1JPIA

Phe232leu mutant of human urod, human uroporphyrinogen iii decarboxylase
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
357
structure length
357
Chain Sequence
GFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKLALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVTLQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKHSRLLRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional consequences of naturally occurring mutations in human uroporphyrinogen decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords UROPORPHYRINOGEN DECARBOXYLASE
total genus 123
structure length 357
sequence length 357
ec nomenclature ec 4.1.1.37: Uroporphyrinogen decarboxylase.
pdb deposition date 2001-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01208 URO-D Uroporphyrinogen decarboxylase (URO-D)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.210 Alpha Beta Alpha-Beta Barrel TIM Barrel TIM Barrel 1jpiA00
3BQ5A 3BQ6A 1XPGA 1YPXA 1U1JA 1U22A 3GVRA 3GVVA 4L64A 4QQUA 3GVQA 1R3QA 1T7LA 4L6HA 4ZR8A 1XDJA 1U1HA 1JPIA 1UROA 1R3RA 4AY7A 3PPGA 1R3SA 3GW3A 3PPCA 1R3TA 4ZTYA 2EJAA 4L5ZA 3CYVA 3GW0A 4L65A 2Q71A 4EXQA 1XR2A 2NQ5A 1JPHA 3L7RA 1R3YA 3GVWA 1J93A 2INFA 1R3VA 3T0CA 3PPHA 3PPFA 4L6OA 4L61A 4AY8A 2Q6ZA 4ZTXA 1R3WA 3RPDA 1JPKA 1U1UA 4WSHA
chains in the Genus database with same CATH superfamily
4WDWA 4ICMA 3ATYA 2V5DA 2DZBA 4O0QA 4EAMA 4QP0A 2DT1A 5LNVA 1AA1B 1YRRA 2ZYFA 4O11A 1EYEA 3CMJA 2QGYA 4AC7C 4E0CA 3DG7A 1WDQA 2CERA 4XWUA 3WNOA 4WUIA 1E3ZA 1XI3A 3FN9A 1MRQA 1RLDA 5GNXA 1S2WA 1ODZA 4DI9A 1KBJA 4P7NA 5E0CA 1FA2A 3U57A 3BJSA 5EPDA 1JCXA 4MJ4A 5DQPA 2YB4A 4D6CA 3IIZA 1ICSA 5HPOA 1XHGA 1XIHA 1M04A 2VTFA 4O1EA 1UKQA 2BASA 2CZFA 3ONBA 1OF6A 2EJAA 3CS2A 3I6RA 2YW4A 3TTQA 3QC0A 4C91A 1TV3A 5A1AA 2OLHA 3CPUA 3M1ZA 4HA1A 1AJ2A 3AXXA 2HJPA 4K36A 4YPJA 2ZE0A 4XAFA 4X22A 3A24A 1VBHA 4US5A 4F8XA 2GYIA 