1JPIA

Phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKLALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROPORPHYRINOGEN DECARBOXYLASE
publication title Functional consequences of naturally occurring mutations in human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 123
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1jpiA00
4AY7A 3PPCA 1JPIA 1R3SA 3PPHA 1R3QA 1UROA 4L65A 1YPXA 1XR2A 3CYVA 4L5ZA 3GVQA 1U22A 3L7RA 1J93A 1U1UA 1R3TA 4L64A 3RPDA 3GVRA 1T7LA 1U1HA 1R3YA 1U1JA 3GW0A 2NQ5A 4QQUA 3BQ5A 3PPFA 1R3VA 4AY8A 1JPKA 2Q6ZA 4EXQA 4ZTYA 2INFA 3GVWA 3GVVA 4L61A 3T0CA 1JPHA 4L6OA 4ZTXA 1XDJA 3GW3A 1XPGA 4WSHA 3BQ6A 4L6HA 4ZR8A 1R3RA 1R3WA 3PPGA 2EJAA 2Q71A
chains in the Genus database with same CATH superfamily
2H3DA 3W7MA 3V0TA 4K8HA 4WY0F 3P80A 1PTDA 5LIUX 1KBBA 4JQ3A 4XZ9A 3NFUA 5FJJA 1B1YA 2PLJA 3LCFA 4MWAE 4IGNA 1UP2A 1H7OA 2PF0A 2Y8UA 3FVDA 1AH3A 3OZPA 1XLGA 2NVDA 3VILA 2YLAA 3M5YA 3H6OA 2VEIA 2PD9A 3NSMA 3QN3A 3QZEA 4MB4A 1HO4A 1VP5A 3GHRA 2RKXA 1CYGA 1XC6A 3UWUA 5CBIA 2BMBA 1CXEA 1XV8A 4IGHA 2PDHA 1X7IA 1FCVA 2VI0A 3H2AA 3SQMA 1KWGA 1JPMA 2CLEA 3QHMA 1TWZA 2XZ7A 2VMFA 1EA9C 4XBJA 4C1NB 3M0HA 4IMFA 3C52A 1CGWA 1UQZA 3LZ3A 1Q6GA 3LLFA 1CCWB 3AO0A 3E3HA 1AJ0A 1PL9A 2E8ZA 4HB7A 4JTQA 1B3XA 2FYMA 2ZRXA 5I3GA 1GGOA 2E3ZA 4MDOA 5A95A 4PMNA 1AUSL 3EMZA 1E72M 3TUUA 1FCUA 3IV3A 4IPIA 3G3DA 5E93A 3UZZA 5M5DA 4JICA 3L0NA 3W6YA 3SCNA 1QO5A 4XO7A 3P93A 4B5XA 1FWNA 3RLUA 5BXTA 3DFQA 1IYXA 4GYFA 4P7RA 2GVEA 2PODA 3GUWA 3P3BA 3REQA 4PRWA 3GG7A 1BYBA 1JPHA 1X7FA 4DY1A 4JIIX 4AVFA 1LOLA 1QHPA 4FX8A 1KD0A 4FAMA 3OLEA 1UOKA 1DJIA 3V75A 1F2JA 1DORA 2FZBA 2DORA 3ARZA 3DYOA 1ADSA 1O95A 3LV6A 4RE0A 2R94A 4C6OA 1WDWA 5A6JA 4UMCA 2VX4A 4UOZA 2QUUA 3C2EA 4B9ZA 3GM8A 1EJSC 2YCLB 3GBDA 3HA1A 4GGHA 4C1KA 2H9AA 1KCXA 3CMFA 2BS9A 3VIJA 1G0CA 3B8WA 1WZMA 4P8XA 3BVJA 1F3EA 2QCDA 5C9RA 3KUMA 1XCXA 3QYSA 2INEA 1EJRC 2OWCA 3KBSA 3ZWTA 3L4XA 2YXXA 5EKYA 4U28A 3PSWA 2VVSA 2OLSA 1MUMA 3LENA 4UCFA 1Q85A 2NZLA 4YCPA 3THAA 4QSHA 1Z41A 4E2DA 3L5MA 1W9XA 4BI6A 1LF1A 1SFJA 4J2MA 4BEUA 3QW4B 3P8JA 1BHGA 4GLEA 3HPFA 2JBMA 4FI4A 4WXZA 2BXYA 2V38A 1GK8A 1EJUC 5BRBA 5FF2A 1A3WA 2FZ9A 1G67A 3KBMA 1E4MM 4UB9A 5BCAA 2ZUVA 3KS6A 4EP8C 2ZDRA 4OQVA 3GUGA 1WOAA 2CKSA 2NW0A 2QJHA 2WZHA 4LJ3A 3PJTA 2Y24A 3LMYA 3UWWA 5CPNA 2XIQA 3NPXA 1FXQA 1FWWA 3OODA 5BU6A 3KTXA 1IT8A 3TTEA 3EKZA 2DIJA 1A3HA 5AC5A 2JGQA 1HGYA 1XC4A 3NDZA 3A23A 2GSEA 5K4ZA 2OYKA 2R1MA 5D37A 3F5JA 3M43A 4D6EA 2HXTA 3NQVA 3TYAA 4TMCA 1QI0A 4Q7IA 5GJMA 4N9BA 2O56A 3DESA 1XSIA 3TC7A 2J9ZA 5EPDA 3BLFA 4H7ZA 4FOJA 1GEHA 3UF9A 1FWTA 4BR1A 3DERA 2ACUA 1EP1A 4Q32A 3K4WA 5D04C 2WLYA 4GD0A 1EF3A 1L8NA 1TV4A 2G4JA 4UFJA 1CLVA 3TW9A 5CJ5A 1VLWA 4O1DA 1QNSA 5T9BG 3W70A 3WSUA 5KETA 1VKFA 3EEZA 3A3HA 4CQBA 2PZNA 3SAZA 3QV7A 5FESA 4G9PA 1I2RA 1SJDA 3GTHA 3SCWA 3H22A 1LUCA 2JEPA 4XAGA 1T41A 2QJJA 4PUDA 1BVWA 1W91A 5HJLA 1UD2A 2GLKA 4NILA 1FDYA 1QATA 3PAJA 3U2ZA 3GNXA 5G2WA 3C8FA 2C1GA 1EC9A 2R1PA 4PTNA 4Q6XA 4Y9MA 1UYQA 4CNSA 1BKSA 3N2CA 1P0KA 1ZGDA 4O18A 3UXDA 1OT1A 1A47A 3W2KA 4WRHA 1F76A 1OYAA 5G1TA 1AQMA 1E43A 3UGRA 2F6UA 4S2CA 2F6KA 2HQAA 1TR1A 2PDLA 4AXNA 4AY7A 4FNRA 2OYLA 1IEVA 1M5WA 3WIJA 3AOFA 5A6BD 1ZCCA 5REQB 3RUBL 1W9BM 4I9JA 4QQUA 1UKQA 4WDXA 3TJXA 3BG9A 2XH4A 4JHOA 1F9CA 1TPH1 3I4KA 4Z2LA 3ONBA 1KFWA 4K3ZA 1KNWA 4PODA 4S3AA 4S39A 3MDUA 1EJ7L 2C13A 3NAVA 1J96A 3FYYA 1MW2A 4DWSB 4MJ4A 3WK0A 2E25A 3N13A 3LQLA 2B7QA 1KO0A 1WBJA 1TCMA 2WMGA 3JZUA 3MMTA 2WW5A 3O2LA 2WBGA 3E9AA 1JJKA 2ESCA 3O3RA 1WO2A 4US6A 2ZWYA 1JGIA 1HQTA 5CG7A 4GZ7A 3M41A 3W22A 3AYVA 1JPDX 3RU6A 5I09A 2EPOA 2PU1A 2YA1A 1BWVA 4Y6GA 3VUPA 1EPXA 3R12A 2ZX7A 1VFOA 2HEJA 4JQ1A 4NU7A 1DJGA 4M6PA 2QJMA 3DKLA 2OKOA 4N6FA 2LLEA 2CZFA 4Q22A 1PXGA 1W1PA 3QHNA 1K8YA 3TR2A 3P7YA 2V5JA 1FVPA 3BOLA 4FMVA 3F03K 1HKMA 3M5ZA 3VZXA 1XLMA 1QI5A 1A5SA 3V1HA 1SJCA 1E4LA 3VDGA 2VR5A 3CAKA 3QOMA 4OE7A 2EPNA 1Y8BA 2Z0IA 4DAIA 1B5TA 1EF2A 1RBOB 4PH6A 2YL9A 1QNQA 1EKOA 4Q8MA 4YTSA 3CT2A 4OV4A 4S2BA 1SMAA 3WH5A 1G4TA 1QNOA 2ZTJA 2J77A 5F2LA 6TAAA 1UD8A 3RLGA 4ZO7A 3CAVA 4PULA 3TQ0A 2JALA 3IIXA 3COTA 1HL8A 3L4YA 4O0ZA 4Q8QA 4RE4A 7TIMA 4MADA 4PCTA 3M0XA 4KWWA 4GKTA 1PX3A 2UY4A 1V5XA 4MG4A 3LCWA 3ZXWA 4JS3A 2XISA 3N2TA 1PYMA 2OVLA 1V93A 3CUJA 1BRLB 3TN5A 1DXIA 1WZLA 4S3DA 3N2OA 3B9DA 4DBSA 2R91A 4FPSA 1OADA 3K8KA 5G5IA 2A7PA 4ZQNA 3KRBA 2Z27A 1ZPTA 2Q3RA 3MJMA 4E2BA 5A2BA 2IPFA 3Q67A 2HMCA 1J2BA 4ZSUA 5LNRA 3BZJA 4H9ZA 4Q8PA 2KX9A 1J18A 3PTKA 1DJHA 5BZAA 4GFIA 2FMNA 1D2KA 2O7QA 3H23A 4PUNA 1VEMA 4Y8EA 2V2DA 2CLFA 1JDDA 1ICSA 1SU5A 1E6QM 3P14A 3MMDA 1BF6A 3VIMA 3H2EA 2ZFAA 3AROA 3L4VA 1NIUA 1R8LA 1TB3A 2OX1A 3NPWA 3AZTA 4RCXA 2GDQA 4JL1A 2GWNA 4ASTA 2Z6JA 1IEWA 1B3WA 3EA2A 4J5NA 2QDGA 3AQUA 4C1NA 1YQ2A 4PMDA 1LQ0A 2CLHA 1AK5A 5FF3A 1M7XA 2PMQA 4L4MA 1O5QA 3M0YA 4RPPA 5D02A 3PZQA 4WGXA 1OVDA 4JNMA 2WJEA 2ZA2A 3VC6A 3W7OA 3VO0A 9CGTA 5ABFB 3CHEA 3AIBA 1TMLA 1JQVA 1LLWA 2QJNA 3E5PA 4ICMA 1OFQA 3IS4A 4PFMA 3LCGA 2PTXA 3C8NA 1RA0A 1F8MA 4K6AA 