1JPIA

Phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
b'GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKLALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROPORPHYRINOGEN DECARBOXYLASE
publication title Functional consequences of naturally occurring mutations in human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 123
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1jpiA00
3CYVA 3PPCA 1R3VA 1U22A 4L61A 1R3RA 3GVWA 1R3TA 1R3SA 1XR2A 3GW3A 3L7RA 3PPGA 3GVVA 4QQUA 4ZR8A 3BQ5A 1JPHA 1XPGA 1XDJA 1J93A 3PPHA 1YPXA 2Q71A 1R3YA 4AY8A 2INFA 4L6HA 4WSHA 3RPDA 1U1HA 1R3QA 3GVQA 4L64A 4L65A 1UROA 4AY7A 1U1JA 4ZTYA 4ZTXA 3GVRA 4L6OA 2NQ5A 1R3WA 3T0CA 3BQ6A 1U1UA 2Q6ZA 4EXQA 1JPKA 4L5ZA 1JPIA 3PPFA 1T7LA 2EJAA 3GW0A
chains in the Genus database with same CATH superfamily
1LRTA 3G1DA 3BLPX 5IBXC 2VR5A 1TPVA 4H8HA 1Y5VA 3HPXA 3AIQA 1J12A 2PCEA 1OCQA 3K1GA 2QPSA 2UY5A 1SFLA 3MSYA 1WDQA 3T0DA 2R1NA 4YVPA 1XCXA 5IRPA 4HA3A 5DF0A 5EB8A 1FY6A 2FZDA 3KP1A 1H1NA 4Q7NA 3RIKA 4MB1A 1JCYA 4X2RA 3EDJA 3I3DA 4DJEA 2OEKA 3KCOA 1VPYA 1RR2A 3E74A 4KEMA 3P2VA 1A0DA 4WDTA 3UXKA 3PZQA 3BE7A 2RAGA 4UNLA 2GSJA 2J7FA 3T0TA 4GGHA 1BD0A 4RCXA 2Y1HA 2QPXA 3D0CA 2DIJA 4KFPA 3PN8A 4ATWA 1OFRA 1MXDA 3PAJA 4MNJA 1W9PA 1VPXA 5A6AA 1WBJA 3TJLA 1XBYA 1KTNA 3CEUA 1UZ1A 2H9AA 1ISYA 3N04A 3W70A 1XYMA 1NEYA 3II1A 1XD0A 3HM7A 3QMSA 4DLMA 3IGXA 4XIAA 3HTWA 2VC7A 3P93A 4YTRA 3H7RA 4GIRA 1KQYA 1A47A 2BOEX 4JY9A 1B4KA 3CMJA 4EE9A 5I0DA 3SR7A 2J8FA 5AYIA 1GVOA 3TP4A 3PF3A 3SRHA 4E3TA 3G8EA 5C2CA 4KGLA 3AFBA 5EU9A 2X09A 3P8IA 5C9RA 2D2GA 3QBUA 4AIOA 1QUMA 4H9TA 2DH3A 3OJGA 4N9DA 2DSVA 3GTNA 1QW9A 4A8NA 3BAIA 3HGSA 1A80A 3T07A 1QCWA 3FJ4A 1GW1A 4LALA 5DBUA 3ITTA 1RVKA 3O07A 1PL9A 4O15A 2A3EA 2WZIA 3CZLA 1UW9A 3C2VA 5A6BD 3IK2A 4M29A 4IL2A 1Q6LA 3IPWA 1UP3A 5DEZA 5AHFA 3NPUA 1RJQA 3CC1A 3P80A 4ZXLA 2G3NA 4URIA 4QLLA 2V8ZA 1GG1A 5MKGA 3S6DA 4F0SA 3PTDA 7TAAA 3VDCA 2WJZA 4EVZA 2QJNA 2UY3A 3G24A 4RE2A 4XZHA 4A3HA 1RVGA 4C91A 2EG6A 2OQLA 3P5YA 4NASA 1GKQA 1RPKA 1OYAA 2C3ZA 1P43A 2DIEA 4HSNA 5DMLA 2SFPA 2XWDA 4HTBA 3W6MA 4YTTA 1GJPA 4PC8A 1H62A 3UW6A 5CJMA 4AZBA 4UFLA 1XWYA 2WVVB 4H9XA 1A5OC 3PUDA 2XH0A 2Q8ZA 2Y88A 3F2CA 1VH7A 3NVDA 2VFFA 2PGWA 4GA8A 4O8RA 4I90A 1OCNA 3AMLA 1BYAA 3PWAA 3UVAA 2TMDA 5CBIA 3MMWA 2R14A 2FB2A 2WWCA 2G5WA 1L6FA 1YXCA 4Y6GA 2OO0A 4FSAA 3W2JA 5EPDA 4GJIA 3CIVA 3MP5A 3GS6A 1ZAIA 1NARA 4J40A 3BH4A 4TX6A 3WF0A 4CVUA 3UZZA 4UTLA 2VX4A 4JKLA 1IT8A 3KXQA 3YPIA 8CGTA 1KRMA 4DJFA 1F05A 1V6XA 2ZA2A 4LBSA 3LHVA 2G3JA 2TODA 4WIWA 3A13A 3EMQA 4EOUA 2ISFA 4BHYA 2DGAA 3HURA 1KCZA 4QEHA 1WDRA 3F5KA 4JHOA 4Q4KA 2WCGA 2Y62A 3A6OA 3L2LA 3W7MA 4UFJA 1Q7MA 2ZYFA 3UPBA 2NUXA 4GUGA 3DHFA 1UC4A 3DFQA 4LAKA 4J7RA 1S2TA 2YIHA 3CHCA 1NVMA 4Z2LA 1F3TA 3EX4A 3MSGA 3GWQA 3S5NA 5A94A 3B0YA 5FSDC 1CI1A 2WNQA 1K70A 2PWUA 3EXSA 1OYCA 3FA5A 1MXGA 2HE8A 2W27A 4HNOA 2OLAA 1LOQA 3PVFA 1NDVA 1LDCA 4RJEA 3PZOA 4XVDA 5AOUA 3G0SA 4L65A 1UROA 5HQLA 5CC7A 4OOUA 5XIMA 3RRXA 5FACA 3VZZA 3OVPA 1JEZA 1VFUA 1PDYA 3QSRA 3FJNA 4K7VA 4JTEA 1PPIA 5CEWA 2B4GA 1ZB5A 3L66A 3UXAA 3VOCA 4FHAA 1Q63A 1CIUA 4IGMA 3HMCA 1WO2A 3VFLA 1A5AA 5AHMA 2ZX5A 3WDHA 2QV5A 4US5D 1W1IE 4ZE5A 2QS8A 1V51A 4HKPA 2CCRA 3FX4A 2PDKA 5HWNA 5FF7A 1V4YA 3TA9A 3MHFA 5IM51 4O28A 1IV8A 3BQ5A 3SFWA 4NZ1A 1K02A 2HBXA 2GUBA 4XBJA 1TTQA 4IIGA 1W17A 4L5ZA 3LRLA 4C6DA 1FCBA 1AFSA 3GH4A 4HYRA 2BP1A 1GEQA 3GDRA 4MWAA 3UWEA 4U10A 3SGGA 2YL8A 5HULA 4CU6A 1JCNA 2WKJA 5J8LA 3CV2A 2PRLA 2PU1A 2OU4A 1P7TA 3W7DA 4Q8PA 3APGA 1WKDA 4KEZA 3I7RA 3IV8A 1NDYA 3VOIA 2Y70A 4OFCA 3C8NA 5D9NA 1ZBWA 3SCPA 1O94A 2FZNA 1B1YA 5KTLA 1ZENA 1DJNA 1R2SA 4G56A 3TC3A 1Q7ZA 4W85A 4F48A 5CBBA 4ZQPA 3EKGA 2VRJA 4R34A 1EOMA 2DUZA 3VZXA 1JZ5A 3KDNA 1UD4A 4HNVA 1LZOA 3L67A 3H23A 1D7KA 4AMAA 3VINA 1IWAA 3NOEA 4MY1A 3V5CA 4CD6A 1MUWA 4GGBA 3MBDA 4JKMA 3W1QA 1QMLA 4PRTA 3O15A 2EAWA 3PPFA 4AZ7A 2VWTA 4QNEA 4PMNA 3WUEA 1DTUA 3RYSA 1POKA 1V77A 2IKJA 3WJYA 3I65A 1DQXA 2P8BA 2Q01A 4FLSA 4ZOAA 1W3JA 4W5UA 2CLHA 3WBAA 5CZKA 3W7EA 3VI2A 1ENUA 3R6IA 2DZVA 2Z1WA 3OVQA 4AWEA 3QMRA 1EQCA 3ENLA 4CQBA 3V4BA 5KSWA 4DJDA 2NVAA 4HSOA 4TVCA 5JU6A 1NU5A 3UJRA 1M68A 3WUBA 3D6NA 4C5ZA 3SRDA 4AXKA 4C7GA 1XIIA 3QLLA 2ZUSA 3R8RA 3IWPA 2PTXA 3N11A 1BRLB 4TTUA 4DWSD 1N82A 4ZR8A 4ATLA 4JTDA 4GISA 2KZHA 1UR9A 5AECA 4JKKA 4PMJA 4A35A 2FFIA 2GJNA 2ZRVA 2J7DA 2E6YA 3E12A 4M51A 4LU0A 2FZ8A 4UTTC 3WMCA 4GVIA 1YTEA 2XN1A 4GQGA 1I2QA 4J2MA 4QITA 5LNVA 3LTPA 3MWAA 1XRSA 2A6LA 8XIAA 4LNCA 2ICSA 3GY1A 3LRMA 3WD4A 4FAMA 1TVNA 1QWKA 2ALDA 3R79A 1TREA 1SM9A 3STFA 4GQBA 1JAKA 3W82A 3LPPA 2OLSA 3GDLA 1YRRA 2E6FA 1QPKA 1X8CA 1BF2A 4D72A 3PK7A 2WLYA 5CPQA 3THAA 3WBEA 4TVUA 1ECEA 3M0JA 1H1ZA 1W5OA 3ARPA 2IQTA 5AY7A 2VZSA 3CUHA 4HZ6A 3COTA 3LQLA 4HD5A 5D32A 4AIUA 4JHMA 1I75A 1PB0A 4TV5A 4O57A 5A5WA 4L4MA 3OVGA 3B8DA 4JICA 3C6CA 5I06A 3QV7A 1E3XA 1A49A 1YDVA 4X0NA 3VIFA 2EPHA 1EC7A 4Z17A 4H6QA 1KR1A 4QG9A 1EQPA 3GR4A 2WV8A 4AZCB 3MP4A 1XISA 1A5MC 1CXKA 3PNZA 1QPQA 3KX6A 5AYBA 2QZRA 4Q8VA 3ZIZA 