2WZTA 3IGUA 4R9XA 3WLTA 2QEZA 4RJEA 5CLWA 4AZ5A 3B8SA 2E9BA 5FJUA 1KQZA 4ZENA 5CAHA 3ZXWA 4ZB5A 2HS8A 4GXPA 4CQ8A 3GG1A 3BL3A 4DM1A 2EPHA 5DCEA 3DKLA 2V6AA 4IIBA 3V7PA 4FIQA 1UR9A 4C1LA 3PUDA 1X6NA 1HKJA 5FD0A 1HJUA 4JTHA 3SY5A 1V6VA 1BG4A 2Z1SA 1C8XA 5D2YA 3F1QA 3GDKA 4I8YA 2IQTA 2QIIA 3M0MA 3Q45A 4RDVA 1BYBA 1BRLB 3VINA 1EEPA 2G37A 5LGXA 3AICA 2EJ1A 2ZRZA 1TKKA 2P8BA 1Q13A 1TREA 4NP7A 2POZA 5FF2A 1XGZA 1XYCA 1F61A 3DHPA 5JU6A 3AUOA 2YZ5A 2OLAA 3FCPA 3S6DA 4MPQA 3AJ7A 2C71A 3N04A 2CZEA 5C71A 1CCWB 1AUSL 4HYRA 3DFYA 4X63A 1SZGA 2REQB 1UMYA 4WJXA 1V3LA 4NNCA 2RFGA 4G9PA 5G1MA 5HA7A 5K2ZA 1GVEA 3OQEA 4ZB2A 2V0TA 1I8JA 1JCJA 1W5PA 1CECA 1S1PA 3BW2A 3S1UA 2CKSA 3KOZA 2VNCA 2Y85A 1J2BA 3GIQA 4O1DA 3T2QA 3GH4A 2VHLA 3E0VA 1P1XA 3BQ6A 2I5IA 1G4SA 4NXSA 1TVPA 2Y63A 3ZFHA 4CD4A 2V30A 5A6BD 1B2YA 2OB3A 3AYSA 4L80A 1XM3A 2G5WA 1W9XA 4MVAA 4AHQA 2XGBA 1Z48A 3UBPC 1EDQA 3QM3A 4N4PA 1JYNA 3GUWA 1RBLA 4IG2B 3VOCA 4RZ6A 1B3VA 2PMQA 3F03K 3GC2A 3KBNA 4RW5A 3VYLA 1RP9A 4DJDD 1S39A 1QW9A 1YE4A 3UR2A 1D2KA 5DRCA 1O94A 4UMCA 3W72A 5JVLA 3AIUA 3DOPA 1KRBC 4O19A 3F2BA 1TPC1 4JIRA 2QCFA 4WJ8A 4QS5A 2J62A 4B5VA 3IGSA 1HKMA 1NOFA 3AHVA 3NUKA 5HQEA 2R9RA 4L4PA 5F2IA 2JKPA 1US3A 3QMRA 4RNJA 3DFQA 2VO5A 1R87A 3OEXA 4OOUA 1XBVA 2FZ9A 5AY7A 5FF0A 5KTLA 3D46A 3IGXA 3R58A 4V33A 4ENLA 3C4UA 2W27A 1ZQ5A 4FPSA 4AISA 3O05A 3DFOA 5LIYX 3ZMRA 4LF2A 1KB3A 4LPCA 3ES8A 2OSYA 3D0CA 1FDZA 3RPMA 3IUDA 3DHDA 3VKJA 4QXIA 1GT8A 4HZ8A 1KXQA 1HTIA 1WUEA 4UTJA 3UR5A 1CGYA 3TN5A 5BRBA 4AX6A 4TV5A 4TX9A 3P80A 3H2EA 3NQ6A 1KLYA 1I45A 4DO6A 4I7VA 5FF4A 2O9RA 4GZ7A 2OGJA 1R8LA 3W87A 1OY0A 2OWCA 5EY5A 4IGHA 5GNZA 2JGQA 3E38A 1W9VA 1W3KA 3ZT5A 3TP4A 2VDIA 4W8BA 3CQ0A 3WBYA 4OT7A 4DJDA 2X2YA 3AI0A 5M1TA 1LRNA 4HJWA 4F2TA 1CGUA 3H24A 4H83A 1QDSA 2FGZA 4DVOA 4RPPA 5E09A 4IP5A 3PNZA 1ZL1A 2ZKMX 1XIBA 1PAMA 3VNKA 4IGMA 4NX5A 4MDOA 2NV1A 1IXQA 4A3QA 4ZEPA 3FXYA 4QLLA 