1JNTA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jntA00
2AWGA 1NSGA 4QT2A 3I6CA 4ODNA 3UI4A 3O5KA 4JFIA 5DIVA 1Y0OA 4J4OA 2FAPA 2RUCA 2K8IA 4DRMA 3UQBA 2RUDA 2XP7A 4JFKA 5I98A 4ODLA 2KE0A 4JFMA 2DG3A 3O5FA 1EQ3A 2F2DA 1YATA 1D7JA 2N87A 1FKRA 1ZCNA 2XPAA 3B7XA 5HKGA 2MLZA 3TC5A 2Q5AA 2PV1A 5HW7A 1NMWA 1Q6IA 2IF4A 3KAGA 5GPGA 1ROTA 3TDBA 3IK8A 3CGMA 3NTPA 4ODRA 3KAIA 4JFLA 1TCOC 4DT4A 1ROUA 2DG4A 1FKSA 3PRDA 2JZVA 1W26A 4G50A 3O5QA 1JNTA 4IPXA 4JFJA 1FKHA 5D75A 1FKKA 4DRKA 1KT1A 1QPLA 1J6YA 2MF9A 2ZR5A 2MLXA 3KADA 4TYOA 2PPPA 4TW6A 3JYMA 3PA7A 2M1IA 2PBCA 2XP4A 2KO7A 3O5IA 1PINA 1EYMA 1U79A 1BKFA 1FKIA 2RURA 3FAPA 4QT3A 3NI6A 3UQIA 1Q6HA 2Y78A 4DRHA 3KZ7A 1FKGA 4LAVA 1C9HA 2KGJA 3O5GA 1NMVA 5HW8A 2PV2A 3IKDA 1FKLA 4U85A 5DIUA 2D9FA 1FKTA 1R9HA 3ODKA 3H9RB 2ZQTA 3O5PA 2M2AA 4GGQA 4TNSA 3O5OA 4DIPA 3JXVA 1FKBA 4DZ2A 3O5EA 1J4IA 4W9PA 2PPNA 1PBKA 4DRPA 2RSEA 5HTGA 1FD9A 1F8AB 1L1PA 2PPOA 3UQAA 1D7IA 2XP8A 4IQCA 1FKDA 4J4NA 4ODMA 1HXVA 3LUOA 1KT0A 4NNRA 1BL4A 2LJ4A 4TW7A 3RFWA 1YW5A 3O5LA 3UI5A 5HUAA 3CGNA 4MGVA 3VAWA 1JNSA 3JYJA 4ODPA 2VN1A 2XP6A 2ZR4A 3O5JA 4JYSA 4U86A 4TW8A 2M08A 3TCZA 1A7XA 1N1AA 2RUQA 1FKFA 4DRJA 4W9QA 3NRKA 1JVWA 3MDYB 5DITA 4FAPA 4ODKA 4TX0A 4ODOA 2KR7A 2ZQUA 2UZ5A 4DRQA 2KI3A 2LKNA 2XPBA 4GIVA 3KCEA 4DZ3A 4U84A 2VCDA 4ITZA 3UF8A 5BXJA 1Q6UA 1FJDA 3KAFA 4R0XA 5HWBA 3KACA 2ZQSA 4W9OA 3WH0A 4QIBA 2DG9A 3UI6A 2L2SA 1T11A 2KFWA 4LAYA 4ODQA 2XP3A 2ZQVA 2RQSA 2ZR6A 4LAWA 4C02B 3KAHA 1QPFA 3O5DA 1FKJA 1P5QA 2LGOA 3OOBA 5HW6A 2ITKA 1QZ2A 4DRNA 5B8IC 2MPHA 1D6OA 1J4RA 3IHZA 3O5MA 2MNTA 4FN2A 1M5YA 3KABA 2OFNA 1J4HA 2LPVA 3O5RA 2XP5A 1ZK6A 4DROA 2F4EA 3PRBA 1FAPA 3EY6A 4LAXA 5HT1A 3RGCA 4DRIA 1Q1CA 2MLYA 5HWCA 2PV3A 4O2TA 2F21A 5J6EA 1F40A 4BF8A 3IKGA 4N19A 2XP9A 1B6CA 3GPKA 2FKEA 1D7HA 4MSPA 4DH0A 4IQ2A 4G2PA
chains in the Genus database with same CATH superfamily
1Y0OA 2RUCA 2K8IA 1W1TA 3ARUA 1OWQA 1YATA 2N87A 5DO2A 4ZPVR 4ZS6A 1FKRA 5JH8A 1ZL1A 3WIJA 2Q5AA 4KQZA 1NMWA 2IF4A 3CGMA 3KAIA 1ITXA 1TCOC 3QOKA 2DG4A 3PRDA 4IPXA 4Q7NA 4IT4A 4DRKA 2MLXA 3KADA 1LG1A 1LQ0A 3ARZA 2XP4A 2DT2A 2KO7A 1PINA 2DSUA 3CHCA 1BKFA 4Z2JA 1VF8A 4NZCA 4AY1A 4Z2HA 4MNMA 1O6IA 2F23A 3ARWA 3ARSA 1C9HA 2KGJA 3O5GA 5HW8A 1E6NA 1NWRA 1FKLA 5DIUA 3ODKA 4KR0B 4TNSA 4DIPA 4L3NA 1CTNA 3WD3A 4DRPA 2P4VA 1GOIA 1LJYA 1EHNA 1E6ZA 1NWUA 1D7IA 4HBOA 1W1YA 1BL4A 2LJ4A 1NH6A 4UDMA 3RFWA 1JNSA 2PN0A 2B5UB 4JYSA 4TW8A 4P8VA 2ETNA 4W9QA 3CHFA 4ODKA 4ODOA 4DRQA 2XPBA 3CHEA 4ITZA 2FDMA 3UF8A 1HKIA 1FJDA 3KAFA 5HWBA 4W9OA 2EULA 4Z2KA 2L2SA 1T11A 1KFWA 3FY1A 2DT0A 3RM9A 1FFRA 