1JNTA

Nmr structure of the e. coli peptidyl-prolyl cis/trans-isomerase parvulin 10
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
AKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Escherichia coli Par10: The prototypic member of the Parvulin family of peptidyl-prolyl cis/trans isomerases.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE C
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2001-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13616 Rotamase_3 PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1jntA00
4JFMA 3O5OA 4J4OA 2M08A 3O5DA 1B6CA 1FAPA 5J6EA 3KAGA 3O5JA 4JFLA 2XP3A 4DRQA 3O5RA 2RQSA 5HKGA 4ITZA 4LAXA 1ROTA 2LJ4A 3IHZA 1JVWA 4DZ3A 1D7HA 4DZ2A 2LKNA 2MLYA 3MDYB 4W9OA 2VCDA 3KAHA 2M1IA 3JXVA 3UI4A 1FKJA 2RUCA 1BL4A 2D9FA 3O5IA 3I6CA 3O5PA 3O5GA 3ODKA 2Y78A 1FJDA 1FKHA 4IPXA 1F40A 4TYOA 3KAFA 1ROUA 1W26A 1YATA 2L2SA 2RSEA 4C02B 3UI6A 4TX0A 2XP4A 2PPNA 2N87A 3O5EA 4DRPA 4TW6A 1Q6IA 4MSPA 1FKRA 4U84A 5HUAA 1NMVA 3FAPA 1A7XA 1J4RA 2LGOA 3PRDA 2AWGA 1D7JA 2PPOA 2DG9A 2XP9A 2RUDA 2F21A 1M5YA 2KR7A 2MLZA 3NTPA 3VAWA 2IF4A 2ITKA 2OFNA 4TNSA 4DH0A 4W9QA 4DRNA 2ZQTA 4JFJA 2ZR6A 4O2TA 1L1PA 1Q6UA 3B7XA 2KI3A 4JFKA 2K8IA 3CGMA 3JYJA 1JNTA 5DIUA 3KCEA 4ODNA 2FKEA 2F4EA 4IQCA 3IK8A 2KGJA 2ZQUA 3TCZA 4N19A 2XP8A 3UQAA 1J4IA 5HW6A 4QT3A 3KZ7A 4FAPA 4TW8A 1T11A 4ODRA 3TC5A 4FN2A 1FKBA 3O5KA 3WH0A 4ODKA 4DRHA 4LAVA 2XP5A 2KFWA 2UZ5A 2MLXA 3UI5A 1FKSA 1J4HA 4G2PA 5DITA 1KT1A 4TW7A 1FKLA 4DT4A 1JNSA 2ZQVA 4BF8A 3NI6A 5HWCA 5I98A 3NRKA 2VN1A 1NSGA 3GPKA 3O5QA 3PRBA 4ODLA 4W9PA 5HWBA 3KABA 4MGVA 3H9RB 3TDBA 4IQ2A 3KAIA 1FKKA 4DRIA 3OOBA 1P5QA 4J4NA 4QIBA 1QZ2A 4ODQA 2MF9A 1FKTA 3LUOA 1Q1CA 4U86A 2MPHA 2XP7A 4LAWA 5HT1A 2PV2A 4DRJA 1HXVA 2F2DA 1QPLA 2RUQA 3KACA 3PA7A 5GPGA 3UQBA 2ZQSA 2ZR4A 4NNRA 4ODOA 2JZVA 2KO7A 2XPBA 1FKDA 5HW8A 2DG3A 1FKFA 4JYSA 1YW5A 2M2AA 5HW7A 3UF8A 4GGQA 1Y0OA 1PBKA 1N1AA 2PBCA 2PPPA 2PV3A 4DROA 2FAPA 2KE0A 3EY6A 1FD9A 2XPAA 2LPVA 4ODPA 1EQ3A 1U79A 2Q5AA 1ZCNA 5HTGA 1NMWA 4LAYA 3IKDA 1D7IA 1BKFA 1FKIA 1Q6HA 1ZK6A 3KADA 3CGNA 3O5MA 1J6YA 2ZR5A 4JFIA 1QPFA 3O5LA 3RFWA 4GIVA 1F8AB 2PV1A 5BXJA 4G50A 3O5FA 3UQIA 5D75A 3RGCA 4ODMA 4DIPA 4QT2A 1EYMA 4DRMA 2XP6A 3JYMA 5B8IC 1FKGA 4U85A 1KT0A 4DRKA 1R9HA 4R0XA 5DIVA 1TCOC 3IKGA 1C9HA 1PINA 2DG4A 2MNTA 1D6OA 2RURA
chains in the Genus database with same CATH superfamily
