1JNTA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jntA00
1YW5A 4FN2A 2M08A 1YATA 2PPNA 3KABA 2XPBA 1JVWA 1EYMA 2LKNA 3O5GA 3FAPA 2D9FA 3KAFA 3UI4A 4DRHA 4DT4A 3IHZA 2XP8A 2Y78A 1JNTA 4ODNA 4J4NA 4U85A 4DZ2A 3IKDA 2UZ5A 2F21A 2N87A 1FKDA 1A7XA 2JZVA 4JYSA 4DRKA 1PINA 3O5FA 1ZK6A 3O5OA 4IQCA 4N19A 5HWBA 2DG9A 3RFWA 3B7XA 2DG3A 3PA7A 4W9OA 3UQIA 3NRKA 4DIPA 5HTGA 4QIBA 1BKFA 2K8IA 4DZ3A 1N1AA 1QPLA 2VN1A 3IKGA 4JFJA 1FKGA 4ITZA 2RQSA 4TYOA 4QT3A 1J4RA 5HKGA 1B6CA 1D7IA 2MF9A 1NMVA 2PPPA 3CGMA 3TDBA 2LGOA 2F2DA 5HT1A 3LUOA 4C02B 4TW7A 4LAWA 2RSEA 5HW6A 1F40A 2ZR6A 4O2TA 1J6YA 3O5EA 4ODKA 3ODKA 3UQAA 2IF4A 3MDYB 3UF8A 4DRJA 1FD9A 2M1IA 4JFIA 4W9QA 2PV3A 3I6CA 1FKRA 1Q6HA 3RGCA 2MLXA 2RURA 4ODMA 3KAHA 1J4IA 4DRMA 1HXVA 1Y0OA 3O5MA 1ROUA 2PV1A 3PRBA 4DRPA 2XP6A 1ROTA 3UQBA 1FKJA 2ZQTA 3UI6A 1KT0A 2KR7A 4LAYA 1FKKA 2XP7A 2Q5AA 1FKSA 3JYJA 4G50A 2DG4A 1FKTA 2RUCA 1C9HA 1L1PA 1QZ2A 2KFWA 4JFMA 5I98A 4G2PA 2PPOA 3CGNA 1FKBA 1R9HA 3KCEA 4R0XA 4BF8A 5HW7A 1KT1A 3O5KA 1FKHA 2FKEA 3O5PA 4ODRA 1Q6UA 1FKFA 4MSPA 1D7HA 4JFLA 4MGVA 3O5IA 4ODLA 5HUAA 4TW6A 2FAPA 2RUDA 2ZQUA 1F8AB 1EQ3A 3H9RB 3IK8A 3JXVA 1NMWA 4LAXA 1ZCNA 4ODOA 1T11A 3UI5A 2ZR5A 3KZ7A 4TX0A 2RUQA 2MNTA 2XPAA 4U84A 1FAPA 5D75A 3O5RA 4FAPA 4DROA 1QPFA 4DH0A 3O5JA 3VAWA 2XP4A 3EY6A 2L2SA 4U86A 1FJDA 1FKIA 1D6OA 1Q1CA 4ODPA 5DITA 3NTPA 1U79A 1NSGA 3JYMA 5J6EA 1PBKA 2XP5A 4TW8A 2MLZA 4GIVA 2M2AA 4TNSA 1BL4A 2LJ4A 2XP3A 2ZR4A 2MPHA 2PBCA 3GPKA 1Q6IA 3KADA 3O5QA 3O5DA 3OOBA 3NI6A 4DRQA 1M5YA 4DRIA 5HW8A 1W26A 2ZQSA 4QT2A 5DIVA 5B8IC 5HWCA 4IPXA 2KO7A 4W9PA 4DRNA 1J4HA 2XP9A 3KAGA 4NNRA 5DIUA 2ZQVA 3TCZA 1P5QA 4GGQA 2PV2A 4J4OA 4LAVA 3TC5A 3KAIA 1JNSA 1D7JA 2KE0A 2VCDA 3KACA 1TCOC 2ITKA 3PRDA 2KGJA 4ODQA 4JFKA 1FKLA 3WH0A 2OFNA 5BXJA 2AWGA 2MLYA 2KI3A 2F4EA 5GPGA 4IQ2A 3O5LA 2LPVA
chains in the Genus database with same CATH superfamily
1ZBCA 1YW5A 4FN2A 1ZU8A 3KAFA 3B8SA 4WIWA 2UZ5A 2F21A 1A7XA 2JZVA 3ARPA 4JYSA 3WD3A 5GPRA 4N19A 5HWBA 5DO2A 2DG9A 3W4RA 3WIJA 3B7XA 3ARZA 3PA7A 4W9OA 3UQIA 1W1PA 5HTGA 4QIBA 1BKFA 4DZ3A 1QPLA 4ZPTR 4JFJA 1IX5A 2RQSA 4QT3A 4Z2HA 2B5UB 5HKGA 1B6CA 1D7IA 3CHEA 1O6IA 3TDBA 2QF8A 2DT3A 2P4VA 1F40A 2DT1A 4JFIA 2PN0A 3WKZA 1FKRA 3AS2A 4DRMA 3ARSA 4S3KA 4Z2IA 4R5EA 5DEZA 3ARUA 2ZQTA 2FDMA 1FKSA 3JYJA 4G50A 1L1PA 1C9HA 2DSVA 5DF0A 5I98A 1KT1A 1FKHA 2DSWA 3FY1A 1Q6UA 1ZB5A 4JFLA 1XHGA 3O5IA 4ODLA 4TW6A 3IK8A 3QOKA 3CHDA 1LG2A 2DSZA 4DROA 1W9PA 1E44A 3EY6A 2L2SA 1W9VA 1D6OA 1UR8A 1PBKA 4TW8A 2MLZA 4W5UA 4AY1A 3KADA 3O5QA 3O5DA 5DIVA 5HWCA 2KO7A 4URIA 3KAGA 2XP9A 3ARWA 4HBOA 3WL1A 