3O5DA 3OOBA 4WIWA 1QZ2A 1J4RA 2MNTA 2XP5A 3ARRA 4DROA 4DRIA 3AS0A 2MLYA 1OGGA 2F21A 5J6EA 2DT1A 1H0IA 1B6CA 2DSVA 4MNJA 1ZB5A 1E15A 3WL1A 4MTVA 1HJVA 4JFIA 1E9LA 3UQBA 4LGXA 4DRMA 4JFKA 5I98A 4JFMA 2DG3A 3B9EA 3WL0A 1EQ3A 2F2DA 4HARA 3WD0A 1W1PA 4DWSC 1ZCNA 3OA5A 5HKGA 3BXWA 1E6RA 1K9TA 3NTPA 4MPKA 4JFLA 4ZPTR 4G50A 1W26A 5D75A 3O5QA 1JNTA 1ZBCA 1QPLA 1J6YA 2IUZA 3PA7A 3O5IA 1FKIA 2WLYA 3NI6A 1FKGA 4LAVA 3G6LA 3WD2A 3IKDA 2D9FA 1FKTA 3H9RB 2ZQTA 3O5PA 2M2AA 3WD1A 2WLZA 1W9PA 3JXVA 1PBKA 3AQUA 1RD6A 2RSEA 3ARYA 2PPOA 4IQCA 1HXVA 4ODMA 1UR9A 3LUOA 1ZBVA 1TFVA 4MGVA 4HBEA 3JYJA 4ODPA 3O5JA 2RUQA 1JVWA 1HJWA 5DITA 4FAPA 5DF0A 2B31A 2UZ5A 4R5EA 1ZBKA 3ARPA 3GTYX 4P8UA 4DZ3A 2VCDA 5BXJA 3ARQA 2WM0A 4QIBA 2DG9A 3UI6A 3FXYA 3WKZA 2XP3A 3KAHA 1X6NA 1QPFA 5B8IC 1HKJA 3ALFA 1HKKA 4FN2A 3WD4A 3PRBA 5HWCA 4O2TA 1F40A 2G41A 4NSBA 3IKGA 3AS2A 3GPKA 2FKEA 1D7HA 1E44A 4DH0A 4IQ2A 4G2PA 1NSGA 4QT2A 3I6CA 4ODNA 3AS1A 3O5KA 4P8XA 4J4OA 3G6MA 4ODLA 1D7JA 1W1VA 3B7XA 2MLZA 1LL7A 1LL6A 2PV1A 1Q6IA 3KAGA 5GPGA 1HJXA 1ROTA 3TDBA 2YBUA 4DT4A 1ROUA 4JFJA 1FKKA 1OGBA 1KT1A 4TYOA 2ZR5A 3JYMA 2M1IA 2PBCA 3PRAA 4QT3A 2RURA 3FAPA 1EDQA 3UQIA 1Q6HA 4DWSD 3KZ7A 1WNOA 4Z2IA 2O92A 1R9HA 4IT6A 4Q22A 4WJXA 4DZ2A 1LL4A 3GU0A 3O5EA 1J4IA 2PPNA 1GPFA 4S3JA 2DPEA 4S3KA 5HTGA 3UQAA 1ZBWA 3B9AA 4TW7A 4NNRA 5HUAA 1H0GA 2OLHA 3O5LA 3CGNA 3VAWA 2A3CA 2ZR4A 1E6PA 2M08A 1A7XA 1FKFA 3CH9A 1JCHB 4DWSB 4W5UA 1NWTA 4TX0A 4XAKA 1XRVA 2KI3A 3KCEA 4U84A 4MAVA 3ARTA 3AS3A 2A3AA 1W9VA 4LAYA 2ZQVA 2RQSA 4L72B 4WKHA 2QF8A 4C02B 1HKMA 4WKFA 2LGOA 1X6LA 5HW6A 2AOSA 2ITKA 2MPHA 3O5MA 3IHZA 1M5YA 1WB0A 3KABA 4MNLA 2LPVA 4Z2LA 2YBTA 1SR0A 2XP9A 1GUVA 4MSPA 2AWGA 5HBFA 3UI4A 5DIVA 2PI6A 2FAPA 2RUDA 2XP7A 2DSWA 2KE0A 3RM8A 1NWSA 3O5FA 2XPAA 3BMBA 3TC5A 5HW7A 1FFQA 3IK8A 3CZ8A 4ODRA 5GPRA 1EIBA 1FKSA 2JZVA 3AROA 1FKHA 1SYTA 4DWSA 1LG2A 2MF9A 2PPPA 4TW6A 1D2KA 3B8SA 4PTMA 1EYMA 1U79A 1ZU8A 2Y78A 3EIPA 3PR9A 1W9UA 4DRHA 3ARVA 1NMVA 3CHDA 2PV2A 4U85A 2WK2A 3W4RA 4GGQA 3O5OA 1FKBA 5GQBA 4URIA 4W9PA 2A3BA 2ESCA 1FD9A 1F8AB 3ALGA 1L1PA 3ARXA 1JNDA 2XP8A 4J4NA 1FKDA 1KT0A 2G8ZA 1YW5A 3UI5A 1UR8A 2VN1A 2XP6A 4MNKA 4U86A 3TCZA 1N1AA 4DRJA 3NRKA 3MDYB 1WAWA 2KR7A 2ZQUA 2LKNA 3B9DA 4GIVA 1JNEA 1Q6UA 4R0XA 4WK9A 3KACA 2ZQSA 3WH0A 4P8WA 3RMEA 4ML4A 2KFWA 4ODQA 2O9OA 2ZR6A 4LAWA 4ZPWR 1FKJA 1P5QA 2DSZA 4DRNA 2DT3A 1D6OA 4QZVB 2A3EA 4WKAA 2OFNA 1J4HA 3O5RA 3RM4A 1ZK6A 2F4EA 1XHGA 1FAPA 3EY6A 4LAXA 5HT1A 3RGCA 1GRJA 1Q1CA 1IX5A 2PV3A 5DEZA 4Z2GA 4BF8A 4N19A 3WQVA 3WQWA
chains in the Genus database with same CATH topology