4J4OA 2M08A 3AS3A 3O5DA 2A3CA 1FFQA 4NSBA 4DRQA 3O5RA 3PR9A 2RQSA 1W9UA 2B5UB 1LG1A 1ROTA 2WLYA 4DZ3A 2A3EA 2DSWA 4W9OA 1XRVA 3JXVA 3UI4A 2RUCA 1FJDA 3O5PA 2Y78A 1H0IA 4TYOA 3CHEA 1ROUA 1W26A 1YATA 2G8ZA 1E6PA 4TW6A 1Q6IA 1ZBKA 1FKRA 1XHGA 4U84A 3WD0A 3B8SA 2AWGA 1D7JA 2PN0A 3WQWA 1M5YA 2KR7A 1O6IA 2OFNA 4TNSA 2B31A 4DRNA 2ZQTA 4O2TA 1GOIA 1NH6A 1VF8A 5DEZA 2KGJA 3EIPA 3G6LA 4AY1A 4S3JA 1J4IA 3CZ8A 1X6LA 4QT3A 1W1TA 3KZ7A 5GQBA 4FAPA 4TW8A 1E6RA 4FN2A 3O5KA 4S3KA 4LAVA 3ARYA 2MLXA 3UI5A 5DITA 1NWUA 4DWSB 5I98A 3NRKA 1JNDA 2VN1A 1UR8A 3O5QA 3AS2A 3GTYX 4MGVA 3B9EA 4DRIA 4QIBA 1QZ2A 1Q1CA 2XP7A 4LAWA 1HXVA 4MNKA 3BMBA 1GPFA 1LJYA 3CHFA 3PA7A 4P8UA 3UQBA 4ODOA 4WKFA 2KO7A 1LG2A 3WD3A 1YW5A 2FAPA 1KFWA 1FD9A 5JH8A 2Q5AA 5HTGA 1ZBWA 3ARTA 4PTMA 3ALGA 2DSVA 2G41A 4LAYA 4ZPWR 3KADA 1J6YA 1HKMA 3FXYA 2PV1A 4Z2HA 5D75A 4ML4A 4DRMA 3ARUA 5HBFA 3QOKA 5DIVA 4WJXA 3O5MA 4Z2JA 4JFMA 1B6CA 3WD2A 5J6EA 3KAGA 2XP3A 4MNMA 3ARRA 4LAXA 3IHZA 4DZ2A 2LKNA 3MDYB 2EULA 1LQ0A 2M1IA 4HBOA 1SYTA 4ZPVR 1BL4A 4ZPTR 5GPRA 3KAFA 4ZS6A 2RSEA 1E9LA 1OGGA 1W9PA 3GU0A 3RM4A 4MSPA 3CH9A 2A3AA 5HUAA 4Z2IA 3PRDA 2RUDA 1LL7A 3BXWA 3VAWA 2ITKA 4DH0A 4W9QA 1ZBVA 4JFJA 2ZR6A 1D2KA 1L1PA 5DIUA 3CGMA 3KCEA 1ITXA 2F4EA 2FKEA 1HJXA 3IK8A 4IQCA 2XP8A 4Z2LA 3UQAA 2QF8A 3TC5A 1GUVA 4XAKA 4DRHA 1FKSA 1KT1A 4TW7A 4DT4A 4MNJA 5HWCA 2DT1A 4ODLA 1EDQA 2YBUA 5HWBA 3KABA 2WLZA 3H9RB 4IQ2A 3OOBA 4J4NA 4ODQA 1JNEA 4IT6A 3WL0A 4DWSD 5HT1A 2MPHA 3WQVA 2F2DA 4P8WA 5GPGA 2JZVA 2ESCA 2FDMA 1FKDA 1FKFA 5HW7A 3UF8A 1Y0OA 2PPPA 4DWSC 3RM9A 2O9OA 2LPVA 4KR0B 1EQ3A 1U79A 3WKZA 4IT4A 3ARSA 1HKIA 1HJVA 1NMWA 1SR0A 1BKFA 1FKIA 1HKKA 1ZK6A 3CGNA 2ZR5A 4JFIA 3O5LA 3RFWA 4G50A 1OGBA 3RGCA 1TFVA 4P8XA 1EYMA 1WNOA 2PI6A 5B8IC 3RMEA 1R9HA 1TCOC 2RURA 2DSZA 1FAPA 3O5JA 3ARXA 4JFLA 2YBTA 4WK9A 2OLHA 5HKGA 3ALFA 3ARQA 2LJ4A 3WIJA 2MLYA 2A3BA 2D9FA 3G6MA 3ODKA 3I6CA 1LL6A 3O5GA 4Q7NA 1X6NA 4TX0A 2XP4A 2N87A 4L72B 3WD1A 3FAPA 1EIBA 1ZB5A 2DG9A 2F21A 2MLZA 2DSUA 4Z2KA 4W5UA 1FFRA 4WKHA 3WL1A 1Q6UA 1JNTA 2P4VA 4ODNA 4N19A 4HARA 5DF0A 1IX5A 1T11A 3FY1A 1HKJA 3ARPA 3WH0A 4ODKA 4R5EA 1ZL1A 4Z2GA 1GRJA 3B9DA 1J4HA 1JNSA 1FKLA 1E44A 2ZQVA 4BF8A 4P8VA 1NSGA 3GPKA 3TDBA 1HJWA 1P5QA 1E15A 4UDMA 3LUOA 4U86A 2PV2A 1QPLA 2ZR4A 1WB0A 4JYSA 4GGQA 1PBKA 1N1AA 4DROA 2PV3A 3EY6A 3AROA 4URIA 1ZU8A 3IKDA 1Q6HA 4WKAA 1W1VA 1QPFA 4GIVA 3O5FA 3UQIA 3ARVA 4ODMA 4QT2A 2XP6A 2DT3A 4U85A 2DG4A 1W1PA 1D6OA 4DRJA 4HBEA 3O5OA 1W9VA 1ZBCA 1K9TA 3CHCA 2IUZA 2ETNA 4ITZA 4MAVA 1JVWA 1D7HA 3OA5A 2VCDA 3KAHA 2DPEA 4Q22A 1FKJA 3O5IA 1FKHA 4IPXA 1F40A 1JCHB 4MNLA 4C02B 2L2SA 3UI6A 1RD6A 2PPNA 3O5EA 4DRPA 4MTVA 1E6ZA 1CTNA 1NMVA 2WK2A 1A7XA 1J4RA 2LGOA 2PPOA 2XP9A 4L3NA 3B9AA 3NTPA 2IF4A 2O92A 3AS1A 1NWTA 5DO2A 3B7XA 4JFKA 2KI3A 2K8IA 3JYJA 2ZQUA 3TCZA 3W4RA 2WM0A 2AOSA 5HW6A 1W1YA 4ODRA 1FKBA 3ARWA 3ARZA 2XP5A 2KFWA 2UZ5A 4QZVB 4G2PA 3AS0A 3NI6A 2F23A 3AQUA 3PRBA 4W9PA 1H0GA 1LL4A 3KAIA 1FKKA 3WD4A 2MF9A 1FKTA 4WIWA 1EHNA 4DWSA 4KQZA 1NWSA 1WAWA 2RUQA 3KACA 2ZQSA 4NNRA 2XPBA 5HW8A 2DG3A 3PRAA 2M2AA 2PBCA 2KE0A 1E6NA 2DT2A 2XPAA 4LGXA 4ODPA 1ZCNA 4NZCA 3CHDA 1OWQA 1D7IA 1F8AB 3RM8A 5BXJA 4DIPA 3JYMA 1FKGA 4MPKA 1KT0A 4DRKA 4R0XA 3IKGA 1NWRA 2DT0A 1C9HA 1PINA 1UR9A 2MNTA