1I45A 4XZWA 4KMQA 6ALDA 4QAIA 3MVIA 3VUSA 4MY8A 4ORIA 4Y9NA 3WQPA 2EKGA 1JD9A 4BCEA 4WXZA 2Y7FA 5AZ1A 1LBFA 1IXQA 1JF6A 3KS5A 3KWSA 3PG8A 1TZ7A 4D6GA 4JFVA 4H6KA 2I17A 2FYMA 1WXZA 3D3AA 3SCWA 4BS0A 3PUOA 1E6NA 1IEVA 4YWSA 3BUVA 3MKCA 1KM5A 4IGSA 4CQDA 4QR6A 4Q22A 3RHGA 1TWIA 4MJMA 3OA3A 3M0HA 4LFYA 4QJ5B 4QTGA 1VFTA 1B3VA 3QYQA 5D8WA 3CM4A 1MRQA 1MRAA 3AMCA 3SJNA 3O1NA 5IFPA 4P7LA 4MAZA 1R5YA 2J7GA 4H6EA 1TV3A 4C6KA 1KB3A 5AKQA 3LGDA 3AISA 3C61A 4N0RA 3CZ8A 3DXIA 2YW4A 2A2IA 5CPTA 1E1FA 3GX9A 3IJIA 2O56A 4GACA 1GG0A 3QR1A 4DN1A 3IACA 1XFBA 4AB4A 2O55A 4AHQA 1H63A 3TJIA 3QGKC 4S3DA 1RXOB 4O50A 1I2PA 4Q8OA 1LF1A 3WQGA 4GLEA 2QR6A 5LHEA 3TLLA 1TJRA 4GI8A 1FHUA 1L6SA 5IHSA 3NXFA 4ZTYA 2BNJA 3WSUA 1E55A 1EHAA 3LK6A 1VRDA 1TPEA 4GZJA 3NG3A 3LHTA 3STGA 3B9OA 4DWDA 3LI0A 1FWEC 1LBMA 4FK9A 1I4NA 1Y5XA 1S5VA 2CLFA 3PZGA 4Y2WA 1CXLA 1ZTVA 3QV8A 1W3NA 5A2CA 1Z44A 3GXMA 1Q6FA 1NSJA 2GGEA 4ZQMA 4ZOCA 4LCRA 1CGUA 3TQPA 2WC3A 1XLDA 2L5HA 3DFHA 2FZMA 1REQB 4S38A 3SQSA 5JBDA 2HK0A 1CGXA 1DHKA 4TXEA 4ZB0A 1IHIA 1POJA 2J66A 2BWGA 2XIIA 1J2BA 1KTBA 3RDKA 1PO9A 3W1XA 3DKLA 3O6YX 1E71M 2DSKA 5C8BB 1PHWA 3ITVA 4G7EB 2ZKMX 4QG8A 3H4WA 4M56A 2WAGA 2DEPA 3KE0A 2GK1B 1C91A 3LSCA 3VNJA 1M9HA 1PWLA 4FIQA 2VJXA 1ISZA 4R33A 2P10A 4DJED 1GOIA 1PKMA 2PDFA 1QNSA 5D05A 2OZ3A 3WNKA 3GU1A 1G5AA 2XVPA 1WAWA 3A9BA 3WH9A 2I14A 2W67A 4J3TA 3TQKA 6TAAA 4XKYB 1ISWA 1SPQA 3G2GA 5A8OA 3GG7A 4G1KA 3V5FA 1OFQA 2QCGA 2ONEA 4LW7A 4K38A 1S46A 3SQLA 3IUHA 4CEUC 2AAMA 4LH8A 3ZT6A 3KRBA 4XAPA 1O60A 3ZJKA 3SEPA 1A5LC 4PUEA 4ZFMA 1SGJA 1HW6A 4BR1A 3W1MA 2VD8A 1MI3A 4AFYA 2VEFA 2D24A 3MZNA 3DX5A 2CBUA 1Q3NA 1KCKA 2WSKA 4GNJA 4TUFA 1VCFA 3NPXA 3L65A 2NUWA 4U2ZA 2QUVA 3VOGA 4FP1A 4KETA 5HNUA 3TK7A 2EPKX 1PTAA 1EJUC 5A6LA 5AC7A 2QULA 6REQA 5G1TA 5FAGA 1UKQA 3VZYA 1DYSA 5I09A 3W88A 3NR0A 3EOLA 3ZT5A 2CXEA 1S2WA 1W1YA 3ZS4A 2DW6A 1H7NA 3BICA 1QK0A 4H3DA 2VEIA 4TR9A 1MWOA 4BZYA 3RX4A 3HA1A 1UHVA 3EMCA 3SY1A 3RCNA 3B0PA 2V3EA 1OADA 4NNBA 1XC6A 4Y96A 2XZ7A 4N6EA 4QDWA 2PLKA 1G4EA 1QT1A 4DZHA 3DYMA 2FDMA 4PSPA 1IGSA 1V6VA 2Z4GA 1HX0A 2QYGA 1V6TA 4ZQCA 2QCDB 3GBEA 3HQPA 3IIPA 4E8GA 2GGJA 4M0XA 1VFLA 3AMGA 3WCZA 1V6YA 1E0TA 3IUDA 2WSQA 2Z24A 1VENA 4HPJA 4CCEA 4IQEA 3MUCA 4J35A 1TR1A 1DOSA 5E0CA 3S2JA 1J01A 1XLCA 2EJAA 2DZSA 1V6WA 1GQIA 1LRQA 3LPOA 4C7FA 3CGTA 2EKCA 2Y63A 3WQOA 7REQB 3LS9A 5AHEA 5C71A 4BJHA 3C2FA 2Q3RA 3U2EA 5CQ1A 4CNNA 1E70M 1SJDA 2IUZA 1Y7VA 4E2OA 3I6EA 4FX7A 4MB5A 1P1MA 3BLFA 4S3CA 2PUZA 1OHLA 3WEOA 1EJTC 2PAJA 2XZ9A 3AWOA 1SO6A 4CNUA 5A6SA 5ABFB 4PN2A 3H24A 5F1VA 2NZLA 2VP8A 1TV7A 1EA0A 1JF5A 1OK4A 1G9HA 3GNXA 3N18A 4QM1A 1V3LA 1CEOA 5LNRA 3N2BA 1TUFA 1B57A 2ZZ1A 3O6DA 2ACSA 4EPEC 3WDIA 1L2UA 2EGZA 4QDMA 5FI8A 3SCQA 3EX6A 2WYSA 3S3GA 2VRQA 3LQGA 5A6JA 3ARVA 5U7SA 3GE7A 4GO8A 3MUZ1 3NQGA 3IGSA 2H8XA 4YCPA 2O9RA 4H9ZA 4AF0B 1D8WA 4L9YA 1A3HA 1K7EA 1XLMA 3BL3A 4Q6JA 2DZBA 2Y24A 1UMLA 2E9MA 1AL7A 2P8CA 5C55A 1RCXB 5K9XA 1Q6QA 1VQTA 2X40A 4BQ4A 4XD5A 1VGAA 2GGIA 3LBOA 1W2VA 1UIPA 2EG8A 2VC6A 3QGAC 3ABXA 4O0KA 2HS6A 4BF7A 4PA8A 4IJCA 1SUXA 3STPA 3BG9A 4PCSA 4A4AA 3O8AA 4LV9A 3MCOA 1YKWA 3MT1A 3TV8A 1ZU8A 1J5SA 2I9EA 3ONBA 3TZNA 4K3ZA 3USBA 2ZA1A 3BARA 3CWHA 1PDZA 4REQB 3TYEA 3GTFA 3H53A 1KTCA 2RGMA 3AXMA 3KCLA 1FH8A 3M4HA 2ZC1A 1F73A 1H5VA 2PDWA 3WQ5A 1MEWA 4N02A 2RJGA 1XLFA 4C1NB 2X7VA 5IBXA 1R9XA 4Z2GA 4XISA 4E2DA 3QKEA 1QPNA 1F8MA 2HROA 1BTMA 2J88A 5LA1A 3CQKA 3EDKA 4FNQA 1A0CA 4BI7A 1YX1A 1R2TA 1ZL1A 3SCRA 4WX2A 1AJ2A 4H8NA 1DQUA 4LQ1A 1HQTA 4S3JA 1R3YA 3IANA 1EDTA 3IIVA 3OZMA 1XLBA 4DO5A 3WLTA 4I9AA 3HGOA 2ZRWA 4BF9A 5CAHA 1V3MA 3R4IA 1F74A 3P14A 3WD0A 1ONEA 2JK2A 5HANA 5M2FX 1TJ1A 3KZPA 3A24A 4IG2B 4GQRA 1XG4A 4NJJA 3SCSA 2VD9A 2X1TA 1GUVA 3FA3A 2NVCA 4AD1A 4GI4A 3TTSA 1WUFA 2VDHA 4S2BA 4DO7A 4US6A 1XIHA 5IOBA 4L61A 1L6YA 6PTDA 1E9IA 3PY2A 4WJ8A 1ME8A 4QCEA 5AYZA 4DWSB 4S3GA 1UWAA 4MWAD 2Y0FA 5HQMA 1TIMA 1V7AA 1DJZA 4RZ5A 3NL2A 2D1ZA 3ZVIA 3ZXWA 4PTNA 3UESA 8A3HA 4YL2A 2C71A 1RUSA 2WC7A 4B3ZA 2HISA 4HCHA 2CLOA 2WZMA 5H2ZA 3O6CA 2POTA 3E0VA 4JHZA 4C6JA 3GR7A 9XIMA 3HPFA 5DCBA 4LCQA 1HXJA 1N8WA 3WF3A 3G6LA 1H7RA 3DZ1A 3T42A 1VBHA 4KCTA 1VFFA 2FH8A 2YLLA 1T6MA 2F7FA 4GZ7A 2XIJA 3G0UA 2REQA 1Z41A 3CIXA 2ZQ0A 3BVJA 1RY8A 3N4AA 1EZ2A 1OC5A 1YPXA 5FL0A 1A5SA 4GUJA 3TVAA 1P0BA 3EEGA 1OGSA 2CBIA 4ATDA 4K7YA 1V3KA 3E2QA 3HJZA 2PSNA 5DMNA 1AH4A 2YCIX 3G0XA 4TOQA 4WDWA 4B5TA 2VFDA 4M3PA 3SBFA 2WHLA 3DFSA 4I9MA 2AQWA 2IPWA 1DXEA 2Z2BA 1ZNNA 3GC4A 5LNWA 2OODA 4PZVA 4AWUA 1UQZA 1LWJA 4R9OA 3H2NA 1YPFA 4AY7A 1W56A 3CS2A 4ZOBA 4Q8UA 1OF6A 1V0NA 2Y7EA 1FCUA 5I3JA 4X60A 2E8ZA 4JFWA 3UPMA 1UIOA 1WDPA 3VIIA 4B5VA 3U2CA 1YDOA 1P6WA 3SURA 2VGBA 1Q5MA 3TAOA 3DERA 4Z0JA 3URBA 3ZM8A 1KXHA 1PYMA 4GYKA 3C0JA 3OEXA 3QLDA 1B3OA 3DDMA 3MYPA 3V7PA 4C6QA 2WO5A 3G3MA 3FAWA 1E1EA 2X1SA 2YXXA 2QF7A 1TTJA 2DP3A 3SUVA 3DFTA 1GHRA 4GUFA 1YEYA 1J93A 2FGLA 3WKZA 2XM1A 1WOBA 4LS0A 2NQHA 3TCSA 2B7PA 4Z2JA 3KBJA 4ZQOA 1UUMA 2R8WA 3UP8A 3S46A 3HF3A 2FVMA 3IIOA 4NP7A 3ZO9A 2P76A 1E6PA 2AQOA 3LGEA 4JFTA 