1Y0OA 2RUCA 2K8IA 1W1TA 3ARUA 1OWQA 1YATA 2N87A 5DO2A 4ZPVR 4ZS6A 1FKRA 5JH8A 1ZL1A 3WIJA 2Q5AA 4KQZA 1NMWA 2IF4A 3CGMA 3KAIA 1ITXA 1TCOC 3QOKA 2DG4A 3PRDA 4IPXA 4Q7NA 4IT4A 4DRKA 2MLXA 3KADA 1LG1A 1LQ0A 3ARZA 2XP4A 2DT2A 2KO7A 1PINA 2DSUA 3CHCA 1BKFA 4Z2JA 1VF8A 4NZCA 4AY1A 4Z2HA 4MNMA 1O6IA 3ARWA 3ARSA 1C9HA 2KGJA 3O5GA 5HW8A 1E6NA 1NWRA 1FKLA 5DIUA 3ODKA 4KR0B 4TNSA 4DIPA 4L3NA 1CTNA 3WD3A 4DRPA 1GOIA 1LJYA 1EHNA 1E6ZA 1NWUA 1D7IA 4HBOA 1W1YA 1BL4A 2LJ4A 1NH6A 3RFWA 1JNSA 4JYSA 4TW8A 4P8VA 4W9QA 3CHFA 4ODKA 4ODOA 4DRQA 2XPBA 3CHEA 4ITZA 2FDMA 3UF8A 1HKIA 1FJDA 3KAFA 5HWBA 4W9OA 4Z2KA 2L2SA 1T11A 1KFWA 3FY1A 2DT0A 3RM9A 1FFRA 3O5DA 3OOBA 4WIWA 1QZ2A 1J4RA 2MNTA 2XP5A 3ARRA 4DROA 4DRIA 3AS0A 2MLYA 1OGGA 2F21A 5J6EA 2DT1A 1H0IA 1B6CA 2DSVA 4MNJA 1ZB5A 1E15A 3WL1A 4MTVA 1HJVA 4JFIA 1E9LA 3UQBA 4LGXA 4DRMA 4JFKA 5I98A 4JFMA 2DG3A 3B9EA 3WL0A 1EQ3A 2F2DA 4HARA 3WD0A 1W1PA 4DWSC 1ZCNA 3OA5A 5HKGA 3BXWA 1E6RA 1K9TA 3NTPA 4MPKA 4JFLA 4ZPTR 4G50A 1W26A 5D75A 3O5QA 1JNTA 1ZBCA 1QPLA 1J6YA 2IUZA 3PA7A 3O5IA 1FKIA 2WLYA 3NI6A 1FKGA 4LAVA 3G6LA 3WD2A 3IKDA 2D9FA 1FKTA 3H9RB 2ZQTA 3O5PA 2M2AA 3WD1A 2WLZA 1W9PA 3JXVA 1PBKA 3AQUA 1RD6A 2RSEA 3ARYA 2PPOA 4IQCA 1HXVA 4ODMA 1UR9A 3LUOA 1ZBVA 1TFVA 4MGVA 4HBEA 3JYJA 4ODPA 3O5JA 2RUQA 1JVWA 1HJWA 5DITA 4FAPA 5DF0A 2B31A 2UZ5A 4R5EA 1ZBKA 3ARPA 4P8UA 4DZ3A 2VCDA 5BXJA 3ARQA 2WM0A 4QIBA 2DG9A 3UI6A 3FXYA 3WKZA 2XP3A 3KAHA 1X6NA 1QPFA 5B8IC 1HKJA 3ALFA 1HKKA 4FN2A 3WD4A 3PRBA 5HWCA 4O2TA 1F40A 2G41A 4NSBA 3IKGA 3AS2A 3GPKA 2FKEA 1D7HA 4DH0A 4IQ2A 4G2PA 1NSGA 4QT2A 3I6CA 4ODNA 3AS1A 3O5KA 4P8XA 4J4OA 3G6MA 4ODLA 1D7JA 1W1VA 3B7XA 2MLZA 1LL7A 1LL6A 2PV1A 1Q6IA 3KAGA 5GPGA 1HJXA 1ROTA 3TDBA 2YBUA 4DT4A 1ROUA 4JFJA 1FKKA 1OGBA 1KT1A 4TYOA 2ZR5A 3JYMA 2M1IA 2PBCA 3PRAA 4QT3A 2RURA 3FAPA 1EDQA 3UQIA 1Q6HA 4DWSD 3KZ7A 1WNOA 4Z2IA 2O92A 1R9HA 4IT6A 4Q22A 4WJXA 4DZ2A 1LL4A 3O5EA 1J4IA 2PPNA 1GPFA 4S3JA 2DPEA 4S3KA 5HTGA 3UQAA 1ZBWA 3B9AA 4TW7A 4NNRA 5HUAA 1H0GA 2OLHA 3O5LA 3CGNA 3VAWA 2A3CA 2ZR4A 1E6PA 2M08A 1A7XA 1FKFA 3CH9A 4DWSB 4W5UA 1NWTA 4TX0A 4XAKA 1XRVA 2KI3A 3KCEA 4U84A 4MAVA 3ARTA 3AS3A 2A3AA 1W9VA 4LAYA 2ZQVA 2RQSA 4L72B 4WKHA 2QF8A 4C02B 1HKMA 4WKFA 2LGOA 1X6LA 5HW6A 2AOSA 2ITKA 2MPHA 3O5MA 3IHZA 1M5YA 1WB0A 3KABA 4MNLA 2LPVA 4Z2LA 2YBTA 1SR0A 2XP9A 1GUVA 4MSPA 2AWGA 5HBFA 3UI4A 5DIVA 2PI6A 2FAPA 2RUDA 2XP7A 2DSWA 2KE0A 3RM8A 1NWSA 3O5FA 2XPAA 3TC5A 5HW7A 1FFQA 3IK8A 3CZ8A 4ODRA 5GPRA 1EIBA 1FKSA 2JZVA 3AROA 1FKHA 1SYTA 4DWSA 1LG2A 2MF9A 2PPPA 4TW6A 1D2KA 3B8SA 4PTMA 1EYMA 1U79A 1ZU8A 2Y78A 3PR9A 1W9UA 4DRHA 3ARVA 1NMVA 3CHDA 