chains in the Genus database with same CATH topology
4J4OA 2M08A 3AS3A 3O5DA 2A3CA 1FFQA 4NSBA 4DRQA 3O5RA 3PR9A 2RQSA 1W9UA 1LG1A 1ROTA 2WLYA 4DZ3A 2A3EA 2DSWA 4W9OA 1XRVA 3JXVA 3UI4A 2RUCA 1FJDA 3O5PA 2Y78A 1H0IA 4TYOA 3CHEA 1ROUA 1W26A 1YATA 2G8ZA 1E6PA 4TW6A 1Q6IA 1ZBKA 1FKRA 1XHGA 4U84A 3WD0A 3B8SA 2AWGA 1D7JA 3WQWA 1M5YA 2KR7A 1O6IA 2OFNA 4TNSA 2B31A 4DRNA 2ZQTA 4O2TA 1GOIA 1NH6A 1VF8A 5DEZA 2KGJA 3G6LA 4AY1A 4S3JA 1J4IA 3CZ8A 1X6LA 4QT3A 1W1TA 3KZ7A 5GQBA 4FAPA 4TW8A 1E6RA 4FN2A 3O5KA 4S3KA 4LAVA 3ARYA 2MLXA 3UI5A 5DITA 1NWUA 4DWSB 5I98A 3NRKA 1JNDA 2VN1A 1UR8A 3O5QA 3AS2A 4MGVA 3B9EA 4DRIA 4QIBA 1QZ2A 1Q1CA 2XP7A 4LAWA 1HXVA 4MNKA 1GPFA 1LJYA 3CHFA 3PA7A 4P8UA 3UQBA 4ODOA 4WKFA 2KO7A 1LG2A 3WD3A 1YW5A 2FAPA 1KFWA 1FD9A 5JH8A 2Q5AA 5HTGA 1ZBWA 3ARTA 4PTMA 3ALGA 2DSVA 2G41A 4LAYA 4ZPWR 3KADA 1J6YA 1HKMA 3FXYA 2PV1A 4Z2HA 5D75A 4ML4A 4DRMA 3ARUA 5HBFA 3QOKA 5DIVA 4WJXA 3O5MA 4Z2JA 4JFMA 1B6CA 3WD2A 5J6EA 3KAGA 2XP3A 4MNMA 3ARRA 4LAXA 3IHZA 4DZ2A 2LKNA 3MDYB 1LQ0A 2M1IA 4HBOA 1SYTA 4ZPVR 1BL4A 4ZPTR 5GPRA 3KAFA 4ZS6A 2RSEA 1E9LA 1OGGA 1W9PA 3RM4A 4MSPA 3CH9A 2A3AA 5HUAA 4Z2IA 3PRDA 2RUDA 1LL7A 3BXWA 3VAWA 2ITKA 4DH0A 4W9QA 1ZBVA 4JFJA 2ZR6A 1D2KA 1L1PA 5DIUA 3CGMA 3KCEA 1ITXA 2F4EA 2FKEA 1HJXA 3IK8A 4IQCA 2XP8A 4Z2LA 3UQAA 2QF8A 3TC5A 1GUVA 4XAKA 4DRHA 1FKSA 1KT1A 4TW7A 4DT4A 4MNJA 5HWCA 2DT1A 4ODLA 1EDQA 2YBUA 5HWBA 3KABA 2WLZA 3H9RB 4IQ2A 3OOBA 4J4NA 4ODQA 1JNEA 4IT6A 3WL0A 4DWSD 5HT1A 2MPHA 3WQVA 2F2DA 4P8WA 5GPGA 2JZVA 2ESCA 2FDMA 1FKDA 1FKFA 5HW7A 3UF8A 1Y0OA 2PPPA 4DWSC 3RM9A 2O9OA 2LPVA 4KR0B 1EQ3A 1U79A 3WKZA 4IT4A 3ARSA 1HKIA 1HJVA 1NMWA 1SR0A 1BKFA 1FKIA 1HKKA 1ZK6A 3CGNA 2ZR5A 4JFIA 3O5LA 3RFWA 4G50A 1OGBA 3RGCA 1TFVA 4P8XA 1EYMA 1WNOA 2PI6A 5B8IC 3RMEA 1R9HA 1TCOC 2RURA 2DSZA 1FAPA 3O5JA 3ARXA 4JFLA 2YBTA 4WK9A 2OLHA 5HKGA 3ALFA 3ARQA 2LJ4A 3WIJA 2MLYA 2A3BA 2D9FA 3G6MA 3ODKA 3I6CA 1LL6A 3O5GA 4Q7NA 1X6NA 4TX0A 2XP4A 2N87A 4L72B 3WD1A 3FAPA 1EIBA 1ZB5A 2DG9A 2F21A 2MLZA 2DSUA 4Z2KA 4W5UA 1FFRA 4WKHA 3WL1A 1Q6UA 1JNTA 4ODNA 4N19A 4HARA 5DF0A 1IX5A 1T11A 3FY1A 1HKJA 3ARPA 3WH0A 4ODKA 4R5EA 1ZL1A 4Z2GA 3B9DA 1J4HA 1JNSA 1FKLA 2ZQVA 4BF8A 4P8VA 1NSGA 3GPKA 3TDBA 1HJWA 1P5QA 1E15A 3LUOA 4U86A 2PV2A 1QPLA 2ZR4A 1WB0A 4JYSA 4GGQA 1PBKA 1N1AA 4DROA 2PV3A 3EY6A 3AROA 4URIA 1ZU8A 3IKDA 1Q6HA 4WKAA 1W1VA 1QPFA 