4J4OA 4LAVA 1LQ0A 4DWSC 3KAIA 1D7JA 1E6PA 2KE0A 2KGJA 3WH0A 1GRJA 1LJYA 2KI3A 2MLYA 1OGBA 4IQ2A 2ETNA 2F23A 2WLYA 3CH9A 3KABA 1EYMA 4ZPVR 1HKJA 3O5GA 2G8ZA 2D9FA 4WKHA 2XP8A 4HARA 1JNTA 1VF8A 4J4NA 3IKDA 3GU0A 1NWUA 4DRKA 1HKKA 1PINA 3RFWA 4ZPWR 4DIPA 3RM8A 3ALFA 2B31A 3IKGA 1J4RA 1H0IA 1X6LA 5HT1A 3AQUA 3LUOA 5HW6A 3AS0A 4O2TA 1J6YA 3O5EA 2IF4A 3MDYB 4DRJA 2PV3A 1Q6HA 2MLXA 2A3BA 4P8VA 4ODMA 3KAHA 3OA5A 4MNLA 3O5MA 5HBFA 1FFQA 3PRBA 1ROTA 1E9LA 3WD1A 2DT2A 1WAWA 2KR7A 1FKKA 2XP7A 2Q5AA 1ITXA 2RUCA 3ALGA 1WB0A 3BXWA 4NSBA 3CGNA 3CHFA 1R9HA 4R0XA 4P8XA 4ZS6A 2FKEA 4HBEA 4MSPA 1D7HA 5HUAA 3H9RB 4ODOA 1ZCNA 1OWQA 1T11A 2ZR5A 2MNTA 1FAPA 1HJWA 1W9UA 1Q1CA 5DITA 2DSUA 3NTPA 4Z2GA 3JYMA 5J6EA 4GIVA 2M2AA 2XP3A 2ZR4A 1E6ZA 1Q6IA 1W1YA 4DRIA 5HW8A 4IT4A 4PTMA 5B8IC 1D2KA 4WJXA 3TCZA 2DPEA 4GGQA 1HKIA 2WK2A 2ITKA 4ML4A 2OFNA 5BXJA 3B9EA 2F4EA 1GUVA 3WD4A 3BMBA 2PPNA 2XPBA 1JVWA 2LKNA 3GTYX 3FAPA 3UI4A 4DT4A 2G41A 3ARRA 4U85A 4L3NA 4L72B 3RMEA 1ZK6A 2O9OA 4IQCA 2DG3A 4Z2JA 3NRKA 1N1AA 1EDQA 1EIBA 1FKGA 3B9DA 4ITZA 4KR0B 2MF9A 3G6LA 3PR9A 4MNMA 3CGMA 2LGOA 4TW7A 2RSEA 1WNOA 4MNKA 2ZR6A 1NWSA 3PRAA 3ODKA 3UQAA 3UF8A 1FD9A 3WQVA 2M1IA 1JCHB 3I6CA 2A3AA 1LG1A 1K9TA 1Y0OA 3WD0A 1ROUA 1NH6A 2PV1A 2XP6A 1TFVA 3UQBA 3UI6A 1SR0A 4Q22A 2DG4A 1QZ2A 2KFWA 1LL4A 2PPOA 1FKBA 4BF8A 5HW7A 3O5PA 4ODRA 1FKFA 2YBUA 3RM9A 4NZCA 4KQZA 2FAPA 2RUDA 2ZQUA 1EQ3A 3UI5A 3KZ7A 2RUQA 4U84A 4P8WA 5D75A 3O5RA 2ESCA 3O5JA 2XP4A 3WL0A 4MAVA 1E6NA 1NSGA 3CHCA 3O5FA 1BL4A 4WKFA 2PBCA 4DRQA 3NI6A 1W1TA 1W26A 2ZQSA 1E6RA 4QT2A 3ARTA 4DWSB 4DRNA 1J4HA 4MNJA 4NNRA 5DIUA 2ZQVA 1P5QA 2PV2A 1OGGA 1JNSA 2OLHA 1SYTA 2VCDA 3KACA 3WQWA 4JFKA 4WKAA 2AWGA 5GPGA 4WK9A 1RD6A 3O5LA 2LPVA 1ZBVA 2M08A 1YATA 3ARQA 3ARXA 4DRHA 1CTNA 4DZ2A 3IHZA 1ZBKA 2Y78A 4ODNA 1E15A 2N87A 1LL7A 1FKDA 4QZVB 3ARYA 3O5OA 2AOSA 1XRVA 2WLZA 2IUZA 2K8IA 4S3JA 2VN1A 4Z2LA 5JH8A 4TYOA 3AS1A 1NMVA 2WM0A 2PPPA 4Q7NA 4Z2KA 2F2DA 1EHNA 4C02B 4LAWA 1LL6A 4ODKA 1W1VA 4W9QA 1FFRA 3RGCA 2RURA 1H0GA 1J4IA 1HXVA 1ZBWA 1UR9A 1JNEA 2PI6A 4DRPA 2YBTA 4MPKA 1HKMA 1FKJA 3AS3A 1KT0A 4LAYA 1JNDA 1FKTA 4JFMA 4G2PA 2EULA 3KCEA 1GPFA 1HJVA 3O5KA 3RM4A 2A3EA 4MGVA 4XAKA 1NWRA 1F8AB 3JXVA 2DT0A 1NMWA 4LAXA 4DWSD 4TX0A 2XPAA 4FAPA 1GOIA 3ARVA 1QPFA 4DH0A 3VAWA 3AROA 4U86A 1FJDA 3FXYA 1HJXA 1FKIA 4UDMA 4DWSA 4ODPA 1U79A 3EIPA 1NWTA 2XP5A 4TNSA 2LJ4A 3B9AA 3GPKA 2MPHA 3G6MA 2O92A 3OOBA 1M5YA 3WD2A 4IPXA 4W9PA 1KFWA 1ZL1A 5GQBA 3CZ8A 3TC5A 2A3CA 4LGXA 3PRDA 1TCOC 4ODQA 1X6NA 1FKLA 4MTVA 4P8UA 4IT6A
chains in the Genus database with same CATH topology