3FA4A 1D3HA 2DVXA 4AHOA 2W6RA 1Q8AA 2XYLA 4LAUA 4GVFA 2GQ3A 3BV4A 3B4UA 4P7OA 3W81A 3N9KA 3WMLA 5C54A 2QW5A 5FOOA 2FTWA 1J2WA 3H55A 5IHRA 2IMRA 2PTZA 1PYFA 5A69A 2PP0A 2I7GA 1ITCA 4P2VA 2X1RA 1Q85A 3WJZA 3AIVA 4N2YA 2NQZA 3HGJA 2D0GA 4HU4A 1W54A 4YTQA 1EP1A 3M46A 2PU0A 1Y65A 2XSBA 3FS2A 3A3XA 1Y0EA 3MDUA 3VNMA 4DNMA 4HHLA 4L6HA 4WD0A 3OYZA 1OF8A 4B4FA 1EO5A 3UD6A 5I2UA 5C0QA 1R86A 3F4WA 3PBWA 4KF1A 3KL0A 4JTLA 1SMDA 2FGBA 2QJIA 1OVDA 4NJHA 1Z42A 4PUDA 2VC5A 1EEXA 1US2A 2QF8A 2Z2AA 1W3LA 2D22A 3L4TA 4MF4A 4AD4A 4ERIA 1OK6A 4K6AA 1SJCA 3ZJ7A 3PWIA 4UC5A 4H04A 5AYYA 3DFYA 1R85A 5CH9A 4HIBA 2EF9A 3QH2A 1UJPA 1K9EA 4QJ1A 1GNXA 5CGTA 1X39A 2GVLA 4HZ7A 1S38A 4FLRA 2W92A 2A3LA 2V2DA 3P67A 1IT0A 4Q8TA 1DHPA 1PJ9A 1E5JA 2R94A 4JGDA 4KKXA 3IVUA 3K4WA 4C65A 2GSEA 3R0DA 1OFDA 2VMFA 3VNDA 4IMDA 4U3AA 1VZWA 1G0CA 1Y5WA 1GVSA 3S42A 2WVTA 3AXHA 2Z0IA 3P60A 3EA3A 2VZUA 3U5YA 5EL1A 2PRHA 4NSBA 3TYZA 4AY1A 3AHVA 2GLKA 3P7YA 4AH7A 3T9PA 4IPPA 2VELA 5BWFA 1GZJA 1CXIA 1JAEA 3NIYA 4K1WA 3V0TA 1ME9A 1WPCA 2VENA 4K8EA 3U8GA 2WZTA 2IKGA 2J7EA 4YYCA 1EJRC 4D9PA 2PDMA 1YPIA 2WQDA 1OM0A 5EMJA 3CT7A 1F3XA 1HP4A 2VZOA 4DI8A 1CECA 1HT6A 4ZQNA 3W7PA 4ZOEA 3ARQA 3UWVA 3S9YA 2RUSA 5DY3A 5FSEC 4CD7A 1GVEA 3WDQA 1H11A 2VZTA 1EGMA 2D0HA 4O52A 3H2AA 2DQWA 4QFUA 5B7YA 1XG3A 2F6KA 3VABA 1Q4NX 4K36A 1W32A 5HWMA 4L1WA 3FY1A 4ZA0A 4WKHA 4TQTA 1HGWA 2BMBA 4BY3A 5G4WA 1XYZA 2PDQA 1PS9A 4CQ8A 4PMYA 3LX9A 2R82A 3QTGA 1BF6A 1PWMA 1AZ1A 3WK0A 1UA7A 3SUUA 3DIPA 1XKYA 3M7SA 3EEZA 1WE5A 3WQ8A 1KXQA 4L4OA 4WJEA 5G4HC 3APYA 2A85A 1ONWA 2QIWA 3C56A 3PWGA 1WXYA 4C6LA 2BODX 3E2VA 4JNZA 3ZMRA 3P74A 4YTSA 3A5FA 4P8VA 4PMVA 4G6CA 2I16A 2GGHA 3PR2A 1WA3A 2QHAA 4ML4A 3OZOA 4O10A 1ZZMA 1R30A 1OJXA 1B30A 1EF2A 4RDZA 4GWEA 4HVXA 3BV7A 4JTSA 3WLOA 4CD8A 4A2RA 1RK6A 1XGZA 3C2OA 3OTRA 1F61A 4LYPA 1FWDC 4BKNA 3WK2A 1ZAJA 2QUTA 3VGFA 3VC5A 1SVDA 2EPOA 3NYDA 2FPVA 3ONCA 2A3CA 5HA7A 4GK8A 4UIOA 2XJ7A 3CL7A 3HPZA 1Q2SA 2YL9A 3B0UX 3N73A 2JQXA 4MYXA 5BCAA 2EG7A 2WMIA 3O2LA 3STCA 1JRBA 1EX1A 2OB3A 1J0ZA 4UTTA 4OQVA 2FZBA 2B0MA 1EO7A 1QO5A 3LHYA 4LUJA 3MSRA 4HA1A 2PWVA 2ATMA 4MJZA 4HK7A 4LUSB 5FEPA 1YIXA 4ACZB 3CUZA 2BVWA 4NZFA 3LTYA 1Z6KA 4F9DA 3IJ7A 4Y90A 2IKIA 1UZDA 1V93A 5BROA 4NRSA 3WG6A 3DBNA 4DB7A 3SFKA 2V6AA 2HZGA 2PWGA 1ZPTA 3VDBA 4HN8A 1SYTA 5CKSA 1JGMA 3C0QA 4IMAA 2OXNA 2FHFA 4JNMA 3W7LA 1XIGA 2QEZA 4MNMA 1JQXA 1BXCA 1SQ7A 4WUIA 4QQUA 3PSWA 3WH6A 4ZBCA 4LS2A 3WYZA 4M82A 4DX3A 3WJWA 4GE8A 1PKLA 1SJAA 5DMMA 4LNYA 4NI8A 2H90A 2WMFA 4LC6A 4MY9A 2UBPC 1IEXA 1U30A 3CU2A 3GHRA 1KM0A 4GFSA 4Q8MA 2CKSA 1LP6A 4UQCA 1P0EA 1KRCC 2CITA 4D6CA 1F6YA 1KM6A 5DELA 4AZHA 3W7GA 1M41A 3NFUA 3URNA 4ZMGA 3RMEA 2YR1A 1MW3A 1LUCB 3K8KA 3RLGA 3REQB 1VFSA 1FHLA 2RKXA 5TQLA 3ISIX 4PBFA 4QS6A 4GD0A 3I6RA 3Q94A 3VIJA 3B40A 3OQ8A 1NELA 5D09A 3VCCA 2YL6A 1I8JA 4MKVA 4DJFC 1BQCA 3PSVA 1L6GA 3AZRA 4X9SA 3RUBL 2WVUA 1JCLA 3CHVA 3UPWA 3ATYA 3QRHA 2YJQA 5AC4A 1RD6A 1OGGA 2YL5A 4IGHA 1XRVA 4A2SA 2PI6A 1DVJA 5CC6A 4GH1A 4HOWA 1NH6A 2AGTA 3JR2A 4LGXA 1FOBA 3NPVA 3TTOA 3UETA 3K1DA 2BX7A 4HJWA 1QOPA 9RUBA 4MHBA 2NT0A 4P8WA 4F0MA 3GKAA 3LSBA 5ECVA 2E0PA 3WLIA 4GI6A 3WJSA 2YA1A 1PHQA 1AZ2A 2ZADA 3GR8A 4OGZA 4L64A 4L80A 2XTKA 2P53A 3VDGA 1H0GA 1VBGA 4Z2KA 1H4PA 2QV4A 3CB8A 4RNHA 1KWKA 3IAPA 5KINA 4PMOA 3W85A 2QPUA 4QG6A 2QCLA 2HMCA 3THUA 1GOKA 4W84A 1FP8A 3UG5A 1HN1A 4TU1A 4AMCA 2UV8G 2V38A 4MWAB 4GNVA 2YXGA 3C2RA 4QRNA 3S83A 4B3KA 4GG9A 1H41A 3NOYA 3FXGA 1F2JA 1V3HA 2H3DA 3TR2A 2QVNA 5LZLA 1VPQA 4L7ZA 4PMDA 5HNTA 3RF9A 3MHGA 2BXYA 4NZ4A 2G95A 1AD1A 5FF4A 3FKRA 1ICQA 3NQVA 3OLEA 4S23A 5L6UA 3CMFA 3UY8A 1UCWA 2BSLA 4MAVA 4YLWA 4EP8C 3JW7A 3SCVA 1FUYA 4XBSA 3T1GA 3HO8A 3UXDA 1AW2A 4KERA 4PR4A 3KRSA 1EPXA 9CGTA 4GBUA 3TWBA 4P8UA 1SFSA 3NL6A 2PB1A 1E4IA 4L4LA 5AVHA 2XISA 3TR9A 2Y89A 4NJKA 4HU0A 4LB4A 3H2OA 4PL2A 4LXFA 3VGBA 2AKZA 1C9WA 3L2MA 3R13A 3MHUA 3WL1A 2R6OA 1V6UA 4FEZA 5HK4A 4AYGA 5IDZA 3GDMA 1J4EA 2XFFA 5BMXA 3OLIA 5HQEA 4AD5A 3L5MA 1RY0A 2XFWA 3BJFA 4S3FA 3S1XA 3RO6A 2E09A 2OKTA 2QJJA 4DBUA 1QDSA 1E0XA 1XIDA 3EDEA 1GVYA 2MUCA 3KOXA 3CHFA 4Q32A 1FKXA 3GTIA 4UQEA 2CU0A 3CV7A 4Q33A 4IPNB 1TG7A 4KWOA 1L9WA 1XGDA 4QX4A 1SSDA 5FJJA 3W1RA 2VQUA 4XTIA 1OFBA 1KGUA 3QKZA 3WQVA 2DW7A 3W2NA 4CLMA 4GHRA 2X0YA 1ADOA 3NXLA 1VFHA 2E3ZA 5DFAA 1E43A 4GCAA 4LVBA 4XD3A 1B4EA 1VEOA 4JFUA 3VKDA 3B8VA 4ZO7A 3C4UA 2VVNA 4UQ9A 3E5PA 3OOQA 1W8GA 3GIQA 3DUGA 7XIMA 6TIMA 1F5ZA 1ZAHA 1GVIA 5E5CA 1LYXA 5CSRA 2C7FA 2ZX6A 3RPTA 5C5YA 1IEQA 2ZVIA 5CSYA 1MDRA 2CEQA 3M0KA 1WBHA 2D0FA 2Y7DA 4RDVA 3W7JA 1DL3A 2AL1A 2H6RA 3RPDA 1ZJHA 3XISA 1M03A 4IFKA 2WJFA 2G50A 4KCVA 4GBDA 5FCZA 2CESA 9XIAA 3PS7A 5CPNA 1J0YA 2ATSA 2OSYA 2VDGA 4ZXOA 1W9BM 2OKOA 1HL8A 3W75A 4B16A 2DZUA 1MUCA 3ES8A 1LTDA 2HJPA 4HK5A 3E2SA 5HJXA 3TYUA 1PIGA 4ORMA 2XVKA 1DKWA 4I5UA 1QW8A 3UZXA 2QVHA 4Q7IA 4QE1A 1FCVA 2ZXQA 3GXFA 1OIMA 5DT5A 3KBMA 5KEZA 3PFRA 3V0UA 4AEEA 3QOKA 3QGVA 3CT2A 4N4PA 3TCEA 3TSDA 3LRKA 4LV4A 2GWNA 3AIWA 5D2VA 3S2CA 4LT9A 2J27A 4HMCA 1R3RA 2LLEA 1WAUA 3RLVA 4U5IA 