4GIVA 3O5FA 3UQIA 3ARVA 4ODMA 4QT2A 2XP6A 2DT3A 4U85A 2DG4A 1W1PA 1D6OA 4DRJA 4HBEA 3O5OA 1W9VA 1ZBCA 1K9TA 3CHCA 2IUZA 4ITZA 4MAVA 1JVWA 1D7HA 3OA5A 2VCDA 3KAHA 2DPEA 4Q22A 1FKJA 3O5IA 1FKHA 4IPXA 1F40A 4MNLA 4C02B 2L2SA 3UI6A 1RD6A 2PPNA 3O5EA 4DRPA 4MTVA 1E6ZA 1CTNA 1NMVA 2WK2A 1A7XA 1J4RA 2LGOA 2PPOA 2XP9A 4L3NA 3B9AA 3NTPA 2IF4A 2O92A 3AS1A 1NWTA 5DO2A 3B7XA 4JFKA 2KI3A 2K8IA 3JYJA 2ZQUA 3TCZA 3W4RA 2WM0A 2AOSA 5HW6A 1W1YA 4ODRA 1FKBA 3ARWA 3ARZA 2XP5A 2KFWA 2UZ5A 4QZVB 4G2PA 3AS0A 3NI6A 3AQUA 3PRBA 4W9PA 1H0GA 1LL4A 3KAIA 1FKKA 3WD4A 2MF9A 1FKTA 4WIWA 1EHNA 4DWSA 4KQZA 1NWSA 1WAWA 2RUQA 3KACA 2ZQSA 4NNRA 2XPBA 5HW8A 2DG3A 3PRAA 2M2AA 2PBCA 2KE0A 1E6NA 2DT2A 2XPAA 4LGXA 4ODPA 1ZCNA 4NZCA 3CHDA 1OWQA 1D7IA 1F8AB 3RM8A 5BXJA 4DIPA 3JYMA 1FKGA 4MPKA 1KT0A 4DRKA 4R0XA 3IKGA 1NWRA 2DT0A 1C9HA 1PINA 1UR9A 2MNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  3O5O A;  4J4O A;  2M08 A;  3O5D A;  1B6C A;  1FAP A;  5J6E A;  3KAG A;  3O5J A;  4JFL A;  2XP3 A;  4DRQ A;  3O5R A;  2RQS A;  5HKG A;  4ITZ A;  4LAX A;  1ROT A;  2LJ4 A;  3IHZ A;  1JVW A;  4DZ3 A;  1D7H A;  4DZ2 A;  2LKN A;  2MLY A;  3MDY B;  4W9O A;  2VCD A;  3KAH A;  2M1I A;  3JXV A;  3UI4 A;  1FKJ A;  2RUC A;  1BL4 A;  2D9F A;  3O5I A;  3I6C A;  3O5P A;  3O5G A;  3ODK A;  2Y78 A;  1FJD A;  1FKH A;  4IPX A;  1F40 A;  4TYO A;  3KAF A;  1ROU A;  1W26 A;  1YAT A;  2L2S A;  2RSE A;  4C02 B;  3UI6 A;  4TX0 A;  2XP4 A;  2PPN A;  2N87 A;  3O5E A;  4DRP A;  4TW6 A;  1Q6I A;  4MSP A;  1FKR A;  4U84 A;  5HUA A;  1NMV A;  3FAP A;  1A7X A;  1J4R A;  2LGO A;  3PRD A;  2AWG A;  1D7J A;  2PPO A;  2DG9 A;  2XP9 A;  2RUD A;  2F21 A;  1M5Y A;  2KR7 A;  2MLZ A;  3NTP A;  3VAW A;  2IF4 A;  2ITK A;  2OFN A;  4TNS A;  4DH0 A;  4W9Q A;  4DRN A;  2ZQT A;  4JFJ A;  2ZR6 A;  4O2T A;  1L1P A;  1Q6U A;  3B7X A;  2KI3 A;  4JFK A;  2K8I A;  3CGM A;  3JYJ A;  1JNT A;  5DIU A;  3KCE A;  4ODN A;  2FKE A;  2F4E A;  4IQC A;  3IK8 A;  2KGJ A;  2ZQU A;  3TCZ A;  4N19 A;  2XP8 A;  3UQA A;  1J4I A;  5HW6 A;  4QT3 A;  3KZ7 A;  4FAP A;  4TW8 A;  1T11 A;  4ODR A;  3TC5 A;  4FN2 A;  1FKB A;  3O5K A;  3WH0 A;  4ODK A;  4DRH A;  4LAV A;  2XP5 A;  2KFW A;  2UZ5 A;  2MLX A;  3UI5 A;  1FKS A;  1J4H A;  4G2P A;  5DIT A;  1KT1 A;  4TW7 A;  1FKL A;  4DT4 A;  1JNS A;  2ZQV A;  4BF8 A;  3NI6 A;  5HWC A;  5I98 A;  3NRK A;  2VN1 A;  1NSG A;  3GPK A;  3O5Q A;  3PRB A;  4ODL A;  4W9P A;  5HWB A;  3KAB A;  4MGV A;  3H9R B;  3TDB A;  4IQ2 A;  3KAI A;  1FKK A;  4DRI A;  3OOB A;  1P5Q A;  4J4N A;  4QIB A;  1QZ2 A;  4ODQ A;  2MF9 A;  1FKT A;  3LUO A;  1Q1C A;  4U86 A;  2MPH A;  2XP7 A;  4LAW A;  5HT1 A;  