4O10A 2I14A 3NXFA 1UR3M 2Y61A 1KFCA 4ZR8A 3ZJKA 3DFSA 1A5KC 3GW3A 4F0LA 2PP1A 3F5JA 5KZEA 2XTKA 3VIKA 4M29A 3TFXA 2AQVA 1E4LA 3MBFA 3CQJA 3UXDA 3OPSA 1FWWA 1DIEA 1IXOA 1TVLA 2FHBA 3KP0A 5AKQA 5PTDA 4IP7A 1ZBCA 1PO9A 2ZICA 4J7RA 1K1DA 4KFNA 3AMDA 3B8VA 3C61A 1XUUA 4W86A 1XG4A 1X7IA 4JICA 3B04A 3FGCA 4TTUA 4FF5A 1YXDA 2VMFA 3GNOA 1N8WA 4AEOA 1OVDA 5LYRA 1JPDX 1ITCA 5JIWA 1C93A 3RO6A 1TTJA 2BOFX 4OIFA 3NZ1A 4GIYA 3NQCA 4GQ0A 1RLCL 1UBPC 1H49A 2J47A 2YLLA 4C5YA 2YCKX 1JNEA 2FIQA 1JXKA 4FZIA 1EJTC 2PBOA 2ISDA 4JX5A 3W26A 4PUNA 2YBVA 2J6XA 2OODA 1WOBA 3OP2A 1AL8A 3A4AA 1P7TA 1E71M 1GGOA 3RNDA 3MCMA 5DY3A 1V51A 3BJFA 1UROA 4JL1A 3V75A 4DUOA 4C6CA 4Y7EA 1JCYA 1NP2A 2VQUA 2D3NA 1FWIC 1UUQA 2XN2A 4YNGA 4GYFA 1EXPA 4I9MA 3VMNA 2PWEA 2BY1A 3AMGA 3C8FA 2J78A 2X7VA 2GSEA 1OG6A 2WWCA 2YDAA 5E9XA 1L6FA 3HOJA 1OCBA 4WCJA 2HVMA 4BF5A 1UMLA 2WC7A 2XIQA 1AQHA 5D37A 3ECQA 3MCOA 3PWAA 1S38A 2HISA 4GY7A 2R14A 1OT1A 2YFOA 4LYPA 1KXTA 4PUJA 1IR2A 1AH0A 4JQAA 2J9XA 3VDAA 5DCBA 1ZRQA 1VR6A 3BLIA 3FVDA 3WUFA 4UIOA 4HNVA 2DUXA 2FH6A 2VDHA 3QH2A 3F4NA 5DBUA 1XC4A 3KTCA 3R43A 1WZKA 4JL2A 4NJKA 5BROA 1GVSA 4N4QA 3S5YA 4A22A 2XFWA 4KCWA 3SN4A 1K7FA 3RM4A 4HU3A 3TUUA 3PBYA 2OFJA 4ILSA 1VCVA 3EPNA 2NW0A 2JF6A 1KNWA 3KZPA 3WL0A 1J5SA 1V79A 4B3LA 4NYUA 3APYA 4GYPC 5IHSA 3BLKA 4FNUA 3KLKA 1OB0A 4HA4A 3V5OA 5I3FA 1XDMA 3B8WA 4IZGA 4LV9A 3KP1A 4MUZA 4FX7A 1O7AA 4MWAC 1FWBC 3WH8A 4KEZA 4I7WA 4ZB0A 1Z44A 1P0KA 4O8AA 3TWAA 2POTA 1H7RA 1Q85A 3WBWA 4PRWA 5LNSA 1A50A 4H2CA 3F5LA 4JYEA 2DIKA 3Q67A 3DN5A 2V5BA 4WXZA 3VCRA 1WZMA 4UQAA 2PBGA 3UG5A 4LVAA 3B0VC 1UASA 1EOKA 1NOWA 4AX7A 2B4GA 3P5YA 4IWWA 3L4WA 1GVYA 2CLMA 4C6JA 5JBEA 4F2UA 1TV5A 2BGNE 1TO3A 1B31A 1LROA 3VDCA 4S38A 2IW0A 3UZWA 3BDKA 4KCTA 3VCCA 2PLMA 4AC1X 3A4XA 3NSXA 3EOOA 1QOPA 1IQ8A 4IUOA 2XH2A 1DP0A 2J24A 3EPMA 4ZCWA 3TQVA 3P74A 1XGDA 2ANUA 4FSAA 4GJJA 3RMJA 3WL1A 3T9PA 1BSIA 3WD1A 3W76A 