1ZBCA 1YW5A 4FN2A 1ZU8A 3KAFA 3B8SA 4WIWA 2UZ5A 2F21A 1A7XA 2JZVA 3ARPA 4JYSA 3WD3A 5GPRA 4N19A 5HWBA 5DO2A 2DG9A 3W4RA 3WIJA 3B7XA 3ARZA 3PA7A 4W9OA 3UQIA 1W1PA 5HTGA 4QIBA 1BKFA 4DZ3A 1QPLA 4ZPTR 4JFJA 1IX5A 2RQSA 4QT3A 4Z2HA 5HKGA 1B6CA 1D7IA 3CHEA 1O6IA 3TDBA 2QF8A 2DT3A 1F40A 2DT1A 4JFIA 3WKZA 1FKRA 3AS2A 4DRMA 3ARSA 4S3KA 4Z2IA 4R5EA 5DEZA 3ARUA 2ZQTA 2FDMA 1FKSA 3JYJA 4G50A 1L1PA 1C9HA 2DSVA 5DF0A 5I98A 1KT1A 1FKHA 2DSWA 3FY1A 1Q6UA 1ZB5A 4JFLA 1XHGA 3O5IA 4ODLA 4TW6A 3IK8A 3QOKA 3CHDA 1LG2A 2DSZA 4DROA 1W9PA 3EY6A 2L2SA 1W9VA 1D6OA 1UR8A 1PBKA 4TW8A 2MLZA 4W5UA 4AY1A 3KADA 3O5QA 3O5DA 5DIVA 5HWCA 2KO7A 4URIA 3KAGA 2XP9A 3ARWA 4HBOA 3WL1A 4J4OA 4LAVA 1LQ0A 4DWSC 3KAIA 1D7JA 1E6PA 2KE0A 2KGJA 3WH0A 1LJYA 2KI3A 2MLYA 1OGBA 4IQ2A 2WLYA 3CH9A 3KABA 1EYMA 4ZPVR 1HKJA 3O5GA 2G8ZA 2D9FA 4WKHA 2XP8A 4HARA 1JNTA 1VF8A 4J4NA 3IKDA 1NWUA 4DRKA 1HKKA 1PINA 3RFWA 4ZPWR 4DIPA 3RM8A 3ALFA 2B31A 3IKGA 1J4RA 1H0IA 1X6LA 5HT1A 3AQUA 3LUOA 5HW6A 3AS0A 4O2TA 1J6YA 3O5EA 2IF4A 3MDYB 4DRJA 2PV3A 1Q6HA 2MLXA 2A3BA 4P8VA 4ODMA 3KAHA 3OA5A 4MNLA 3O5MA 5HBFA 1FFQA 3PRBA 1ROTA 1E9LA 3WD1A 2DT2A 1WAWA 2KR7A 1FKKA 2XP7A 2Q5AA 1ITXA 2RUCA 3ALGA 1WB0A 3BXWA 4NSBA 3CGNA 3CHFA 1R9HA 4R0XA 4P8XA 4ZS6A 2FKEA 4HBEA 4MSPA 1D7HA 5HUAA 3H9RB 4ODOA 1ZCNA 1OWQA 1T11A 2ZR5A 2MNTA 1FAPA 1HJWA 1W9UA 1Q1CA 5DITA 2DSUA 3NTPA 4Z2GA 3JYMA 5J6EA 4GIVA 2M2AA 2XP3A 2ZR4A 1E6ZA 1Q6IA 1W1YA 4DRIA 5HW8A 4IT4A 4PTMA 5B8IC 1D2KA 4WJXA 3TCZA 2DPEA 4GGQA 1HKIA 2WK2A 2ITKA 4ML4A 2OFNA 5BXJA 3B9EA 2F4EA 1GUVA 3WD4A 2PPNA 2XPBA 1JVWA 2LKNA 3FAPA 3UI4A 4DT4A 2G41A 3ARRA 4U85A 4L3NA 4L72B 3RMEA 1ZK6A 2O9OA 4IQCA 2DG3A 4Z2JA 3NRKA 1N1AA 1EDQA 1EIBA 1FKGA 3B9DA 4ITZA 4KR0B 2MF9A 3G6LA 3PR9A 4MNMA 3CGMA 2LGOA 4TW7A 2RSEA 1WNOA 4MNKA 2ZR6A 1NWSA 3PRAA 3ODKA 3UQAA 3UF8A 1FD9A 3WQVA 2M1IA 3I6CA 2A3AA 1LG1A 1K9TA 1Y0OA 3WD0A 1ROUA 1NH6A 2PV1A 2XP6A 1TFVA 3UQBA 3UI6A 1SR0A 4Q22A 2DG4A 1QZ2A 2KFWA 1LL4A 2PPOA 1FKBA 4BF8A 5HW7A 3O5PA 4ODRA 1FKFA 2YBUA 3RM9A 4NZCA 4KQZA 2FAPA 2RUDA 2ZQUA 1EQ3A 3UI5A 3KZ7A 2RUQA 4U84A 4P8WA 5D75A 3O5RA 2ESCA 3O5JA 2XP4A 3WL0A 4MAVA 1E6NA 1NSGA 3CHCA 3O5FA 1BL4A 4WKFA 2PBCA 4DRQA 3NI6A 1W1TA 1W26A 2ZQSA 1E6RA 4QT2A 3ARTA 4DWSB 4DRNA 1J4HA 4MNJA 4NNRA 5DIUA 2ZQVA 1P5QA 2PV2A 1OGGA 1JNSA 2OLHA 1SYTA 2VCDA 3KACA 3WQWA 4JFKA 4WKAA 2AWGA 5GPGA 4WK9A 1RD6A 3O5LA 2LPVA 1ZBVA 2M08A 1YATA 3ARQA 3ARXA 4DRHA 1CTNA 4DZ2A 3IHZA 1ZBKA 2Y78A 4ODNA 1E15A 2N87A 1LL7A 1FKDA 4QZVB 3ARYA 3O5OA 2AOSA 1XRVA 2WLZA 2IUZA 2K8IA 4S3JA 2VN1A 4Z2LA 5JH8A 4TYOA 3AS1A 1NMVA 2WM0A 2PPPA 4Q7NA 4Z2KA 2F2DA 1EHNA 4C02B 4LAWA 