2PV2 A;  4DRJ A;  1HXV A;  2F2D A;  1QPL A;  2RUQ A;  3KAC A;  3PA7 A;  5GPG A;  3UQB A;  2ZQS A;  2ZR4 A;  4NNR A;  4ODO A;  2JZV A;  2KO7 A;  2XPB A;  1FKD A;  5HW8 A;  2DG3 A;  1FKF A;  4JYS A;  1YW5 A;  2M2A A;  5HW7 A;  3UF8 A;  4GGQ A;  1Y0O A;  1PBK A;  1N1A A;  2PBC A;  2PPP A;  2PV3 A;  4DRO A;  2FAP A;  2KE0 A;  3EY6 A;  1FD9 A;  2XPA A;  2LPV A;  4ODP A;  1EQ3 A;  1U79 A;  2Q5A A;  1ZCN A;  5HTG A;  1NMW A;  4LAY A;  3IKD A;  1D7I A;  1BKF A;  1FKI A;  1Q6H A;  1ZK6 A;  3KAD A;  3CGN A;  3O5M A;  1J6Y A;  2ZR5 A;  4JFI A;  1QPF A;  3O5L A;  3RFW A;  4GIV A;  1F8A B;  2PV1 A;  5BXJ A;  4G50 A;  3O5F A;  3UQI A;  5D75 A;  3RGC A;  4ODM A;  4DIP A;  4QT2 A;  1EYM A;  4DRM A;  2XP6 A;  3JYM A;  5B8I C;  1FKG A;  4U85 A;  1KT0 A;  4DRK A;  1R9H A;  4R0X A;  5DIV A;  1TCO C;  3IKG A;  1C9H A;  1PIN A;  2DG4 A;  2MNT A;  1D6O A;  2RUR A; 
#chains in the Genus database with same CATH topology
 4J4O A;  2M08 A;  3AS3 A;  3O5D A;  2A3C A;  1FFQ A;  4NSB A;  4DRQ A;  3O5R A;  3PR9 A;  2RQS A;  1W9U A;  2B5U B;  1LG1 A;  1ROT A;  2WLY A;  4DZ3 A;  2A3E A;  2DSW A;  4W9O A;  1XRV A;  3JXV A;  3UI4 A;  2RUC A;  1FJD A;  3O5P A;  2Y78 A;  1H0I A;  4TYO A;  3CHE A;  1ROU A;  1W26 A;  1YAT A;  2G8Z A;  1E6P A;  4TW6 A;  1Q6I A;  1ZBK A;  1FKR A;  1XHG A;  4U84 A;  3WD0 A;  3B8S A;  2AWG A;  1D7J A;  2PN0 A;  3WQW A;  1M5Y A;  2KR7 A;  1O6I A;  2OFN A;  4TNS A;  2B31 A;  4DRN A;  2ZQT A;  4O2T A;  1GOI A;  1NH6 A;  1VF8 A;  5DEZ A;  2KGJ A;  3EIP A;  3G6L A;  4AY1 A;  4S3J A;  1J4I A;  3CZ8 A;  1X6L A;  4QT3 A;  1W1T A;  3KZ7 A;  5GQB A;  4FAP A;  4TW8 A;  1E6R A;  4FN2 A;  3O5K A;  4S3K A;  4LAV A;  3ARY A;  2MLX A;  3UI5 A;  5DIT A;  1NWU A;  4DWS B;  5I98 A;  3NRK A;  1JND A;  2VN1 A;  1UR8 A;  3O5Q A;  3AS2 A;  3GTY X;  4MGV A;  3B9E A;  4DRI A;  4QIB A;  1QZ2 A;  1Q1C A;  2XP7 A;  4LAW A;  1HXV A;  4MNK A;  3BMB A;  1GPF A;  1LJY A;  3CHF A;  3PA7 A;  4P8U A;  3UQB A;  4ODO A;  4WKF A;  2KO7 A;  1LG2 A;  3WD3 A;  1YW5 A;  2FAP A;  1KFW A;  1FD9 A;  5JH8 A;  2Q5A A;  5HTG A;  1ZBW A;  3ART A;  4PTM A;  3ALG A;  2DSV A;  2G41 A;  4LAY A;  4ZPW R;  3KAD A;  1J6Y A;  1HKM A;  3FXY A;  2PV1 A;  4Z2H A;  5D75 A;  4ML4 A;  4DRM A;  3ARU A;  5HBF A;  3QOK A;  5DIV A;  4WJX A;  3O5M A;  4Z2J A;  4JFM A;  1B6C A;  3WD2 A;  5J6E A;  3KAG A;  2XP3 A;  4MNM A;  3ARR A;  4LAX A;  3IHZ A;  4DZ2 A;  2LKN A;  3MDY B;  2EUL A;  1LQ0 A;  2M1I A;  4HBO A;  1SYT A;  4ZPV R;  1BL4 A;  4ZPT R;  5GPR A;  3KAF A;  4ZS6 A;  2RSE A;  1E9L A;  1OGG A;  1W9P A;  3GU0 A;  3RM4 A;  4MSP A;  3CH9 A;  2A3A A;  5HUA A;  4Z2I A;  3PRD A;  2RUD A;  