4UUIA 2W66A 1GQKA 3CPUA 2C0AA 4DUXA 2P5NA 2QUNA 2VURA 5RUBA 2WLZA 4Q4OA 3VCNA 1EBHA 3KL5A 3W01A 1DWIM 2J6XA 1AD4A 3IRSA 3H7UA 1RCOB 3U7VA 2DT0A 1IF2A 2YDQA 1RQBA 2C79A 3WFZA 2DPEA 1M65A 4D2JA 4YVVA 2J9XA 3CZJA 4JX4A 3CTLA 2R1PA 3MW7A 4TIMA 1LQ2A 1T7LA 2WANA 5E1QA 5A95A 1OZQA 5A8GA 3TYBA 3LHUA 3TE9A 4C7DA 1OB0A 5M5DA 2XIBA 3W28A 2PWFA 1EBGA 2X30A 3KRUA 3HG4A 4PB4A 3NSNA 4JIHA 4FOJA 3W7KA 1LQ0A 4Q8WA 2O4MA 1F9CA 3UYIA 1H51A 1AQMA 4I3GA 3D5HA 5KZEA 5HJLA 1D9EA 1YBQB 1JRCA 3L68A 2OCZA 1A5CA 1TELA 1TX2A 3EWZA 8RUCA 3WNMA 2A79A 4DUVA 3HBLA 2HXTA 3OPSA 1V0KA 2DIKA 1TPC1 4HYVA 3AS1A 2KX9A 3QTPA 3FYPA 5D2XA 3KBSA 3RMJA 3OLDA 4G9PA 3NTYA 5HUOA 3B0VC 1FHDA 3GAYA 1QHZA 4O53A 1FWSA 3GU2A 1MQQA 2QGHA 4IL0A 2CERA 1IEIA 1PIIA 3O0FA 3OZPA 5LIYX 3AROA 3CL8A 1EOKA 1JI1A 2FVLA 1EGZA 4FXRA 2F2KA 5LA2A 1YDYA 2GGGA 1R0MA 3NQEA 1NY1A 5I02A 2FVKA 2O7SA 3RGTA 2JGYA 1R87A 3WF4A 4Y9AA 5HOSA 2I57A 2V69A 4AC1X 2NXGA 4QGCA 4HCLA 3CJPA 4M81A 4I7WA 3B8TA 3QMTA 5HR7A 3SSJA 3T8LA 3WD1A 2HCVA 3NSXA 3M43A 4NNCA 3OYXA 4B9ZA 5F4SA 4JQ2A 1XL9A 1BHGA 1R46A 3R25A 1JZ4A 5BYWA 4GX8A 2WQPA 4YYFA 5LSMA 1UKSA 4MIMA 4M5PA 3K5XA 3W3OA 2PDXA 4QJ3B 3WD3A 1XYAA 4H7VA 4WGXA 4PE8A 1SZRA 3WX7A 2V5LA 1R38A 1VYSX 3GNPA 1YXYA 2ZUWA 3GFYA 1PV8A 3PPGA 1XSJA 4C60A 2VDIA 1F3EA 3C0LA 4YMZA 1T96A 4UZUA 2E9LA 4UQBA 3OG3A 2J25A 4RPQA 1GTEA 1UUOA 3ZLHA 4MNLA 5HMDA 5D2YA 1TJPA 1FWJC 4AIBA 3W7RA 3LPFA 3HPSA 3VX1A 2ZE3A 2YOCA 3H7VA 1VRXA 3PUEA 4X63A 4J4KA 1CYGA 5DMYA 2XFRA 2V5KA 2PA6A 1Z3NA 2PDBA 3SUWA 3RLHA 2XU2A 1B2YA 3V16A 3M9YA 1VCGA 1MQRA 2A21A 5CAKA 3RLUA 4R3UA 3ABSA 3W1LA 2NLYA 5LGZA 2VGIA 1J18A 2VNCA 2C1IA 1XLJA 3EPMA 3LV6A 4FZIA 1VR6A 3TX9A 3RJXA 4AD0A 1LWIA 1OFOA 1UR0A 4A05A 4KQNA 1KFJA 4IOTA 6REQB 1JPDX 1MXSA 3S6OA 3RRAA 2A6NA 1XRFA 4KWSA 4KWUA 5CLTA 2BVYA 4R7JA 4R85A 2WVVA 2FZ9A 2NLIA 5DRIA 4QS5A 1FWFC 1FWWA 1DJGA 2P0IA 3BW4A 2ZZ6A 2VEPA 4BI5A 3ZR4A 1XYBA 2PTDA 1V8EA 3O06A 4LAZA 2VQTA 1LT8A 4QP0A 1SMAA 3W1PA 1E6RA 1US0A 1H7XA 3L21A 4DF1A 1W0MA 2TSYA 1SJBA 3IUIA 1OCBA 4L56A 2A4AA 3M0XA 1R3SA 2P3ZA 1UD6A 5JBEA 1F3WA 4PGLA 2G96A 1K8CA 2PRMA 3VGGA 2FJUB 4H83A 3FVMA 4RZ4A 4OIFA 1HJVA 3G1AA 2Y5EA 3ATZA 4IJRA 2R24A 4PUNA 1TX0A 3E0FA 1O4UA 4O1FA 3BWWA 4F0HA 1R8LA 4S1FA 1FBAA 3ARYA 1S5MA 2PLCA 3QHOA 5A8NA 4PRWA 2D2JA 2YCEA 1C7TA 3EB3A 3EWXA 3L23A 4MUZA 4Z2HA 4JQ1A 3ZOAA 2QCMA 4UTFA 5GJMA 3ITYA 5I03A 1NP2A 1OX4A 3PZMA 2X2YA 3H2MA 3AAMA 3R12A 3CWOX 5I3DA 3UZ5A 3B06A 1EIXA 1ZJBA 3N1AA 4FOUA 3TJXA 1LQAA 4OBTA 2ZOXA 3NM1A 2ON3A 4FS9A 4W87A 1V3JA 1PKNA 2J79A 3VIPA 3S8HA 1H60A 3TMQA 4O1BA 2FKPA 1FWHC 2AL2B 1THFD 4AG0A 3WO8A 3TEVA 1X6LA 2Z6JA 5EA9A 5HINA 1RSCA 4Z1YA 5C6MA 3N2OA 2DZWA 1QNRA 1R9ZA 4XTDA 4GI9A 1UP2A 2HPIA 2PDGA 3FCPA 4R9XA 3WDJA 1X98A 1OFEA 3NM3A 4KPLA 3L9CA 3NQAA 4Z1DA 1F4HA 2FQIA 4U28A 3NQMA 2RJHA 2BY2A 3EWBX 4HTYA 2WCAA 3LLDA 2GJPA 1M6JA 2ISDA 2PWHA 5BNKA 3MUAA 3H21A 1C29A 3FNDA 1HJWA 4IHCA 2NQJA 3NEVA 3UXIA 1TCMA 1XI3A 1XHGA 3N15A 1FWIC 2WPBA 3RU8X 4X3ZA 4RXFA 4LF1A 2VGFA 5GQBA 2IS7A 5HMSA 4AEOA 3O3RA 1HUVA 3NEHA 5GJNA 4OV9A 5LIKX 2XWEA 1B5TA 1H61A 3E3HA 5A2BA 1XLHA 3WBXA 2BOFX 4RL3A 3UZWA 2I1OA 3L7RA 2PCQA 1P6BA 3EOUA 3H12A 4ADTA 2B7NA 4UTWC 2INFA 1IQ8A 4LC8A 3O05A 1MNSA 3VOHA 3PZTA 4MDOA 1QO2A 4JR5A 3N2CA 4Q4PA 3DECA 2Z7GA 5ABGA 3SY8A 2OT0A 4IJBA 1JDDA 2DJXA 3TC6A 2CYGA 4N6FA 4JTIA 3S1UA 1WDWA 3WQFA 2YDRA 2BHYA 3GM8A 1BSLA 3AALA 3ID7A 4A22A 3W53A 1W3HA 1AMYA 1NWSA 3MU7A 4ZFCA 1TV5A 2ZE0A 3P62A 1S3TC 1QR7A 4JEJA 1I9CB 5FIPA 3ARWA 4UTMA 1QNVA 3V0SA 1R3TA 3FIGA 2YYTA 2BXVA 3W1NA 4B5UA 3H4GA 3SI9A 4MMWA 4AX6A 1ODZA 3GKFA 3KHDA 5ENLA 3WQCA 2DJLA 3B8WA 1W91A 1RQEA 4H8UA 3ZJ8A 2TRSA 4O1AA 2XGIA 4ZODA 5F2MA 2XG9A 4O4VA 4N42A 3GFXA 3T4WA 4E2BA 2XIOA 1QBAA 3N13A 1LLZA 3GDKA 4DUWA 2DT2A 4QBXA 2Y2WA 3WNOA 3E2RA 5LHFA 1VHNA 5HDRA 4UB9A 1ZFJA 3HFTA 3M5YA 2OSXA 3GH7A 5IXEA 3IS4A 4MNKA 4WDXA 2GPTA 3WLQA 2OWWA 4PFHA 5BXPA 3TN3A 1CWYA 4RNJA 3STEA 1LOLA 1PIFA 3AJXA 3A3WA 1UWUA 3WBYA 2FJKA 1TWDA 1B9BA 4M6QA 4EXAA 1OFAA 2QIIA 3UWUA 2RDXA 4BEQA 1N2VA 1VEMA 3LZ3A 4G1NA 4GMEA 2DSWA 3DG3A 1YNPA 3VKKA 3WLPA 1BRLA 3A4WA 3G77A 2YZ5A 4GUIA 2X41A 4O0ZA 1NFGA 3D3FA 1QPOA 1E0UA 4J27A 1DJXA 4UOQA 2F61A 2E8YA 3ES7A 4O14A 5D38A 2QAPA 1UH4A 1LORA 3E6EA 1OABA 1AJ0A 1TUXA 3A22A 1A3XA 2DT3A 3PAOA 1MDLA 1XUUA 4YJ5A 1W1TA 2QUMA 3HG5A 3W38A 1TYGA 5D9OA 3S5SA 5LXXA 3I4EA 2X2GA 3KLKA 1T8QA 1HJUA 1K9TA 6XIMA 2FTYA 4UFKA 4Z42C 3N2XA 3W71A 1F76A 5G2WA 2BOGX 1QW7A 3W2MA 1TPFA 5CC3A 4AAJA 3JRKA 3BMXA 2VUYA 2HVMA 2E40A 4I9JA 4FLQA 1JZ3A 4CCDA 1EHNA 2P1FA 2C0HA 1UOZA 1FDYA 3I68A 1OX6A 3QR3A 4AXNA 3EDDA 4NQ1A 1K3UA 4MTVA 5A6TC 3PZ9A 1J5TA 1HKMA 4HQVA 2C8NA 2IW0A 1U1JA 3MUXA 3P6LA 1J6PA 3R8GA 3MANA 5EBUA 2P3EA 1IYXA 2WJEA 3TFCA 1JFHA 1B0IA 1FH7A 4FPSA 4RLIA 5TNVA 4H19A 1ICSA 3MPGA 2FMNA 5KZMA 3GBDA 4GY7A 2DV0A 1O66A 3IGUA 3SQMA 1FFQA 4DBEA 1ZRQA 3EXRA 3Q58A 4AZCA 4JTTA 1OX5A 5C2GA 4WZHA 3W7QA 1UR8A 4S3AA 5HR6A 2V30A 1XYCA 1SZFA 3KTCA 1QI5A 3SUSA 1KRAC 2NV1A 5D2WA 3WMSA 1NWRA 2WWDA 2XH7A 1TA3A 4OE7A 4XD6A 5HPCA 2DZPA 