5CJNA 3NUKA 4W84A 3W86A 2Z28A 3HFYA 1TPB1 3KS5A 3T8LA 1J0HA 1NF7A 4BI5A 3QW3A 4BEQA 1BD0A 3EA1A 4JN6A 4RNIA 4P8UA 3M0JA 3SUUA 2Y63A 4MKNA 2PZ0A 2WM0A 2CIPA 3AALA 4IJCA 1TFVA 4B2DA 3BARA 1DQXA 3DDMA 5CC7A 1N55A 4CCCA 3URNA 1ADOA 3OZOA 2OQHA 2Y62A 5FJUA 2VRQA 3UT0A 4ATDA 4AAJA 5A2CA 3JR2A 2RDXA 4LV4A 4L4OA 4JTRA 1TREA 4A2SA 3B8VA 3BSMA 3PR2A 2AQWA 2Y7FA 2C79A 1YDOA 2OQLA 3H7VA 1XD0A 3TYUA 4BKNA 4KERA 2C15A 2ZCGA 3EZ4A 3SSZA 4U33A 2O9OA 3JZEA 4ZB0A 3WK2A 2FZDA 4LF1A 2VD8A 1V03A 1XLLA 1E40A 1K70A 1V3LA 2V9DA 2AOSA 1M03A 4WIWA 3F7JA 1U5HA 3THDA 1PV8A 3WQFA 3AMGA 3GU2A 1GOMA 1BAGA 2HVMA 3DXIA 2QMKA 1Z3NA 1ZBWA 2ALRA 5M2FX 4GH1A 4XZIA 1XIJA 1ZBKA 3P61A 3URAA 3WEMA 3JU2A 1ECQA 1IWPA 4FOKA 4RNHA 1W3NA 4GI9A 1RA5A 2OEMA 5A8NA 4DUVA 3B40A 3IIZA 4C7FA 3IIOA 4ZO9A 4XD3A 3JS3A 3W26A 1C3FA 5A2AA 2D2HA 4ROQA 3BW2A 2PDIA 4IHCA 2QVHA 4F0SA 3SGZA 3ZR5A 4JFVA 4GQGA 3MHFA 3BH4A 2V3FA 5EMKA 1VYPX 2W4XA 3D3FA 4JIRA 3NQ2A 3W1RA 1K9DA 3E0WA 2NQHA 5GQBA 5ABGA 3EWWA 4ZQCA 1GKQA 2RUSA 3O9NA 3MUZ1 3GH4A 2EG8A 4V1YA 5DCDA 1DHPA 1RSCA 4Z1BA 2RJHA 1MFVA 2O4QA 1KFBA 4A3HA 1TPWA 4AVNA 1PZ3A 2DSKA 1KBJA 1XRSA 5LA1A 4M51A 3T8QA 3GNNA 4DF2A 3U57A 5C0QA 4WJ8A 3SEPA 3NNTA 4Q8TA 4GFSA 3TYZA 1WUEA 1A5KC 4FIRA 5JXQA 3LBMA 1VJSA 3LN3A 2DDXA 1DV7A 3BXWA 1GYMA 2XH2A 3WBYA 3QY8A 1VHCA 2X0HA 3R6IA 6ALDA 1RBLA 1AA1B 3LHYA 1CGVA 1UASA 3H26A 5GNYA 3LTYA 4CU6A 4HA0A 3TEVA 5C8BB 4GIYA 2F84A 3FA5A 5JBFA 3ZT7A 1L9WA 4O17A 1RLCL 5HOSA 4DYKA 4JCMA 4PTMA 3WQOA 1GW1A 2ACSA 4XD5A 4W8LA 4UR8A 4HHLA 3TLQA 3HTWA 1IXOA 1C9DA 4NJJA 3C2FA 1AH0A 3I3DA 1LG1A 1XBXA 5F4WA 5CAKA 4ZA0A 2PPGA 1WZAA 3GVVA 2CLOA 1XH1A 1N2VA 2OO0A 3HPAA 3UR8A 2CITA 1JXKA 1AQFA 2VFGA 3QRHA 5REQA 1R6WA 5KINA 1Q7MA 1XS2A 4B5UA 4ZXLA 1EUNA 1YE4A 4WOZA 4U10A 1R85A 1ZBVA 2YXGA 1LROA 1RPKA 3FKKA 1CDGA 4KWVA 3ECQA 3HJZA 3MVIA 1BSLA 2CERA 1LTDA 4PUKA 4UCGA 1AG1O 3B0UX 1DJQA 3LMZA 1G9HA 2YBUA 5A8GA 3A5VA 3ATZA 4H3DA 3KHJA 3YPIA 3WQ6A 3BDKA 3GZ3A 4Y9OA 5F1VA 5LIYX 4AG0A 1KRMA 1US0A 1J79A 4LAOA 1UA7A 3VCNA 4QCEA 4M7SA 1QW8A 2Y7EA 4MMWA 5CXPA 2WANA 1KTCA 1E3ZA 5AYXA 1XUZA 1S2WA 1NWRA 3GDTA 3U48A 3EGJA 1YYAA 4RDYA 2NSOA 2MUCA 5D9MA 2ZZ2A 3BOXA 2GZXA 5H6HA 4KIRA 4PMJA 2J7EA 3VKDA 3MUAA 3PZGA 3M0VA 3WLSA 3EA3A 3OVQA 3MV11 4LTSA 1GVRA 1C8QA 5JBDA 1JDAA 3CC1A 4CN4A 3HO8A 4WSHA 2QXWA 2PB1A 1BVNP 3CH0A 3IRDA 5AHIA 3BLLA 3PUEA 1VH7A 4K8EA 3UVIA 1B54A 1XHGA 4XUYA 3LPGA 4O11A 3V5OA 2E6AA 3MUIA 4EANA 1K1DA 2BXZA 3L65A 4MHBA 4BWLA 4EIVA 2OPJA 2VO5A 1NAL1 3CUXA 2B31A 2A3LA 1ME7A 5F2IA 1IXQA 1PEZA 3R4IA 4QLJA 1FOBA 2G3NA 3O6CA 3CL6A 4Y2WA 3K1GA 3ONCA 2ASHA 3W7PA 3SFKA 4F9DA 4NI3A 1S2UA 1B3VA 5D9PA 2NQ9A 2EJ1A 5KZ6A 5IM51 2BVWA 4DYJA 1OYCA 1OYBA 1XGZA 5E0CA 2QCNA 4L4PA 3PG9A 5LHEA 1BRLA 3VNIA 4JIQA 3I65A 2NLIA 3S2MA 2PGEA 5DX7A 3ZLGA 3W7CA 2ZC1A 2HVNA 2OWXA 3P0XA 4KF1A 4IGSA 3LDVA 1FH8A 4J40A 3MP4A 4ZFMA 4ZOEA 1X97A 3AXMA 3IIVA 3CQ0A 3RU8X 1R38A 1V3JA 3ZJ6A 1EA0A 2OJPA 3VIIA 4IMEA 4FLRA 2ZVRA 4XAYA 1I2QA 1VD6A 1MWOA 2B0MA 3TYDA 4I8YA 1GVSA 3D0CA 3W7RA 4W93A 5MF5A 2DT3A 1AD4A 1NP2A 1QNRA 3GY1A 2I57A 3K2GA 4A2RA 3DFNA 1H7RA 2G97A 1UC5A 3B9AA 2X8RA 4L6OA 4PR4A 3UGVA 1AQ0A 1VF8A 3GSMA 1H2JA 2YL6A 4PTDA 4XZMX 4LUTB 2VC9A 3AJXA 4MB3A 2VZSA 2GGGA 4BF7A 1RUSA 1IE7C 5JUVA 4W87A 2YJQA 2VZOA 2AGKA 4LYQA 5ABFA 4QDPA 4HPXA 1XPGA 4QS5A 3WQ8A 3NO1A 2PSNA 1EFZA 1OX4B 3ISIX 2BDQA 2QMJA 3PY2A 2PC8A 3WK3A 1YRRA 2IW0A 5CLTA 1CENA 3OGSA 3K30A 1H60A 4NZCA 4U2YA 1D3GA 1Q6DA 2ON3A 1DXFA 4KW2A 3PZNA 1J6OA 2Z24A 2IXVA 3SCVA 3QGAC 1PPIA 3GXFA 4GC3A 5IFPA 1FA2A 1R47A 2R6OA 3NL3A 4YVVA 1JNDA 1THFD 1VC4A 1RQHA 4YHGA 4XTDA 2PC4A 4FLQA 1VBRA 3VD3A 4GQBA 3DIPA 1T6MA 3ZVHB 3PB2A 1PHQA 1YPIA 3W81A 3CIWA 3IEBA 5ABEA 3QGVA 3QY7A 1EC7A 2HE5A 1H51A 1LRTA 1E4IA 3FXYA 2I56A 3C4UA 3FA3A 4WXYA 4BWLC 1I2NA 1OGSA 4XZNX 2BZNA 1QWKA 2QCLA 4IH3A 2KAUC 3LPOA 4WY0B 2QQ6A 2NX9A 4CQDA 1F7BA 1HXJA 4Q7BA 4XZBA 2XIIA 4O1AA 4JD4A 1F4HA 3SQSA 4LX4A 3TN3A 2ISWA 2HBXA 1SM9A 4JFWA 2DZWA 2NXGA 2Q71A 4ORIA 4R9OA 5CBBA 3FFSA 4N4QA 1XFCA 3NM1A 1O94A 1I4NA 3EWYA 4XO6A 3MHUA 2VURA 3E96A 3EKGA 3NOYA 5CZTA 4FLSA 2OT1A 1E0TA 2FH6A 4FB7A 2WPGA 3GC4A 3PBUA 2NVAA 5A6SA 1CX9A 3R11A 2POTA 1UJPA 2V3DA 3LEPA 3IUIA 4CNNA 6ENLA 1QNVA 2OT0A 3VD5A 2VQTA 1EIXA 1W1YA 1RQBA 3TA6A 5L9FA 3B05A 4KWUA 3KAOA 2XH0A 3ERPA 1UD6A 2DVTA 2Z7KA 4XKMA 2Q8XA 3STPA 1MNSA 2BGSA 1GCYA 3QYQA 1PB0A 6PTDA 4AIUA 5CGMA 4HA4A 3LSCA 1K6WA 4LPCA 2VKZG 1XINA 4ZTYA 2BGQA 2E1DA 1T8XA 4QLLA 2G96A 3KRUA 2I9EA 4X9SA 3W27A 1WAUA 2ATMA 1CNVA 1FWSA 4DXKA 2I9UA 4GUGA 4H8UA 5JMUA 4BK9A 4GH3A 1LBLA 1UP3A 3SECA 5BWFA 4HK6A 1AODA 4QJ3B 3FYPA 3PWGA 1QAPA 7A3HA 3O0FA 3RFAA 1UR4A 1TA3B 3VGHA 2GVGA 3WDQA 1PDZA 1SQ7A 2F6XA 2V68A 3LM7A 2FPVA 4O50A 5LA0A 1GHRA 1DIKA 3GU9A 1FH9A 3EDKA 5LSMA 4LXFA 2ZRZA 3O15A 3IK2A 3MANA 2PDFA 3UG5A 2DU2A 3Q45A 1G5AA 5KZMA 4AHOA 3O63A 3MPGA 5IFTA 2DUAA 2EXOA 3W72A 1ZAHA 1TTIA 1CW2A 3W85A 4XG1A 2ZWZA 1VR6A 4O15A 5AN7A 1QFEA 3W07A 4PUUA 1TWIA 1F61A 5TNVA 4QJ1A 1VPXA 3KCLA 4MSSA 3RCYA 3M7WA 5DANA 7TAAA 1BXNA 4QE1A 1E4NA 