1LL7 A;  3BXW A;  3VAW A;  2ITK A;  4DH0 A;  4W9Q A;  1ZBV A;  4JFJ A;  2ZR6 A;  1D2K A;  1L1P A;  5DIU A;  3CGM A;  3KCE A;  1ITX A;  2F4E A;  2FKE A;  1HJX A;  3IK8 A;  4IQC A;  2XP8 A;  4Z2L A;  3UQA A;  2QF8 A;  3TC5 A;  1GUV A;  4XAK A;  4DRH A;  1FKS A;  1KT1 A;  4TW7 A;  4DT4 A;  4MNJ A;  5HWC A;  2DT1 A;  4ODL A;  1EDQ A;  2YBU A;  5HWB A;  3KAB A;  2WLZ A;  3H9R B;  4IQ2 A;  3OOB A;  4J4N A;  4ODQ A;  1JNE A;  4IT6 A;  3WL0 A;  4DWS D;  5HT1 A;  2MPH A;  3WQV A;  2F2D A;  4P8W A;  5GPG A;  2JZV A;  2ESC A;  2FDM A;  1FKD A;  1FKF A;  5HW7 A;  3UF8 A;  1Y0O A;  2PPP A;  4DWS C;  3RM9 A;  2O9O A;  2LPV A;  4KR0 B;  1EQ3 A;  1U79 A;  3WKZ A;  4IT4 A;  3ARS A;  1HKI A;  1HJV A;  1NMW A;  1SR0 A;  1BKF A;  1FKI A;  1HKK A;  1ZK6 A;  3CGN A;  2ZR5 A;  4JFI A;  3O5L A;  3RFW A;  4G50 A;  1OGB A;  3RGC A;  1TFV A;  4P8X A;  1EYM A;  1WNO A;  2PI6 A;  5B8I C;  3RME A;  1R9H A;  1TCO C;  2RUR A;  2DSZ A;  1FAP A;  3O5J A;  3ARX A;  4JFL A;  2YBT A;  4WK9 A;  2OLH A;  5HKG A;  3ALF A;  3ARQ A;  2LJ4 A;  3WIJ A;  2MLY A;  2A3B A;  2D9F A;  3G6M A;  3ODK A;  3I6C A;  1LL6 A;  3O5G A;  4Q7N A;  1X6N A;  4TX0 A;  2XP4 A;  2N87 A;  4L72 B;  3WD1 A;  3FAP A;  1EIB A;  1ZB5 A;  2DG9 A;  2F21 A;  2MLZ A;  2DSU A;  4Z2K A;  4W5U A;  1FFR A;  4WKH A;  3WL1 A;  1Q6U A;  1JNT A;  2P4V A;  4ODN A;  4N19 A;  4HAR A;  5DF0 A;  1IX5 A;  1T11 A;  3FY1 A;  1HKJ A;  3ARP A;  3WH0 A;  4ODK A;  4R5E A;  1ZL1 A;  4Z2G A;  1GRJ A;  3B9D A;  1J4H A;  1JNS A;  1FKL A;  1E44 A;  2ZQV A;  4BF8 A;  4P8V A;  1NSG A;  3GPK A;  3TDB A;  1HJW A;  1P5Q A;  1E15 A;  4UDM A;  3LUO A;  4U86 A;  2PV2 A;  1QPL A;  2ZR4 A;  1WB0 A;  4JYS A;  4GGQ A;  1PBK A;  1N1A A;  4DRO A;  2PV3 A;  3EY6 A;  3ARO A;  4URI A;  1ZU8 A;  3IKD A;  1Q6H A;  4WKA A;  1W1V A;  1QPF A;  4GIV A;  3O5F A;  3UQI A;  3ARV A;  4ODM A;  4QT2 A;  2XP6 A;  2DT3 A;  4U85 A;  2DG4 A;  1W1P A;  1D6O A;  4DRJ A;  4HBE A;  3O5O A;  1W9V A;  1ZBC A;  1K9T A;  3CHC A;  2IUZ A;  2ETN A;  4ITZ A;  4MAV A;  1JVW A;  1D7H A;  3OA5 A;  2VCD A;  3KAH A;  2DPE A;  4Q22 A;  1FKJ A;  3O5I A;  1FKH A;  4IPX A;  1F40 A;  1JCH B;  4MNL A;  4C02 B;  2L2S A;  3UI6 A;  1RD6 A;  2PPN A;  3O5E A;  4DRP A;  4MTV A;  1E6Z A;  1CTN A;  1NMV A;  2WK2 A;  1A7X A;  1J4R A;  2LGO A;  2PPO A;  2XP9 A;  4L3N A;  3B9A A;  3NTP A;  2IF4 A;  2O92 A;  3AS1 A;  1NWT A;  5DO2 A;  3B7X A;  4JFK A;  2KI3 A;  2K8I A;  3JYJ A;  2ZQU A;  3TCZ A;  3W4R A;  2WM0 A;  2AOS A;  5HW6 A;  1W1Y A;  4ODR A;  1FKB A;  3ARW A;  3ARZ A;  2XP5 A;  2KFW A;  2UZ5 A;  4QZV B;  4G2P A;  3AS0 A;  3NI6 A;  2F23 A;  3AQU A;  3PRB A;  4W9P