4ACZA 2HNHA 4GVFA 5XINA 1CGWA 4LUTA 4F0KA 1OGSA 3W2UA 4ICCX 2NLIA 1WBJA 5AYZA 3WF3A 3T2PA 1BWKA 4GNKB 3D47A 1E0VA 4XD6A 2WNQA 1XLBA 3ALGA 4CD5A 4IX2A 1W8SA 1M65A 1AH3A 3QW4B 1CXFA 3G1HA 3NZQA 1TB3A 1RXOB 2R1NA 4LNYA 4WX2A 1UWSA 1CDGA 1HVQA 2D2JA 4IGNA 2PD5A 2PE4A 1SW0A 4IMDA 4DF2A 2YB1A 4KGLA 1NELA 3L67A 1W3IA 3DFNA 2Y7FA 3B9OA 5JQ9A 2PGRA 3N2XA 3WCZA 2CBVA 2DW7A 4XVDA 3AYVA 1WPCA 3HU7A 3CGTA 2ZUVA 2VKZG 5I3IA 3V16A 4ML4A 4MHBA 4ZODA 4ZO7A 2QKFA 3F4CA 4I9JA 3L5AA 2ZADA 2V38A 3H2FA 1LUCA 2VGGA 4RZ4A 1AODA 3B8DA 3E6EA 1M7OA 3N25A 3RRAA 4MKVA 3MU7A 4QEEA 3THDA 4A3YA 3RCYA 1PKLA 3GX9A 4JIPA 1TYGA 1I2QA 4K3ZA 1XLLA 3IVUA 3ZLFA 1LLZA 1RALA 1QAPA 3R10A 1AZ1A 3IJ6A 4I8DA 1UHVA 2EF9A 3IWPA 3S1VA 3PZUA 2X16A 4EAYA 4BZYA 2XWDA 1F8MA 1YKWA 4Q4PA 3W2KA 3F2CA 4PB4A 1VD6A 2PP0A 2OG9A 1RPXA 4GJ1A 1Q6CA 5CPOA 1WP6A 1ITQA 3MDUA 4BHYA 3PBMA 4B90A 4D6FA 4GACA 2OVLA 5BXPA 5I7GA 4QJ4B 4G1NA 2CIPA 4R7JA 4B5NA 2I56A 1A5NC 3HN3A 4WGHA 3FYOA 4JZ5A 3WQ5A 1A3HA 2VEIA 5FACA 2A21A 1ZCCA 2X1RA 3UJSA 2DH3A 4J2PA 4Z2IA 3TH6A 3QOKA 4NIRA 4NQ1A 3LLFA 2OSXA 4F0RA 4B5WA 2Z1VA 3ZOAA 2C79A 4B15A 1FBAA 4D71A 2PS2A 3WG6A 2NVDA 2YR1A 1NTHA 2VXNA 3TW6A 5AB3A 1BHGA 3QKZA 3NQVA 4KERA 5CAKA 1F4AA 1ZAJA 3VIIA 1JF6A 3NQ7A 3GYCA 1I2PA 2ZA1A 1R7OA 1KCXA 3CB3A 1V77A 1K9DA 1FCUA 4IMFA 4EOUA 2GQ8A 1H11A 4JGDA 1WE5A 1ISXA 2A0NA 4GVHA 3ZIZA 2J7BA 3C2YA 4XAPA 1F76A 4MM1A 1XLEA 4HPGA 3QSRA 2QJHA 1VFOA 1IIGA 1PXGA 3FAXA 1BSLA 2BBFA 4C1KA 2XZ9A 1J0JA 2VEKA 3CMGA 3R25A 4A8NA 1WA3A 2GJXA 4UWMA 4AD3A 5LSMA 2J7DA 3TWBA 1NF0A 3DI0A 3PR2A 4AVFA 5F2MA 3WFLA 3GXTA 1O68A 3T1GA 3DAQA 4QE4A 3AXIA 3H4WA 3N18A 1FWFC 4AXNA 4IL2A 3SN1A 1GZGA 2VURA 4GQQA 4P2VA 2O0TA 1QNPA 4UZSA 2C13A 1GKQA 3LTPA 3SW6A 4PRTA 3VDBA 3T07A 1W3TA 3M41A 2IPGA 1WKEA 3ORWA 3W02A 1GOOA 4JEQA 4IPIA 1QI5A 4IPJA 3W82A 1XIJA 4FXFA 1QOQA 5LIWX 3EEGA 1NP0A 4KEMA 1KM4A 2WKJA 3S2MA 1JL8A 1RVKA 3H2NA 3WQEA 3K4AA 