2PV2A 4U85A 2WK2A 3W4RA 4GGQA 3O5OA 1FKBA 5GQBA 4URIA 4W9PA 2A3BA 2ESCA 1FD9A 1F8AB 3ALGA 1L1PA 3ARXA 1JNDA 2XP8A 4J4NA 1FKDA 1KT0A 2G8ZA 1YW5A 3UI5A 1UR8A 2VN1A 2XP6A 4MNKA 4U86A 3TCZA 1N1AA 4DRJA 3NRKA 3MDYB 1WAWA 2KR7A 2ZQUA 2LKNA 3B9DA 4GIVA 1JNEA 1Q6UA 4R0XA 4WK9A 3KACA 2ZQSA 3WH0A 4P8WA 3RMEA 4ML4A 2KFWA 4ODQA 2O9OA 2ZR6A 4LAWA 4ZPWR 1FKJA 1P5QA 2DSZA 4DRNA 2DT3A 1D6OA 4QZVB 2A3EA 4WKAA 2OFNA 1J4HA 3O5RA 3RM4A 1ZK6A 2F4EA 1XHGA 1FAPA 3EY6A 4LAXA 5HT1A 3RGCA 1Q1CA 1IX5A 2PV3A 5DEZA 4Z2GA 4BF8A 4N19A 3WQVA 3WQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AWG A;  1NSG A;  4QT2 A;  3I6C A;  4ODN A;  3UI4 A;  3O5K A;  4JFI A;  5DIV A;  1Y0O A;  4J4O A;  2FAP A;  2RUC A;  2K8I A;  4DRM A;  3UQB A;  2RUD A;  2XP7 A;  4JFK A;  5I98 A;  4ODL A;  2KE0 A;  4JFM A;  2DG3 A;  3O5F A;  1EQ3 A;  2F2D A;  1YAT A;  1D7J A;  2N87 A;  1FKR A;  1ZCN A;  2XPA A;  3B7X A;  5HKG A;  2MLZ A;  3TC5 A;  2Q5A A;  2PV1 A;  5HW7 A;  1NMW A;  1Q6I A;  2IF4 A;  3KAG A;  5GPG A;  1ROT A;  3TDB A;  3IK8 A;  3CGM A;  3NTP A;  4ODR A;  3KAI A;  4JFL A;  1TCO C;  4DT4 A;  1ROU A;  2DG4 A;  1FKS A;  3PRD A;  2JZV A;  1W26 A;  4G50 A;  3O5Q A;  1JNT A;  4IPX A;  4JFJ A;  1FKH A;  5D75 A;  1FKK A;  4DRK A;  1KT1 A;  1QPL A;  1J6Y A;  2MF9 A;  2ZR5 A;  2MLX A;  3KAD A;  4TYO A;  2PPP A;  4TW6 A;  3JYM A;  3PA7 A;  2M1I A;  2PBC A;  2XP4 A;  2KO7 A;  3O5I A;  1PIN A;  1EYM A;  1U79 A;  1BKF A;  1FKI A;  2RUR A;  3FAP A;  4QT3 A;  3NI6 A;  3UQI A;  1Q6H A;  2Y78 A;  4DRH A;  3KZ7 A;  1FKG A;  4LAV A;  1C9H A;  2KGJ A;  3O5G A;  1NMV A;  5HW8 A;  2PV2 A;  3IKD A;  1FKL A;  4U85 A;  5DIU A;  2D9F A;  1FKT A;  1R9H A;  3ODK A;  3H9R B;  2ZQT A;  3O5P A;  2M2A A;  4GGQ A;  4TNS A;  3O5O A;  4DIP A;  3JXV A;  1FKB A;  4DZ2 A;  3O5E A;  1J4I A;  4W9P A;  2PPN A;  1PBK A;  4DRP A;  2RSE A;  5HTG A;  1FD9 A;  1F8A B;  1L1P A;  2PPO A;  3UQA A;  1D7I A;  2XP8 A;  4IQC A;  1FKD A;  4J4N A;  4ODM A;  1HXV A;  3LUO A;  1KT0 A;  4NNR A;  1BL4 A;  2LJ4 A;  4TW7 A;  3RFW A;  1YW5 A;  3O5L A;  3UI5 A;  5HUA A;  3CGN A;  4MGV A;  3VAW A;  1JNS A;  3JYJ A;  4ODP A;  2VN1 A;  2XP6 A;  2ZR4 A;  3O5J A;  4JYS A;  4U86 A;  4TW8 A;  2M08 A;  3TCZ A;  1A7X A;  1N1A A;  2RUQ A;  1FKF A;  4DRJ A;  4W9Q A;  3NRK A;  1JVW A;  3MDY B;  5DIT A;  4FAP A;  4ODK A;  4TX0 A;  4ODO A;  2KR7 A;  2ZQU A;  2UZ5 A;  4DRQ A;  2KI3 A;  2LKN A;  2XPB A;  4GIV A;  3KCE A;  4DZ3 A;  4U84 A;  2VCD A;  4ITZ A;  3UF8 A;  5BXJ A;  1Q6U A;  1FJD A;  3KAF A;  4R0X A;  5HWB A;  3KAC A;  2ZQS A;  4W9O A;  3WH0 A;  4QIB A;  2DG9 A;  