A;  1H0G A;  1LL4 A;  3KAI A;  1FKK A;  3WD4 A;  2MF9 A;  1FKT A;  4WIW A;  1EHN A;  4DWS A;  4KQZ A;  1NWS A;  1WAW A;  2RUQ A;  3KAC A;  2ZQS A;  4NNR A;  2XPB A;  5HW8 A;  2DG3 A;  3PRA A;  2M2A A;  2PBC A;  2KE0 A;  1E6N A;  2DT2 A;  2XPA A;  4LGX A;  4ODP A;  1ZCN A;  4NZC A;  3CHD A;  1OWQ A;  1D7I A;  1F8A B;  3RM8 A;  5BXJ A;  4DIP A;  3JYM A;  1FKG A;  4MPK A;  1KT0 A;  4DRK A;  4R0X A;  3IKG A;  1NWR A;  2DT0 A;  1C9H A;  1PIN A;  1UR9 A;  2MNT A; 
#chains in the Genus database with same CATH homology
 4J4O A;  2M08 A;  3AS3 A;  3O5D A;  2A3C A;  1FFQ A;  4NSB A;  4DRQ A;  3O5R A;  3PR9 A;  2RQS A;  1W9U A;  1LG1 A;  1ROT A;  2WLY A;  4DZ3 A;  2A3E A;  2DSW A;  4W9O A;  1XRV A;  3JXV A;  3UI4 A;  2RUC A;  1FJD A;  3O5P A;  2Y78 A;  1H0I A;  4TYO A;  3CHE A;  1ROU A;  1W26 A;  1YAT A;  2G8Z A;  1E6P A;  4TW6 A;  1Q6I A;  1ZBK A;  1FKR A;  1XHG A;  4U84 A;  3WD0 A;  3B8S A;  2AWG A;  1D7J A;  3WQW A;  1M5Y A;  2KR7 A;  1O6I A;  2OFN A;  4TNS A;  2B31 A;  4DRN A;  2ZQT A;  4O2T A;  1GOI A;  1NH6 A;  1VF8 A;  5DEZ A;  2KGJ A;  3G6L A;  4AY1 A;  4S3J A;  1J4I A;  3CZ8 A;  1X6L A;  4QT3 A;  1W1T A;  3KZ7 A;  5GQB A;  4FAP A;  4TW8 A;  1E6R A;  4FN2 A;  3O5K A;  4S3K A;  4LAV A;  3ARY A;  2MLX A;  3UI5 A;  5DIT A;  1NWU A;  4DWS B;  5I98 A;  3NRK A;  1JND A;  2VN1 A;  1UR8 A;  3O5Q A;  3AS2 A;  4MGV A;  3B9E A;  4DRI A;  4QIB A;  1QZ2 A;  1Q1C A;  2XP7 A;  4LAW A;  1HXV A;  4MNK A;  1GPF A;  1LJY A;  3CHF A;  3PA7 A;  4P8U A;  3UQB A;  4ODO A;  4WKF A;  2KO7 A;  1LG2 A;  3WD3 A;  1YW5 A;  2FAP A;  1KFW A;  1FD9 A;  5JH8 A;  2Q5A A;  5HTG A;  1ZBW A;  3ART A;  4PTM A;  3ALG A;  2DSV A;  2G41 A;  4LAY A;  4ZPW R;  3KAD A;  1J6Y A;  1HKM A;  3FXY A;  2PV1 A;  4Z2H A;  5D75 A;  4ML4 A;  4DRM A;  3ARU A;  5HBF A;  3QOK A;  5DIV A;  4WJX A;  3O5M A;  4Z2J A;  4JFM A;  1B6C A;  3WD2 A;  5J6E A;  3KAG A;  2XP3 A;  4MNM A;  3ARR A;  4LAX A;  3IHZ A;  4DZ2 A;  2LKN A;  3MDY B;  1LQ0 A;  2M1I A;  4HBO A;  1SYT A;  4ZPV R;  1BL4 A;  4ZPT R;  5GPR A;  3KAF A;  4ZS6 A;  2RSE A;  1E9L A;  1OGG A;  1W9P A;  3RM4 A;  4MSP A;  3CH9 A;  2A3A A;  5HUA A;  4Z2I A;  3PRD A;  2RUD A;  1LL7 A;  3BXW A;  3VAW A;  2ITK A;  4DH0 A;  4W9Q A;  1ZBV A;  4JFJ A;  2ZR6 A;  1D2K A;  1L1P A;  5DIU A;  3CGM A;  3KCE A;  1ITX A;  2F4E A;  2FKE A;  1HJX A;  3IK8 A;  4IQC A;  2XP8 A;  4Z2L A;  3UQA A;  2QF8 A;  3TC5 A;  1GUV A;  4XAK A;  4DRH A;  1FKS A;  1KT1 A;  4TW7 A;  4DT4 A;  4MNJ A;  5HWC A;  2DT1 A;  4ODL A;  1EDQ A;  2YBU A;  5HWB A;  3KAB A;  2WLZ A;  3H9R B;  4IQ2 A;  3OOB A;  4J4N A;  4ODQ A;  1JNE A;  4IT6 A;  3WL0 A;  4DWS D;  