3SUSA 2YIHA 1LT8A 4S1FA 1UROA 5CPLA 1ISYA 1XLFA 4MWAD 2PBGA 2WBKA 5CQ1A 3WD3A 4WGHA 4RW5A 4E2VA 3L12A 2GJRA 3CZGA 3SO7A 1DQWA 3N34A 3N9RA 5T9CE 4IP4A 1QNPA 4PMQA 4IFRA 4A3YA 3N2XA 3DHPA 4AYSA 1RALA 4OVXA 4I3GA 2J7HA 3MQTA 2X1TA 2JE8A 4URIA 4F0MA 4GHRA 1IXNA 5D2YA 3GG8A 4QG9A 1V77A 5K7JA 4GINA 1W3KA 4B3LA 5HQEA 1ISXA 2VFIA 3EX3A 4CD7A 5HAOA 4UTJA 4ATWA 2E6FA 3W25A 5TF0A 3VKBA 4CQAA 4WSKA 3GWQA 4PBGA 3A64A 1EEXA 4GXWA 4Y9NA 3KDNA 2FTWA 1H7XA 3TXVA 3C2OA 5HNNA 7PTDA 1P6WA 4GACA 4RZ4A 3V1PA 4EOUA 4FXFA 3OTRA 3TN6A 1ISWA 3OPSA 1NTHA 5BU9A 4HPHA 2OX4A 2WC4A 4WVXA 2GYIA 4MKVA 2P8CA 4JHMA 5CC3A 4TXEA 1I1XA 1LOSA 3KRSA 4JIEA 3VMNA 4UTUA 2NWRA 4K7YA 4DPPA 2DJLA 3AZSA 5AKQA 3UCCA 3GZAA 5CPTA 3PZ9A 1A5CA 4FO4A 2EO7A 4J3ZA 3P2VA 3K46A 5LNWA 3GH5A 2FZMA 2GUYA 1MW3A 1I45A 5FOOA 3AIVA 3ITVA 3MJYA 3HJEA 3IJ6A 4MZ1A 1PKNA 5FJIA 4A8IA 4C60A 4AY8A 2Q6ZA 1HKJA 3R7MA 2WJFA 3AIQA 2VYOA 1PCKA 4FNUA 3WDRA 4I7VA 3IJQA 4S38A 1KLZA 1QK0A 4X60A 1BGGA 1EQCA 3LQGA 4HIBA 4FIQA 2J7BA 5FEPA 1P6CA 5CPMA 3WD4A 3P5YA 1MYRA 1G6CA 5F2GA 2R8WA 4NI8A 5FF4A 1J2WA 2BNJA 5JU6A 4O0KA 3HU7A 2ANUA 2TPSA 3KOWA 3KRZA 4QG6A 3ZJKA 3H2MA 2X42A 3P67A 4B4FA 1CI1A 1OFPA 2Z6IA 3R10A 4BCEA 4YYCA 3UFYA 1PTAA 4P7QA 2J27A 3ES7A 4H1ZA 4GRSA 5ABTA 4B3KA 3NZRA 2ZRWA 2E6DA 4MWAC 3KL3A 2DW7A 3GKAA 3T2OA 3TQPA 1W5QA 3BLIA 5E09A 3UESA 4Z42C 3ABSA 1W3IA 1FWCC 1U2YA 4FALA 4WCJA 1Q2RA 4NYUA 4IXXA 4X9YA 3ARRA 1IEQA 1ZS2A 2CXGA 3I6RA 3FK4A 2VZVA 1EPVA 2V3EA 4QR6A 3NR0A 1JZ8A 1XYLA 4DO7A 4S3FA 3PZIA 2X7WA 3PWIA 9RUBA 3BMXA 2BHYA 3LOTA 1QW9A 3UWZA 3NQAA 1ONEA 2ISFA 4MY8A 1RP8A 4IMAA 4LUTA 3EWBX 3QJAA 4LANA 3B0PA 2CHRA 3CMGA 3MUY1 3BAYA 2X40A 2E09A 1XYAA 1UA3A 3T7VA 2HSAA 2FMOA 1CB2A 5ABHA 3CWOX 4IMGA 3UP8A 4FEZA 3EEGA 3G1VA 4XSLA 3PUDA 5I2UA 4B5SA 4JEQA 1X6UA 4F4RA 3TC3A 4F3HA 3LPPA 1MXSA 2JFEX 4H00A 1KCLA 3GR4A 4AISA 3WNOA 1ITCA 3QKZA 4DM2A 2WNWA 4NVTA 1E9LA 5FA5A 5A8MA 2VX7A 4GI6A 1IR1A 1H0IA 4HMCA 2QCMA 1TJPA 1VEPA 2CCRA 2J47A 2XN0A 5DXYA 5I03A 1KFLA 1ZJAA 1QTWA 2AQVA 7REQB 3GXDA 1IXPA 2HNHA 5I02A 4P7LA 1Z8AA 3VNYA 3MU7A 3N2MA 3ZVHA 1CLXA 2VUYA 3V7PA 1Q6OA 3LNPA 1H61A 4WSJA 3RXZA 3RAOA 5FIPA 3W7KA 5LNSA 4TQTA 1MO0A 3H7UA 4V2XA 2G41A 4DI9A 2F9RA 3EOSA 3CYJA 3EMCA 1DWGM 1M53A 3T0CA 5A3HA 3TNBA 1HP5A 5LA2A 3FGCB 1Z42A 4WY0A 3PPGA 3T2QA 2O55A 2YYTA 3TKFA 1LWHA 5HWMA 2FPTA 3WLKX 3E12A 3DI0A 1VRDA 3MCMA 4H9UA 4OBTA 3F4WA 1S5NA 2E67A 2E40A 1TWWA 1GOWA 5AC6A 4AHQA 4O16A 1GKPA 4W86A 4B9YA 2V8ZA 4PL2A 5G2HA 2H6RA 5G4EA 3I3EA 3MB9A 5BXPA 4IP7A 4AWUA 5J04A 2B7NA 4PL1A 3E2RA 4A22A 5D9OA 1SSGA 2DZVA 5A94A 4MYXA 2VWSA 3IVUA 3SCRA 4XWUA 1H1ZA 4GVIA 1H41A 3LM3A 4AC7C 3T4WA 3L9CA 5LNVA 1XDLA 5FI8A 5CBJA 5HNTA 4FF5A 3UNTA 2J7DA 2YFNA 3HOJA 2BXVA 3PFRA 3HG3A 5AHLA 1R0MA 2QJGA 5EB8A 4XZLX 5C5YA 1ME9A 3VOGA 2FH8A 3ZQ9A 3VU2A 3CYVA 3T0TA 2VOMA 3CO8A 1JYNA 4DBEA 5JIPA 1QOPA 3LGDA 1OFOA 4B4HA 2WK2A 1MZHA 2C1IA 4LF2A 4FX6M 3GK0A 4OOUA 4IIGA 4P8WA 3WNLA 1XG3A 5U7SA 3APTA 2R1KA 1E55A 1A50A 3HGJA 4HYVA 3U0HA 3GXTA 1X1OA 1W8GA 1QCWA 1YTEA 3IIPA 5M17A 5K9DA 1GEQA 3TNOA 3BCJA 2C6QA 4AEOA 3OG2A 4O54A 3SFWA 2GOUA 3PJUA 3O8AA 1FTXA 2Z1VA 3A4AA 4JTDA 4H7CA 3ZS4A 3QMRA 2GJLA 4UTHA 4UC5A 4LFYA 3MWCA 1UD5A 4XTIA 3LRMA 1E1EA 3TZNA 2Y88A 4NT0A 4AD1A 3B0XA 1CXIA 1XDMA 4YNGA 3N4FA 3NQFA 1XRVA 3UWEA 3W28A 3DHDA 3MBFA 1IT7A 3FEQA 1H09A 3S2LA 3PWAA 1WDSA 3U5UA 3FJ4A 1MQQA 3PM6A 3HPXA 5JIWA 3C0JA 1TQXA 3NL2A 1GW9A 1JRBA 2A21A 5C9UA 3HG4A 4LYPA 2ZADA 3PTDA 3SI9A 2RGLA 3OHIA 2PDUA 2DVXA 4L61A 3VIKA 4IIEA 4AY1A 4HSOA 4JDYA 3VX0A 5LKYA 1C9WA 2YA2A 5AC8A 3VAVA 2JKAA 2ZOXA 1S46A 4AFYA 1P7TB 4IT1A 2G3JA 2CBIA 3WMBA 2J88A 1WKYA 1Q7QA 3GDBA 4KT2A 5IBXA 1LL7A 3GAKA 1JL8A 1GT8A 2QZRA 1JDFA 4E38A 2RAGA 1UD3A 2JKPA 1KM4A 2WMFA 4Q4MA 3TX9A 3U5YA 2WMKA 1FWJC 5AHMA 4A3RA 5HMSA 2FGLA 2NWSA 1H49A 3VNJA 1KBIA 1LDCA 2NX1A 3E0VA 1JFHA 4TVCA 3UR2A 4LSBA 1J0YA 2RDWA 3ZWSA 5SWUA 3UCQA 2QR6A 3MSYA 4K39A 1AL7A 3RR4A 1SO5A 1P1XA 3XIMA 3CL8A 5JH1A 2GVJA 4YWIA 2CYGA 2JEQA 1I0DA 3PN8A 3L4ZA 4CNPA 3FSUA 2OSYA 1UG6A 3J7HA 4GI4A 3WNKA 3WF3A 3LBCA 3ID7A 1GPWA 3OP2A 3S46A 2OGJA 3PS7A 2C19A 3HMCA 1NWTA 1DTUA 3H70A 3MY9A 1MI3A 2G3FA 4QG8A 1Y7VA 2EHHA 4ZE4A 2WZTA 4GJJA 5DRIA 1ISVA 4EXAA 3MHGA 4O14A 3GKFA 1FWHC 1DIOA 2E5BA 4OUEA 1XGDA 3SJ3A 2FTPA 3DG3A 3MO4A 2J66A 4AXKA 3B97A 4KEMA 3HF3A 2RJGA 4NAFA 4ADTA 3GXPA 2E0PA 3ARTA 1UR9A 1D3CA 4IL2A 2CW6A 3GVQA 2XUCA 2EBNA 5D4YA 3A9BA 2FJUB 1FP8A 5TIMA 4GQRA 1K7EA 1JDCA 3BOFA 2ZXAA 1GJWA 3BAWA 1G01A 2BY1A 2J78A 4NASA 4U3CA 1IWAA 3V16A 4JTHA 4L56A 2XVNA 3TC6A 3BMWA 1M7PA 2XIOA 3VKJA 4A8LA 1GQJA 3P0WA 3NIYA 4XD4A 1BYDA 3ABZA 1OWQA 4WJXA 3RILA 2EKGA 1ODUA 5LGZA 3GHUA 1D8WA 2OCZA 4LNCA 4BS0A 1BXCA 3GTIA 1CWYA 2JGYA 1KTNA 3CPUA 1ONXA 3ABXA 3VNZA 4ALDA 5JQ9A 4Z1DA 1G4EA 3HQPA 3NL6A 4UTTC 3UWQA 1ZJBA 2AL2A 4L64A 3Q4DA 3WMCA 1NH6A 2QLYA 1XPYA 3SN4A 2IQDA 3WQ4A 4UWMA 4EWJA 1NQ6A 1MMFA 3VMPA 4QIUA 4IISA 2QKFA 2VT0A 1EH9A 4KCTA 4W7WA 1TIWA 1LM1A 3WNPA 4UQAA 5G4HC 3BGAA 3WD0A 5I24A 3QV8A 2VL4A 4PYSA 3AS2A 4IFKB 3W7GA 3WLMA 3VK5A 