QC3A 3UD5A 2FLPA 4JI7J 1UVJA 3OTOJ 4PWWA 4A8WA 3K17A 5G0RA 2D74B 4LRAA 4ZP6A 4XTTA 8ATCB 1I1GA 1JJCB 1VMBA 4K2XA 1PJ7A 2V8DA 1M90T 3AD8C 3AXMA 1SC3B 2E1AA 4J91A 2RSFA 1NK6A 5LL6d 1CJTB 1JLGA 4H4OB 3BSOA 2RD5C 3W2WB 3N6LA 1U24A 5AXLA 4DFKA 1NHUA 2VPWB 2EW9A 2IMWP 2F7VA 5F8IA 1RK8A 2CPFA 2I8EA 5CYQA 2ROGA 4RNMA 2VC1A 2F8MA 1JLAB 2NPIA 3SFGA 1Z1ZA 4MKVA 2RKIA 1F3VA 4D3GA 2QYGA 2IDEA 3VF0B 2IMOA 1UEUA 2NYIA 2RF2B 2LA6A 1IWGA 2H4WB 4C4WA 2GFFA 4RR5A 4LSNB 2ZE2B 1KQGB 2HK3A 1RT7B 2H48B 2X3GA 1WC1A 5DDOC 3A3PB 3JTNA 2XG8A 1GH8A 3DLHA 3M2VA 1FFWB 2HVIA 1NBEB 1FJEB 4J9OA 5BNWA 3S1TA 4URSA 3LALA 1FFSB 1YSJA 2OMOA 1B99A 1X31C 2VASA 2MZRA 1U26A 2CNKB 1MNEA 2R8GA 2DTJA 5H9EJ 2RS2A 2X5GA 4UYKB 3MFIA 4TVAB 3GFZA 4I64A 2IJFA 1SUQA 2BM1A 3X3UA 4EU0A 1RABB 1TL5A 5DDQC 4DSFA 4PUOB 3JSMB 2DRBA 2ZBRA 4J5OA 1NPPA 1JLQB 4IRKA 3GCWP 1Q7YT 3HVWA 4IKAA 3AY0A 2DNMA 3GJQB 4Q44A 3J81j 1TFYA 4ZIVA 4LRFA 3CVKA 3TARA 1HBOA 3D3BJ 3CTRA 5KT3A 3GQCA 2HS3A 2DGUA 1NSAA 5CCMA 4RBTA 4NI2B 5CA5A 5MAOA 3CF5Q 1WHWA 3TJ9A 2ZITA 1G7CB 1RAGB 2Y1IA 2V34A 4PYAA 4IUFA 4PXBA 4LF1A 1CJUA 1XC9A 3MEKA 2AJ1A 1N54B 3HSDA 5LJ3Y 1N5QA 3J7AN 3HMJG 4I2PA 4QW9A 3FBCA 2XY7A 1HNWF 1VJQA 4C6AA 1HQ2A 4BC9A 3P3DA 3M1VA 4IOAQ 2CWKA 2QL5B 2UVUA 2YWWA 4WXWA 4TLQA 3IG1B 3TA2A 4ES1A 4KV8A 1S7IA 3N79A 1XIQA 3LGNA 2OPRB 4WBFA 3UCGA 3PR5B 3MM9B 1NZAA 2ZE2A 5D8HB 4YB5A 2HS0A 4E8UA 4QWCA 3KK1B 3LPEA 1S99A 2XZTB 3VAGA 3HKZD 4A4JA 1UCNA 3SMZA 3GPAA 5JXSA 2ZH6A 5LXYA 4RWWA 4CO2A 3C46A 2CVEA 3RBXA 2DK2A 4WKYA 1W2IA 2J6SA 2FHMA 3HHKA 2RQCA 4LR9A 2ASYA 5B0EA 3KG4A 3PHTA 3H42A 3MPWA 4QR1A 5DDRC 2XS7A 5M2RA 4N47A 1QVFR 3OR2A 2IC3B 1AUSL 3PRDA 3PYGA 4ZLPA 3ZFVA 2CQGA 2CQCA 2QYCA 2W2OP 4PG5A 3MI7X 4KTQA 4OHYA 1D8YA 3C14A 1Q4RA 1BGXT 2ACYA 2C2ZB 3FBEA 4ZJLA 5D78A 1QAXA 1HA1A 2NZCA 3L7PA 1RWUA 1HNWJ 1RT4B 4NASA 3UFCX 1FRMA 1BXNA 2HHWA 2I38A 3MMBB 5C1DA 4RKUC 2HMIB 3EWGA 2C2MB 1FRIA 2QMXA 4NL5A 4CCHA 1WD6A 2F40A 2HVEA 4OI0A 1V9OA 4CO0A 2FFGA 2YWEA 2ZWOA 3C6UA 1IKXB 2HBRB 5KFVA 4ED6A 1UW9A 4X4SA 1BD6A 1HWIA 2UP1A 4DJBA 3W5YA 1FWKA 4LSLA 4B3TF 1BHNA 2BE2B 1NK7A 3CT9A 3D54A 3MCNA 2C2RA 1VQ8S 3RAMA 5E3PA 2BQ3A 4XK8C 2M3DA 4I2QA 1IQTA 1O0PA 1TK5A 3BB5A 2VA3A 2BJ1A 3FBBA 1IKYA 2CQ0A 3IC1A 3M8YA 5ETMA 2IM0A 4C11A 3U1MA 2NUHA 1FVSA 1RQ0A 4P2SA 1FKPA 4RZRA 3QT5A 3R6GB 3U02A 2DNYA 1M1HA 2IY5B 3GP9A 4ELUA 2F8EX 1MMNA 2G4BA 2BA9A 1HPZA 3VVTA 4QR2A 3Q8PB 3RYLA 3SCIE 5KG5A 2A0FB 3R27A 3Q2TC 4Q5VA 2A18A 1FRHA 1U2CA 4RWXA 3IGVA 3BBCA 4DMZA 1SCJB 3QZ8A 4YUDA 1A0OB 2E5IA 5E0OA 4DDFA 4U96A 2GHVC 2HHQA 5EUHA 3IWLA 3MD1A 2AT1B 3R5JB 5J1PA 4J9UE 4B3TJ 1T9WA 4EFAC 3Q86A 2XS5A 4W4MA 4X4NA 1V3ZA 5KFKA 1KVIA 4DG1A 2FHOB 1WDTA 4IFYB 3UWTA 1M0SA 2GZOA 2CUYA 3AA9A 1S6QB 4FVMA 2UVRA 3AFGA 3C66A 3V81B 