4DIAA 3FEQA 3GXDA 5E0KA 2JGQA 2Z2UA 3H22A 2CLEA 1XDLA 8TIMA 3U7BA 3BDKA 3QZ6A 5BXRA 4IX0A 4AZGA 3LEPA 1UB3A 2DQXA 4OU1A 4ZTXA 1UD5A 3DC0A 4EAMA 3WUFA 1BVNP 5AHNA 3KBVA 3ZZ1A 4A21A 3S5OA 4JYDA 4RXGA 3AIEA 4IMGA 2YLAA 1XDJA 3M5ZA 3TXZA 2QXWA 3EWWA 4PRRA 1QI3A 2R1KA 1O5XA 1W9UA 4G8TA 1J0KA 1WQ5A 2GFTA 4YTUA 1Q7QA 2HTMA 3P0XA 2XUCA 3TN6A 3HG3A 1XX1A 2DORA 3R58A 3U9IA 1ADDA 1L2QA 5A8MA 4HPHA 1TV4A 1SW0A 1Q6OA 4PB5A 1NTHA 4WSHA 4YVXA 4JN6A 3UQNA 1K9DA 3TIMA 2GUUA 6XIAA 4F79A 1TPDA 2YW3A 4XVEA 5G1YA 5FF3A 3RITA 4B5XA 1UA3A 3K2GA 1S1PA 4W93A 2CLMA 4OKDA 2NQ5A 4CCCA 5ABEA 3ZLGA 2OG9A 3NQ6A 6A3HA 1SFTA 4E2VA 2EEXA 4H2CA 5E0FA 3PHAA 1K03A 4B92A 1KLZA 4IUGA 1TWSA 1RLDA 3R43A 3V1PA 2NV2A 1XBVA 3KZSA 4BI6A 5CLWA 1XICA 4JDYA 2VEKA 4DO6A 4JIRA 4F3HA 2QCNA 2HS8A 2QCFA 4D6DA 1KGWA 3GUWA 3CO8A 1B54A 1TR9A 1WYIA 3NAVA 2VUNA 1IR2A 5A8QA 3ECQA 4NYYA 1NJJA 3GYCA 4HMEA 1TVPA 1VIZA 3ZQ9A 3WH8A 2W5FA 1REQA 3BURA 1B3WA 1JUKA 4L6DA 1U5HA 2GSHA 4XZ9A 3WK3A 4DELA 4KS0A 4HZMA 2Y85A 3S0CA 1QNOA 2WOQA 1UMYA 3JS3A 1Q6DA 2Z1XA 2OWXA 4C6FA 1EXPA 4H9MA 3G18A 5D33A 2JBMA 3HG2A 1GZ1A 5I3HA 4GXMA 4V28A 3EMZA 3F2BA 1ECQA 1HJSA 4G7EA 5TAOA 1F7BA 2WHKA 2GK1A 2XSXA 3HU7A 2FB3A 2Y6ZA 4FR6A 1P0KA 2YKKA 4ZEPA 1EC8A 2C14A 1OG6A 4HHHA 1YTKA 2GJXB 4OBSA 1G7UA 4FXJA 5CG0A 1W37A 5D04C 3BLDA 1WNOA 4J3XA 4KRUA 1LM1A 4EKJA 4XKYA 2I56A 4FO4A 3UXLA 2YB1A 1ZALA 3QFWA 4DM2A 3N19B 3NDYA 4C6CA 4C90A 3AIRA 1A5KC 3CUIA 4GIAA 1TB3A 4ZGYA 1K9FA 3C8FA 1TWZA 3S5ZA 1ZJAA 4JAWA 3AUJA 1U5JA 3UR5A 3DBPA 2ABBA 1VCVA 3G1FA 1GKPA 5LGXA 1XS2A 3NSMA 4C6MA 1A4MA 3RR4A 4RR4A 3WLLA 4CQ9A 4PTXA 1XLIA 2JEPA 1KM1A 3W1UA 3UBPC 1XRTA 3N6HA 4I7UA 3QHNA 1PVNA 5E6YA 2WXDM 3G22A 4ADSA 2V5JA 2JKPA 1M7JA 3LNPA 5F4WA 1YADA 4D6JA 2WMIB 4AZ5A 2J13A 2ZRUA 1BYDA 3W25A 3LN3A 4RDYA 1DPMA 4N4QA 3FJ6A 4NZCA 1KRBC 5GJPA 3T44A 1GEHA 4JIEA 1JZ6A 1BQGA 4K68A 4OTKA 3TA6A 4DXXA 2JF6A 2G0WA 1K8YA 4HA0A 1B90A 4MPKA 3VXGA 3W76A 1OINA 3CWNA 1C8VA 3FN9A 1FQ0A 2ZICA 1SU5A 2E5BA 3VO0A 4PTMA 3LM7A 2PF0A 3OIHA 4U31A 3LYEA 3RK8A 2ACRA 3F4NA 3T0AA 1TWWA 1VEPA 1PX4A 2QCDA 2FIQA 4W7WA 4YIWA 3ARSA 5AHLA 1A5UA 4L4PA 3MV11 3CTTA 4H8VA 3TLQA 4LBUA 4XK2A 4WXYA 1AMKA 5EGRA 4X22A 5JQ9A 3EYPA 3M16A 1LLOA 2DZTA 4OT7A 4M1BA 4UOJA 3LG3A 2Z7KA 1XBXA 4A3UA 3G1VA 1W9XA 3HQ1A 4AZ6A 1OEPA 3GLCA 7REQA 4D6IA 3M0VA 6CGTA 1H50A 3M6DA 1UZHA 2B81A 4KBXA 1QOXA 3UG8A 3WLHA 3PBGA 3WF1A 3GHSA 1TV8A 3AYRA 3W6YA 4DBDA 4R27A 4OECA 4K2SA 3GSMA 3NCOA 1JCTA 3CPRA 5ABFA 1JFXA 2HE5A 1OFPA 4I6KA 4LANA 5CG7A 4F9JA 4HZ8A 4QDPA 4NKCA 1JXJA 4D6FA 4IFRA 2QQ6A 4IMFA 4US5A 1YXDA 2CW6A 2VX7A 5I5RA 2HVOA 1XKJA 3VPLA 2ISVA 3H4XA 3U2ZA 3LTSA 3CHDA 3UNDA 3ZVHB 1WZLA 1EJSC 1C9DA 4DLFA 1GQLA 1V7YA 3O9NA 4AVNA 3TTYA 2J75A 5DRCA 4RE3A 4AF0A 2Z1SA 2J78A 2PE4A 2B7OA 1KA9F 4HN4A 4M6PA 3K30A 1O5RA 3R1ZA 5JXQA 3ARZA 1TSIA 3POHA 2YFNA 5AHIA 4LVFA 3SCUA 1GOQA 3BC9A 2RFGA 4GYJA 1Q6CA 4JYFA 5FEWA 4E4UA 1HKWA 4C6EA 3IJLA 1XUZA 1IXOA 2ZTKA 3BSMA 1KM3A 2J24A 5FAJA 1KCXA 4LRSA 3WLNA 4JQ4A 2WKLA 3TDFA 3G1SA 2PDHA 5C9XA 2HVNA 1HKJA 3ANVA 4WR3A 3ELFA 2YZRA 1GORA 4M1RA 5JMUA 3MS8A 2PZ0A 4ROPA 4OZOA 4REQA 3E0LA 3OLGA 1KV5A 3IRDA 2B31A 4BFAA 4WY0B 3VYLA 1KQZA 3TTQA 1MYRA 1WP6A 4C1NA 4KFOA 4DYKA 1FCQA 4JTFA 2HRWA 5FJOA 3B9EA 1M53A 4GINA 4DYEA 3NURA 4HJFA 3BW2A 2E25A 3N3TA 1HP5A 3NDOA 5I3GA 1DIOA 2CZFA 2JE8A 2CHOA 4DF2A 1FWBC 1GOXA 2V9DA 4FF7A 4NAEA 1BXBA 3DENA 1X6UA 1CXFA 4GKLA 5G2HA 1R9YA 2OR2A 5AN7A 1ZBCA 1E0WA 5LIWX 3WDPP 3IVSA 1O5KA 2I5QA 5TBOA 4NXKA 4IIFA 3LV5A 5CZJA 4XV0A 1KBBA 3UWZA 1PTGA 4IG2A 4MB3A 4A8IA 1W3TA 2E4TA 2V3DA 1EP3A 2NSOA 3AWNA 4MZ1A 3SCTA 4IFOA 3CYVA 5BMWA 2WM0A 2BASA 4EF8A 4AQLA 3QSTA 3GTHA 5J04A 3KOYA 3SCOA 3U0HA 3G8RA 3QY6A 1B3YA 1BGGA 4B90A 2NX3A 2JIEA 2PDIA 1ISVA 3MCNA 5FEXA 4PB3A 4ZL1A 1SO3A 4AHPA 5IFTA 1EL3A 4NX0A 2PDCA 3H2EA 4O8AA 1I60A 1XPYA 2PDUA 1Z69A 3BW3A 3AO0A 2XGZA 3VA8A 4LB3A 3P0WA 1DP0A 5HUPA 4GJ1A 3WNNA 1NP0A 3LLXA 4PBEA 1TIWA 4E0CA 4W89A 2R91A 1KCLA 1NDWA 4QLKA 2YBVA 3AU2A 4UWMA 2GQ9A 1DWAM 1Q6GA 1U1UA 2A7RA 1TQJA 3OU8A 3DYOA 3W87A 4FMVA 5JH2A 3O6AA 5CPOA 3UGRA 3AHTA 4PBGA 3NA8A 2VL4A 3RNDA 3T6CA 5JUVA 3MI2A 4MZYA 1UYQA 5C9UA 2NX1A 1M7PA 4HOXA 1Q45A 1UD2A 1XM3A 1SW7A 1QXLA 1M1BA 1OG0A 5DCEA 4JTAA 5H8PA 3UJ2A 4GRSA 4PSRA 4YXGA 2V3GA 5BOOA 5CGMA 3ZSTA 1JR1A 1GOMA 3HZ3A 1EZWA 1V3IA 2YDAA 3PUGA 2F6UA 4DHGA 2BHUA 4QHRA 3LGGA 2BVDA 2CLPA 1WDSA 1V0LA 4JPGA 3HV8A 1V03A 3OP2A 4AW7A 2E5CA 1FTXA 4XAFA 4OV4A 4CQAA 5E9XA 2PURA 1DTNA 5DO8A 3BG3A 1C90A 1T99A 3DH7A 5G4EA 3CZGA 3CPGA 3GG1A 2OYKA 5JVLA 3C86A 4ZB2A 1W5MA 2ZX8A 3DHPA 1ME7A 1GHSA 2A3AA 3CL6A 3KOZA 3TJ4A 3P82A 5HPOA 1PAMA 3ABRA 3DG7A 2WK2A 1UKPA 3PJUA 4IZGA 3A12A 2DVTA 3HFYA 3ME3A 1ITUA 4DAFA 4R7WA 4QAWA 2WNWA 3MTWA 1ZP4A 4JZ5A 3T05A 4G7FA 4MLRA 2J62A 1IIGA 4DRSA 4DVOA 4GQ0A 4RV8A 3ARXA 2ESCA 3B4YA 5SWUA 4QEEA 4HHMA 4JDBA 3AC0A 2AGKA 3B0XA 1P1XA 4JFSA 2QDHA 3BOXA 5CJ5A 3W7OA 3EKLA 5LXEA 5CPMA 2CZDA 3RX2A 3UT0A 4GYPC 4P7QA 2G4FA 1EWDA 2VYOA 1ONRA 4TX8A 3S5YA 2C16A 1CLXA 4JNYA 1BKSA 2PODA 2GUYA 2CZVA 5EFFA 4O13A 