3UI6 A;  2L2S A;  1T11 A;  2KFW A;  4LAY A;  4ODQ A;  2XP3 A;  2ZQV A;  2RQS A;  2ZR6 A;  4LAW A;  4C02 B;  3KAH A;  1QPF A;  3O5D A;  1FKJ A;  1P5Q A;  2LGO A;  3OOB A;  5HW6 A;  2ITK A;  1QZ2 A;  4DRN A;  5B8I C;  2MPH A;  1D6O A;  1J4R A;  3IHZ A;  3O5M A;  2MNT A;  4FN2 A;  1M5Y A;  3KAB A;  2OFN A;  1J4H A;  2LPV A;  3O5R A;  2XP5 A;  1ZK6 A;  4DRO A;  2F4E A;  3PRB A;  1FAP A;  3EY6 A;  4LAX A;  5HT1 A;  3RGC A;  4DRI A;  1Q1C A;  2MLY A;  5HWC A;  2PV3 A;  4O2T A;  2F21 A;  5J6E A;  1F40 A;  4BF8 A;  3IKG A;  4N19 A;  2XP9 A;  1B6C A;  3GPK A;  2FKE A;  1D7H A;  4MSP A;  4DH0 A;  4IQ2 A;  4G2P A; 
#chains in the Genus database with same CATH topology
 1Y0O A;  2RUC A;  2K8I A;  1W1T A;  3ARU A;  1OWQ A;  1YAT A;  2N87 A;  5DO2 A;  4ZPV R;  4ZS6 A;  1FKR A;  5JH8 A;  1ZL1 A;  3WIJ A;  2Q5A A;  4KQZ A;  1NMW A;  2IF4 A;  3CGM A;  3KAI A;  1ITX A;  1TCO C;  3QOK A;  2DG4 A;  3PRD A;  4IPX A;  4Q7N A;  4IT4 A;  4DRK A;  2MLX A;  3KAD A;  1LG1 A;  1LQ0 A;  3ARZ A;  2XP4 A;  2DT2 A;  2KO7 A;  1PIN A;  2DSU A;  3CHC A;  1BKF A;  4Z2J A;  1VF8 A;  4NZC A;  4AY1 A;  4Z2H A;  4MNM A;  1O6I A;  2F23 A;  3ARW A;  3ARS A;  1C9H A;  2KGJ A;  3O5G A;  5HW8 A;  1E6N A;  1NWR A;  1FKL A;  5DIU A;  3ODK A;  4KR0 B;  4TNS A;  4DIP A;  4L3N A;  1CTN A;  3WD3 A;  4DRP A;  2P4V A;  1GOI A;  1LJY A;  1EHN A;  1E6Z A;  1NWU A;  1D7I A;  4HBO A;  1W1Y A;  1BL4 A;  2LJ4 A;  1NH6 A;  4UDM A;  3RFW A;  1JNS A;  2PN0 A;  2B5U B;  4JYS A;  4TW8 A;  4P8V A;  2ETN A;  4W9Q A;  3CHF A;  4ODK A;  4ODO A;  4DRQ A;  2XPB A;  3CHE A;  4ITZ A;  2FDM A;  3UF8 A;  1HKI A;  1FJD A;  3KAF A;  5HWB A;  4W9O A;  2EUL A;  4Z2K A;  2L2S A;  1T11 A;  1KFW A;  3FY1 A;  2DT0 A;  3RM9 A;  1FFR A;  3O5D A;  3OOB A;  4WIW A;  1QZ2 A;  1J4R A;  2MNT A;  2XP5 A;  3ARR A;  4DRO A;  4DRI A;  3AS0 A;  2MLY A;  1OGG A;  2F21 A;  5J6E A;  2DT1 A;  1H0I A;  1B6C A;  2DSV A;  4MNJ A;  1ZB5 A;  1E15 A;  3WL1 A;  4MTV A;  1HJV A;  4JFI A;  1E9L A;  3UQB A;  4LGX A;  4DRM A;  4JFK A;  5I98 A;  4JFM A;  2DG3 A;  3B9E A;  3WL0 A;  1EQ3 A;  2F2D A;  4HAR A;  3WD0 A;  1W1P A;  4DWS C;  1ZCN A;  3OA5 A;  5HKG A;  3BXW A;  1E6R A;  1K9T A;  3NTP A;  4MPK A;  4JFL A;  4ZPT R;  4G50 A;  1W26 A;  5D75 A;  3O5Q A;  1JNT A;  1ZBC A;  1QPL A;  1J6Y A;  2IUZ A;  3PA7 A;  3O5I A;  1FKI A;  2WLY A;  3NI6 A;  1FKG A;  4LAV A;  3G6L A;  3WD2 A;  3IKD A;  2D9F A;  1FKT A;  3H9R B;  2ZQT A;  3O5P A;  2M2A A;  3WD1 A;  2WLZ A;  1W9P A;  3JXV A;  1PBK A;  3AQU A;  1RD6 A;  2RSE A;  3ARY A;  2PPO A;  4IQC A;  1HXV A;  4ODM