1LL6A 4ODKA 1W1VA 4W9QA 1FFRA 3RGCA 2RURA 1H0GA 1J4IA 1HXVA 1ZBWA 1UR9A 1JNEA 2PI6A 4DRPA 2YBTA 4MPKA 1HKMA 1FKJA 3AS3A 1KT0A 4LAYA 1JNDA 1FKTA 4JFMA 4G2PA 3KCEA 1GPFA 1HJVA 3O5KA 3RM4A 2A3EA 4MGVA 4XAKA 1NWRA 1F8AB 3JXVA 2DT0A 1NMWA 4LAXA 4DWSD 4TX0A 2XPAA 4FAPA 1GOIA 3ARVA 1QPFA 4DH0A 3VAWA 3AROA 4U86A 1FJDA 3FXYA 1HJXA 1FKIA 4DWSA 4ODPA 1U79A 1NWTA 2XP5A 4TNSA 2LJ4A 3B9AA 3GPKA 2MPHA 3G6MA 2O92A 3OOBA 1M5YA 3WD2A 4IPXA 4W9PA 1KFWA 1ZL1A 5GQBA 3CZ8A 3TC5A 2A3CA 4LGXA 3PRDA 1TCOC 4ODQA 1X6NA 1FKLA 4MTVA 4P8UA 4IT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW5 A;  4FN2 A;  2M08 A;  1YAT A;  2PPN A;  3KAB A;  2XPB A;  1JVW A;  1EYM A;  2LKN A;  3O5G A;  3FAP A;  2D9F A;  3KAF A;  3UI4 A;  4DRH A;  4DT4 A;  3IHZ A;  2XP8 A;  2Y78 A;  1JNT A;  4ODN A;  4J4N A;  4U85 A;  4DZ2 A;  3IKD A;  2UZ5 A;  2F21 A;  2N87 A;  1FKD A;  1A7X A;  2JZV A;  4JYS A;  4DRK A;  1PIN A;  3O5F A;  1ZK6 A;  3O5O A;  4IQC A;  4N19 A;  5HWB A;  2DG9 A;  3RFW A;  3B7X A;  2DG3 A;  3PA7 A;  4W9O A;  3UQI A;  3NRK A;  4DIP A;  5HTG A;  4QIB A;  1BKF A;  2K8I A;  4DZ3 A;  1N1A A;  1QPL A;  2VN1 A;  3IKG A;  4JFJ A;  1FKG A;  4ITZ A;  2RQS A;  4TYO A;  4QT3 A;  1J4R A;  5HKG A;  1B6C A;  1D7I A;  2MF9 A;  1NMV A;  2PPP A;  3CGM A;  3TDB A;  2LGO A;  2F2D A;  5HT1 A;  3LUO A;  4C02 B;  4TW7 A;  4LAW A;  2RSE A;  5HW6 A;  1F40 A;  2ZR6 A;  4O2T A;  1J6Y A;  3O5E A;  4ODK A;  3ODK A;  3UQA A;  2IF4 A;  3MDY B;  3UF8 A;  4DRJ A;  1FD9 A;  2M1I A;  4JFI A;  4W9Q A;  2PV3 A;  3I6C A;  1FKR A;  1Q6H A;  3RGC A;  2MLX A;  2RUR A;  4ODM A;  3KAH A;  1J4I A;  4DRM A;  1HXV A;  1Y0O A;  3O5M A;  1ROU A;  2PV1 A;  3PRB A;  4DRP A;  2XP6 A;  1ROT A;  3UQB A;  1FKJ A;  2ZQT A;  3UI6 A;  1KT0 A;  2KR7 A;  4LAY A;  1FKK A;  2XP7 A;  2Q5A A;  1FKS A;  3JYJ A;  4G50 A;  2DG4 A;  1FKT A;  2RUC A;  1C9H A;  1L1P A;  1QZ2 A;  2KFW A;  4JFM A;  5I98 A;  4G2P A;  2PPO A;  3CGN A;  1FKB A;  1R9H A;  3KCE A;  4R0X A;  4BF8 A;  5HW7 A;  1KT1 A;  3O5K A;  1FKH A;  2FKE A;  3O5P A;  4ODR A;  1Q6U A;  1FKF A;  4MSP A;  1D7H A;  4JFL A;  4MGV A;  3O5I A;  4ODL A;  5HUA A;  4TW6 A;  2FAP A;  2RUD A;  2ZQU A;  1F8A B;  1EQ3 A;  3H9R B;  3IK8 A;  3JXV A;  1NMW A;  4LAX A;  1ZCN A;  4ODO A;  1T11 A;  3UI5 A;  2ZR5 A;  3KZ7 A;  4TX0 A;  2RUQ A;  2MNT A;  2XPA A;  4U84 A;  1FAP A;  5D75 A;  3O5R A;  4FAP A;  4DRO A;  1QPF A;  4DH0 A;  3O5J A;  3VAW A;  2XP4 A;  3EY6 A;  2L2S A;  4U86 A;  1FJD A;  1FKI A;  1D6O A;  1Q1C A;  4ODP A;  5DIT A;  3NTP A;  1U79 A;  1NSG A;  3JYM A;  5J6E A;  1PBK A;  2XP5 A;  4TW8 A;  