3S2MA 4H2HA 2ZXBA 1FDJA 4MSSA 3DI1A 3SGUA 3DI0A 4Q8NA 4JOMA 4JX5A 4HU8A 1E51A 2V2HA 3RM9A 4G2DA 2RDUA 5HAOA 3W2UA 2PLJA 1QRQA 3BLIA 3MUIA 2A3HA 4AWSA 3AIUA 3SM0A 3I10A 1UWIA 3W84A 2CWNA 4PTWA 2O4QA 1OCJA 4CNTA 2VO5A 1BEUA 3H2FA 3UWQA 1VFMA 3BGAA 7ODCA 3W2LA 4EAYA 3B05A 2J77A 1E3ZA 1ML1A 4C6IA 4TMBA 2Z26A 3LY0A 3HJEA 5KZDA 3SZ8A 4NAFA 1U5VA 4MGGA 2BV9A 4N7QA 5K4ZA 1ZBKA 2QJHA 3T0CA 3NQDA 2JFEX 4MJ2A 3UCDA 1W9DM 3W23A 3QC0A 2PC8A 1G4PA 1QBBA 1WB0A 3RG6A 1W5PA 3L4XA 3KCJA 3MO7A 1DJIA 1M5WA 1ZCCA 5BOEA 1W8SA 3NZRA 3TNOA 1Y8BA 3NO5A 1QU4A 4CD5A 4XZBA 1XLKA 1JJKA 4UR7A 1G4TA 2V67A 4J9JA 2X8RA 4YWIA 1WZAA 3PP7A 2W0UA 3MMTA 3VD9A 4CCZA 2A0NA 4GXPA 1ONXA 1FWRA 5F2IA 5XINA 5JH1A 3BZGA 3GO2A 2GOUA 2OX4A 3WBWA 3GXTA 1BPLB 3OGSA 4E5TA 3CUGA 2YCLB 3UA3A 4F0LA 2JF7A 4H00A 2PTWA 2ZZ3A 1P0DA 2NT1A 2PLMA 2HXUA 2I5GA 1IXNA 2D73A 5FEZA 4JL1A 4DJFD 3G1YA 3DKJA 4IIEA 4C6OA 3FV9A 3ITOA 1TO3A 3PANA 5D4YA 2ALRA 2X1IA 2OLHA 3OGVA 4IIBA 3T4CA 2D3NA 3N3MA 2VT0A 3AU6A 3ABQA 3P8JA 4UTWA 3R0KA 3F4DA 3NO1A 2WKGA 2VX5A 4NNAA 1E6XM 3J7HA 4NX5A 1CTNA 2BG5A 3TYCA 1W5NA 4KESA 1UR3M 2JKEA 1D3CA 3UG4A 4PUKA 4E4PA 2QDEA 1D8CA 5DCDA 3KS6A 4E8DA 1TKKA 4I6VA 1FVPA 1QPRA 3MUY1 4X2PA 2V5DA 4HGXA 1BVZA 1QNQA 4NIRA 4QQ3A 1O5QA 1KNWA 3N2MA 3SN1A 2Y8UA 1FWNA 4FIRA 5HMEA 3LNMA 5I3IA 4WRHA 3QOMA 3P5ZA 2G37A 1E1CA 1CT5A 4FNRA 4UFIA 4H7CA 3BG5A 1GTHA 4HOZA 4IX2A 3MI6A 2J7HA 4NJIA 1H49A 1UG6A 1OD0A 3IJDA 3GVWA 1IZKA 3AYSA 4RE4A 3GUGA 3TZFA 3QHMA 4UTIA 1T5AA 4FALA 1BYCA 4LY4A 3L0NA 2GL5A 1UJQA 1W1PA 4IP4A 4CGTA 3MQTA 3LM3A 3M44A 3CH9A 1B31A 1BWKA 3S2LA 3GG8A 1PE1A 4ALDA 2WPGA 3SAZA 2ZWYA 5REQB 4RPPA 3BCDA 1GVFA 1S2UA 1K8ZA 2IQ0A 2O9PA 2NSXA 4B3LA 2WBGA 3MB9A 4O1DA 3V75A 4XIMA 1DJYA 4H41A 2NVDA 1KC7A 3IARA 4CKQA 1E6QM 4JEQA 3ZWTA 1DIEA 3BLOA 3WQ4A 3GVQA 5A1AA 2PGFA 4AUBA 1X1NA 3GZ3A 4JTJA 3IK4A 1VAHA 3S1WA 3VNKA 3QEZA 4A8RA 4LVDA 4LVGA 2IXVA 3VOFA 4ZO6A 3NNTA 1HJQA 3E1F1 4IICA 3WNLA 3F5JA 1YE6A 1AL8A 4I5XA 5TD4A 1GGOA 1TMHA 2QJGA 3HQNA 3EB2A 1ZSXA 5EKYA 4LUSA 5K3VA 3CH0A 3TW6A 2VZVA 2E67A 3LHWA 3QZEA 1HF6A 3AUOA 4ACZA 3JZEA 1XLEA 1G67A 4NL1A 4G5DA 4DXVA 1DWJM 1E4LA 2V2CA 1OGBA 3R11A 3H70A 1F6PA 5J5RA 3GRIA 4PCNA 4DYJA 3I7QA 4DBWA 4D8LA 1RA0A 2D2HA 3HV9A 2W91A 5B7ZA 3VGDA 4IGNA 2ZXAA 1SR9A 4GZIA 3V1HA 2GYIA 3GHUA 1EH9A 5FJIA 4ECLA 2PMQA 1CW2A 5LA0A 2X42A 4NI3A 1FX6A 1E9ZB 4TV6A 3CXOA 4AIEA 2ISSA 1ALDA 1W3IA 1K4GA 1WZKA 1VB9A 2Q71A 4HSHA 1C8XA 3OODA 4V27A 4DJDD 1TMQA 4P7RA 2PC4A 1LOSA 4IXHA 3LMYA 5EMKA 3NGJA 4DAIA 3KWXA 5G2IA 4C6PA 4ROQA 4ZQRA 1YLVA 4KFNA 1OX4B 1MZHA 2FPYA 1RP9A 3PB2A 4AC7C 3L0GA 1R7OA 1W1A1 3WUGA 4Z1BA 3E38A 4XB3A 1BWVA 4ILSA 1XIFA 4GH3A 4HNNA 3LXAA 1LUCA 1P4CA 3REQA 1W9VA 3TNBA 4O1CA 1R3VA 1YDNA 2PP1A 1ADSA 1PX3A 3VIHA 2IPFA 1BLIA 2ODOA 3TSBA 3K8MA 4OHQA 3SW6A 3UCQA 3MWCA 1KKRA 5XIAA 4GKTA 4M6UA 1ESWA 1RJRA 1UOKA 3U4AA 3VGEA 3C5QA 1JQVA 2PD9A 1FDZA 3DGRA 3IJQA 2VFEA 3LCHA 4WLCA 2GVEA 4RW3A 3KTSA 4TVDA 2WNNA 1AK5A 3QW4B 4WDUA 2Y4SA 3I3BA 3UEQA 4F66A 1CGYA 3F5LA 2QLYA 3KVKA 2NW0A 1U33A 1AG1O 1DWGM 2ZX9A 3W7NA 1VHCA 1TZ9A 1KXVA 2J7BA 5EFDA 4ERAA 4PCPA 4B91A 3OG2A 1LL7A 2NUYA 5HBFA 3CHEA 2ZX7A 2RDTA 5CJNA 3OHMB 4NYUA 5BRQA 4HNCA 3LCIA 5I23A 4EX4A 1EJXC 2V81A 4UFMA 5DY2A 4D8AA 2HDJA 1BYBA 3T2OA 1UR1A 3LBMA 1OT2A 1R47A 2VTFA 2Z00A 1HGYA 1XJBA 2VFHA 3UR8A 4ZO9A 3EWUA 4ERGA 3WH7A 3CV6A 2VCBA 2WCSA 1WKFA 5A3HA 4FNSA 1K6WA 5C9ZA 3VMNA 2W4XA 1KFEA 2GJLA 1E0VA 3T78A 3WN6A 2QCEA 1YE4A 3ITXA 3MVTA 1WCGA 3QPEA 2ZUNA 1SZGA 3OB8A 2VR2A 1X1ZA 2Y5SA 1U83A 2Y5JA 3GDTA 2FHCA 4HT3A 1UPMB 1LBLA 4CNOA 4F0RA 3RO8A 4ASTA 1WV2A 1A50A 1JDAA 4W8LA 2OT1A 3FVDA 2DH2A 2ZVRA 5EMMA 3M0IA 5ABTA 5K4XA 4IF2A 1UKTA 4WGHA 3DN5A 2OYLA 3OBAA 2C18A 3AJ7A 4ACYA 1DWFM 4HNTA 2C1HA 2E6AA 5K2ZA 2G8ZA 2ZA3A 1GCYA 4IT1A 3WFAA 4UFHA 1Q65A 5D8ZA 2CBVA 3N6QA 3RM4A 3K46A 1B3ZA 2QUUA 4UNKA 1AQHA 3RAOA 7CGTA 2QMKA 3B03A 2XIMA 3LD5A 1JDFA 3SGZA 2YCKX 2VFGA 3H8AA 3UERA 3PFMA 2C19A 2HK1A 4NF7A 3GAKA 2PF8A 4CVWA 3T7VA 1QOQA 2VVSA 4DXKA 1XYFA 1GYMA 2YX0A 2PDYA 1S2CA 1P0NA 5H91A 4EF9A 4F2BA 1NDZA 3TN5A 1UQYA 4D1JA 3CAWA 4BEUA 1MW1A 2J7CA 3T09A 2Z29A 1CPUA 2WHJA 4XAZA 2VHLA 4MM1A 2Q8LA 1M04A 3QW3A 4L9ZA 3TQVA 2F38A 3AZSA 4PULA 3N2TA 2H9AB 2W79A 3LMZA 3N9SA 1XIEA 4RUBA 1GPWA 2Q6ZA 4UTHA 1JPIA 1P5BA 4XSMA 3TU9A 4JTKA 3M0ZA 4HMNA 4JTQA 3VDAA 3RCYA 3G1RA 2C1GA 3M41A 3QJAA 1KFKA 1LJYA 2EPMX 1NOWA 4OUEA 2O9OA 3NQFA 1R3WA 1TCDA 4I8DA 3VD7A 3BGGA 4YPJA 4FXSA 2V5BA 3AMKA 4ZO8A 3W24A 4F4RA 5CBJA 3DEQA 4IIDA 5FF2A 2CETA 1OBAA 1PEZA 1X7FA 4GJJA 1HJXA 3A5VA 3IJ6A 4V2XA 1CNVA 5TIMA 2OVLA 4O19A 2VCAA 3U57A 1EJVC 2BZNA 3NQ8A 1Z9AA 4J3UA 4ZE4A 5BWAA 1QTWA 4ES4A 5CXPA 2WHMA 3DG6A 2C15A 2Y7GA 1DEDA 4EACA 1J9YA 1S5TA 1Z32X 1J11A 2O92A 3GFZA 2YB4A 2QT3A 2VKZG 3BGJA 1W6TA 2UY2A 4ZZ9A 3VUPA 3ZFHA 4FA3A 5I6SA 3BLLA 5MKGB 3EA2A 4JTRA 3AHYA 3W73A 3KVLA 1JZ7A 3P84A 5DQPA 1ISXA 3MMUA 3VKJA 7ENLA 1JCMP 4UTUA 1OWQA 3G1HA 4O12A 3PM6A 3IEBA 3E96A 1OC7A 4GVGA 2P88A 4UNIA 1J6OA 1KV8A 4IUOA 1J79A 3QPZA 3FK4A 4UBPC 4L6OA 2V82A 2FLIA 2BBFA 3VKBA 1PBGA 