3XINA 4W7UA 3LCXA 4JPGA 4FLOA 2O92A 3W29A 1V6WA 2HK1A 1E71M 5M1TA 1KR0A 4MLRA 2Q3OA 4NX0A 3L66A 1FFQA 1R30A 3ARSA 1DJXA 3FEMA 1MZRA 2JF6A 3NDYA 4O0QA 4YS1A 2DH2A 4GIRA 3II1A 2C7FA 1VJIA 4MNKA 1GONA 4AWEA 2XFFA 2X1UA 1NWUA 3W6LA 1JCJA 3TROA 3TOYA 4ES4A 4NJIA 4I9TA 3QQWA 3VYLA 5RUBA 4JXCA 3SRHA 2GQ9A 3C2RA 1J5TA 1TV3A 3SCSA 3NQEA 1IV8A 1P5BA 2QIIA 4UOJA 1J4EA 1HX0A 2ATSA 2VCAA 1QRQA 1X6LA 2WM1A 3MP5A 1KLYA 4ADSA 3K1DA 1TV5A 4LOCA 4R7JA 2ZKMX 3ITOA 1K3UA 3W82A 4JKKA 1HIZA 1PKYA 4IM4A 4LRSA 1E5NA 1VPYA 3U2EA 1SYTA 3QV9A 5BOOA 3BGJA 1TTQA 3BLOA 1TR9A 1EZWA 4LWWA 4JIHA 2DZBA 3AISA 3FGCA 5BRPA 1K03A 1QI2A 2V5KA 3NWRA 4V1XA 4K7VA 1WXYA 4LY8A 2VC6A 1TTJA 3LZ5A 4V28A 5C7VA 1DWJM 2PDBA 4GVGA 3UZWA 3W02A 4DVOA 4DAFA 2WHKA 2PI6A 3GLCA 2W9MA 5D09A 4YXGA 5D38A 2XM1A 4NUWA 3REQB 1F07A 3S5YA 1N7KA 4Q3MA 5XINA 3S1GA 2O4MA 1GORA 3VIOA 5E0KA 4GE8A 2NV2A 3BLPX 4QLKA 3T40A 5CZ0A 3PHAA 4RW3A 1F74A 3RJXA 1OG6A 4G1NA 3AMLA 4GO9A 3NYZA 1XLEA 4IX2A 1D7FA 3ITCA 1B9ZA 1OB0A 2PE4A 3TOPA 4BQ4A 5IDIA 5I3IA 4H6KA 1EXBA 3CBWA 2A5HA 3UVAA 1XYCA 4UQDA 2Y1HA 3VFCA 3MUCA 3UCDA 1JR1A 1XSJA 4J28A 3URBA 3KX6A 2HJPA 2QCDB 5I23A 3FNDA 4QNEA 3WH6A 2VCBA 2D2OA 4RUBA 3NA8A 2CZVA 1JI1A 2XPKA 3DN5A 4HKPA 8CGTA 4NHVA 4LB3A 5HDRA 3VGEA 2BY0A 4OT7A 1KM5A 4PGLA 3SUVA 3BGGA 3GW0A 3T0BA 1CLKA 3W74A 3RPTA 1NF0A 4RE3A 3VGBA 3T9PA 4EE9A 3SCTA 3QLLA 1J10A 3RF9A 4IJRA 4WUIA 2GSJA 1HO1A 2VEFA 3A47A 3A4XA 1AZ2A 1TPVA 2A2IA 2VFDA 4G5DA 4LAMA 4R34A 1OIMA 2WXDM 4NZ5A 1BVZA 1LCOA 1AW1A 4XISA 4LQ1A 4B5VA 3E1F1 3PFMA 4NX5A 4PC8A 4OHQA 4HYRA 2WZIA 1L2UA 4WLCA 3WF0A 2Y0FA 1XYFA 1VBGA 3UXLA 1M65A 2Z4GA 3AJ7A 1MQPA 2PP3A 4M1BA 3RK8A 4D8LA 2QCFA 1E0VA 1UR0A 4KFPA 8TIMA 1H62A 5FKYA 1E70M 3G3MA 3O6DA 3F2CA 2CZDA 4AW7A 1HGWA 1W3HA 1PIGA 1G1YA 1UCWA 5DY3A 4HN4A 3DFSA 1HNYA 1BF2A 5BXRA 4C65A 4EPEC 3QPZA 2JK2A 1KCKA 4UR7A 3W1MA 2WQDA 1FHVA 5TD4A 4I6KA 2BLEA 5FJOA 3PANA 4M80A 1KGXA 1DJYA 3O05A 4RPQA 4MZ8A 2AL1A 2ZZ1A 1H63A 1QR7A 1XDJA 2J8TA 1V79A 3GIYA 1ZENA 1P7TA 3TWAA 3FHAA 3EX6A 4GWEA 2BY2A 1GG1A 4ZSTA 4J4KA 1A49A 3LXAA 1TSIA 4H83A 3QPYA 1K7XA 1C8VA 4Q4PA 3OIHA 1I2PA 1W3JA 1NDVA 2PTYA 4POCA 2OB3A 3BL3A 1BG9A 1H5YA 1E51A 2I7GA 3BLDA 1L2QA 3UY8A 2J24A 4NZFA 1F3WA 4MAZA 3DC8A 1JVNA 3KHDA 5BWAA 4PBEA 1JZ5A 1Q4NX 4KRUA 3UJSA 1LQ2A 1B3ZA 1UPMB 3N4EA 1TUXA 3ME3A 5AZ0A 3AIWA 1XLBA 3PZMA 2PWUA 4FP1A 3KTCA 1XICA 3WEOA 2OZ0A 4M81A 3W73A 4D72A 1YMYA 1K77A 4Z0JA 3IARA 3IK4A 4D6HA 2BGNE 2FHBA 5AHFA 4MPKA 2ZX5A 4UR9A 3GNDA 4ZO6A 1HVXA 3WQGA 2WSPA 2OQYA 1OC6A 2XIJA 4H9YA 4GO8A 3KOXA 3RGTA 5E9XA 4YN5A 2VDIA 3ABRA 3W00A 3PTQA 1RLDA 2DQXA 4H04A 2E5DA 3N9SA 3RX4A 2GUUA 5AC7A 1Y65A 2PFHA 3SZ8A 2VHLA 2GVLA 4W85A 2BHUA 1JZ3A 4JQAA 5HPOA 2X7VA 2CC0A 1TO3A 2BVYA 2PRMA 7CGTA 2PDYA 5HJYA 1S2CA 3LV5A 1ZUAX 4IJBA 2I1OA 3OZMA 1C7SA 2AKZA 1W17A 1IR2A 3DG6A 3VIHA 3MKKA 3CIVA 3IANA 3K13A 3LRLA 2C16A 3R8HA 3S42A 4GGBA 4NRSA 3SY1A 3EXRA 1ZU8A 5AYZA 1JD7A 2W66A 5TAOA 3W1AA 5C55A 5I07A 3W7DA 1Z6KA 3WD2A 2CETA 2WNQA 1B4EA 3ABOA 4Y8FA 2X1IA 3MSRA 5KSWA 4QAIA 1OEPA 3STGA 1XISA 1DQUA 3V3WA 5A69A 3WLLA 2PGFA 4FHAA 1VEOA 1VS1A 4AD0A 5AZ1A 1RJRA 4GNKB 3W71A 5K9XA 2YDAA 3UPMA 1FDZA 2E6YA 1X6NA 3CS2A 3S83A 3B9OA 4UFIA 1UWUA 1Q6LA 1OFRA 4PMOA 5T8GA 5CZKA 1XQKA 5C7HA 3EOLA 3CWNA 1O4UA 5DMYA 4Q8WA 4HK5A 2FVMA 3LB0A 1EJWC 1VCGA 2YCJA 3DFHA 1VB9A 4MAVA 1NELA 3GE7A 4D6CA 1H0GA 3SRDA 2AAAA 3TYEA 2FFIA 2OLHA 5FL0A 4QE4A 3LHTA 2HPIA 4ACZB 4WKFA 3RN6A 3SCQA 1KXTA 2GPTA 1OFAA 3H54A 3WFAA 3WF2A 1WKDA 1GPFA 1VENA 2WHJA 1W9UA 2DT2A 2DUXA 3W83A 4AZHA 4F2TA 3S4TA 4JX5A 3P81A 1TRIA 4AWSA 3TIMA 3WF1A 3IVTA 3CXOA 1NOWA 1J8VA 3DKJA 3PVFA 5E0FA 2IXUA 1JCTA 2PDNA 1D3HA 3A6OA 3GH7A 1RJQA 4EPBC 1TV2A 2P1FA 4L9ZA 2F2KA 3WH7A 3EX2A 3S1UA 1GVEA 1FKWA 3KE0A 3TMLA 3OQ8A 1SZRA 1QPNA 4J7RA 5C9WA 4M8UA 1J01A 1DEDA 1V8EA 4W89A 3OW1A 1O7AA 3HM7A 4A29A 3ICJA 4IXHA 3KFTA 3RMEA 4QRNA 2A3HA 4MM1A 1TUFA 4DXXA 2Y89A 3MI3A 4PCNA 4C6FA 1HKKA 2TMDA 5M03A 1TQJA 3LXCA 3UZ5A 1K9FA 2Z2UA 4W5UA 1T96A 3UEQA 2HISA 1UB3A 1EX5A 5HMFA 2D2JA 1MVYA 1WKEA 5DO8A 4HJFA 1XH0A 5FSEC 3CTTA 3PUGA 3L4WA 2XWEA 4PUMA 3WUGA 3HQNA 4Y9AA 1R2TA 2CBVA 1QI3A 1A4MA 3WMSA 4BJHA 5D9NA 4W5ZA 4F0RA 3QZAA 3B06A 4HYWA 1US2A 1OT2A 3PBYA 5E5CA 1NFBA 3BPWA 3BTNA 5CSRA 1KFCA 3F5LA 1HL2A 2DZSA 4MJ2A 3WQ5A 3HGSA 2NLYA 2PDWA 4A3UA 1G7UA 3KWXA 4Z1YA 4AZCB 2XTKA 3RJYA 3NQGA 2BASA 3ENLA 3EPMA 3FW6A 1XIHA 1FWBC 3VTRA 5I00A 3AU6A 2POZA 1ML1A 4ZCWA 3M6YA 5A6TC 4CU7A 4I7UA 2GJXB 3VINA 2VFEA 2RDTA 3GG1A 4F9JA 5J8LA 4JX4A 3TVAA 2XZ9A 4MNJA 1EEPA 1ESWA 1FHUA 3B8DA 2QUMA 4AD2A 2Z1KA 3CL7A 3URQA 1VIWA 3S5SA 3U4FA 4MNLA 1E6ZA 4IQLA 4B92A 4WHBA 3KXQA 1L6GA 3UXIA 2V82A 3ITLA 4DUXA 4DBDA 3PC0A 1RR2A 4EVZA 2ALDA 3AS1A 4KMQA 3DFTA 1E6NA 3MW7A 1UZHA 1SO6A 1LZOA 2QAPA 3GHTA 4KCVA 4AU0A 4CU8A 4PTWA 4GBDA 4UTLA 3T6CA 4HQVA 1MRAA 2C0AA 3GS6A 1UWQA 8RUCA 1JGMA 4I8DA 2Q01A 2JF7A 1GVYA 3ANVA 2GQAA 3VM7A 3N15A 3VGDA 3DECA 3F2BA 4C6BA 4ZQRA 1A0CA 1JUKA 3TYBA 2YX0A 1EWDA 2ZXQA 2QIWA 1YXCA 3G8RA 3N2BA 1XH2A 2CZEA 2NVCA 3RLHA 2OEKA 3SGUA 