2MLZ A;  4GIV A;  2M2A A;  4TNS A;  1BL4 A;  2LJ4 A;  2XP3 A;  2ZR4 A;  2MPH A;  2PBC A;  3GPK A;  1Q6I A;  3KAD A;  3O5Q A;  3O5D A;  3OOB A;  3NI6 A;  4DRQ A;  1M5Y A;  4DRI A;  5HW8 A;  1W26 A;  2ZQS A;  4QT2 A;  5DIV A;  5B8I C;  5HWC A;  4IPX A;  2KO7 A;  4W9P A;  4DRN A;  1J4H A;  2XP9 A;  3KAG A;  4NNR A;  5DIU A;  2ZQV A;  3TCZ A;  1P5Q A;  4GGQ A;  2PV2 A;  4J4O A;  4LAV A;  3TC5 A;  3KAI A;  1JNS A;  1D7J A;  2KE0 A;  2VCD A;  3KAC A;  1TCO C;  2ITK A;  3PRD A;  2KGJ A;  4ODQ A;  4JFK A;  1FKL A;  3WH0 A;  2OFN A;  5BXJ A;  2AWG A;  2MLY A;  2KI3 A;  2F4E A;  5GPG A;  4IQ2 A;  3O5L A;  2LPV A; 
#chains in the Genus database with same CATH topology
 1ZBC A;  1YW5 A;  4FN2 A;  1ZU8 A;  3KAF A;  3B8S A;  4WIW A;  2UZ5 A;  2F21 A;  1A7X A;  2JZV A;  3ARP A;  4JYS A;  3WD3 A;  5GPR A;  4N19 A;  5HWB A;  5DO2 A;  2DG9 A;  3W4R A;  3WIJ A;  3B7X A;  3ARZ A;  3PA7 A;  4W9O A;  3UQI A;  1W1P A;  5HTG A;  4QIB A;  1BKF A;  4DZ3 A;  1QPL A;  4ZPT R;  4JFJ A;  1IX5 A;  2RQS A;  4QT3 A;  4Z2H A;  2B5U B;  5HKG A;  1B6C A;  1D7I A;  3CHE A;  1O6I A;  3TDB A;  2QF8 A;  2DT3 A;  2P4V A;  1F40 A;  2DT1 A;  4JFI A;  2PN0 A;  3WKZ A;  1FKR A;  3AS2 A;  4DRM A;  3ARS A;  4S3K A;  4Z2I A;  4R5E A;  5DEZ A;  3ARU A;  2ZQT A;  2FDM A;  1FKS A;  3JYJ A;  4G50 A;  1L1P A;  1C9H A;  2DSV A;  5DF0 A;  5I98 A;  1KT1 A;  1FKH A;  2DSW A;  3FY1 A;  1Q6U A;  1ZB5 A;  4JFL A;  1XHG A;  3O5I A;  4ODL A;  4TW6 A;  3IK8 A;  3QOK A;  3CHD A;  1LG2 A;  2DSZ A;  4DRO A;  1W9P A;  1E44 A;  3EY6 A;  2L2S A;  1W9V A;  1D6O A;  1UR8 A;  1PBK A;  4TW8 A;  2MLZ A;  4W5U A;  4AY1 A;  3KAD A;  3O5Q A;  3O5D A;  5DIV A;  5HWC A;  2KO7 A;  4URI A;  3KAG A;  2XP9 A;  3ARW A;  4HBO A;  3WL1 A;  4J4O A;  4LAV A;  1LQ0 A;  4DWS C;  3KAI A;  1D7J A;  1E6P A;  2KE0 A;  2KGJ A;  3WH0 A;  1GRJ A;  1LJY A;  2KI3 A;  2MLY A;  1OGB A;  4IQ2 A;  2ETN A;  2F23 A;  2WLY A;  3CH9 A;  3KAB A;  1EYM A;  4ZPV R;  1HKJ A;  3O5G A;  2G8Z A;  2D9F A;  4WKH A;  2XP8 A;  4HAR A;  1JNT A;  1VF8 A;  4J4N A;  3IKD A;  3GU0 A;  1NWU A;  4DRK A;  1HKK A;  1PIN A;  3RFW A;  4ZPW R;  4DIP A;  3RM8 A;  3ALF A;  2B31 A;  3IKG A;  1J4R A;  1H0I A;  1X6L A;  5HT1 A;  3AQU A;  3LUO A;  5HW6 A;  3AS0 A;  4O2T A;  1J6Y A;  3O5E A;  2IF4 A;  3MDY B;  4DRJ A;  2PV3 A;  1Q6H A;  2MLX A;  2A3B A;  4P8V A;  4ODM A;  3KAH A;  3OA5 A;  4MNL A;  3O5M A;  5HBF A;  1FFQ A;  3PRB A;  1ROT A;  1E9L A;  3WD1 A;  2DT2 A;  1WAW A;  2KR7 A;  1FKK A;  2XP7 A;  2Q5A A;  1ITX A;  2RUC A;  3ALG A;  1WB0 A;  3BXW A;  4NSB A;  3CGN A;  3CHF