1V5IB 3AOCA 2E5LF 1U25A 3G82B 2EWHA 5CYJA 3HHNB 2OJ3A 1RA6A 4DR5F 3R1HA 1NHKL 2AJ2A 2YNFA 4ZKAA 1KVJA 3R6LB 4I7FB 2NS1B 5D0HA 3MTJA 3ZZTA 4OI3A 3THPA 2CWXA 3PYFA 2DO4A 3EZ5A 2P9EA 3OXLA 2KG0A 2M2BA 1SQGA 4JYAF 3QLHB 1C0TA 4OX7A 3R5GA 4Y2KA 2E9ZA 1RDRA 3KLIB 4NLWA 2G0IA 4ED8A 3ETMA 4PEOA 4DHVA 4OJ3A 4B3SF 1HMVA 2LXFA 5DG9A 5CABA 4XDCA 1YZ7A 3POTB 1O5JA 3KWMA 5AXNA 1KTQA 1VYAA 4A8SA 2NXEA 3F0NA 1S1WA 4PXEA 4ZPVR 4PRFA 2VU5A 1EETA 3MXHP 1W7WA 2E5LJ 2ZZNA 1N33F 3M2RA 3OTCA 5A8RA 3MEGB 4X4VA 4DR5J 4DI6A 4DPOA 1FWPA 3VAHA 2CJAA 4WJBA 2IM3A 1JIHA 3GR1A 5EWFA 4NEYA 2MZQA 1LFPA 3IWXA 1UAWA 3T5LA 2MQNA 4O4GB 1JNZB 5HI7A 1TMMA 4B9TA 2QA4G 3A1YG 1NLKL 3M2UA 1X0FA 4JYAJ 3DLBA 1LK5A 2JNJA 2PDAA 1F0XA 4NLSA 4IFYA 5KFHA 4EGLA 2DXDA 1F5AA 2Y3YA 2KU7A 1FEEA 3KJNB 1ROFA 2GQ2A 2LVWA 3G9CA 3V81A 3UDCA 4MAKA 2R8KA 4B3SJ 3H20A 4B9MA 2X3DA 1OY8A 4FNHA 1DQ8A 4DL5A 1V5VA 4A46A 3PW4A 4C3KA 5GVQA 5B0AA 1U0HA 5F41A 5GMEA 1RKIA 3BYPA 2MKHA 2IAJA 3TAQA 1URNA 1QSLA 2VBXA 1U4BA 4X64F 1UKUA 3DGVA 1Y5NB 3N9UC 4FXWA 4BCAA 1UW4A 1N33J 3FNNA 2HWHA 2P5VA 3W65A 2PEBA 2CQ4A 3Q23A 2XHCA 1XMQF 5E3CA 1NB7A 2ZUGA 4KSEB 1WOOA 4G1QB 5IV4A 1D9AA 2JJ4D 4F7VA 3HCXA 1U7LA 3OFHA 2IA0A 2JVOA 2MQOA 4Y65A 1SB6A 3DDIA 2DNQA 3GTYX 2R7UA 1G6BA 2HHSA 1C1BA 3ZTQA 5CHCB 4YB6A 4BBYA 4FNIA 3KK2B 3QT7A 2KT3A 2G9OA 1RT1A 3TZXA 4HI2A 1N52B 4AL5A 4P7TA 1F5BA 1REVA 4FS2A 3NXZA 1BQMA 5KFGA 4R0JA 2H3EB 3P4UB 2VFVA 2Q3PA 2ZH8A 4MK8A 3DHWC 4KPCA 2MSTA 3C15B 2C22A 1S0MA 4FBUA 2XCPA 3O5TB 4PXDA 1RHJB 1WEXA 1RTDA 1VRUB 4NRTA 4NCGA 2O01C 2HURA 2W8LA 4UQTA 4FYVB 5FIIA 1Y3KA 4CLSA 4X64J 2XZDB 2MSSA 3W3SA 1S0VA 4NWBA 4KHRA 3W8PA 2DH7A 2WVFA 3EM1A 3HFVA 5C2CA 3IBWA 1VHFA 1XMQJ 2Y0SD 1MMDA 5ETRA 1FRLA 4P2XA 5KT4A 2EFNA 2XS2A 1WF1A 3K5OA 2HYIB 1YTYA 4F4ZA 2F9DA 3QPIA 1AXQA 3GYXB 1U2FA 4KGMA 3DLKA 1WG1A 2V2VA 1PYSB 3KG1A 5KFRA 2K06A 4ZCIA 3G2XA 3HXMA 2IBOA 4JV5F 3OLBA 4HT5A 4OI2A 3NGDA 4KH1B 3OTEA 1B7FA 2J76E 3CCWA 4MFBA 2DNLA 5C5JA 4CLYA 4DPUA 4O3PA 3ETOA 4NLRA 4GVLA 4C0BA 3UCUP 1C0UB 4GKKF 4ZS6A 4ZN3A 2OPPA 3AHPA 2CNNB 2N7YA 1Q86T 1M5SA 4J9PA 4ECSA 3TWZA 2FJBB 2ZD1B 1HYSA 3HHLD 2VKRA 3LP1A 4DQRA 4EBEA 1HWUA 2W9BB 4OJGA 3M8PB 5ITHA 4NOHA 4C8YA 1X0PA 5U47A 2B7CB 4JUZA 2K1RA 1T9YA 4OYAA 2IRYA 4ZPWR 2W4DA 2ATLA 2W7PA 3QFWA 3I5BA 4NX9A 3CD0A 1HW8A 3DRSB 3D1HA 1HR0F 3V6KA 4OLPA 3DRRB 2KJVA 3AQPA 4HDGA 4JV5J 1PGZA 2OEKA 5K14A 3J7ZT 1HWLA 1R0CB 1XMOF 3U1NA 1S9FA 2GHPA 5DO2A 2LEAA 2DBBA 5B7WA 5HO4A 4GKKJ 3B8HA 1F5CA 4ZPDA 3TUZC 3NGTA 1FJGF 4C0HA 5KFOA 2EFGA 3GG0A 1TKTA 2DNOA 2DEIA 3I56S 5HANA 2OSQA 2W7OA 4QPTA 3TO8A 3RW6A 4UZBA 2B4UA 1FESA 1KKHA 2VPYB 2BKNA 2LDYA 4N41A 4X4TA 5DG8A 4DQPA 4CYUA 1VC6A 2ZUAA 1S72S 2PA3A 4GVBB 2NPFA 1TKZB 4K4VA 2HHHF 2PE8A 1X4GA 4DU7A 2DHXA 3VAMA 1HR0J 