A;  1UR9 A;  3LUO A;  1ZBV A;  1TFV A;  4MGV A;  4HBE A;  3JYJ A;  4ODP A;  3O5J A;  2RUQ A;  1JVW A;  1HJW A;  5DIT A;  4FAP A;  5DF0 A;  2B31 A;  2UZ5 A;  4R5E A;  1ZBK A;  3ARP A;  3GTY X;  4P8U A;  4DZ3 A;  2VCD A;  5BXJ A;  3ARQ A;  2WM0 A;  4QIB A;  2DG9 A;  3UI6 A;  3FXY A;  3WKZ A;  2XP3 A;  3KAH A;  1X6N A;  1QPF A;  5B8I C;  1HKJ A;  3ALF A;  1HKK A;  4FN2 A;  3WD4 A;  3PRB A;  5HWC A;  4O2T A;  1F40 A;  2G41 A;  4NSB A;  3IKG A;  3AS2 A;  3GPK A;  2FKE A;  1D7H A;  1E44 A;  4DH0 A;  4IQ2 A;  4G2P A;  1NSG A;  4QT2 A;  3I6C A;  4ODN A;  3AS1 A;  3O5K A;  4P8X A;  4J4O A;  3G6M A;  4ODL A;  1D7J A;  1W1V A;  3B7X A;  2MLZ A;  1LL7 A;  1LL6 A;  2PV1 A;  1Q6I A;  3KAG A;  5GPG A;  1HJX A;  1ROT A;  3TDB A;  2YBU A;  4DT4 A;  1ROU A;  4JFJ A;  1FKK A;  1OGB A;  1KT1 A;  4TYO A;  2ZR5 A;  3JYM A;  2M1I A;  2PBC A;  3PRA A;  4QT3 A;  2RUR A;  3FAP A;  1EDQ A;  3UQI A;  1Q6H A;  4DWS D;  3KZ7 A;  1WNO A;  4Z2I A;  2O92 A;  1R9H A;  4IT6 A;  4Q22 A;  4WJX A;  4DZ2 A;  1LL4 A;  3GU0 A;  3O5E A;  1J4I A;  2PPN A;  1GPF A;  4S3J A;  2DPE A;  4S3K A;  5HTG A;  3UQA A;  1ZBW A;  3B9A A;  4TW7 A;  4NNR A;  5HUA A;  1H0G A;  2OLH A;  3O5L A;  3CGN A;  3VAW A;  2A3C A;  2ZR4 A;  1E6P A;  2M08 A;  1A7X A;  1FKF A;  3CH9 A;  1JCH B;  4DWS B;  4W5U A;  1NWT A;  4TX0 A;  4XAK A;  1XRV A;  2KI3 A;  3KCE A;  4U84 A;  4MAV A;  3ART A;  3AS3 A;  2A3A A;  1W9V A;  4LAY A;  2ZQV A;  2RQS A;  4L72 B;  4WKH A;  2QF8 A;  4C02 B;  1HKM A;  4WKF A;  2LGO A;  1X6L A;  5HW6 A;  2AOS A;  2ITK A;  2MPH A;  3O5M A;  3IHZ A;  1M5Y A;  1WB0 A;  3KAB A;  4MNL A;  2LPV A;  4Z2L A;  2YBT A;  1SR0 A;  2XP9 A;  1GUV A;  4MSP A;  2AWG A;  5HBF A;  3UI4 A;  5DIV A;  2PI6 A;  2FAP A;  2RUD A;  2XP7 A;  2DSW A;  2KE0 A;  3RM8 A;  1NWS A;  3O5F A;  2XPA A;  3BMB A;  3TC5 A;  5HW7 A;  1FFQ A;  3IK8 A;  3CZ8 A;  4ODR A;  5GPR A;  1EIB A;  1FKS A;  2JZV A;  3ARO A;  1FKH A;  1SYT A;  4DWS A;  1LG2 A;  2MF9 A;  2PPP A;  4TW6 A;  1D2K A;  3B8S A;  4PTM A;  1EYM A;  1U79 A;  1ZU8 A;  2Y78 A;  3EIP A;  3PR9 A;  1W9U A;  4DRH A;  3ARV A;  1NMV A;  3CHD A;  2PV2 A;  4U85 A;  2WK2 A;  3W4R A;  4GGQ A;  3O5O A;  1FKB A;  5GQB A;  4URI A;  4W9P A;  2A3B A;  2ESC A;  1FD9 A;  1F8A B;  3ALG A;  1L1P A;  3ARX A;  1JND A;  2XP8 A;  4J4N A;  1FKD A;  1KT0 A;  2G8Z A;  1YW5 A;  3UI5 A;  1UR8 A;  2VN1 A;  2XP6 A;  4MNK A;  4U86 A;  3TCZ A;  1N1A A;  4DRJ A;  3NRK A;  3MDY B;  1WAW A;  2KR7 A;  2ZQU A;  2LKN A;  3B9D A;  4GIV A;  1JNE A;  1Q6U A;  4R0X A;  4WK9 A;  3KAC A;  2ZQS A;  3WH0 A;  4P8W A;  3RME A;  4ML4 A;  2KFW A;  4ODQ A;  2O9O A;  2ZR6 A;  4LAW A;  4ZPW R;  1FKJ A;  1P5Q A;  2DSZ A;  4DRN A;  2DT3 A;  1D6O A;  4QZV B;  2A3E A;  4WKA A;  2OFN A;  1J4H A;  3O5R A;  3RM4 A;  1ZK6 A;  2F4E A;  1XHG A;  1FAP A;  3EY6 A;  4LAX A;  5HT1 A;  3RGC A;  1GRJ A;  1Q1C A;  1IX5 A;  2PV3 A;  5DEZ A;  4Z2G A;  4BF8 A;  4N19 A;  3WQV A;  3WQW A; 