A;  1R9H A;  4R0X A;  4P8X A;  4ZS6 A;  2FKE A;  4HBE A;  4MSP A;  1D7H A;  5HUA A;  3H9R B;  4ODO A;  1ZCN A;  1OWQ A;  1T11 A;  2ZR5 A;  2MNT A;  1FAP A;  1HJW A;  1W9U A;  1Q1C A;  5DIT A;  2DSU A;  3NTP A;  4Z2G A;  3JYM A;  5J6E A;  4GIV A;  2M2A A;  2XP3 A;  2ZR4 A;  1E6Z A;  1Q6I A;  1W1Y A;  4DRI A;  5HW8 A;  4IT4 A;  4PTM A;  5B8I C;  1D2K A;  4WJX A;  3TCZ A;  2DPE A;  4GGQ A;  1HKI A;  2WK2 A;  2ITK A;  4ML4 A;  2OFN A;  5BXJ A;  3B9E A;  2F4E A;  1GUV A;  3WD4 A;  3BMB A;  2PPN A;  2XPB A;  1JVW A;  2LKN A;  3GTY X;  3FAP A;  3UI4 A;  4DT4 A;  2G41 A;  3ARR A;  4U85 A;  4L3N A;  4L72 B;  3RME A;  1ZK6 A;  2O9O A;  4IQC A;  2DG3 A;  4Z2J A;  3NRK A;  1N1A A;  1EDQ A;  1EIB A;  1FKG A;  3B9D A;  4ITZ A;  4KR0 B;  2MF9 A;  3G6L A;  3PR9 A;  4MNM A;  3CGM A;  2LGO A;  4TW7 A;  2RSE A;  1WNO A;  4MNK A;  2ZR6 A;  1NWS A;  3PRA A;  3ODK A;  3UQA A;  3UF8 A;  1FD9 A;  3WQV A;  2M1I A;  1JCH B;  3I6C A;  2A3A A;  1LG1 A;  1K9T A;  1Y0O A;  3WD0 A;  1ROU A;  1NH6 A;  2PV1 A;  2XP6 A;  1TFV A;  3UQB A;  3UI6 A;  1SR0 A;  4Q22 A;  2DG4 A;  1QZ2 A;  2KFW A;  1LL4 A;  2PPO A;  1FKB A;  4BF8 A;  5HW7 A;  3O5P A;  4ODR A;  1FKF A;  2YBU A;  3RM9 A;  4NZC A;  4KQZ A;  2FAP A;  2RUD A;  2ZQU A;  1EQ3 A;  3UI5 A;  3KZ7 A;  2RUQ A;  4U84 A;  4P8W A;  5D75 A;  3O5R A;  2ESC A;  3O5J A;  2XP4 A;  3WL0 A;  4MAV A;  1E6N A;  1NSG A;  3CHC A;  3O5F A;  1BL4 A;  4WKF A;  2PBC A;  4DRQ A;  3NI6 A;  1W1T A;  1W26 A;  2ZQS A;  1E6R A;  4QT2 A;  3ART A;  4DWS B;  4DRN A;  1J4H A;  4MNJ A;  4NNR A;  5DIU A;  2ZQV A;  1P5Q A;  2PV2 A;  1OGG A;  1JNS A;  2OLH A;  1SYT A;  2VCD A;  3KAC A;  3WQW A;  4JFK A;  4WKA A;  2AWG A;  5GPG A;  4WK9 A;  1RD6 A;  3O5L A;  2LPV A;  1ZBV A;  2M08 A;  1YAT A;  3ARQ A;  3ARX A;  4DRH A;  1CTN A;  4DZ2 A;  3IHZ A;  1ZBK A;  2Y78 A;  4ODN A;  1E15 A;  2N87 A;  1LL7 A;  1FKD A;  4QZV B;  3ARY A;  3O5O A;  2AOS A;  1XRV A;  2WLZ A;  2IUZ A;  2K8I A;  4S3J A;  2VN1 A;  4Z2L A;  5JH8 A;  4TYO A;  3AS1 A;  1NMV A;  2WM0 A;  2PPP A;  4Q7N A;  4Z2K A;  2F2D A;  1EHN A;  4C02 B;  4LAW A;  1LL6 A;  4ODK A;  1W1V A;  4W9Q A;  1FFR A;  3RGC A;  2RUR A;  1H0G A;  1J4I A;  1HXV A;  1ZBW A;  1UR9 A;  1JNE A;  2PI6 A;  4DRP A;  2YBT A;  4MPK A;  1HKM A;  1FKJ A;  3AS3 A;  1KT0 A;  4LAY A;  1JND A;  1FKT A;  4JFM A;  4G2P A;  2EUL A;  3KCE A;  1GPF A;  1HJV A;  3O5K A;  3RM4 A;  2A3E A;  4MGV A;  4XAK A;  1NWR A;  1F8A B;  3JXV A;  2DT0 A;  1NMW A;  4LAX A;  4DWS D;  4TX0 A;  2XPA A;  4FAP A;  1GOI A;  3ARV A;  1QPF A;  4DH0 A;  3VAW A;  3ARO A;  4U86 A;  1FJD A;  3FXY A;  1HJX A;  1FKI A;  4UDM A;  4DWS A;  4ODP A;  1U79 A;  3EIP A;  1NWT A;  2XP5 A;  4TNS A;  2LJ4 A;  3B9A A;  3GPK A;  2MPH A;  3G6M A;  2O92 A;  3OOB A;  1M5Y A;  3WD2 A;  4IPX A;  4W9P A;  1KFW A;  1ZL1 A;  5GQB A;  3CZ8 A;  3TC5 A;  2A3C A;  4LGX A;  3PRD A;  1TCO C;  4ODQ A;  1X6N A;  1FKL A;  4MTV A;  4P8U A;  4IT6 A; 