3UE2A 1BQNA 3LPYA 1RTIB 1RLCL 4PG7A 3TUIC 4O3OA 2V4JB 4AT1B 4NPOA 2ZD1A 4G1IA 4DL0C 3SCKE 1TV6B 2ZH3A 3N28A 3ZC4A 3KHRA 3CC7S 1KR4A 5KG3A 4RW6B 5A6PA 4MKAA 3NRBA 2ZH2A 1XMOJ 4ZP8A 2P9CA 1GEHA 2DCUB 2R4FA 2VUGA 3LO3A 4RUHA 4AXJA 4UTGA 1VCTA 4RBUA 5HROB 4C8ZA 1FJGJ 1RWMB 5G4DA 2XO6A 3FRYA 3WC0A 1JJ2R 3AXKA 4ECTA 3BGRB 3MURP 3KK3A 1DQ9A 5T41A 2BM0A 2HW3A 2KXNB 2WK4A 1TU0B 1JLEB 1E6VA 4IG3A 2RU3A 2P6SA 3QRPA 3M32B 4WP3A 4CWBA 1RYRA 3B4MA 2XWXA 2EBGA 1FRKA 3NNAA 3CJKB 1TL7B 1FT8A 1NKEA 1H7XA 7FD1A 2HHHJ 1HNIB 3A8EA 4HLBA 1RT5B 2P9GA 3AQOA 3TU3B 4RU9A 3BBFA 1Z4UA 4KY3A 1TL1B 4YR3A 5D0EA 2N4DA 3H40A 5JJBA 1WEYA 1RBOB 1IBLF 2XNQA 1WSRA 4ECRA 3CDWA 2J7KA 4DZ6A 4F50A 2HNDA 4U95A 4EYHB 1G4CA 4DV4F 2JLGA 4B9LA 4MMOA 5D15A 2COLA 3BSNA 4RW9B 1NU4A 5B09A 1TKZA 3T5JA 3DDKA 3PNIA 3FVYA 2HFOA 4DN9A 1URRA 2W9CA 1B3TA 3X1LB 1JXVA 4NLVA 4MIAA 2V9WA 4ICLA 4USKA 3MEDB 3SCLE 1OJ4A 3OFEA 4HHUA 3IGNA 1CJVB 2RDDA 2YY3A 3UO0A 3AJ2A 3HULA 4IO1A 1HARA 3VGTA 4JI1F 1IN0A 2CJYB 3NEKA 1UTAA 1RGVA 2E44A 4ZPCA 3T19A 3J81U 5HN0A 2IVYA 4MIBA 1FD2A 2NREA 1WI6A 4WFXA 4KQZA 5JVGQ 1KQKA 1IBLJ 1SJ3P 3MPVA 2KN4A 4ES2A 3JYTA 4NCAA 1J2VA 2RNEA 4F25A 3W2VA 3QNWB 1RT2B 4DV4J 3PCOB 2BQUA 3GJSB 1DTTA 2BANB 4ER8A 1Q95G 1HHSA 4ZDNA 3H98A 4OZ0A 2B6AA 1YJWS 2FD2A 3T5KA 1SQEA 3GMGA 2ZJRQ 1YX2A 3CDBA 5LOQA 1QAJA 3N01A 5I4MA 3G8QA 1HBNB 1WDDA 5KFUA 2IVFB 3EXYA 3KXDA 1AT1B 3PRVA 3I0RB 3JSRA 1NRKA 3AJDA 5IQ6A 5F9LA 1TQLA 2HHPA 4M5LA 4JI1J 2AZ1A 4KHMA 5D4PA 4B3RF 4ELVA 2FHJD 2I0XA 4K5SA 1C1CA 3TUPA 2MZSA 3FJ2A 1YIJS 4F36A 1DTQA 3T6JA 5FDLA 1Q79A 1S9EB 3OVSA 3DOMB 3GR0A 1KTVA 1KOOA 4LF6F 2YKPA 3MAAB 2HIYA 1VBKA 2QLXA 4LVOP 2XYPB 3PDNA 3MEDA 4F3MA 3B54A 1TKXB 4ZN1A 4DS4A 3D6HB 1D0EA 3MTKA 2MZJA 3DOLB 2AGOA 4NMLA 2CZ9A 3GE9A 3PFOA 3A3OB 2GVDB 2FUG9 1HD1A 2RQ4A 1T03A 1ZTTA 2NSCA 3SIPB 2YH1A 4RW4A 1S9GA 3DGPA 2E5JA 3ISNC 2VJUA 2MKSA 3OUYB 3CDUA 1TUVA 1WHYA 2YKQA 2FPHX 2FLNA 4FYDA 4HHJA 3D9BA 3TJ8A 3QFHA 3BT3A 2DRDA 1RT3A 2MHEA 4B3RJ 3LP0B 4I56A 1KBRA 3FGVA 3M05A 4WP8A 3NGKA 2MJUA 4CNYA 2HBZB 2CRLA 2J9DE 3QO9A 4PYDA 4WPAA 2DGQA 2GGPA 2EBEA 1RUSA 3DFEA 1Q7LB 3PW0A 4LF6J 2N82B 1SH3A 2G2ZA 4ZVFA 3D68A 3K5MA 3MEEB 2MQQA 1I5OB 3QATA 3I0RA 2FGCA 2VKZG 1XJWB 4ZP7A 1TVRA 2UUWA 3VAFA 2DVIA 3ENAA 2BX6A 2ZBQA 1CULA 3BGLA 4CO3A 2OPQA 4GKJF 2HAIA 1OPZA 4ATNA 4UOFA 4KAIA 1XBWA 4RU2A 5KT2A 2HLTA 3HFZB 2WVDA 5FJ4A 1T95A 1N6QB 2QFJA 4X4RA 2K4NA 3D0GE 2DR6A 2HNYB 5DRKA 4IR1A 2RRAA 5D3GA 2VOOA 3SQGB 5DM7Q 2YH0A 3R7SB 4QIGA 4A8XA 4UOCA 2XHWA 3BGOP 2KJZA 3BKTA 1VQYA 3GIMA 2EVZA 3Q8SB 1FDBA 3KNAA 3OBIA 1SIZA 2VDIA 5IM0B 1PYOB 1XR7A 5KG2A 5HAOA 3V6JA 1UFWA 1HLWA 3RB3A 3TVYA 2BJ3A 1BLUA 3DHXA 2D3UA 2YQ3A 4K4UA 3LQVA 1L3VA 4KKOB 2LCWA 1WKLA 2UU9F 5CH7B 2RAQA 5AXMA 4E98A 3ZZZA 4ERDA 3LH2S 2FC8A 5T7LB 2YKNB 5SUHA 3CCVS 2ZDPA 4GKJJ 2AEJA 2XMWA 3I6PA 4YOEA 2WB4A 1JXEA 4FXDA 2E1MC 4TQRA 3HHDA 2VBYA 2VG5B 4J9VA 3MEEA 3OL9A 1RT6A 2ZVIA 3E3XA 3CEDA 3NS6A 2Y1RI 4OYZA 3K8VA 3AODA 2E1RA 5J1EA 3DYAA 5AE3A 2LQ5A 3BO3A 1SC6A 2W4CA 1FK9B 4KYZA 4JI3F 3F56A 3O44A 2HQFA 2WONA 4KO0B 2BACA 2GVZB 2YKMB 1S57A 2AP6A 4OX6A 1R0AA 4LFCF 3D7SB 3IO1A 2VICA 5FD1A 2DGSA 4PAAA 1C4AA 1LK7A 2N7CA 1WNEA 3L7UA 2JL9A 1RTZA 1X4BA 3V6DA 1S1VB 2RHQB 2M7SA 2KG1A 2FZGB 4ZCLA 2F1FA 1VBYA 4B08A 1NK4A 2M88A 3R2DJ 3CD7A 1VRQC 5I3PA 3KLHA 2UU9J 4USWA 4ED2A 1TK8A 5M2UA 4USJC 2BJ7A 2KZZA 3Q2SC 3QYYA 4UT4A 1Q8LA 4JI2F 3DI6B 2XLJA 1U7IA 1Q1KA 3KHLA 2JEJA 1X9MA 4F4WA 5KG1A 2QE5A 4BS2A 4DSLA 3EZOA 4NA1A 4OYBA 3IN5A 1SV5B 1RI7A 2WVBA 3PG9A 3E2EA 2JEFA 2AZ3A 2V8HA 1RHMB 2CXEA 3RBDA 4ZJQA 3T9ZA 1CJKB 1N5YB 4PZVA 1LW2B 5AOXB 4NCBA 5IT9U 4LRDA 4DQIA 3ZZRA 3CDAA 4JI3J 1RCXB 3H90A 3UN2A 3LP2B 1MROB 1E6YB 5T7LA 2FVSA 3PYEA 3GJTB 3KLGB 1A6LA 3J80U 3M8ZA 4LFCJ 1S6OA 1TL4A 5KT5A 1FA0A 4J9LA 2HGNA 1X9SA 3K2YA 4K50A 4RL1A 1QJHA 1HQEA 4FBTA 3GZ7A 2R2UA 3BDPA 5J2NA 3VZHA 5LSRA 2M8DB 2ZDOA 4F04B 2MEWA 2XMMA 1OS5A 2D69A 2CPXA 1K73T 1RAAB 1FJ7A 2HFNA 4X65F 1BUXA 2IJNA 1KD1T 1P27B 3VAJA 1ZAVA 3D6MB 2BJ8A 4JP8A 2YKOA 4PKDB 1FK9A 2Y9HA 5CXTA 2WSCC 5E3QA 1IM6A 4JI2J 2GVZA 2YKMA 3TUJC 2V0NA 1N56A 2E1PA 3DM2B 2CPIA 2EC0A 2CQ1A 1FRJA 4ZCKA 2V63A 5IXUA 1CS4A 2I9SA 3PJ9A 3MM5A 3R2CJ 1MMLA 4I6WA 1WI8A 3ICLA 5ETQA 2DRAA 2C28A 5I42B 1MG7A 5D6GA 2CQ2A 2J8SA 2F3JA 2AU0A 3PO5A 1UWAA 3BH7B 2CA9A 4ANCA 3RB4A 3M30B 5J2MB 1T02A 2B0GA 2BW7A 4ES3A 1RAEB 9RUBA 4IFVB 3GSDA 1ELOA 3DU6A 2B43A 1ZS6A 1LXNA 4B3OB 5DQIA 1HD0A 4O4RA 3ZO7A 3UDLA 1U48A 1VRTA 4L75A 3D1OA 2NXJA 3G4SS 4NLDA 3VWSA 5HP1A 1TAQA 2Q6CA 4X65J 5KAKA 4X4OA 1VQOS 1EKRA 3HHLA 2J0QD 4F2RA 3HO1A 5AOXA 1JLCB 2X1BA 5L39A 5I3QA 3JB9k 3PVXA 3WBZA 2IM2A 4XI9A 5J2QA 4QYZK 2VF3A 1JKHB 3K5PA 4DFJA 2WVCA 1Q5VA 2PD1A 4WWSA 3J7YI 2W2PP 4ECQA 3DC2A 2XBPA 5K8PA 1AZSB 4UYJB 1J5OB 3G71S 3PE4A 3ZXWA 5D77A 2Z2ZA 4RJVA 3KJVB 4P72A 2AX0A 5KFCA 2HNZB 1HI0P 2AD9A 3NBPA 3QWUA 1WC0A 5H9FK 1FX2A 1T05B 5HSPA 3TAPA 2KFYA 5B08A 3W63A 3G6XA 3ENWA 5D4LA 2HHVA 5B0CA 1MWYA 4CO4A 1RJJA 3V5RA 1HNVA 4PWDB 2QO3A 3ET6B 2YQ1A 1SKSA 4DR7F 3D2WA 4R5PB 5CZXA 5F8JA 3MR7A 1VS3A 3WDOA 3OVAA 2MZTA 3T1AA 3IR7B 3CJ3A 3GILA 1L3UA 2QLWA 5J2PA 2RUGA 2LU1A 1OYEA 4RW8A 3UDVA 2DGVA 4FKYA 2WVEA 3M8QA 1LKZA 2VH7A 2QN6B 3EPIA 4QWDA 3UN5A 2CDRB 2DIUA 2CPHA 1H72C 3MMCB 4ANDA 3M4XA 4ZVEA 1VISA 2B9YA 1HW9A 3DLGB 1I6JA 3H0PA 1X5TA 3RZAA 4GC7A 4ED0A 3N6NA 3FZ2A 4CDIA 3J7YU 2K7JA 3GU0A 5HQLA 3BH6B 3GSIA 2NXUA 5L1LA 4V19J 4R8UA 4WFYA 4HACA 2C3OA 1GMVA 1N4LA 1UL3A 4H4KA 3NP5A 4DUTA 2YNGA 2RRNA 3IA0A 3NCQA 3NWRA 3KLFB 2WHOA 3BV8A 4LIWA 1A9NB 1RU1A 2R7OA 