5HT1 A;  2MPH A;  3WQV A;  2F2D A;  4P8W A;  5GPG A;  2JZV A;  2ESC A;  2FDM A;  1FKD A;  1FKF A;  5HW7 A;  3UF8 A;  1Y0O A;  2PPP A;  4DWS C;  3RM9 A;  2O9O A;  2LPV A;  4KR0 B;  1EQ3 A;  1U79 A;  3WKZ A;  4IT4 A;  3ARS A;  1HKI A;  1HJV A;  1NMW A;  1SR0 A;  1BKF A;  1FKI A;  1HKK A;  1ZK6 A;  3CGN A;  2ZR5 A;  4JFI A;  3O5L A;  3RFW A;  4G50 A;  1OGB A;  3RGC A;  1TFV A;  4P8X A;  1EYM A;  1WNO A;  2PI6 A;  5B8I C;  3RME A;  1R9H A;  1TCO C;  2RUR A;  2DSZ A;  1FAP A;  3O5J A;  3ARX A;  4JFL A;  2YBT A;  4WK9 A;  2OLH A;  5HKG A;  3ALF A;  3ARQ A;  2LJ4 A;  3WIJ A;  2MLY A;  2A3B A;  2D9F A;  3G6M A;  3ODK A;  3I6C A;  1LL6 A;  3O5G A;  4Q7N A;  1X6N A;  4TX0 A;  2XP4 A;  2N87 A;  4L72 B;  3WD1 A;  3FAP A;  1EIB A;  1ZB5 A;  2DG9 A;  2F21 A;  2MLZ A;  2DSU A;  4Z2K A;  4W5U A;  1FFR A;  4WKH A;  3WL1 A;  1Q6U A;  1JNT A;  4ODN A;  4N19 A;  4HAR A;  5DF0 A;  1IX5 A;  1T11 A;  3FY1 A;  1HKJ A;  3ARP A;  3WH0 A;  4ODK A;  4R5E A;  1ZL1 A;  4Z2G A;  3B9D A;  1J4H A;  1JNS A;  1FKL A;  2ZQV A;  4BF8 A;  4P8V A;  1NSG A;  3GPK A;  3TDB A;  1HJW A;  1P5Q A;  1E15 A;  3LUO A;  4U86 A;  2PV2 A;  1QPL A;  2ZR4 A;  1WB0 A;  4JYS A;  4GGQ A;  1PBK A;  1N1A A;  4DRO A;  2PV3 A;  3EY6 A;  3ARO A;  4URI A;  1ZU8 A;  3IKD A;  1Q6H A;  4WKA A;  1W1V A;  1QPF A;  4GIV A;  3O5F A;  3UQI A;  3ARV A;  4ODM A;  4QT2 A;  2XP6 A;  2DT3 A;  4U85 A;  2DG4 A;  1W1P A;  1D6O A;  4DRJ A;  4HBE A;  3O5O A;  1W9V A;  1ZBC A;  1K9T A;  3CHC A;  2IUZ A;  4ITZ A;  4MAV A;  1JVW A;  1D7H A;  3OA5 A;  2VCD A;  3KAH A;  2DPE A;  4Q22 A;  1FKJ A;  3O5I A;  1FKH A;  4IPX A;  1F40 A;  4MNL A;  4C02 B;  2L2S A;  3UI6 A;  1RD6 A;  2PPN A;  3O5E A;  4DRP A;  4MTV A;  1E6Z A;  1CTN A;  1NMV A;  2WK2 A;  1A7X A;  1J4R A;  2LGO A;  2PPO A;  2XP9 A;  4L3N A;  3B9A A;  3NTP A;  2IF4 A;  2O92 A;  3AS1 A;  1NWT A;  5DO2 A;  3B7X A;  4JFK A;  2KI3 A;  2K8I A;  3JYJ A;  2ZQU A;  3TCZ A;  3W4R A;  2WM0 A;  2AOS A;  5HW6 A;  1W1Y A;  4ODR A;  1FKB A;  3ARW A;  3ARZ A;  2XP5 A;  2KFW A;  2UZ5 A;  4QZV B;  4G2P A;  3AS0 A;  3NI6 A;  3AQU A;  3PRB A;  4W9P A;  1H0G A;  1LL4 A;  3KAI A;  1FKK A;  3WD4 A;  2MF9 A;  1FKT A;  4WIW A;  1EHN A;  4DWS A;  4KQZ A;  1NWS A;  1WAW A;  2RUQ A;  3KAC A;  2ZQS A;  4NNR A;  2XPB A;  5HW8 A;  2DG3 A;  3PRA A;  2M2A A;  2PBC A;  2KE0 A;  1E6N A;  2DT2 A;  2XPA A;  4LGX A;  4ODP A;  1ZCN A;  4NZC A;  3CHD A;  1OWQ A;  1D7I A;  1F8A B;  3RM8 A;  5BXJ A;  4DIP A;  3JYM A;  1FKG A;  4MPK A;  1KT0 A;  4DRK A;  4R0X A;  3IKG A;  1NWR A;  2DT0 A;  1C9H A;  1PIN A;  1UR9 A;  2MNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...