#chains in the Genus database with same CATH homology
 1ZBC A;  1YW5 A;  4FN2 A;  1ZU8 A;  3KAF A;  3B8S A;  4WIW A;  2UZ5 A;  2F21 A;  1A7X A;  2JZV A;  3ARP A;  4JYS A;  3WD3 A;  5GPR A;  4N19 A;  5HWB A;  5DO2 A;  2DG9 A;  3W4R A;  3WIJ A;  3B7X A;  3ARZ A;  3PA7 A;  4W9O A;  3UQI A;  1W1P A;  5HTG A;  4QIB A;  1BKF A;  4DZ3 A;  1QPL A;  4ZPT R;  4JFJ A;  1IX5 A;  2RQS A;  4QT3 A;  4Z2H A;  5HKG A;  1B6C A;  1D7I A;  3CHE A;  1O6I A;  3TDB A;  2QF8 A;  2DT3 A;  1F40 A;  2DT1 A;  4JFI A;  3WKZ A;  1FKR A;  3AS2 A;  4DRM A;  3ARS A;  4S3K A;  4Z2I A;  4R5E A;  5DEZ A;  3ARU A;  2ZQT A;  2FDM A;  1FKS A;  3JYJ A;  4G50 A;  1L1P A;  1C9H A;  2DSV A;  5DF0 A;  5I98 A;  1KT1 A;  1FKH A;  2DSW A;  3FY1 A;  1Q6U A;  1ZB5 A;  4JFL A;  1XHG A;  3O5I A;  4ODL A;  4TW6 A;  3IK8 A;  3QOK A;  3CHD A;  1LG2 A;  2DSZ A;  4DRO A;  1W9P A;  3EY6 A;  2L2S A;  1W9V A;  1D6O A;  1UR8 A;  1PBK A;  4TW8 A;  2MLZ A;  4W5U A;  4AY1 A;  3KAD A;  3O5Q A;  3O5D A;  5DIV A;  5HWC A;  2KO7 A;  4URI A;  3KAG A;  2XP9 A;  3ARW A;  4HBO A;  3WL1 A;  4J4O A;  4LAV A;  1LQ0 A;  4DWS C;  3KAI A;  1D7J A;  1E6P A;  2KE0 A;  2KGJ A;  3WH0 A;  1LJY A;  2KI3 A;  2MLY A;  1OGB A;  4IQ2 A;  2WLY A;  3CH9 A;  3KAB A;  1EYM A;  4ZPV R;  1HKJ A;  3O5G A;  2G8Z A;  2D9F A;  4WKH A;  2XP8 A;  4HAR A;  1JNT A;  1VF8 A;  4J4N A;  3IKD A;  1NWU A;  4DRK A;  1HKK A;  1PIN A;  3RFW A;  4ZPW R;  4DIP A;  3RM8 A;  3ALF A;  2B31 A;  3IKG A;  1J4R A;  1H0I A;  1X6L A;  5HT1 A;  3AQU A;  3LUO A;  5HW6 A;  3AS0 A;  4O2T A;  1J6Y A;  3O5E A;  2IF4 A;  3MDY B;  4DRJ A;  2PV3 A;  1Q6H A;  2MLX A;  2A3B A;  4P8V A;  4ODM A;  3KAH A;  3OA5 A;  4MNL A;  3O5M A;  5HBF A;  1FFQ A;  3PRB A;  1ROT A;  1E9L A;  3WD1 A;  2DT2 A;  1WAW A;  2KR7 A;  1FKK A;  2XP7 A;  2Q5A A;  1ITX A;  2RUC A;  3ALG A;  1WB0 A;  3BXW A;  4NSB A;  3CGN A;  3CHF A;  1R9H A;  4R0X A;  4P8X A;  4ZS6 A;  2FKE A;  4HBE A;  4MSP A;  1D7H A;  5HUA A;  3H9R B;  4ODO A;  1ZCN A;  1OWQ A;  1T11 A;  2ZR5 A;  2MNT A;  1FAP A;  1HJW A;  1W9U A;  1Q1C A;  5DIT A;  2DSU A;  3NTP A;  4Z2G A;  3JYM A;  5J6E A;  4GIV A;  2M2A A;  2XP3 A;  2ZR4 A;  1E6Z A;  1Q6I A;  1W1Y A;  4DRI A;  5HW8 A;  4IT4 A;  4PTM A;  5B8I