3PTMA 3WELA 4HBKA 1KGXA 4YS1A 1B9ZA 4GVHA 1XR2A 4LPCA 3RXZA 2PTYA 4CU8A 4BWLC 1TA3B 3HB9A 5BW6A 2NXIA 4M7SA 2CHNA 3L0KA 2W61A 4ICCX 1PCKA 4ML9A 7TIMA 5GVJA 4B5SA 2VEMA 1W1ZA 4UXDA 1S2VA 3W74A 4UMCA 2BDQA 1GK8A 1C3FA 4V33A 1D2KA 3CAVA 3WF2A 4HU3A 1ITQA 3EOOA 3RJYA 1VKFA 3VNLA 4OJYA 1KFLA 3ALFA 3CASA 1V02E 4GIYA 1EX5A 4DY1A 2C6QA 1Z48A 3UYCA 1LWHA 3WFLA 1GOOA 3LBCA 1PZ1A 1VJIA 2BY1A 3WQDA 3WDRA 4IQLA 4IP5A 1AVAA 3F1QA 3T40A 4LUTA 2ZIDA 2ZUTA 4F40A 3DESA 2VR4A 4OWGA 2UWFA 1OD8A 4W9TA 1VC4A 1XINA 4E8CA 2OZ0A 3WZ0E 4S3BA 1WX0A 4KCWA 5D37A 5I07A 3NZGA 3LCXA 1MW0A 2GVYA 1DXFA 2FMOA 1CLKA 1DV7A 1S2AA 2YGYA 2BY3A 2ZRXA 1YBQA 3Q45A 5CSUA 3BJTA 4GABA 4XZLX 1NWUA 4FF5A 3M5VA 1O1ZA 1O68A 1I1WA 4RNIA 3TXVA 1X7IA 1EA9C 1FKWA 3BANA 3FYOA 1PUDA 3UY7A 3CLWA 2X7WA 3HOJA 4HA4A 1HKKA 1PTDA 1T40A 1CGWA 4NY2A 4PFMA 4IQJA 4W7VA 3ITCA 5A2AA 3CUXA 3V5OA 1ELSA 5GNYA 3NL5A 4AWTA 4PMZA 3PPHA 4POCA 2BGSA 3VVGA 3MYOA 3LPGA 1XFCA 3UNTA 5D2TA 1HL9A 1JDCA 4S2CA 3W2KA 1LRNA 3R7MA 3HPAA 3FYYA 2W3ZA 2TPSA 5C70A 4XAYA 4XZNX 4C6BA 4JL2A 2VFIA 4PH6A 1UZ4A 2GWGA 3R89A 2YDSA 3GVGA 1KO0A 1RAKA 4RK8A 1BWLA 1XQLA 1Q66A 2OGYA 4XAGA 5HJYA 4AU0A 4Y8FA 2PGEA 2OTDA 4PMUA 5DANA 4J1OA 4Y9OA 4LAOA 2ZZ4A 2NWSA 4Q4MA 1G6CA 3WLKX 3WH5A 4YNGA 1E40A 1MVYA 3GG0A 3WLMA 3ZLFA 3OIXA 4V1XA 4C6NA 4WEVX 4HK6A 4GUHA 4PTVA 1PX8A 4WF7A 2VWSA 5K7JA 4DEFA 1V5XA 5M3WA 1MEIA 1FWTA 2NWRA 3QY8A 1P7TB 4NZJA 4MOZA 2DVUA 4MLJA 2OEMA 3UZJA 2DUAA 1KFWA 2J6VA 1GYNA 2AOSA 1N8IA 3MJMA 1DJHA 4LSBA 1K7FA 3AXIA 1BG9A 2OQHA 1VYPX 3N29A 1ZLPA 3L4VA 2YPIA 1KFCA 1XLLA 5EY5A 3FXYA 4Y9MA 1AQFA 3W6LA 2VGGA 3LDVA 4JD4A 1US3A 4N9CA 2V0TA 2I9UA 1EJ7L 4U3CA 2FFCA 5I77A 1KKOA 1TV2A 4MJ4A 1A0EA 4WSJA 4UMAA 2OMAA 2XVNA 4JTCA 2CKRA 3T2QA 4FI4A 2QGYA 4UQAA 3L4UA 1ZS2A 2R1LA 2F6XA 3W22A 2ZFAA 3MZ2A 5DLCA 3LCLA 1IZJA 3Q4DA 3I4KA 1RBAA 3K4AA 1E72M 1JPKA 1JVNA 4E4FA 2CLKA 2JIWA 3N14A 2MNRA 1XIBA 5I00A 3GVVA 1ODUA 3GC2A 3UZYA 1JDEA 2ACQA 4J2PA 2OEJA 1XH1A 3IIZA 2BXZA 3BAJA 1TRIA 4FX8A 3EAUA 4LY8A 4DO4A 1XW8A 4HPGA 2W9MA 2Z1BA 1KBLA 3OO2A 4I5RA 4DQWA 3F4CA 3SSZA 2Z28A 3FGCA 2J9YA 5K9DA 2HNEA 3BSGA 4E38A 5JIPA 3LI1A 1Z7AA 3S9IA 3VNZA 1NFPA 3BK0A 4UTJA 3EA1A 2CZEA 3SY5A 4XUYA 3MDWA 3QVQA 4JN8A 3GNNA 1NFBA 4F8XA 3VMPA 3VCRA 2ASHA 1YNQA 4OOZA 2OGJA 1Q2RA 1UPPA 3KBWA 2CWXA 4K8HA 4RW5A 4Z1AA 4KEUA 1XD1A 3NDZA 1UWTA 1RPXA 3CO4A 3CK5A 3N9RA 1LLWA 4GYPA 1S39A 2CIPA 2XGBA 1E4MM 1J10A 1HNYA 5BOFA 3CB3A 1Q8JA 1O7AA 4EXQA 4GPNA 3TSMA 1HVXA 4W8BA 3ICJA 4FR1A 4YHGA 3TC7A 3P3BA 1O6IA 4A8LA 5AC8A 3WMBA 3N12A 2RDWA 1P48A 3UU0A 2UY4A 5FJTA 2AL2A 1UWQA 3W83A 1VJZA 3FDKA 1GVRA 5I3KA 3CQ0A 3VOJA 3FDGA 4S39A 1EPVA 4GFIA 3UFYA 3L12A 1JCXA 1UBPC 5I79A 1B3XA 4MADA 4A6GA 2ZUMA 4EIVA 4GCXA 2O0TA 2Y8KA 1OIFA 5D02A 2OOGA 2V68A 1DQWA 1JYNA 3JUGA 4PUMA 2P50A 2G3MA 1RV8A 3KBNA 1NF0A 1EEPA 3PZUA 4PUUA 4NZ5A 1X96A 4W86A 3SJ3A 5C7VA 2X05A 4D6EA 1IIHA 5K9CA 3LXCA 2GQ8A 3NGFA 3SB0A 1JUEA 2YYUA 2XVGA 2VOMA 3W0KA 1F6KA 4J3SA 5AB3A 3VC6A 3UG3A 3CAQA 3C3NA 2PFHA 5E93A 1UH2A 3ABOA 5E09A 2OX1A 4K1GA 1SZEA 1SR0A 4LBRA 3T8QA 3M6YA 4ENLA 3N4FA 4Z1CA 3IJ9A 5GNZA 3TKFA 1H1YA 1W1VA 4Q3MA 1I0DA 1JYWA 4LAMA 2ISWA 3TONA 3THQA 4LCSA 1F8IA 2QKFA 3CUFA 5TF0A 1PSCA 1K8XA 1TJ2A 2DFAA 1NOFA 3AXXA 2G3FA 4XG1A 4X9YA 3DHDA 1IWBA 1QHOA 2E7FA 2GDQA 1BFNA 3CLMA 4NAEB 3H54A 4KCUA 4RKAA 4JCLA 2VRKA 3TMLA 2ZUVA 5FESA 3JZUA 1RCQA 2OZTA 4HB7A 4ZVJA 3U5UA 1H0IA 4PMQA 1UWRA 1XF0A 2BY0A 1XIMA 2PEVA 2D23A 3I3EA 3PBMA 3XIMA 4BA0A 1I0BA 1AA1B 5BXTA 5CZSA 3ANYA 2XIQA 3KFTA 3V36A 3VGHA 3GIPA 1RLCL 1EXBA 1FRBA 2PBGA 4LYRA 4UR8A 1VP5A 1NIUA 3AOFA 3EX3A 3LB0A 3QXBA 2CPUA 1UUQA 3MP3A 3KOFA 3LCWA 1TPUA 4M6VA 1EWEA 1FP9A 1WKYA 5U4NA 2J74A 4H6RA 2KAUC 4XO6A 5HNNA 3F4VA 3S2NA 5B80A 1Q6EA 2EBNA 3DFPA 3WIJA 3KTXA 1KR0A 3ARUA 4IQDA 1BXNA 1OYBA 2X16A 2A1YA 3AMDA 5BU9A 2NX9A 4F0KA 3LERA 3EPOA 3DOPA 5LIUX 4BQ2A 3A64A 2DZAA 2ZZ5A 7A3HA 2AKMA 4B9YA 1C92A 1L8PA 4CD4A 4XKMA 3S1GA 4DWSC 3VNYA 4YU1A 2HPMA 4GX9A 3EPNA 3ZR5A 1T41A 1E5NA 5AC6A 1GW9A 4XZIA 3JU2A 3CV1A 1KXTA 4WHBA 3W9ZA 2MANA 3PZNA 2E77A 3AXKA 3RILA 3LHZA 2YSWA 4C5YA 1FHVA 1VD6A 2OOFA 5EYWA 4RZ6A 3V18A 3FJLA 2OSWA 3WQ6A 4O0QA 1QHPA 2Q02A 1M7OA 3PZVA 4MVAA 3KEHA 1KM4A 3C2YA 3EB4A 2AMXA 2WZEA 5T91A 1W3KA 1EIBA 2ZTJA 3IAQA 2GZXA 3PZIA 2PDPA 3W37A 4C1KA 1HTIA 4KIEA 4O11A 4PMXA 4AX7A 4JQAA 3VMOA 5CGQA 1GVQA 3EX2A 4JIPA 3F2DA 1QI0A 3CYJA 2EO7A 3T81A 4PYSA 5BRPA 2PPGA 1NM9A 2J8GA 2VM8A 3RN6A 3TOPA 1L6WA 3GTXA 1EJWC 4A29A 4HYWA 4MYAA 3LOTA 3KW3A 1EFZA 1KBKA 3SADA 1FXPA 3IGHX 3WLRA 2A3BA 5EBAA 2XH2A 1EDGA 1VLIA 4U5KA 3QF0A 3R10A 5T26A 4JCMA 2ZXDA 3AS2A 1PZ2A 4UCGA 3QFEA 3DCPA 1PCWA 3AS3A 1X8FA 4CN1A 1SSGA 1O12A 5BXSA 1PXGA 4S3EA 4P5UA 3GIYA 4QIUA 3EWYA 1IWPA 5BZAA 1W31A 4RE0A 1UKOA 3VDHA 1TPB1 1TTPA 1I6NA 4XD4A 2ADAA 1GZGA 4B5WA 1U2YA 3PB0A 4F2UA 2XM2A 3VFCA 4DZ5A 4KW2A 2X0SA 2NQLA 4QROA 3THCA 1AJZA 4L1GA 2R9RA 3VTRA 2E9BA 4LOCA 1NOUA 1EB3A 4MDPA 3OBEA 1D7FA 3AIBA 3MBFA 1XLAA 4YN5A 1HFBA 4CUCA 1AW1A 3ERPA 3FAXA 1L8NA 1EYWA 2TYSA 3A4XA 1XQKA 1DIDA 1LCOA 1K1DA 