1XLMA 3M43A 2ATMA 2BHZA 4P61A 1XQKA 3G6MA 2P1FA 1QNOA 3RX2A 3LSBA 3W1XA 3QQ1A 1I6NA 4WY0F 2JKEA 1CLVA 3PY2A 3MS8A 3W1LA 1MO0A 5HINA 3UG4A 3B9EA 1VBGA 4CNUA 3MP4A 3STCA 1CGVA 4PCTA 3WK1A 1NSJA 3NZRA 3PUOA 1I60A 2GZXA 1XRTA 1TE1A 2VI0A 5C6MA 4EACA 3JRKA 3I3EA 3LG3A 2LLEA 3UCDA 1XCXA 3N14A 3IK2A 1XFCA 4IICA 3EX1A 4XTIA 1V3HA 1FHUA 1CENA 1TPH1 1UP0A 3BZJA 5FCZA 3WQGA 4ATWA 3WQCA 2FZNA 4BQ4A 2QT3A 1SJAA 4S3EA 3LZ5A 4LQ1A 4H19A 2C16A 2YL9A 3BAWA 4IIDA 1U83A 5FEPA 4P8UA 4JTIA 3IIOA 2Z2AA 1S3HA 1VPXA 2ZRVA 5T8GA 1W6TA 3M9YA 3QHMA 1AFSA 3S42A 2J75A 5I3KA 3TDFA 4IIGA 1ITXA 1UZ1A 2CWNA 3RRXA 5HDRA 2WK2A 1XP3A 3LHZA 4TXEA 1A5MC 1AH4A 2PU1A 3P81A 3VNLA 1PBGA 2YGYA 4U33A 3W83A 3OODA 3E96A 1LBMA 1Q6LA 3GXMA 5BMWA 3DCPA 3C2OA 4ONVA 4PBEA 1GQLA 1UG6A 1ZY9A 5HUPA 1Z8AA 3NQ8A 2Z6JA 3JW7A 3TQKA 4LTSA 5C0QA 1RD5A 3UGRA 2ZTKA 2G3FA 4C7GA 5HWJA 3SUWA 1FKXA 7REQB 4KRTA 3SSZA 3G1YA 2J7CA 4JS3A 1E9ZB 3P7YA 4YYCA 2WCGA 3WQFA 1VFLA 4I3GA 1UZHA 1PTGA 1EC9A 3LCHA 1YPIA 1GYNA 4MWAA 3ITLA 4B5XA 2WMIB 3N73A 1SMDA 1SW3A 4AXKA 2ZX6A 3QEZA 3S9YA 3EB4A 3JS3A 4KEUA 4UFIA 1E6RA 2B81A 1KKOA 4MLJA 1UW9A 5DMNA 1I1WA 1V6YA 5IDIA 2AL2A 3OZMA 4MY1A 3TLLA 5FJOA 1J79A 3QMTA 4NX0A 4S2BA 3UWUA 4CN6A 3UJ2A 3CL7A 2XG9A 1OINA 1JI1A 4BF9A 2XH4A 1XIMA 2A3BA 1NF7A 2WMJA 3W2JA 4IPNB 5EBAA 1E4IA 2VCCA 1O6IA 5HANA 3OGSA 1V6TA 3U5UA 4K8GA 2CLEA 3UWYA 2GGGA 1JG9A 4WR3A 3AMLA 1KFEA 3BTNA 2Z28A 3PAJA 3WFZA 4IFKA 4EIVA 3CO4A 3QC3A 4PUDA 2AAAA 1AQFA 1Y65A 4XUYA 1ME7A 1H7NA 3MKKA 3SUTA 4S23A 4RE3A 2ACRA 5H8PA 2TRSA 1M7PA 1BQCA 3ARQA 2Y6ZA 4DWDA 4DX3A 2UY3A 4QE1A 4E6MA 1TQXA 7TAAA 3U2ZA 3A4WA 4FLQA 3IJ8A 1DJZA 1EJUC 3MMDA 1UOKA 4RUBA 4DZHA 1R38A 1GVIA 2WKLA 4S3GA 4CUCA 2XIJA 1NU5A 4Q7IA 4K68A 2XVLA 3DX5A 2Z27A 3K8MA 4F0SA 2V5JA 2YX0A 3WUGA 1JZ5A 1ZP3A 1OCNA 2G95A 1GKPA 2Y7EA 2RUSA 4KIRA 2BFGA 1GTHA 2PWUA 5KSWA 3PANA 2OKOA 3AUJA 1TSIA 5F1UA 4MUPA 3NSNA 1KTCA 3G3DA 1KC7A 2PDGA 