4WD0A 1S3TC 2VNCA 1UMLA 4O57A 3NURA 4PTVA 5BMXA 1IQ8A 2VENA 4QTGA 3KEHA 4QITA 4RZ5A 3W01A 3G1YA 5EYWA 4DJDD 4DHGA 2XFYA 2NUXA 4JOMA 1O1ZA 3THUA 1CIUA 3A24A 1ZTVA 3DHFA 4UZUA 1KXVA 2Q8ZA 2WCSA 3QLDA 4XKYB 5HINA 1SW0A 3QPEA 3S5ZA 4EPKA 2YW4A 2QCHA 4MYAA 1TE1A 6XIMA 1CB7B 4XAZA 2D23A 3BCDA 4MJZA 4Z2HA 4XAPA 2BWGA 5CCZA 3I7QA 4C6LA 4ZZ9A 3QGKC 1RP9A 5FACA 4P7NA 1WOBA 3UPWA 4JTLA 5A5WA 4GXPA 3SY5A 4Q8UA 2O9RA 3IGUA 3AUJA 3HPZA 1CXLA 3UQNA 4JYEA 2I5GA 1XLHA 3KVMA 4PUWA 2HXUA 3EPNA 2WVTA 3QKEA 6REQB 4JQ4A 4AQLA 3HGRA 4HTBA 3OO2A 4JNYA 3STEA 3N17A 4JTTA 2WNZA 4XUGA 2A7RA 2V5BA 3N6HA 1W31A 4QE5A 1UUQA 2V5LA 4CD5A 3BJFA 3F1QA 1A5MC 5A6BA 2WVVB 2J6VA 3D47A 3VA8A 2DZPA 4YU1A 1WQ5A 2X1SA 5AVNA 1VBUA 3W75A 4BHYA 1KV5A 3OQEA 4DF0A 2CLKA 4GYPA 3M7SA 4EX4A 4U31A 3GTFA 3AXIA 4U5IA 2OEJA 1YNPA 4RDZA 1K9TA 1OBAA 1NVMA 1RAKA 2DEPA 2HTMA 4IMCA 3RR1A 5C9ZA 1I2OA 1R2RA 3VOHA 4D2JA 5MHBA 4AD5A 3CZLA 4KETA 3WJXA 4NXSA 3SM0A 4AZ7A 1B3YA 3EDFA 3VOCA 3DOPA 5EGRA 2R9RA 2ZXBA 1VJZA 3EXTA 4HZ7A 4BQ2A 5C71A 3IAQA 3EDEA 4DZHA 5JVLA 2C71A 3ZOAA 1U33A 1MUWA 4TTGA 4I5XA 4CVUA 5TQLA 4GVFA 2WV8A 1V0MA 3FJLA 2P50A 1TE6A 5H1WA 1C8XA 1AMKA 4XQ6A 1TX0A 4HMNA 3MMUA 4HSHA 4DBUA 1W6TA 4JEJA 5FAJA 3G0SA 3S5OA 3HV9A 1UW9A 4E0CA 4FNSA 1PYFA 2CLMA 4KCUA 2PLCA 5FF7A 1HFBA 3UBPC 5A8QA 1IGSA 1QASA 4DJDC 4A21A 1AW2A 2V2CA 4PRTA 2A3BA 3BW3A 8XIAA 1T5AA 2PDCA 2J9YA 1NEYA 3ITXA 4MDPA 3R94A 4K68A 3NO5A 1V3HA 3KZPA 1R9XA 4CD8A 3NEVA 1R86A 4HJWA 2XSAA 2DH3A 4DJEA 4LUIA 3VNKA 2P3EA 1VFLA 1S3HA 1LWJA 1KRAC 3INPA 4P8VA 1QO2A 1XJBA 4GQ0A 4HPNA 4DM1A 3FN9A 2FIQA 3RIKA 4JTUA 5CZSA 4RXFA 2Z7GA 1E3XA 4NZJA 3UXKA 5C2CA 4DJED 2FPYA 4CEUC 4R5EA 4CLMA 1GVFA 1UZ1A 2F61A 4K1GA 3ATYA 4C5ZA 5B7ZA 3GXIA 3HB9A 3F2DA 4GA8A 4W8BA 1Q13A 3K8MA 4N4PA 4B5TA 1QK2A 5DCEA 4Q7NA 1ZQ5A 1R5YA 1DE5A 4B16A 2BODX 2OOFA 1SUXA 4X3ZA 3SQLA 3FXGA 4CQ8A 4ZL1A 3S5NA 1HG3A 3ARVA 2BOEX 4ACZA 4KIEA 4GABA 4J3TA 1TCDA 3KL5A 3UERA 3PP7A 4Y96A 4LVFA 5K4XA 3NQCA 3VPLA 4GY0A 3A13A 4A6GA 1FX6A 4FXSA 4TR9A 1V3IA 4TOQA 5TBOA 1TYGA 4V33A 5I3HA 1VBHA 3VD9A 1JZ7A 1UR8A 4IG2A 5CSYA 2HS8A 2EG7A 1Z32X 2VC5A 1KXQA 3U2OA 4R53A 1F05A 4Y9PA 4F48A 4N42A 3CQIA 2IPWA 3GAYA 1ZZMA 4XSMA 1U5VA 5JBEA 4GYPC 4KCWA 3QMTA 1O12A 3VM5A 3S47A 4ZOBA 5AB3A 1JZ4A 3WY1A 2VX6A 1DJNA 2TODA 2CKRA 4LS1A 1ITUA 3VDAA 3KBWA 4XAFA 3W37A 4R85A 3S6OA 3KM8A 5IDZA 2GVYA 4E8GA 1A5LC 1DPMA 1XLJA 3IGXA 2QGYA 4QDWA 8A3HA 4IL0A 5K3VA 1OFDA 1BYAA 2I5IA 1XXXA 3BAKA 4H8VA 3TSDA 4IICA 3CV1A 2Y2WA 1NWSA 2PDPA 4DJFA 3GO2A 2GDVA 3P5ZA 2W91A 1BQCA 1UJQA 2INZA 3VDHA 4JN8A 3W87A 1SFLA 4LCQA 1EDQA 1U1UA 4QDMA 3CQHA 3IJDA 4TX9A 1SR0A 4WDTA 3BQ5A 4DJFD 4F0KA 4HPGA 1QHOA 4S3KA 1EUAA 1FFRA 2CHNA 3HPSA 4AZCA 2DSUA 4JYDA 3TA9A 3GDKA 4LH8A 1LP6A 2ISDA 2E5CA 1FWAC 5EA9A 3NQ8A 1BXBA 2DFAA 4FR6A 1UPPA 1POJA 2Y4SA 4X61A 2GJXA 3ZJ7A 4DJEC 2CFFA 4HD5A 4NZ4A 3BZGA 1LLZA 1E9IA 3OVRA 2HNEA 1TJRA 3BICA 4RV8A 3T55A 2BVDA 3QHOA 4S3GA 2ACQA 2UWFA 4C6JA 3MI6A 4FZIA 3S8HA 3OB8A 2XN2A 1ZCOA 3C0LA 4HNUA 2WMJA 1WDRA 1RPXA 3ZLHA 3PTMA 1UR1A 3ZSSA 3A3WA 4KEUA 4NY2A 1DIDA 4PUJA 4O8RA 1SJBA 2VTFA 3S2JA 2GSHA 4LV9A 4ZMGA 5K2ZA 1PZ0A 1NOUA 1BSIA 1FRBA 4QJ5B 1A5BA 3LXBA 1DVJA 4V27A 5I3DA 4UFLA 4NJHA 2XVKA 3C3NA 3NQ6A 1ZJIA 3UA3A 5DELA 4UNLA 3LNMA 1W2VA 3GD6A 3N19B 1TVLA 2YFOA 4QP0A 2XYLA 1Z9AA 4MLJA 3G1HA 1BLIA 4P7OA 2WYSA 3VCRA 2WMHA 2X05A 1W1B1 2A79A 3O07A 1M68A 1UUOA 3W23A 5H8PA 3WJYA 3S9ZA 3FIGA 3R2GA 3PNUA 4HA3A 2XSXA 4ZO8A 3T4CA 4QNWA 2A3AA 1IWBA 2L5HA 4XIMA 5B7YA 5IOBA 4KH2A 4UOQA 3WBXA 2VEPA 1SW7A 3M46A 4L9YA 3W6MA 4XKYA 1EBHA 1EO5A 3N14A 3VNDA 2FKPA 2YDSA 3WG6A 1BFNA 1XIMA 2OGYA 1BWLA 2DZAA 1EL3A 3RM8A 3AWNA 2Y8KA 1X98A 3LRKA 2CNCA 3LI0A 3CQJA 1X39A 4GUJA 2WHLA 1FBAA 1YDNA 1P6BA 2FGZA 1H1NA 3W3OA 4JTKA 1XGEA 1K8ZA 3G24A 2D24A 3T2PA 4I9MA 4MUZA 1WKFA 3LD5A 1KM1A 3RM4A 1FCQA 6REQA 4DJFC 2EJAA 4NF7A 1ZALA 3G6MA 2YXOA 4JCLA 1H7NA 4MWAB 1UKOA 4N02A 5FEXA 4TVDA 1V02A 1PO9A 2XIMA 4G7FA 1JYXA 4LBRA 1OC5A 3FY1A 3T07A 1EDTA 4HOWA 5I06A 2XSBA 3W53A 2Z00A 3S9IA 5G1YA 1C7TA 3GNRA 2WVVA 3K4AA 4M24A 4IPJA 1B30A 1XBVA 3AMKA 2ZDSA 3MKVA 3EPOA 2XU2A 3AI0A 4NNAA 4WX2A 2QUTA 3EB3A 1O68A 1HJWA 4HZMA 1UKPA 1R3QA 3S9YA 3W2LA 1XIDA 2OZ8A 3RITA 5I3KA 4Y90A 4S3JA 1R9YA 4H01A 3STCA 3TSBA 4ILSA 4S3CA 4S3EA 4R7WA 2WWCA 3M0MA 3VZZA 3W7NA 4AIEA 3OA5A 3UXAA 4AIOA 1C91A 3G1DA 2OG9A 2WB5A 3GNOA 3AHYA 3K8LA 3C86A 3IUHA 2OMAA 5EFDA 2B81A 1FWIC 1V3MA 4HGXA 5AYIA 2ZUSA 1YPFA 5DY2A 4HHHA 3RM9A 4LAZA 4IPPA 3V36A 3H53A 4LEQA 6TIMA 5CC6A 1SFSA 3WNNA 4YYFA 1VFFA 2QUVA 1OCJA 1ELSA 3UD6A 3S2NA 1J93A 2XWDA 2W3ZA 3VMOA 3TYCA 1U1HA 4XD6A 2EF9A 2E9MA 3MWAA 4KKXA 3B9EA 3V0UA 2DGAA 3DUGA 2TRSA 5CPQA 2ZZ3A 4HU0A 4H8NA 2GL5A 4ZVJA 3BMVA 3GXMA 5HMDA 3MS8A 3W2NA 1OY0A 4LVDA 1EIBA 3ZVIA 3RMJA 4C7DA 3L21A 4QM1A 2V5CA 1US3A 4XK2A 1Q45A 4GZJA 3E0IA 4GUHA 1CGUA 3KLKA 3V35A 2WSKA 4WKHA 3TQVA 2DV0A 3A9IA 3HFTA 4AZ6A 2A3EA 5D2VA 3HQOA 4WKAA 5LIKX 1ZRQA 2W62A 3C3UA 4GK8A 3BWWA 3RO6A 2HV5A 1PAMA 3VVGA 2PDGA 5MKGB 1RD6A 1HUVA 1QBBA 3THCA 3CAWA 1PWMA 2VRJA 