5HL7Q 3TVZA 3CCJS 5DZ7A 3NNHA 1YHQS 2HRTA 4DR7J 3KLEB 4YDXA 2MLXA 1Y5LB 3O6QA 5L1IA 1QLNA 2QMUB 3EGVA 1Y7PA 2YXLA 2GMLA 1DQAA 3QIPB 2E9RX 1HBUA 2DR5A 4ZPTR 2N4CA 4DV5F 1S59A 3RU0A 1BC6A 2QSWA 1FE4A 4USTA 2UV8A 3RAQA 1RU2A 4CI0B 4HEA9 1EP4B 2H65B 2F9JA 1GMUA 2C1EB 8AT1B 4USMA 3LGHA 5C2GA 4HR2A 3Q8RB 1PIEA 1CQMA 5HJYA 4ED5A 3CD6S 1VIOA 3MM8B 4XO0A 4HTJA 2FZCB 1REGX 5LM7E 1U0SA 2DXFA 1H74A 1KDNA 3A8KA 1S1XB 1YZ6A 4Z7CA 1ZH5A 3R9LA 3SV4A 3GIJA 2C3PA 3SCJE 3QBCA 4IH5A 3MOJB 4EEYA 1SQFA 2J0SD 3IM9A 1LW0B 3D6FB 3TQEA 1KS2A 4ZVRB 2VQFF 1SKUB 4DV5J 3MPYA 4KFBB 2JC0A 3IRXA 3MPDA 2B4OA 3MUVP 2RT3A 4EZ9A 3MAHA 1Z2ZA 4Y2MA 2HZVA 3PEHA 1Q8IA 3U7JA 3PV8A 3HT0A 1S6PB 2HKEA 2YNHA 4IDKA 1NK5A 3OJSA 4ED7A 3DLEA 1SVDA 3EGWB 3ITHB 4I6YA 3HZGA 4RW7A 2V2KA 2NCKL 3VQSA 4FZVA 3TAMA 4ZPAA 3PKYA 3VHQA 3MAQA 3OQ2A 5HK4A 4XAKA 1QY7A 3G6YA 1DLOB 1EP4A 3L9ZA 2KVIA 4Q8EA 4QU7A 3MGJA 4K0KF 1GQEA 3B4DA 2B8QA 1LOUA 4AY5A 2GCFA 4LF2A 4ECVA 5CAAA 3CCMS 2LEPA 4CH0S 3KNGA 3PW2A 2R7XA 4UZCA 5KFDA 2X5HA 8RUCA 1QD1A 3GFXA 2VQFJ 3J81Y 1LNQA 1PC5A 2XMAA 2N3OA 2DNHA 3DLJA 4UF4A 2D3O1 5F9NA 5HQMA 5GMDA 2RS8A 1IM4A 1RWKB 2YX4A 3P8BB 4ID5A 5G0RB 3P5BP 2FHJA 2B56A 2C2EA 4TKTA 2QEXS 3W9JA 3OSNA 5ETVA 4LSZB 2YTCA 4DV2F 5A8WB 4ETZA 2AV5A 3OV7A 3QGGA 1FF2A 1UZHA 4UY85 3TA0A 1JLGB 4DL6A 3ZZOA 3GV8B 2DPJA 2LA4A 1IKWA 2BW2A 4ZITA 1GTHA 4A8YA 3KTQA 1FTCA 4K4YA 2EFOA 4KFBA 5CYQB 4YDDB 5F3ZA 2QSFA 1OWXA 3J7A1 2QL7B 1WF2A 5DS7A 4H54A 2XULA 2RKIB 4Y3CA 4B9UA 4Y0FA 2XY6A 5HMYA 4K0KJ 2FZKB 2VG6A 3ZTPA 1PILA 1RE1B 3I0SB 2CPDA 4KR0B 4DX6A 4WK1A 1WKKA 2JOQA 4DV1F 4ANEA 3G8TA 3M2VB 4QYZJ 4F4KA 3Q24A 1XK8A 4URQU 2FVCA 2GO8A 3DU5A 1NZ8A 2G0CA 2IFXA 3C16A 2VPXB 2YKAA 1AROP 3N4WA 3I4HX 4DV2J 4L3KA 5ETOA 3W9HA 5F8HA 4N76A 3KYLA 2WBMA 3N6MA 1XMBA 2D3ZA 2KVQE 3TI0A 2GJ2A 1IJFB 5IC4B 2HS4A 5GADI 1SUQB 2QLJB 1F2HA 4IRDA 2RDIA 3FEZA 2HFVA 2H5EA 2KM8C 4NLGA 2O67A 4QW8A 3TW0A 3DRPA 3PACA 2E7XA 1KNZA 5GAHI 1TL3A 1UP1A 3G96A 1UJRA 3FSXA 1HBOB 1JMTA 4BWMA 1ZOTA 5A8WA 2R3VA 1B7YB 3MR2A 3ONQA 1U45A 1JLBA 2YWFA 3CE8A 4U7UK 4OI1A 3HZEA 4DV1J 2VONA 1CJUB 4QOTA 2PSZA 3LAKA 4I68A 5IT0A 3P96A 4KGZB 3HLUA 4OL8A 2FJDB 2MZ1A 3H4DA 3A12A 4I2PB 3OXGA 4CH7A 4LFAF 5J1NA 1TTHB 1SPBP 4DBQA 1R7IA 3SDEA 4I69A 2UUBF 3I82A 3M1VB 4OHWA 1FERA 5T14A 4LRCA 5KFBA 1XERA 2K2PA 4KV8B 3THVA 5F0UA 1RAIB 3I0SA 5KFZA 3HF5A 2VBWA 3U1LA 4M95A 3FFIA 2RRBA 1S12A 2UVVA 4X62F 4M8LA 4AL6A 3THTA 5F8LA 2PA8D 1FNOA 2KTQA 4XIUA 3OMSA 2RHSB 4Y34A 3BREA 3ZZUA 1HHTP 4P75A 5CCLA 3LA0A 2FVPA 5LMNF 2YPZA 4CLWA 4TXSA 2IIHA 4IYQA 3G8SA 2IBKA 2XYHB 4CLLA 5GAHU 2ILYA 2OEJA 3OR2B 1PSDA 4QBUA 4M5MA 2P8IA 2V6AA 5C25A 4WE1A 1T0TV 3MM6A 3QIDA 1D9FA 5F8GA 2ZHBA 1TR0A 3UR0A 2CPYA 3C14B 4B9NA 1O51A 2BBEA 3I96A 4LFAJ 2HBYB 4QIVA 