C;  1D2K A;  4WJX A;  3TCZ A;  2DPE A;  4GGQ A;  1HKI A;  2WK2 A;  2ITK A;  4ML4 A;  2OFN A;  5BXJ A;  3B9E A;  2F4E A;  1GUV A;  3WD4 A;  2PPN A;  2XPB A;  1JVW A;  2LKN A;  3FAP A;  3UI4 A;  4DT4 A;  2G41 A;  3ARR A;  4U85 A;  4L3N A;  4L72 B;  3RME A;  1ZK6 A;  2O9O A;  4IQC A;  2DG3 A;  4Z2J A;  3NRK A;  1N1A A;  1EDQ A;  1EIB A;  1FKG A;  3B9D A;  4ITZ A;  4KR0 B;  2MF9 A;  3G6L A;  3PR9 A;  4MNM A;  3CGM A;  2LGO A;  4TW7 A;  2RSE A;  1WNO A;  4MNK A;  2ZR6 A;  1NWS A;  3PRA A;  3ODK A;  3UQA A;  3UF8 A;  1FD9 A;  3WQV A;  2M1I A;  3I6C A;  2A3A A;  1LG1 A;  1K9T A;  1Y0O A;  3WD0 A;  1ROU A;  1NH6 A;  2PV1 A;  2XP6 A;  1TFV A;  3UQB A;  3UI6 A;  1SR0 A;  4Q22 A;  2DG4 A;  1QZ2 A;  2KFW A;  1LL4 A;  2PPO A;  1FKB A;  4BF8 A;  5HW7 A;  3O5P A;  4ODR A;  1FKF A;  2YBU A;  3RM9 A;  4NZC A;  4KQZ A;  2FAP A;  2RUD A;  2ZQU A;  1EQ3 A;  3UI5 A;  3KZ7 A;  2RUQ A;  4U84 A;  4P8W A;  5D75 A;  3O5R A;  2ESC A;  3O5J A;  2XP4 A;  3WL0 A;  4MAV A;  1E6N A;  1NSG A;  3CHC A;  3O5F A;  1BL4 A;  4WKF A;  2PBC A;  4DRQ A;  3NI6 A;  1W1T A;  1W26 A;  2ZQS A;  1E6R A;  4QT2 A;  3ART A;  4DWS B;  4DRN A;  1J4H A;  4MNJ A;  4NNR A;  5DIU A;  2ZQV A;  1P5Q A;  2PV2 A;  1OGG A;  1JNS A;  2OLH A;  1SYT A;  2VCD A;  3KAC A;  3WQW A;  4JFK A;  4WKA A;  2AWG A;  5GPG A;  4WK9 A;  1RD6 A;  3O5L A;  2LPV A;  1ZBV A;  2M08 A;  1YAT A;  3ARQ A;  3ARX A;  4DRH A;  1CTN A;  4DZ2 A;  3IHZ A;  1ZBK A;  2Y78 A;  4ODN A;  1E15 A;  2N87 A;  1LL7 A;  1FKD A;  4QZV B;  3ARY A;  3O5O A;  2AOS A;  1XRV A;  2WLZ A;  2IUZ A;  2K8I A;  4S3J A;  2VN1 A;  4Z2L A;  5JH8 A;  4TYO A;  3AS1 A;  1NMV A;  2WM0 A;  2PPP A;  4Q7N A;  4Z2K A;  2F2D A;  1EHN A;  4C02 B;  4LAW A;  1LL6 A;  4ODK A;  1W1V A;  4W9Q A;  1FFR A;  3RGC A;  2RUR A;  1H0G A;  1J4I A;  1HXV A;  1ZBW A;  1UR9 A;  1JNE A;  2PI6 A;  4DRP A;  2YBT A;  4MPK A;  1HKM A;  1FKJ A;  3AS3 A;  1KT0 A;  4LAY A;  1JND A;  1FKT A;  4JFM A;  4G2P A;  3KCE A;  1GPF A;  1HJV A;  3O5K A;  3RM4 A;  2A3E A;  4MGV A;  4XAK A;  1NWR A;  1F8A B;  3JXV A;  2DT0 A;  1NMW A;  4LAX A;  4DWS D;  4TX0 A;  2XPA A;  4FAP A;  1GOI A;  3ARV A;  1QPF A;  4DH0 A;  3VAW A;  3ARO A;  4U86 A;  1FJD A;  3FXY A;  1HJX A;  1FKI A;  4DWS A;  4ODP A;  1U79 A;  1NWT A;  2XP5 A;  4TNS A;  2LJ4 A;  3B9A A;  3GPK A;  2MPH A;  3G6M A;  2O92 A;  3OOB A;  1M5Y A;  3WD2 A;  4IPX A;  4W9P A;  1KFW A;  1ZL1 A;  5GQB A;  3CZ8 A;  3TC5 A;  2A3C A;  4LGX A;  3PRD A;  1TCO C;  4ODQ A;  1X6N A;  1FKL A;  4MTV A;  4P8U A;  4IT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...