4IQJA 4GJ1A 1WDQA 3QR1A 5L6UA 1JRCA 1MXGA 3CLMA 3EYPA 1DWIM 1A4LA 4QQ3A 4S3BA 2X1RA 4UTFA 2ONEA 4LC8A 4MB5A 4FNTA 4XIAA 3W7IA 3N18A 2XDFA 3KCOA 3XISA 1M6JA 1FKXA 1MEWA 4CQ9A 2GGIA 3PZOA 1Q8AA 3KCJA 4GIAA 1VCVA 3C61A 5DF0A 5D32A 3H21A 3CO4A 3AMDA 3EWXA 1ENUA 4HN8A 4U5KA 2OU4A 1GJUA 3L68A 3CT7A 1D8CA 1Q7ZA 1XP3A 4ZFCA 1V0LA 5CLWA 4BFAA 3WJZA 1XG4A 3RDKA 3QXBA 4PN2A 5LXEA 1TIMA 1Z89A 3DFPA 5AHEA 3LCLA 4QFUA 2A85A 2GFTA 3VABA 3QY6A 3ZR6A 3UYCA 4GQQA 1DXEA 1FHLA 1XD1A 1X96A 2BY3A 1BGAA 1XLIA 1EZ2A 1OX5A 4HZ6A 1KFJA 4EKJA 1Q6QA 3TXZA 4HNOA 2B7OA 2Z1XA 2FQIA 4JFUA 4GYKA 3C56A 2ZRVA 1R3RA 2TAAA 1C92A 2YL5A 4HVXA 2PLKA 1SO3A 2WKLA 1JUBA 2R82A 4DELA 4O10A 3GFXA 4O28A 1KR1A 3BAIA 2VC7A 3R8RA 2ZYFA 1XIIA 4BQ5A 3RYSA 4M6UA 1JCYA 1QOXA 3CJPA 4HMDA 2G50A 4U4MA 1S2TA 1NDYA 3WQVA 4QEEA 2J4GA 3ITYA 4C91A 2EG6A 4HPJA 2FHFA 2PP0A 1AH4A 5IXEA 1LJYA 1D9EA 4ZQMA 5JH2A 4PCPA 3SB0A 4CD6A 4DXVA 3EWDA 3GDLA 2VZTA 1UUMA 3DCPA 3BG3A 2BG5A 2J8FA 1JEZA 1G4PA 1UZ4A 3P6LA 3U2CA 4WQ6A 3SBFA 3Q37A 2QYGA 3G0XA 2YYUA 3T44A 3KLLA 5C2XA 3TW6A 2XINA 3WN6A 3WDJA 3DYMA 1E9ZB 4FK9A 1EXPA 4PMZA 4GY7A 2VCCA 3E2QA 2DT0A 4Q8VA 1XLCA 1ICPA 2VFHA 4QS6A 2XG9A 1TKKA 1O60A 2V30A 3T81A 1UKTA 3S1VA 3F4CA 3TTQA 3QSRA 3ZJ8A 3APGA 4H6EA 4D1JA 2GUBA 3ES8A 3B8UA 2FJKA 2RGMA 2ZUWA 2AAMA 3BQ6A 3P82A 5AVHA 2NT0A 5KZDA 3LK6A 2V0TA 4KBXA 3MO7A 4JFTA 1P0EA 1GVQA 4JYFA 4K1WA 3VIFA 3C6CA 1UWRA 4A4AA 4QAWA 2DIEA 2MNRA 1YTKA 4LC6A 4EWND 2X09A 3GYCA 3PZUA 3N6QA 1RK6A 1OGGA 4Z2KA 3BSGA 4C6MA 3ARQA 3EBVA 3D3AA 1QPRA 3LS9A 4MUPA 3QR0A 4IOTA 1V6VA 4AD3A 5I7GA 1ONRA 4OTKA 1ADDA 4O13A 4M19A 3CQKA 4RKAA 1RCQA 2WPBA 3TMQA 3U9IA 2UY3A 4YTRA 1UD4A 3O06A 2DW6A 3LCIA 4NNBA 1F3XA 5A6MA 3OU8A 4HZ8A 3TJ4A 3N73A 3GDRA 4DQWA 1XLKA 1H3GA 1E0XA 4JTIA 2DZUA 1TPEA 5D2TA 4XBKA 1SGJA 5I78A 1OZMA 3UA4A 1JPIA 1JULA 4GJIA 3HG5A 1SZEA 1VIZA 2EPKX 1DP0A 1EJVC 4HP5A 1NFPA 1RD5A 2HE8A 3CPGA 3ZMRA 3OOQA 2PURA 3WFLA 2NQLA 3FDGA 5BXSA 1A3XA 1NSJA 2QEZA 3CV2A 4FXJA 2OWWA 4NL1A 5KITA 4O4VA 1UR2A 3AYSA 4RNFA 4AUBA 4CN1A 1RJPA 2WO5A 2C14A 3HGOA 7ODCA 2QHAA 3VX1A 3QEZA 2YBVA 1KXHA 1PKMA 3PZTA 1GTHA 1C8YA 2ZE3A 1DWHM 2X2YA 5F4SA 1JAEA 4AZ5A 2PWFA 1FP9A 4MWAA 4KWOA 2ZA3A 2E28A 3ITTA 1ZP4A 4KQNA 4C6DA 1I0BA 5XIMA 2J7CA 1EBGA 3DC0A 4LS0A 3EXSA 3S2CA 1JZ2A 3UJEA 2BHZA 3AYTA 2YCKX 3NSNA 4ZXOA 3U7BA 3ABQA 1Y0EA 2CHOA 3NQDA 1BQGA 3S1WA 5BRQA 4M29A 1O5XA 2IKHA 4OJYA 2QGHA 4GNVA 3VXGA 1QOQA 2FLIA 2RH9A 3UR7A 3DHUA 4G56A 2WJZA 1CECA 6A3HA 1V7AA 4L80A 3DX5A 2VDHA 2DUZA 3VIGA 5CAHA 2A4AA 4LYKA 1FCBA 1KM0A 3NL5A 4I90A 1ZY9A 1PDYA 3FX4A 2GK1B 1WA3A 3CV7A 4KGJA 3MUXA 2QJIA 2ODOA 2PWHA 1PBGA 3MVTA 3KDOA 4LVAA 4NP7A 4AEFA 2VGBA 3NEHA 1W56A 1R3SA 4FNPA 4TTUA 4UQCA 3W1UA 1B2YA 3WZ0E 1GVIA 4IUGA 3VOJA 3L4TA 1TVNA 3VDCA 3FV9A 2QAFA 3DBNA 3VE9A 2J62A 3WL1A 3MKCA 1R7AA 3TH6A 1I60A 4GPNA 4O8AA 1W2PA 1NARA 3G77A 3PF3A 3IAPA 4G1KA 1BWKA 1PX4A 2WOQA 4I9AA 3N11A 1UQYA 1XSKA 2PWGA 4NZ3A 3P8IA 4NQ1A 5AFDA 2QS8A 1VFUA 1LYXA 1ZBCA 1GYNA 3V5CA 1EGVA 1ISZA 1OGBA 4KFOA 4ORMA 4YJ5A 5AYBA 3C0QA 2ZX8A 4BZYA 2F8QA 3G1SA 1RZMA 3EDDA 4HSNA 1EB3A 4F8XA 3IJ7A 1N82A 3T78A 4B90A 4MJMA 3BLEA 4CCDA 1Q2SA 1XWYA 3NZGA 3OBKA 4PRRA 2D69A 4UUIA 3RHGA 1FWDC 1UMYA 5HK4A 1OSEA 1CGTA 4R9XA 2PS2A 1VYRA 3T09A 3CH9A 3BLKA 3AIRA 2R1NA 1U22A 2CESA 4PUEA 4DRSA 1VCFA 1U1JA 3IRSA 4CNUA 4AEEA 4AZIA 3R0UA 5BOFA 4H7VA 3O6YX 3K4DA 2YW3A 5MKGA 4BF9A 2JKEA 2ICSA 2CBJA 3M5XA 1YXDA 4Z17A 4NAFB 4CVWA 4H9MA 2ISVA 1HJXA 3RPMA 1U30A 4LS2A 4K8GA 4MNMA 4GI8A 1PVNA 2IKJA 5D2XA 3NQMA 4A8NA 3AS3A 2ZZ6A 4F0LA 1LRNA 2EPHA 4E6MA 3SN1A 1P0BA 4Z1CA 2PGWA 3BO9A 3LYEA 1XIBA 3H8AA 4MVAA 4NIRA 3EWZA 4L6DA 1WXJA 2ZRYA 1A5OC 4NAEB 3W1LA 4Z1AA 1KWKA 2HCVA 5EMJA 1W5OA 3D46A 1V0NA 2CLPA 4TUFA 3K5XA 4JTJA 1IIGA 1OD8A 1XRTA 1HF6A 3ZLFA 3T0DA 2J74A 2C8NA 4RL3A 2OZ3A 3MSDA 4PEKA 1QPQA 2DPEA 1A5UA 4BF5A 3IGHX 2DQWA 3TZFA 2WSYA 5LYRA 2AMXA 2AL2B 3B9NA 4IPLA 4Q4SA 3MT1A 1NJJA 1HN1A 1E1CB 1KTBA 2IKIA 1ZB5A 1FWGC 3C2YA 5EBUA 5EL1A 3QR3A 3CZ8A 2GOKA 2BB0A 2WZMA 4MIMA 4LGXA 2H90A 5HPCA 3SDOA 2Z1WA 1JUEA 3R89A 1DJWA 1R3VA 3WQDA 4DPQA 1O6IA 1FWEC 1VFMA 5HUOA 2YA0A 3N25A 1YNYA 2PLMA 4GCXA 1Q4WA 4IGMA 4GBUA 3R25A 1TELA 4YVPA 2XGIA 3SADA 4D9PA 1H4PA 3N04A 3WKZA 2NV1A 4N0RA 3TTYA 4E3VA 3USBA 4PB3A 1OK4A 3LHZA 1JIBA 5DCBA 4YCOA 2Z2AA 4B5WA 2DVUA 2O9PA 5D8WA 1JDEA 1XCWA 2REQB 2ZUTA 4U3AA 3QC0A 4W88A 2GGEA 3AIEA 4AF0B 2FVKA 4AWTA 1J0ZA 2JIEA 2PWVA 2ZA1A 1FHDA 1OCNA 2EAWA 3G1AA 3TTOA 4UNKA 4WJEA 4WR3A 1K02A 2X16A 2BV9A 3B0VC 4ZB2A 2PTDA 2OELA 3BJSA 4FS9A 1VQTA 3JUGA 4IIHA 4C6PA 1CBGA 3C2VA 1TWDA 5FJRA 1M1BA 2VR2A 3GHSA 3OYXA 1CXHA 1XBZA 1PTGA 1X38A 3T05A 3PJXA 1MW0A 3U4AA 1A53A 3WUFA 4OV9A 1IEIA 3AICA 2EEXA 3CK5A 3UG8A 4J3WA 4AZBA 2V67A 4MOZA 3U8GA 2YCLA 4B2DD 1EJXC 3MI2A 3O16A 3N29A 3H7RA 4LAKA 4D6DA 3PZVA 2X30A 4M6VA 1F5ZA 2WKJA 2E9BA 2P0IA 1GQIA 3NZQA 3PBWA 1P1MA 4HCDA 5IHSA 5A8OA 3LBOA 5C9XA 3GRIA 3ZR4A 3TR9A 2VGIA 3CZJA 1ODZA 3V0SA 3CWHA 3WH9A 4M0XA 3QV6A 1SO4A 3GDMA 4HNCA 1QVBA 1XLDA 4Z2JA 2A0NA 4TMBA 2NT1A 3CEUA 1LWIA 