5SZTA 2A2DA 1OO0B 1MWQA 4KPYA 2OFHX 2EK6A 2C2OB 2G0JA 4AYBD 2UUBJ 2NUUG 4TLRA 5AXKA 1SBRA 2BV3A 4LR8A 2CYYA 3K5NA 3EX7B 1Q0NA 3NS7B 4IOCQ 2BKOA 5K8NA 2HIQA 4X62J 1K0TA 2PIIA 1EKSA 5K8OA 3GYNA 2DKOB 3BDEA 2OLWA 1L3SA 3C6UB 3CJ2A 2ATCB 4GZ5A 1NDLA 2W7AA 1UA1A 1JWWA 3O8WA 1VC0A 5JVHQ 4LSLB 4TU9A 3FRZA 4TNOA 5B0GA 2ZH7A 2ASJA 4MH8A 1WF0A 1TKDA 1B64A 5LMNJ 4KB7A 3GIIA 2LLZA 4I2QB 1N34F 2MXYA 3R8YA 3H7HB 2CJXB 1IKYB 4DX5A 1RA7A 5HJXA 2EEYA 2AYMA 4USHA 3HVTA 4Q8FA 4C11B 2B4PA 3PX4A 3OFFA 1K9MT 5L38A 1Z2LA 3E51A 1FKPB 3T3FA 3MM7A 4ED3A 1MN7A 2XYGB 1UEKA 3HD1A 4U8YA 2E7VA 4O23A 2XQCA 1T9UA 2MLZA 5AJ3F 2WOMA 2W4PA 2ZEJA 5KOXA 3PIOQ 4FF1A 1HPZB 2AJ4A 2XTJP 2PMZD 3UDEA 3IAM9 2R7TA 4FPRA 3BS9A 1MU2A 4OX9F 1QMOE 2WW8A 1AB8A 5K20B 1FHTA 3MUMP 4HKQA 4IOBA 4ZIWA 2H4YB 2M70A 5HBMA 5ETTA 3M6XA 3QAEA 1U1MA 2WZ1A 4UQGA 1GNKA 1LQ9A 4LBHA 2BJDA 1LWCA 3MFHA 1HQUA 3EVMA 2DR9A 4YR0A 5KFMA 3S6EA 2JEIA 5KFEA 4DSKA 4PXCA 1JJHA 2ZBCA 4DG1B 3ITWA 2AQ4A 4Z37A 2AGQA 3BM7A 1N34J 3CIZA 1R8BA 5IWAF 2VA2A 4DL4A
chains in the Genus database with same CATH topology
4QZVB 1S1XA 4ELVA 5IT9Y 1H3DA 2FHJD 2I0XA 3JTOA 4K5SA 5K8MA 1C1CA 1HNVB 5CQGA 2KHCA 1R89A 2MZSA 4DUYF 3FJ2A 1YIJS 2O1PA 4O3SA 1R8PA 4PR6A 3QAUA 4CNZA 3F41A 3H4BA 1KONA 2CZ4A 2YNFB 1CLFA 4Q45A 2C3YA 1HI1A 3J80Y 1DTQA 2EFPA 3T6JA 5FDLA 1Q79A 4ID8A 3C8YA 4QYRA 3BJYA 1S9EB 3MECA 3OVSA 4OZ5A 4G1QA 2ZVSA 2IRXA 3JSBA 4XPEA 3GR0A 1YWXA 4LIRA 4CH1A 3PIPQ 2L08A 1KTVA 1KOOA 3OVBA 2R8HA 2W9AA 4LF6F 1X4RA 2YKPA 5LMUF 1LW0A 5J2PB 2IRUA 3QGHA 1U1QA 4U67Q 2QLXA 3DRXA 4LVOP 1N5TA 1X4HA 4Y2AA 3MOZA 3PDNA 4RW8B 3MEDA 2OPSB 2LQBA 4F3MA 1C0TB 1KOHA 1OSDA 2E9TA 2MGZA 4OI4A 1TKXB 3OLAA 2QA2A 1ZM9A 1L3TA 3M8QB 1WACA 5BJRA 2J9EA 1X4AA 4DS4A 2DHAA 4NZ6A 5DGBA 1D0EA 3TP2A 2B51A 2PT0A 2ROPA 3C6TB 3MTKA 4JI7F 2MZJA 3DOLB 3KK2A 4YFUA 1OPIA 5ADZA 2AGOA 3OTOF 4C0OC 4NMLA 5A6WA 3GE9A 5A8KA 5KFPA 6FDRA 2JFDA 3PFOA 4ILRA 1SKRA 4X84A 4A47A 5DJBA 3MMAB 4R25A 1HMVB 2FUG9 3E01A 4DSIA 1HD1A 2E5GA 2RQ4A 1FE0A 5DLGA 3L09A 1T03A 1ZTTA 4NZ7A 1S6PA 2LECA 2V8GA 3KKFA 2IYGA 1P6TA 2NSCA 2KDOA 5GAGU 3LWMA 2YH1A 4RW4A 1S9GA 4LT6A 4WU2A 1E8OB 3DGPA 2E5JA 1MW7A 3ISNC 3ENVA 2KT2A 4I67A 2XEXA 2MKSA 4RBVA 3OUYB 3CDUA 2VFRA 2BJEA 2GX8A 1Y0HA 1TUVA 3VTIA 1WHYA 3ITHA 4R8UB 5IT4A 2GQCA 2YKQA 4ZOSA 2FPHX 2Y1JA 2FLNA 4FYDA 4HHJA 5LXRA 5IS2A 1F60B 2NR0A 1S1WB 2DJWA 4O3RA 3D0IE 2ZOMA 2YWKA 2OIHA 1NJXA 3CCES 2YNGB 1U6BA 6FD1A 2MDAA 3BT3A 1VRUA 2F4VF 4CQ1A 1RT3A 2AW0A 3SV3A 2RJZA 1EETB 2RILA 1NKBA 3UI3A 2LU2A 3M2RB 1H98A 2MHEA 4GYYA 2KYXA 2FGOA 5A8RB 1ZM2A 3AH6A 2RQKA 4LVNP 4KJIA 2XLIA 1X7VA 1PC4A 2B4VA 3LP0B 4L3NA 4I56A 3G6ES 1KHVA 5L8RC 3LOUA 3FGVA 3AB4B 3M05A 4KC5A 3LGMA 4Q43A 1P9QC 2KHDA 3R5CA 4OJHA 5M2PA 1FXLA 2PC6A 2YVSA 