2J8TA 5HQLA 1ONEA 1H1YA 3PTQA 1NVMA 4GE8A 3C2EA 3OBEA 8RUCA 2YDQA 3W73A 3EWWA 3M0XA 1E40A 1VPYA 1J01A 4XIAA 3CYVA 3MI6A 3VPLA 2X09A 5E6YA 4M8UA 3CAQA 4RZBA 2PDHA 4AG0A 4CEXC 4NU7A 2I1OA 4Z2JA 2F2HA 3DUGA 4R33A 3ITTA 4KFPA 2YA2A 3A12A 1E51A 3VA8A 1K9TA 2VZSA 4GG9A 4Y9OA 3UXIA 1T8XA 1Q3NA 4LF1A 4FXSA 1IGSA 2ON3A 1MMFA 1DTUA 4WGXA 3THQA 3C0SA 4X9SA 4EXBA 3P62A 4PULA 1V0KA 4GI4A 1O95A 3AU6A 3I4EA 4GUIA 2DZXA 4V1XA 3PPCA 3W4RA 1V6XA 4RX0A 2FTPA 1VENA 1RVGA 4HSHA 1A4LA 4HBKA 3W7GA 2HVNA 1DWJM 3MQTA 3SCSA 1WKYA 5FJTA 3KZSA 4PBFA 3N17A 3A23A 3MUY1 1X7FA 5CJ5A 4CCCA 4AZCA 4O4VA 3QY6A 1JAKA 1BVZA 3UA4A 3EXTA 4KBXA 1KA9F 1T8QA 3VD5A 3IRDA 4Z2HA 3MO4A 1CNVA 3W86A 3AWNA 1RCQA 3IAPA 1XSJA 1XLFA 4GOAA 3ARZA 3TYCA 1TTPA 1CXEA 2NQZA 2V5CA 2J6VA 2Y8VA 1QK0A 2ZX5A 2VRKA 1BYCA 5EMUA 5A2AA 1HJSA 4Q22A 1JUKA 3G1FA 2E3ZA 2Y7GA 5D8WA 2QCMA 3PNUA 1XSIA 1V3KA 2J4GA 3TE9A 2G4JA 1H50A 1QPNA 2CBJA 3HJEA 3SCOA 5JUVA 4K38A 2BWGA 1XLDA 2GSHA 2GGEA 2FQIA 1V3JA 1OGBA 4DJEA 3RLGA 3UWQA 3PPHA 2BY3A 1NOUA 1F73A 2PWVA 1M7XA 4Y2WA 2O7QA 3WJXA 2JGYA 5AHIA 4MKSA 5BXRA 1WAWA 3EA1A 4MF4A 3C56A 3Q94A 3MI2A 2PDIA 4YLWA 2AAMA 4PE8A 3M7SA 4I9AA 4GUGA 1YXYA 2AKMA 1KCZA 4NZJA 4JTLA 4HNCA 3ZYZA 3KE0A 3OVPA 3N2BA 1XRSA 3ZS4A 4IPPA 2EPLX 1CTNA 1FWHC 3A5FA 2Q01A 1W5QA 4ZQPA 3Q37A 1H60A 2QCLA 9XIMA 1Y5XA 1X96A 4GLEA 2XDFA 2Z4GA 2XN1A 3UVIA 2EXOA 1T0OA 4UMBA 1YW1A 5B7YA 3AIBA 4P7OA 4AHOA 3CV6A 3N3TA 3MMUA 3BQ5A 4Q8TA 5IM51 1G9HA 3HG2A 3WD0A 1GOXA 1H7WA 4UR8A 3RITA 1NQ6A 3TW9A 3TTOA 1OFBA 1U1UA 4Q4MA 1EA9C 5LXEA 3SRHA 3BUVA 2G97A 1G6CA 4HK6A 4OGZA 3LGGA 5D38A 2VX5A 4PR4A 3U8GA 5H1WA 3ANVA 1P0DA 3PVFA 3GXFA 4QLJA 1K7EA 1EX5A 3BH4A 4PEKA 3V4BA 3CUGA 3TZFA 1O4UA 6ENLA 5LIXX 1GKRA 1CXLA 5AVHA 1O1HA 3WLKX 3BCJA 3WUBA 2ZRYA 3N6QA 2PLJA 1KRCC 3GD6A 1JCTA 1FUYA 4XZIA 1IT7A 4AVNA 4CNTA 3CT2A 2XM1A 3I4KA 2AL2B 2XFFA 5TBOA 3NPVA 4HPNA 2O4MA 1JZ4A 3VZYA 4H8VA 1P0EA 1TPEA 