2UZ9A 5BYWA 2FTYA 1SZGA 1QT1A 1V7YA 1GOOA 3OJGA 2EPMX 1E9YB 4J27A 4GG9A 3AHVA 3GXNA 1TPUA 4GKLA 4FX7A 1TX2A 4J35A 3A12A 1NFGA 1TMQA 3T1GA 4PMUA 1T0OA 3NVTA 4EK7A 3M07A 4QXIA 1SFTA 2RHGA 1TTPA 4V15A 3QTGA 2FFCA 4MF4A 2PCEA 1XYBA 3PAOA 3VFLA 5D30A 1BTMA 1Q3NA 3R0KA 2DJXA 3TCEA 3W1PA 2H3BA 1JI2A 1LLOA 3WBWA 4HT3A 2Q02A 3GX9A 4IIBA 3VC5A 4I5RA 2ZUUA 4AHPA 3HZ3A 1W3LA 4HMEA 4YPJA 4XB3A 3N3MA 4W8AA 3WLTA 3WX7A 2WNNA 1FWRA 5C70A 2PP1A 5F1UA 3ZO9A 1NY1A 1OM0A 4H9TA 1LQAA 1ME8A 1JCXA 3OIXA 3W76A 3CB3A 4NZ1A 2CXEA 5DT7A 2F7FA 5DQPA 2BOGX 3L0GA 4DO5A 4LUSB 1ONWA 2VD9A 2JQXA 3A22A 1IZJA 1UH2A 1J9YA 1VFHA 3PSVA 3Q2DA 1O66A 1RBAA 4F2BA 5H91A 2PDQA 1MXDA 3ELFA 5EBAA 2J7FA 1MQRA 3QFEA 1ZP3A 5FF0A 1BKHA 1A5AA 5E70A 3CHVA 3S0CA 3R1ZA 1KKRA 2C18A 4Z0SA 3PPFA 3FYOA 1UP0A 5I3FA 3EB2A 2ZRUA 5HUPA 3CHFA 1SZNA 3QBUA 2VGFA 4J3XA 4D1IA 1UKSA 4JTFA 4REQB 4UTTA 3VGFA 3TONA 3OBAA 3H55A 4JR5A 1V3KA 3NO3A 3LX9A 3W2UA 4Q4OA 1MEHA 1PZ1A 2P5NA 1XI3A 4LU0A 1GTEA 2OXNA 4GCAA 2DSWA 1S2VA 5EU9A 1E6RA 2FZ8A 1LG2A 1V0KA 1D7KA 2SFPA 4CUCA 1UOZA 6XIAA 1RCXB 2FDSA 3TWBA 1XFBA 1GZ1A 1CGYA 1M7OA 3BV7A 1IHIA 3L23A 1HVQA 1SJAA 2VEGA 3TSMA 1TPFA 1YX1A 1YPXA 2V69A 1CEOA 1K7FA 2W92A 1TRDA 3WLIA 2GK1A 2QUNA 3O7UA 1I1WA 1DHKA 1ZJHA 1B0IA 3NZ1A 4HU4A 4ERGA 1ZSXA 3EB4A 1IEXA 4LBUA 5IRPA 4UFMA 4LW7A 2AGTA 3WLPA 1A0EA 2VX5A 3LGGA 4DWSA 2ZVIA 1MDRA 2WMIB 3H2FA 3WD1A 3E5BA 1DTNA 2PWEA 4LRTA 3I10A 1YNQA 2JIWA 4DZAA 5DMNA 5FJPA 2Y5EA 5E6ZA 4Q4QA 1OD0A 3TJLA 5HR7A 1A80A 3UR5A 2VXNA 3M6DA 3CUGA 1K8XA 4ONVA 2QDEA 3NQBA 2V3GA 2HWGA 4TIMA 4L65A 5FD0A 4DWSD 1YEYA 1EGZA 1UWTA 3AWOA 4GNJA 3HIJA 3AXKA 3H12A 3EAUA 2NXHA 3NDOA 2PA6A 4ADUA 1KM6A 4PA8A 4PEEA 3I68A 1CZ1A 1WPCA 1G7VA 3VI2A 3MMWA 4WEVX 5PTDA 3EX1A 1M41A 3T0AA 7XIMA 1YDVA 3DENA 1EGMA 2ABAA 2NSXA 1C93A 1B3OA 3E02A 3TU9A 3CUZA 1OZQA 4ZB5A 2I5QA 3WF4A 4MKSA 2E77A 3AYRA 4JTGA 3QSTA 3OA3A 5KZEA 3SR7A 4ZENA 4DX3A 4R3UA 4DF1A 1H11A 2D0GA 4JBRA 2P3ZA 3BW4A 4H4IA 4H6QA 3L5LA 5CG0A 4DWDA 4D6IA 3MP3A 2G37A 2J13A 3NOEA 4R88A 1T40A 4HCHA 3CTLA 1ITQA 3SIMA 2QPSA 1GUVA 3CUFA 1JG9A 4ZTXA 5HATA 2BP1A 3PBVA 4AX6A 2X0SA 4KEZA 1AMYA 2NQZA 4KRTA 2D0HA 4QX4A 3OGRA 3SJNA 5HXMA 5CPOA 1P0NA 1P48A 1W0MA 2A3CA 2BOFX 2O9TA 2XIBA 3QOKA 4OGZA 4M82A 4O19A 2YZ5A 1ZAJA 3DZ1A 4LAUA 5HBFA 1OF8A 4ZGYA 3SUWA 1F6YA 1K9EA 4NAEA 5KTLA 2YSWA 4X0NA 3WK1A 3BAJA 3UWYA 4QCFA 5CEWA 3PULA 1EC8A 3ANYA 2PDKA 5GVJA 4PMVA 2YCEA 2W63A 4FSAA 4HU8A 3BE7A 3NG3A 2A1YA 1K4GA 2RDUA 1TZ7A 1XIFA 1EP3A 2O0TA 2O7SA 3ARXA 1KFKA 3FCPA 3MBDA 3IACA 4A3QA 2FZNA 3H2OA 4GZEA 1E1CA 2OKTA 5H2ZA 5H8UA 4Z2GA 3A5FA 1S2AA 3FLUA 4GY1A 2E7FA 3RG6A 3AHZA 3UW6A 3NXFA 1YHTA 2XGBA 3OHMB 4HA1A 4JGDA 1WP6A 4UQ9A 8XIMA 4GOAA 4P5UA 2WWDA 1NM9A 2NQ5A 3MC5A 5DMMA 4GC4A 4DI8A 1FY6A 2FB3A 3V18A 4UTWA 3B04A 3IJLA 4IIFA 2C0HA 3S6DA 4N9EA 2ZX9A 4P2VA 4RK8A 4MGGA 4OKDA 1YDYA 2XHYA 3DU0A 4IIDA 1AJ2A 3CEPA 4DWSC 3BAXA 3GR7A 2C3ZA 3WDHA 2DZXA 1XIGA 4J1OA 3PG8A 4IFOA 2WKGA 4C1LA 2DSVA 2REQA 4IWWA 3SRFA 3WQWA 3GQYA 2PRHA 3WLNA 4UTKA 3RRXA 2VEMA 2Z25A 4AF0A 3W1TA 2YOCA 1XL9A 5EMYA 4FXRA 2EPLX 3DBPA 1ZAIA 4QBXA 2XGZA 4O4WA 2KZHA 4YWSA 1XKYA 1Z44A 1TJ1A 5EMMA 1QJWA 2AMGA 2AQOA 1LL6A 3AC0A 1YLVA 4WZHA 3AS0A 1GOQA 5HJXA 2ACRA 4YTUA 1V08A 4O1FA 3L2IA 1POKA 1XX1A 5K9CA 1JXJA 1OCQA 2WQPA 3OG3A 4WDWA 2MANA 3KW3A 2VM8A 1F4AA 2Y61A 2HPMA 3DFYA 3EWUA 2X41A 2G5WA 3E2VA 1JYVA 1EX1A 1UH3A 4H2HA 4CN6A 1PJ9A 2C91A 3ANUA 4P61A 3RRAA 2DIKA 5GPRA 4C6CA 1M04A 3PJWA 4W7VA 2AKMA 4NYYA 1TPDA 1IIHA 2FDMA 4L5ZA 4ZOCA 2G4FA 1G94A 3M1ZA 3P84A 2ZZ7A 3LSBA 3TAKA 1R3TA 2IMRA 4PCFA 4BI7A 3R13A 2WAGA 4JNZA 2C1HA 5GJNA 3Q94A 4UMBA 1NOFA 3CPRA 1R87A 3QF0A 3GR8A 2WJDA 1VRXA 4L6HA 4BQ3A 1EOMA 4HCLA 3KVJA 9XIMA 3WENA 1N8WA 3Q58A 2NX3A 1PX8A 4PFHA 2VWTA 3DG7A 1Y5XA 3POHA 5IHRA 3S6TA 3APYA 3KBNA 2ZIDA 2F2HA 2W0UA 4GMEA 3CHCA 4PZVA 3SRKA 2PGRA 3FKRA 3TJIA 3KTSA 4ERAA 3BUVA 5CGQA 2HK0A 1U5JA 4LEFA 2QULA 1ZNNA 2XVLA 1B4KA 1DIEA 4TU1A 3WLOA 5M3WA 1KM2A 2QPXA 3M0ZA 1R3YA 3AFBA 3UPBA 3AAMA 5CKSA 2G8ZA 1I8JA 2QT3A 1IF2A 4IZGA 4MPQA 4JZ5A 2J8GA 1K8CA 2H8ZA 3M16A 3W1NA 4E4FA 4AD4A 4Q4RA 3W7HA 5AECA 1E0WA 3W7LA 3M0LA 3NPVA 3ORWA 1RK5A 3GIQA 1HJQA 3KL0A 3B03A 3G1FA 3H4XA 4UXDA 1V51A 3CV6A 4M7TA 3LPFA 3HBLA 4F0HA 4LCRA 4EXBA 4UTWC 1KGWA 4DLMA 5FL1A 4TX6A 3EOEA 1DE6A 1F73A 1N8FA 1GOKA 2GJNA 1VBJA 1LT7A 3WCZA 4IX0A 1TZZA 5HMEA 4WOQA 1W5MA 2YKKA 4LUSA 2QVNA 1KFEA 3VNMA 5H8MA 1KQZA 1WDDA 3UWVA 5HWJA 3GVGA 1K6AA 3IJ9A 1QW7A 1GQNA 3SCUA 4HNLA 3MYPA 1YTDA 2NV9A 2YR1A 3M47A 2H8XA 3LG3A 4YIWA 3F5KA 1EHAA 1YE6A 3ARPA 4AIBA 1J11A 3E0FA 1FH7A 4QJ4B 4C6NA 3LLXA 2I16A 4KWSA 2ZE0A 3BANA 2D1ZA 3WQPA 4MY1A 2YPIA 1MW1A 2QCGA 3UJRA 2FVLA 4D6JA 2QDHA 1Z69A 2PDXA 4UNIA 4REQA 1JF5A 1KA9F 5D03A 1SPQA 3PBGA 2UY5A 3IWPA 3UETA 1XM3A 1M3UA 1CTNA 2WHMA 1W5PA 3WEZA 5I5RA 5CSSA 3WL0A 1LRQA 2PCQA 4JQ2A 1KM3A 3FAWA 2BVTA 3WUEA 1JCNA 2D73A 1B90A 3SCPA 3VGGA 3KWSA 4K36A 4HHMA 3CB8A 2QW5A 2VJXA 2W79A 1X8FA 2R1LA 3LUTA 4WDUA 3WLRA 4DNMA 1O1HA 4N9CA 5HANA 5DT5A 4W9TA 3W1QA 3L4UA 1EYWA 3M44A 4UTMA 