3ENQA 4BDPA 4XIFA 1NK0A 1QE1A 1DLOA 2CKWA 1LWFA 1Y3JA 4FP9A 3NGKA 2MJUA 5IZHA 2MKCA 4NLUA 5BYRA 4CNYA 2MHNA 5CYMA 2CRLA 2D9PA 3GFHA 2HHXA 2J9DE 3VCDA 3QO9A 2DGQA 2GGPA 2EBEA 3DRYA 2DB1A 3DFEA 3N5BA 2Z8QA 1YITS 3V4IA 1U1OA 1914A 1Q7LB 1LWEA 3PW0A 3PR4A 4CO5A 2N82B 1HBUB 3M2UB 2HVZA 2ZM6F 1SH3A 2KJWA 2OP5A 1S76D 2X51A 4ZVFA 1CQNA 3K5MA 3MEEB 1VI7A 2MQQA 3PKMA 4MYUA 1B7FA 2CPEA 3I0RA 4ED1A 1ZBTA 2FGCA 3HP6A 1UETA 1TP7A 3LAMA 3MDFA 2Z0GA 1DBDA 2M9KA 2J7WA 2VKZG 4LF5F 4ELTA 4ZP7A 2FLPA 1TVRA 1UVJA 2UUWA 3VAFA 2DVIA 4OI6A 1NJYA 3CCTA 4A8WA 3B78A 2J9CA 1QUVA 3KFWX 5G0RA 2D74B 2DHGA 4ZP6A 3BGLA 1I1GA 2MKJA 1VMBA 4OQJA 4K2XA 4RX6A 2V8DA 3AB2B 2RB7A 1M90T 4CO3A 4Y2IA 2OPQA 3FMWA 2E1AA 2XSJA 4GKJF 2HAIA 4YR2A 4DUZF 1OPZA 4ATNA 1VOMA 4KAIA 1XBWA 4RU2A 5KT2A 2PEHA 2HLTA 2RSFA 1IKVA 4PG6A 1NK6A 1GXLA 2JX2A 2PFFB 2AJ0A 3PRBA 4KIAA 5FJ4A 5LL6d 2WSEC 3HVAA 1T95A 1JLGA 4H4OB 5A2QY 3BSOA 5KFFA 1C0UA 2RD5C 5DDPC 1N6QB 3D0HE 3IR6B 3W2WB 2IAJB 4PPDA 2QFJA 4A8FA 4E0DA 3N6LA 1V6HA 2KFNA 4X4RA 1U24A 2WRMA 2K4NA 4NRUA 3D0GE 5I3UA 4MYTA 2M0GB 2BYCA 5AXLA 4ECXA 4DFKA 2HNYB 4K4TA 5DRKA 1NHUA 1WWHA 2VPWB 4IR1A 2RRAA 1FCAA 3BGFA 1N36F 2EW9A 3H2LA 2IMWP 5D3GA 2F7VA 1A7GE 3NAHA 1SL0A 5F8IA 3GWCA 1RK8A 2CPFA 2I8EA 2B5JA 5CYQA 4WZQA 2ROGA 2VOOA 2MKIA 3SQGB 4RNMA 5DM7Q 2VC1A 2YH0A 4W90B 2F8MA 1IR0A 1JLAB 4QIGA 2W9BA 3IWNC 4A8XA 4UOCA 2NPIA 3SFGA 1Z1ZA 2XHWA 3M8PA 3M6VA 4PQUB 4HYKA 1RTHA 5JUMA 2RKIA 2JSXA 2KJZA 3TX8A 4N8NA 4D3GA 1VQYA 3L95X 3GIMA 3ZZYA 1FEHA 2XWYA 2EVZA 3Q8SB 1FDBA 3KNAA 3OBIA 2BRKA 2IMOA 3VF0B 1SIZA 1UEUA 5EWGA 1JB0C 5IM0B 2NYIA 3TAXA 2EG2A 2AJFE 2EKYA 2LA6A 1XR7A 2RF2B 3I55S 2KM8B 5KG2A 1H2UX 4WFAQ 4C4WA 1ZPVA 4I1TA 2GFFA 2CDQA 4LSNB 2ZE2B 1FXRA 3V6JA 1ZM3A 2UUAF 4LF9F 1UFWA 4O0IA 1KQGB 3RB3A 3TVYA 1RT7B 1C1BB 1OIAA 1Y00A 1HBMA 4NXNF 1BLUA 2X3GA 2MKKA 3DHXA 4TYBA 2D3UA 5DDOC 1QVGR 3MWBA 1XR6A 2YQ3A 4B3MF 4K4UA 2HHUA 1RT1B 3IRXB 2KI2A 3JTNA 2XG8A 3M6UA 4NLPA 1GH8A 3R1LA 3DLHA 3M2VA 3DRSA 1REVB 3TOQA 3C3LA 3LQVA 2HVIA 5KG7A 1L3VA 1BQMB 3DRRA 4KKOB 2LCWA 1X5PA 2UU9F 5CH7B 1ZZFA 5AXMA 4E98A 1FJEB 2YNHB 4D3HA 4J9OA 3ZZZA 3NNCA 4ERDA 2R7WA 5BNWA 4IDKB 1ZAXA 3S1TA 4URSA 3Q8QB 2W9JA 4JV0A 5A0YA 3LH2S 2FC8A 3LALA 3O1LA 4B02A 1YSJA 5T7LB 2YKNB 4ZHRB 4N77A 2OMOA 5SUHA 3CCVS 2LMIA 2ZDPA 2VASA 3DLEB 4NA2A 3US5A 2MZRA 1U26A 2XMWA 1MNEA 4Q2MA 1SKWA 2R8GA 1ULRA 2DTJA 3JTPA 3FSIA 3KMQA 5H9EJ 2J8AA 3I6PA 2RS2A 1UJ4A 2VBZA 4RW7B 1APSA 2ZZMA 4YOEA 2X5GA 4UYKB 1W25A 2WB4A 2JEGA 1RTDB 1JXEA 2NLWA 3MFIA 4WU3A 4FXDA 1RP5A 4NCGB 2E1MC 3K5LA 1K1SA 3TAMB 1VC5A 3GFZA 4TQRA 4I64A 5E33A 3HHDA 4C8LA 2VBYA 2G1DA 2IJFA 2VG5B 1SUQA 2O66A 3ISND 3MEEA 3OL9A 5EX0A 4N3CA 1RT6A 3E3XA 3CEDA 3NS6A 1Y5IB 2Y1RI 1XEZA 2RMLA 1OQ6A 3K8VA 4L72B 2BM1A 3X3UA 