6ENLA 5M03A 4NAFB 3QYSA 3UWYA 3VKAA 5D9MA 4S3KA 3L2IA 1SFJA 5CPSA 4QE5A 3PTKA 4DZAA 4UMBA 3UJEA 3W1AA 4E6MA 3M64A 2G3IA 4LJ3A 3AYVA 4EXBA 4GC4A 1XBZA 2EHHA 4KRZA 2INEA 1PKYA 3MSDA 3EWCA 2JALA 1BVWA 1IZCA 1IEWA 3MV01 1E15A 3HGRA 3RCMA 4HNUA 2DUXA 3FEMA 1IGWA 2WSRA 1XCFA 2ACUA 3SN0A 7PTDA 3NQ2A 1UC5A 1LL4A 2E68A 5D9PA 5C7HA 3THDA 2QNEA 4WK9A 2BFGA 3A9IA 4XWUA 4QISA 2W63A 1K4HA 3N34A 4DPQA 2A7NA 3NUKA 1BTCA 3LENA 4H7ZA 4QJ4B 2J9ZA 1T8XA 2ZC8A 3FOKA 3BCJA 2RHGA 4B4HA 2NV9A 4JN7A 3QQ1A 1DJWA 1L0PA 1LG2A 4IH3A 4UR9A 2HNHA 1H09A 2POZA 1EYEA 4ICNA 4DNHA 1HKVA 4B5NA 2P0OA 2WB5A 1DE6A 4MG4A 1XPGA 1ZHAA 3VAVA 1Q4WA 2FPTA 4L9XA 1CGVA 4OBRA 2WMJA 3NZQA 3KOWA 3MJYA 2PDNA 3E9AA 1IT7A 4JQ3A 4UTKA 2R1MA 2Q3OA 1F07A 3OW1A 3KVJA 1GQJA 2BLEA 3GD6A 2PD5A 3PBYA 3RPMA 4PTDA 4JBRA 4HMDA 1FFRA 3B9DA 1E73M 3VU2A 4XBKA 1MSSA 1E1CB 1N55A 5CPLA 2I5IA 4GXWA 1RJPA 4DJEC 4ZENA 3H26A 2VEGA 4R7OA 4AISA 2GJXA 3E5BA 1XP3A 3H2CA 3NQCA 1NAL1 1NQKA 2EQDA 4I8YA 4LVAA 4FX6M 5A8PA 2WZHA 5ABHA 1JIBA 3TQ0A 2DSZA 5KITA 4UCFA 1JNEA 4JTUA 2ZRZA 3VX0A 3TH6A 1CCWB 4JIQA 1C8QA 2OELA 3GXPA 3OA5A 4WOQA 3VD5A 1QWGA 1DORA 4QXIA 2HEJA 5A6KA 4EPDC 1YQ2A 2ZRYA 4O4WA 2CZ5A 1EDQA 1MO0A 1X1OA 2J4GA 1WKEA 5IDIA 4B2DA 2B7QA 2Z27A 3BCFA 1J8VA 3UJFA 1TVLA 1E9YB 3TYDA 3F03K 2GOKA 2CBJA 3Q37A 1IE7C 1H2JA 2DZXA 1QK2A 4K39A 2BS9A 1FH9A 3W7IA 1GONA 1S5NA 5F7UA 2HV5A 4U2YA 2C13A 3UR2A 1YW1A 1U22A 3SIZA 3R0UA 3CZEA 1JNDA 3KM8A 1H7OA 1GYLA 5DX7A 1ZCOA 4CEXC 4DF0A 4XO7A 2X1UA 4DUOA 3B8UA 4D8ZA 1V08A 5LNUA 1LROA 2QDDA 4ONVA 3OGRA 2WMGA 3ZJ6A 4WOZA 2BHZA 3E0IA 3GU9A 3A47A 3LCFA 3M47A 1BKHA 1FWCC 2WNZA 3N25A 1LT7A 1A3WA 5PTDA 3VIKA 1XLGA 5C9WA 3MO4A 2YXOA 3AICA 4Y9PA 2GVJA 4KWVA 2REQB 3CUJA 1KBJA 3L4YA 1EUNA 1TE6A 4GQQA 1XSIA 4IMEA 4LS1A 3GNRA 2DT1A 1UD8A 3W02A 1VF8A 2V5CA 5E70A 1CZ1A 3GXIA 4B15A 4UQDA 4JS3A 1G01A 2CHRA 2YA0A 3IIXA 4TMCA 5D30A 3BAYA 2IPJA 2GDVA 1RA5A 2XN0A 3EX1A 3S47A 1S5WA 1ITXA 4KEVA 1QAPA 3M5XA 3VILA 4HHPA 4KWWA 4WQ6A 1BG4A 1CENA 3RM8A 3DGBA 1A5BA 1JUBA 3BJSA 3U48A 4M7TA 1JGIA 4QE4A 1SZNA 3G5EA 4Z0SA 1KLYA 1MFUA 1QFEA 2E1WA 3EDFA 1R3QA 1ZP3A 4ADUA 1XXXA 1I2RA 3B3DA 3URQA 3T55A 1MNZA 3C0SA 3OQEA 4WSKA 4PCFA 3NL3A 2OZ8A 3GW3A 1FA2A 1I2NA 4JXCA 4A3QA 4MWAE 2YCJA 2E1DA 5BU6A 3APTA 1CXHA 1PZ0A 4LYKA 3WLSA 8XIMA 1W2PA 4IWWA 3W26A 3EXTA 3BPWA 2TAAA 1UP0A 3UJSA 5H1WA 3O16A 4KRTA 1UH3A 1G4SA 2VI0A 5AC5A 1DIKA 4Q6XA 3VM5A 3N4EA 3IJ8A 5FJPA 3DAQA 3TYAA 4P8XA 1EC9A 2OPJA 1EUAA 1BSIA 1KM2A 4BWLA 3A21A 4NXSA 2WMHA 5I3FA 1QI4A 4PMRA 3WENA 1UR2A 4IPIA 3VM7A 3WD2A 2PGRA 1XGEA 4NJGA 3BXWA 3OZYA 1RD5A 3BO9A 3NZ1A 1RK5A 1VJSA 3ZVHA 1SO4A 5F1UA 2OYMA 4AY8A 3G3DA 5EMUA 1XSKA 4CNSA 3MC5A 1TTIA 4J5NA 3W29A 3M0YA 1MUMA 3CBWA 3FFSA 1ZJIA 4IIHA 3VIOA 3PPCA 3KHJA 4M80A 4HPNA 4FNTA 3L4WA 1IR1A 3G1XA 1H3GA 4QNWA 1UBSA 3FLUA 3EOSA 3OHIA 5L9FA 3BTNA 3FSTA 3BAKA 3SDOA 1WDDA 4PL1A 1JI2A 2VOTA 2JEQA 1DWHM 3WK1A 4AD3A 1G1YA 2GVGA 3A4AA 5F2GA 1FXQA 4TX9A 4CN6A 5M1TA 2QJMA 3BAWA 5MF5A 4GYFA 4FNUA 3QZAA 4WY0A 3BQ6A 2NQ9A 1CB7B 2CNCA 4MKNA 3VKCA 4W8AA 5CCZA 2V3FA 5CZ0A 4W4QA 1GQNA 3W7HA 1DXIA 1W1B1 4NVTA 2DSUA 3NO3A 4DZIA 4JX6A 1LL6A 2Z1VA 3LUTA 3BMVA 4P7NA 2CC0A 3R94A 2YFOA 1YTDA 1HL2A 5C2XA 4MFEA 2AQVA 3CQHA 2XHYA 3FKKA 4ZSTA 3MA8A 3AI0A 1DBTA 1HZYA 1XDMA 4O17A 1U1HA 3GNOA 4RNFA 2H8ZA 3KAOA 1Q13A 3NWRA 5F2LA 3B8SA 3S9ZA 4DPPA 4MKSA 3GZAA 4LUYA 4FB7A 3ZWSA 4C1LA 3VD3A 3MMDA 3C3UA 1QASA 3FHAA 2D2OA 5BRBA 3DU0A 3USZA 2Q8XA 4I7VA 4E3VA 3VE9A 4R53A 5MHBA 3LU2A 2CLLA 3MKVA 1RQHA 3MY9A 1JXKA 4W7UA 3ABZA 3A23A 4MWAC 3E02A 1MFVA 3MI3A 3ZR6A 4LTSA 4Y8EA 2NXHA 5DT7A 4HP5A 5GPRA 2GJRA 2BB0A 1TMLA 4QCFA 3QM3A 3UVIA 3S6TA 2OWCA 3QPYA 4JY8A 4LYQA 4M19A 5JIWA 3CNYA 2G97A 3WQWA 3WL0A 4INFA 3SRKA 4Q4SA 1AH3A 3M07A 1AQ0A 1I2OA 4LX4A 4DBSA 5HXMA 1CDGA 3Q2DA 1RHCA 4LEQA 5FKYA 4H01A 1XH2A 3L5LA 4GO9A 3VIGA 4RX0A 1VBJA 3EGJA 1QVBA 1V0MA 3A4JA 3P61A 3NZPA 1TE1A 1J0JA 1QI2A 3GDBA 3NYZA 1R2RA 2E6DA 3P81A 4EWJA 5A6BA 2XVLA 1HO1A 2XDFA 1KFBA 2XH4A 1EP2A 5DXXA 3WEZA 1V02A 3TN4A 1EKOA 1M7XA 4PEEA 2FGZA 4MPQA 5G1MA 5ECUA 1OT1A 1GJWA 5I24A 4MUPA 1C7SA 1MQPA 1XIJA 2CFFA 5CSSA 3PJTA 3EBVA 4XX6A 1QATA 2EJ1A 5E9AA 3RU6A 1H7PA 4DJDC 1C8YA 1WXJA 5T8GA 2OO6A 2ZBTA 4NHVA 2DU2A 1HKIA 5EMYA 2Z1KA 3WNPA 4XQ6A 3TFXA 3FW6A 2F84A 1CLVA 3SRFA 2XFYA 3BLKA 3N17A 3R8HA 3KVMA 1MMFA 4R5EA 2CXGA 3W00A 2VCCA 1YYAA 3AS0A 3W86A 3SECA 1Z8AA 2BVTA 2FH6A 1M01A 1RBOB 1KWGA 3DYPA 2WM1A 2FTPA 3ALGA 4TTGA 1E9LA 2RGLA 1XC4A 3TWAA 4J28A 4XUGA 2ZZ2A 5DXYA 4EPBC 4OVXA 2J8TA 1X97A 3HMJG 2WSPA 3QC3A 4OUIA 1J96A 1N7KA 3EWDA 3SUTA 2F2HA 4P61A 5HNRA 5LNSA 2O7QA 3W72A 4I9TA 4N9BA 4JTGA 4MFDA 4JTHA 4Q4QA 4CU7A 3OBKA 1FWAC 4BF5A 2Z6IA 4O54A 1D3GA 5CC5A 3PBVA 4BQ5A 1OSEA 5FJUA 3DC8A 2ZUUA 1DJQA 3GNDA 2BGQA 3S1VA 4D71A 4HCDA 3T0BA 3M0MA 1DE5A 3TTEA 3WLJA 3ZSSA 5J5DA 2ABAA 4GZEA 3M1ZA 3CIWA 3KRZA 1QJWA 2WMKA 4KGJA 1JL8A 2A7PA 1A4LA 3WJXA 3AZTA 3PTQA 3RX3A 4PCTA 2IPGA 1RALA 4JIIX 2QMJA 3QQ0A 3NQ7A 3C2EA 3PG9A 1ZQ5A 3KLLA 2DDXA 5HMFA 4RDWA 1VIWA 1C93A 1OY0A 1ICPA 4RV3A 3CZKA 3RR1A