4JTSA 3WO8A 4QISA 3EOUA 1Q6FA 1GKRA 1TJ0A 5CJMA 1RVKA 1FXPA 2WMIA 3MZ2A 9XIAA 2GDUA 3MCNA 3PB0A 1HZYA 5KEZA 2G0WA 3CAQA 1P0DA 1DJZA 2D0FA 3W2JA 2B4GA 1W9VA 3R5EA 3GBEA 5AOUA 1E0UA 1H50A 3R0DA 1TWSA 6CGTA 1G69A 1SW3A 5GJPA 1TVPA 2A7NA 1A5NC 1TG7A 1Q8JA 4JIPA 4C6IA 1OABA 2BBFA 1VZWA 1J12A 3RPDA 3M5VA 3LERA 1Y5WA 4KESA 3S1XA 3QM3A 4JY8A 5HR6A 5DBUA 1WAWA 3RO8A 1KCZA 1WZKA 5XIAA 5EMLA 1T8QA 1X1ZA 3AIUA 3GYEA 1TZ9A 2W67A 2YBTA 5FCZA 5HNUA 3MCOA 3U7VA 3WQEA 1IGWA 3IPWA 4MB1A 3PBMA 3H24A 1W1TA 4J2PA 3CASA 4OBRA 1JCLA 3VD7A 4KS0A 1AD1A 4CD4A 3AHXA 4QSFA 5A6LA 4D6GA 1YIXA 2QV5A 3WDIA 5G4WA 1OINA 7ENLA 4O1CA 4IF2A 1XYZA 4YMZA 4X2RA 3ALFA 2WSRA 2QPUA 4L1GA 4LVBA 5D05A 3TW7A 2YGYA 4DYEA 2XM2A 4I6VA 3FHQA 4CNOA 3PPCA 5AHNA 4LVGA 5FEZA 1BEUA 4KEVA 3UY7A 3VKCA 2FGBA 2P10A 2B7PA 4HU3A 2IUZA 5KMYA 1LBMA 1EWEA 4HNVA 3NZPA 3LTSA 3SURA 2OFJA 2PF8A 4UQEA 1XLAA 3UZYA 2D3LA 2QCCA 1QI4A 3VOFA 1BTCA 1WCGA 2EQDA 3KOYA 3W1XA 1LBFA 3FOKA 1WDPA 2XVPA 4YLWA 2CWXA 2QV4A 1HJUA 4J3SA 3SSJA 4CGTA 4JTAA 5F4XA 4D71A 2QF7A 3CHDA 4L1WA 5FAGA 4H8HA 2ZQ0A 1PS9A 3IGSA 4QEHA 2Z26A 2OTDA 2IQ0A 2V81A 4AZGA 4HOXA 4AX7A 4OBSA 1J5SA 1DWFM 4Z08A 3SY8A 1V6XA 3CUIA 1VAHA 2E4TA 4LBSA 4TX8A 3A3XA 4I7WA 3WLHA 3ZZ1A 1N8IA 2VELA 3A4JA 1IZCA 4J9JA 3U3HA 4E8DA 4LY4A 3VKAA 1B9BA 2G95A 3SN0A 4MFDA 1PIFA 2OO6A 4ZODA 1AJZA 3FSTA 2I14A 3I7RA 4X22A 3T42A 1H1YA 2CEQA 1C29A 5LGXA 1F6KA 2HRWA 4E5TA 5T26A 1E6XM 2ZTKA 3PPHA 4M56A 4X0VA 1E6SM 2OZTA 1JD9A 1YKWA 5EMUA 5LXXA 1W8SA 5HQMA 4E3TA 3L2MA 1RH9A 4MTVA 2OSXA 1OFBA 3LHUA 4Z2IA 5FSDC 1AVAA 4ICNA 2YDRA 5E1QA 4IG2B 1OX4A 4C5YA 2Y7DA 3U6WA 3QVQA 1GHSA 1GQLA 3ARWA 3G6LA 3RX2A 3G8EA 3N9KA 5FJTA 3AXXA 3MYOA 4LALA 1VFSA 2PTWA 3F4DA 4FF7A 1OJXA 2FB2A 1W1A1 1EDGA 1KRCC 1WE5A 4JKMA 3OLDA 4XVEA 4DIAA 2E68A 4C7GA 1PIIA 2ZZ5A 4TVUA 1V6UA 4EXQA 1Z7AA 2HROA 2OODA 3UJ2A 3W7JA 4QHRA 5C6MA 3W4RA 4LUJA 2XFWA 4ATLA 2GQ8A 4H9VA 1H5VA 3EX4A 3DGBA 1O5RA 3CLWA 1QXLA 4GYJA 5I3JA 4F66A 3GG0A 4FA3A 3I4EA 5I77A 3CZKA 1MSSA 5BROA 1XCFA 2FHCA 4IUOA 4NJGA 1HKVA 1KB3A 3STFA 1EHNA 2CZ5A 1S39A 4RXGA 1KW1A 1YBQB 1SSDA 2CWNA 3IUDA 4DBWA 5DN1A 1PWLA 3PK7A 4JL2A 5DFAA 1GOXA 4EF8A 4QROA 1ECEA 4US5A 4JHZA 2WCGA 4YTTA 1HJVA 1KKOA 2R24A 1PZ2A 2HZGA 3TFCA 3TN4A 3O1NA 2CPUA 4H41A 3T08A 1H7PA 4LYRA 1QWGA 3NTYA 2YL8A 4RNJA 1GNXA 4GISA 1V6YA 3B8TA 3KBVA 3EDJA 3F4NA 1TJ2A 4US5D 4HNTA 2PEVA 1JFXA 3WNMA 4PCSA 4JN7A 3WYZA 3M0KA 3FVMA 5B80A 3VE7A 2ZICA 1R9ZA 3OBEA 4Q6JA 2EKCA 3TLLA 4RX0A 2D20A 3V4BA 2VRKA 5ECUA 1QU4A 3LCHA 1CGXA 3GIPA 1OX6A 1GZGA 3W7QA 3O0KA 4EAYA 4F79A 4A35A 1T99A 3WUBA 4G8TA 3POCA 2WVSA 3BJTA 4ZQPA 2DSZA 5CPSA 5CGTA 1W1ZA 4G6CA 4J3UA 3OVPA 3TV8A 3KZSA 3GFYA 3GTNA 1RHCA 1F6PA 2GGJA 1TMHA 2YZRA 4PSRA 1XW8A 1E15A 5LZLA 1MFUA 1R46A 1S5WA 1UZDA 1HKIA 4AMCA 2W6RA 1R7OA 2XN1A 2W61A 3KOZA 1TA3A 2W27A 2VZUA 1V4YA 2Y85A 4DJDA 2X0YA 2P88A 3UJFA 4CQCA 4NKCA 2PRLA 1U83A 1XF0A 3M0IA 4FR1A 2OR2A 3WELA 3E2SA 1WB0A 1S1RA 3NYDA 4GUIA 2ABBA 2D22A 3NJ3A 1XRFA 3CZEA 3KP1A 1QPKA 3E38A 3W7EA 4DZIA 2PUZA 4JAWA 3B8SA 4R7OA 1HP4A 3M4HA 3CM4A 4RE2A 1M7JA 4H19A 2GJPA 4YTQA 1AZ1A 4DN1A 1OHLA 2XH7A 3BURA 4JY9A 3W84A 2P8BA 1ITXA 1ZFJA 2V6AA 4UFHA 1UC4A 1F8IA 1REQB 1ZLPA 2V63A 3HN3A 3UZXA 1S38A 5DRCA 1X8CA 3LTPA 5BMWA 1UR3M 4RV3A 3QC3A 4YHEA 1KBLA 4B5NA 3OYZA 1KGUA 4NNCA 4BY3A 3DH7A 5HWNA 1DOSA 1QPOA 2PU0A 3P60A 4IMDA 4D8ZA 4B91A 2RFGA 4WF7A 4OFCA 3E6EA 1XR2A 1TPC1 2J7GA 5FEWA 1PSCA 2V5DA 3HQ1A 4F2UA 5A6AA 1VFTA 2P53A 1JNEA 1RCOB 2G3IA 1E56A 4H6RA 4IQEA 3PNZA 1WYIA 1CT5A 5D2WA 2HDJA 3EMQA 1W9PA 3TK7A 4XV0A 1BYCA 2DP3A 2YB1A 1NDWA 1S5TA 1E73M 5LHFA 5DXXA 2VDGA 1Q6EA 4O12A 3WDPP 3TAOA 3UU0A 3N3TA 4BA0A 4LNYA 3MZNA 1W54A 1B31A 3OLGA 3RLVA 2QCEA 3UG4A 2IS7A 2R14A 4ACYA 3IVSA 4M3PA 4N7QA 4HHPA 1L0PA 1GVOA 3H2NA 1MRQA 4OWGA 3VUSA 4PSPA 3HURA 1HL9A 4I5UA 2HVOA 3FJNA 1ALDA 4Q8OA 3N12A 4RDVA 4N2YA 1Q6CA 4GXMA 3LI1A 4H9XA 1RY0A 1WNOA 2W5FA 1XKJA 1PUDA 4ROPA 1BPLB 3CGTA 1QUMA 2XFRA 4OECA 2D2GA 4O53A 5J5DA 4DEFA 1EYEA 2PAJA 3WH8A 3NSXA 2ZUMA 4FOUA 3LY0A 3LHWA 3AU2A 2G3MA 2DT1A 3IJIA 1W9DM 1MUCA 3TCSA 4ZEPA 4ECLA 3ZSTA 1ZHAA 4H2CA 4A05A 5CC5A 5E9AA 1E5JA 5C54A 1RV8A 1AW5A 1UIPA 1FWFC 3E0LA 5GNXA 3ZT5A 2PD5A 1NP0A 2WSQA 4G7EB 3G0UA 4PBFA 4EAMA 3L67A 2UV8G 3JW7A 3B4YA 2VFFA 4XX6A 4CKQA 1OCBA 1OC7A 4JDBA 1WUFA 3B0YA 4AH7A 1XQLA 1JQXA 3OLIA 3BV4A 3B8IA 4ZQOA 2QDDA 3QQ1A 1I9CB 5T91A 4FNQA 1UBPC 3G1XA 3BK0A 4N9DA 3H4WA 1W37A 4DO4A 3ZFHA 2QNEA 4UQBA 1EOKA 3NVDA 5G1MA 2OLAA 1XUUA 4B3ZA 1KRBC 3M64A 3KOFA 4DZ5A 4RDWA 3NGJA 3I3BA 2X2GA 1V6TA 2UY2A 1YADA 2WCAA 1RXOB 3Q65A 3VDBA 3AXHA 5ENLA 4HTYA 2BX7A 4YVXA 3NPUA 3WJWA 2GGHA 3G2GA 1SZFA 1F3TA 3GB6A 4B15A 1J0IA 2WC3A 3R58A 1TV8A 1WBHA 4PMRA 1L6FA 3G22A 4UIOA 4YL2A 3SW6A 1LL4A 5DBTA 1DBTA 3LLDA 1W5NA 5ECVA 3UNDA 4HOZA 1GYLA 3ITGA 1ZL1A 3B3DA 3FAXA 1VGAA 2BSLA 4RR4A 1GZJA 5IBXC 3SIZA 3ARUA 1HW6A 4INFA 4AYGA 2WC7A 3SCOA 3O6AA 3RCNA 2ZZ4A 1EP2A 3GNPA 3MSGA 5HA7A 5AC4A 3KVLA 3AMCA 1FQ0A 1UHVA 3TTSA 1V02E 3QMSA 4WK9A 3W38A 3KP0A 2VQUA 4UMAA 3W0KA 4MZYA 1DYSA 4K2SA