4EU0A 2E1RA 1TL5A 5DDQC 5J1EA 3DYAA 3RRGA 5AE3A 4DSFA 1UWBA 2LQ5A 4PUOB 4IH7A 2HZCA 4OZ1A 3JSMB 3FSYA 2ILZA 3BO3A 2DRBA 4J5OA 1SC6A 2HGMA 2QIFA 1DZ5A 3CCSS 1JLQB 3DXBA 5BYQA 2W4CA 4IRKA 5EX3A 1FK9B 2VOPA 3GB0A 1Q7YT 3HVWA 4JI3F 3S7RA 4IKAA 3AY0A 2VG7A 2DNMA 4MJKA 4Q44A 3F56A 3O44A 4CT8A 2WONA 2ASDA 1TFYA 3I32A 1FDAA 3HVRA 5EN1A 4KO0B 2BACA 4DR4F 4C2MA 3DMJA 1X9WA 2YKMB 3CVKA 4DSEA 3TARA 1SJFA 1SL2A 4DF8A 1HBOA 2D3OR 2AP6A 4OX6A 3CTRA 4IQXA 1Y4ZB 1R0AA 5KT3A 4LFCF 2LYVA 1G3OA 4RNOA 3GQCA 2HS3A 3IO1A 2Z2MA 5FD1A 2DGUA 2DGSA 5CCMA 2DGWA 2M52A 2FLOA 1UA0A 1C4AA 3DLKB 1LK7A 4RBTA 3T5HA 2N7CA 1WNEA 5CA5A 2JL9A 3G86A 5MAOA 4C3LA 3CF5Q 1X4BA 2RE1A 1WHWA 2ZITA 1G7CB 3V6DA 1S1VB 2Y1IA 3PW5A 2M7SA 2JVRA 2KG1A 3FZBA 4IUFA 4ZCLA 5D4NA 1S0OA 2F1FA 4R0EA 1UVMA 2ZH4A 4PXBA 1OSCA 1XC9A 3MEKA 4B08A 1VBYA 1NK4A 2AJ1A 2M88A 1N54B 5KFLA 2ZC4A 5LJ3Y 1KQSR 4ID5B 5F8MA 3CD7A 4FXVA 5L9NA 5IFMA 1RTIA 1VQSA 1N5QA 5I3PA 3HMJG 3CJ5A 4I2PA 3KLHA 1FD8A 4QW9A 2DITA 3N0VA 3DOKA 2ROEA 4ED2A 2V4JA 1TK8A 3SSQA 4USJC 5M2UA 4X4PA 4G1PA 1DJ0A 1N32F 4MFBB 2KZZA 3F44A 2XY7A 3Q2SC 1U1LA 2APOA 4EWTA 1HNWF 1TV6A 3QYYA 1SXLA 3GG1A 1M5PC 4BC9A 3P3DA 3M1VA 1Q8LA 4IOAQ 4PQUA 4RW6A 2UVUA 4JI2F 4WK3A 3DI6B 4WXWA 4TLQA 2XLJA 3IG1B 3TA2A 1U7IA 2MY8A 4NLOA 4ES1A 1Q1KA 3KHLA 2JEJA 1X9MA 4Q0BA 4KV8A 1TFWA 1AUDA 4F4WA 3N79A 5KG1A 3LGNA 2QE5A 2OPRB 3EPGA 1IKWB 4BS2A 4DSLA 4NA1A 3CD5A 3GIKA 4PPZA 3UCGA 3PR5B 2OPPB 1NZAA 3MM9B 4NLQA 5KG6A 2ZE2A 3IN5A 5HROA 1SV5B 2ERRA 5D8HB 3NMRA 4YB5A 1NK8A 2HS0A 4E8UA 1RI7A 3T1YF 4QWCA 3E2EA 3KK1B 2JEFA 1GXUA 1S99A 2V8HA 3VAGA 3HKZD 4A4JA 3BN4A 1B0TA 3HHEA 3RBDA 1HYSB 1S7HA 3T9ZA 5HMWA 1C4CA 3LP1B 3SMZA 2DISA 5JXSA 2ZH6A 5LXYA 3BGRA 1N5YB 1LW2B 3DCAA 4RWWA 5AOXB 3UCZP 4NCBA 1V3SA 4CO2A 1SJ4P 4DQIA 3C46A 3ZZRA 2CVEA 3CDAA 2DK2A 4WKYA 1W2IA 2J6SA 1N5VA 2DGOA 3HI9A 3LP2B 1UVLA 2ZHAA 1SH2A 2FHMA 2MQLA 2VG6B 3HHKA 1MROB 4M1KA 1E6YB 5T7LA 2FVSA 1JLEA 2RQCA 2K1RB 3KLGB 1VK8A 4ZHRA 1A6LA 3L7OA 3UW1A 4YY3F 2ASYA 1NAQA 5B0EA 3KG4A 3M32A 3MPWA 5DDRC 4QR1A 5KFWA 1S6OA 2XS7A 2GO9A 1TL4A 1U47A 2SXLA 5M2RA 3WZ0A 1FA0A 4I6AA 4N47A 5KT5A 4XPCA 4YEAA 2HGNA 3OR2A 4J9LA 4J9KA 1X9SA 1QVFR 4TY9A 2IC3B 3K2YA 5F8NA 4K50A 4X66F 2I5JA 2QV6A 3PRDA 2LXUA 1QJHA 1HQEA 3VZIA 3CJKA 4ZLPA 4FBTA 3GZ7A 2R2UA 2PN6A 3ZFVA 5J2NA 3VZHA 2GQQA 2CQGA 5LSRA 2M8DB 3BDPA 2ZDOA 1HNIA 2CQCA 2QYCA 2Z4PA 3SFUA 2XMMA 1RT5A 3SSRA 4PG5A 4KTQA 3MI7X 1OS5A 2QA1A 2CPXA 1BQXA 4OHYA 3MF5A 1FJCA 1D8YA 4CZCA 1Q4RA 2YWGA 1TL1A 2K3KA 5DG7A 1K73T 1BGXT 2ACYA 2HFNA 4LF4F 1FJ7A 1X4CA 4X65F 1HNZF 2IJNA 1KD1T 1P27B 2GV1A 5K14B 3VAJA 1ZAVA 5D78A 1QAXA 5GAEI 1HA1A 2YKOA 5E41A 1RAJA 3L7PA 3Q22A 1RWUA 3CCLS 1YRXA 3OL7A 1GX5A 1RT4B 1FK9A 4PKDB 1VBXA 2A2CA 5CXTA 3UFCX 2WSCC 3VCXA