#chains in the Genus database with same CATH homology
 1Y0O A;  2RUC A;  2K8I A;  1W1T A;  3ARU A;  1OWQ A;  1YAT A;  2N87 A;  5DO2 A;  4ZPV R;  4ZS6 A;  1FKR A;  5JH8 A;  1ZL1 A;  3WIJ A;  2Q5A A;  4KQZ A;  1NMW A;  2IF4 A;  3CGM A;  3KAI A;  1ITX A;  1TCO C;  3QOK A;  2DG4 A;  3PRD A;  4IPX A;  4Q7N A;  4IT4 A;  4DRK A;  2MLX A;  3KAD A;  1LG1 A;  1LQ0 A;  3ARZ A;  2XP4 A;  2DT2 A;  2KO7 A;  1PIN A;  2DSU A;  3CHC A;  1BKF A;  4Z2J A;  1VF8 A;  4NZC A;  4AY1 A;  4Z2H A;  4MNM A;  1O6I A;  3ARW A;  3ARS A;  1C9H A;  2KGJ A;  3O5G A;  5HW8 A;  1E6N A;  1NWR A;  1FKL A;  5DIU A;  3ODK A;  4KR0 B;  4TNS A;  4DIP A;  4L3N A;  1CTN A;  3WD3 A;  4DRP A;  1GOI A;  1LJY A;  1EHN A;  1E6Z A;  1NWU A;  1D7I A;  4HBO A;  1W1Y A;  1BL4 A;  2LJ4 A;  1NH6 A;  3RFW A;  1JNS A;  4JYS A;  4TW8 A;  4P8V A;  4W9Q A;  3CHF A;  4ODK A;  4ODO A;  4DRQ A;  2XPB A;  3CHE A;  4ITZ A;  2FDM A;  3UF8 A;  1HKI A;  1FJD A;  3KAF A;  5HWB A;  4W9O A;  4Z2K A;  2L2S A;  1T11 A;  1KFW A;  3FY1 A;  2DT0 A;  3RM9 A;  1FFR A;  3O5D A;  3OOB A;  4WIW A;  1QZ2 A;  1J4R A;  2MNT A;  2XP5 A;  3ARR A;  4DRO A;  4DRI A;  3AS0 A;  2MLY A;  1OGG A;  2F21 A;  5J6E A;  2DT1 A;  1H0I A;  1B6C A;  2DSV A;  4MNJ A;  1ZB5 A;  1E15 A;  3WL1 A;  4MTV A;  1HJV A;  4JFI A;  1E9L A;  3UQB A;  4LGX A;  4DRM A;  4JFK A;  5I98 A;  4JFM A;  2DG3 A;  3B9E A;  3WL0 A;  1EQ3 A;  2F2D A;  4HAR A;  3WD0 A;  1W1P A;  4DWS C;  1ZCN A;  3OA5 A;  5HKG A;  3BXW A;  1E6R A;  1K9T A;  3NTP A;  4MPK A;  4JFL A;  4ZPT R;  4G50 A;  1W26 A;  5D75 A;  3O5Q A;  1JNT A;  1ZBC A;  1QPL A;  1J6Y A;  2IUZ A;  3PA7 A;  3O5I A;  1FKI A;  2WLY A;  3NI6 A;  1FKG A;  4LAV A;  3G6L A;  3WD2 A;  3IKD A;  2D9F A;  1FKT A;  3H9R B;  2ZQT A;  3O5P A;  2M2A A;  3WD1 A;  2WLZ A;  1W9P A;  3JXV A;  1PBK A;  3AQU A;  1RD6 A;  2RSE A;  3ARY A;  2PPO A;  4IQC A;  1HXV A;  4ODM A;  1UR9 A;  3LUO A;  1ZBV A;  1TFV A;  4MGV A;  4HBE A;  3JYJ A;  4ODP A;  3O5J A;  2RUQ A;  1JVW A;  1HJW A;  5DIT A;  4FAP A;  5DF0 A;  2B31 A;  2UZ5 A;  4R5E A;  1ZBK A;  3ARP A;  4P8U A;  4DZ3 A;  2VCD A;  5BXJ A;  3ARQ A;  2WM0 A;  4QIB A;  2DG9 A;  3UI6 A;  3FXY A;  3WKZ A;  2XP3 A;  3KAH A;  1X6N A;  1QPF A;  5B8I C;  1HKJ A;  3ALF A;  1HKK A;  4FN2 A;  3WD4 A;  3PRB A;  5HWC A;  4O2T A;  1F40 A;  2G41 A;  4NSB A;  3IKG A;  3AS2 A;  3GPK A;  2FKE A;  1D7H A;  4DH0 A;  4IQ2 A;  4G2P A;  1NSG A;  4QT2 A;  3I6C A;  4ODN A;  3AS1 A;  3O5K A;  4P8X A;  4J4O A;  3G6M A;  4ODL A;  1D7J A;  1W1V A;  3B7X A;  2MLZ A;  1LL7 A;  1LL6 A;  2PV1 A;  1Q6I A;  3KAG A;  5GPG A;  1HJX A;  1ROT A;  3TDB A;  2YBU A;  4DT4 A;  1ROU A;  4JFJ A;  1FKK A;  1OGB A;  1KT1 A;  4TYO A;  2ZR5 A;  3JYM A;  2M1I A;  2PBC A;  3PRA A;  4QT3 A;  2RUR A;  3FAP A;  1EDQ A;  3UQI A;  1Q6H A;  4DWS D;  3KZ7 A;  1WNO A;  4Z2I A;  2O92 A;  1R9H A;  4IT6 A;  4Q22 A;  4WJX A;  4DZ2 A;  1LL4 A;  3O5E A;  1J4I A;  2PPN A;  1GPF A;  4S3J A;  2DPE A;  4S3K A;  5HTG A;  3UQA A;  1ZBW A;  3B9A A;  4TW7 A;  4NNR A;  5HUA A;  1H0G A;  2OLH A;  3O5L A;  3CGN A;  3VAW A;  2A3C A;  2ZR4 A;  1E6P A;  2M08 A;  1A7X A;  1FKF A;  3CH9 A;  4DWS B;  4W5U A;  1NWT A;  4TX0 A;  4XAK A;  1XRV A;  2KI3 A;  3KCE A;  4U84 A;  4MAV A;  3ART A;  3AS3 A;  2A3A A;  1W9V A;  4LAY A;  2ZQV A;  2RQS A;  4L72 B;  4WKH A;  2QF8 A;  4C02 B;  1HKM A;  4WKF A;  2LGO A;  1X6L A;  5HW6 A;  2AOS A;  2ITK A;  2MPH A;  3O5M A;  3IHZ A;  1M5Y A;  1WB0 A;  3KAB A;  4MNL A;  2LPV A;  4Z2L A;  2YBT A;  1SR0 A;  2XP9 A;  1GUV A;  4MSP A;  2AWG A;  5HBF A;  3UI4 A;  5DIV A;  2PI6 A;  2FAP A;  2RUD A;  2XP7 A;  2DSW A;  2KE0 A;  3RM8 A;  1NWS A;  3O5F A;  2XPA A;  3TC5 A;  5HW7 A;  1FFQ A;  3IK8 A;  3CZ8 A;  4ODR A;  5GPR A;  1EIB A;  1FKS A;  2JZV A;  3ARO A;  1FKH A;  1SYT A;  4DWS A;  1LG2 A;  2MF9 A;  2PPP A;  4TW6 A;  1D2K A;  3B8S A;  4PTM A;  1EYM A;  1U79 A;  1ZU8 A;  2Y78 A;  3PR9 A;  1W9U A;  4DRH A;  3ARV A;  1NMV A;  3CHD A;  2PV2 A;  4U85 A;  2WK2 A;  3W4R A;  4GGQ A;  3O5O A;  1FKB A;  5GQB A;  4URI A;  4W9P A;  2A3B A;  2ESC A;  1FD9 A;  1F8A B;  3ALG A;  1L1P A;  3ARX A;  1JND A;  2XP8 A;  4J4N A;  1FKD A;  1KT0 A;  2G8Z A;  1YW5 A;  3UI5 A;  1UR8 A;  2VN1 A;  2XP6 A;  4MNK A;  4U86 A;  3TCZ A;  1N1A A;  4DRJ A;  3NRK A;  3MDY B;  1WAW A;  2KR7 A;  2ZQU A;  2LKN A;  3B9D A;  4GIV A;  1JNE A;  1Q6U A;  4R0X A;  4WK9 A;  3KAC A;  2ZQS A;  3WH0 A;  4P8W A;  3RME A;  4ML4 A;  2KFW A;  4ODQ A;  2O9O A;  2ZR6 A;  4LAW A;  4ZPW R;  1FKJ A;  1P5Q A;  2DSZ A;  4DRN A;  2DT3 A;  1D6O A;  4QZV B;  2A3E A;  4WKA A;  2OFN A;  1J4H A;  3O5R A;  3RM4 A;  1ZK6 A;  2F4E A;  1XHG A;  1FAP A;  3EY6 A;  4LAX A;  5HT1 A;  3RGC A;  1Q1C A;  1IX5 A;  2PV3 A;  5DEZ A;  4Z2G A;  4BF8 A;  4N19 A;  3WQV A;  3WQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...