1S5TA 2DT3A 4S39A 3M16A 3RG6A 3LERA 3NFUA 4LB4A 3NEVA 3C6CA 4WY0B 4EKJA 3EB3A 2WVVA 4UUIA 3GNNA 2DZWA 3RX4A 3DYMA 4HU8A 1H0GA 2V9DA 3ARPA 3VGHA 3UZ5A 4E38A 3W53A 3MMWA 3GG8A 3AHXA 2E4TA 1F05A 4GNVA 3T8LA 1HKVA 5MKGB 2FVKA 3FV9A 1OZMA 2J79A 3M7WA 4HZ6A 4QDMA 3JU2A 2AGKA 2I17A 1LCOA 1TZ9A 1BG9A 1G0CA 1WCGA 3FLUA 2IPWA 3R94A 4BQ3A 1S5NA 1MZHA 1HKWA 3TVAA 4YIWA 3URQA 1DOSA 2PGWA 4V27A 3ELFA 3W81A 1PKMA 2BY0A 2W66A 4R53A 1J0HA 2QIWA 1N7KA 3HPSA 1FHVA 1E6QM 1GZJA 2WZEA 2YL5A 2V2HA 1JZ2A 2BY2A 1SZFA 3OIXA 1ZHAA 1VFMA 2XH7A 4DBDA 5DBTA 2GUUA 1YTEA 2IKHA 3WMCA 4GY1A 1W1PA 3W37A 1MEIA 1EPVA 4FNSA 1LORA 4UB9A 5TF0A 2O7SA 3C0LA 3CC1A 1PE1A 1TTQA 1SR9A 1ZAIA 1KBIA 3B97A 2DY3A 3GDLA 5HMDA 4GCXA 3U2CA 1QHZA 3NURA 2C18A 1R2RA 1T41A 2CLOA 2QVNA 1EUAA 4JIEA 4RNFA 4EF8A 4XQ6A 3P6LA 4Q6XA 3NG3A 1L8PA 1FWEC 4NZCA 4H9VA 3GZ3A 3PBGA 3E5PA 1MUMA 1W31A 2EG6A 1Z6KA 2OWXA 3E1F1 2V5KA 3S6TA 4IFRA 4JFTA 3QV6A 5H91A 3TTSA 2DIJA 3KHDA 4H6KA 3RX3A 1QHOA 1LOLA 3GAYA 1BPLB 1SW7A 2J27A 3EWYA 2CZDA 1OIMA 4FHAA 5CG0A 2VJXA 4GXMA 4MYAA 3XISA 4NVTA 3M0HA 4HZ7A 3SJ3A 1QW7A 3WD2A 4BCEA 3GXPA 5D2WA 5IFPA 3HPFA 4H3DA 3UY8A 4IQEA 4PMZA 4EVZA 1XBYA 3EMZA 4EXQA 2GSJA 1TPWA 4MNMA 3UXKA 2WSKA 4Q7NA 4M6PA 3LRMA 1J12A 1AJZA 1OFPA 3LCIA 1O5KA 4NI3A 1IZJA 2QV5A 4QHRA 1VGAA 3CU2A 4MY9A 4JIQA 1W1ZA 3VKBA 4WVXA 2F6KA 4FXJA 2A85A 4QEHA 4ERIA 3KW3A 4CVWA 4A29A 1GPWA 3POCA 4JTKA 3ZWTA 1ISZA 1DJQA 1H1NA 2VZUA 4ZXLA 5D02A 1EEXA 3M0ZA 5I3DA 4DIAA 4NAEB 1LTDA 2YXGA 2WJFA 4Q8WA 4EPEC 3CH0A 3THAA 2CC0A 4MNJA 1UH2A 2GWGA 3PZGA 3VNYA 1IT0A 3FA5A 5KMYA 4IIHA 3EMCA 4H4IA 3MWCA 2HPMA 4E2DA 3TTYA 4K39A 3S5NA 3UZYA 1D7FA 5C9XA 1DPMA 4RLIA 4L56A 1Q4NX 4CQAA 1UZ4A 4DAFA 3WY1A 1UD2A 4GFSA 4AEEA 1IIHA 4UBPC 1ZLPA 4JTUA 3MUCA 1PYMA 2PDJA 1V08A 3ABXA 3USBA 4WHBA 3AISA 3HURA 1Q2SA 2A3LA 4PCFA 4P8WA 1GYLA 3EX6A 4JXCA 6PTDA 2VRJA 1UD8A 3E74A 1ZU8A 1IWPA 1TJPA 1XYBA 3UZXA 3RK8A 1EWDA 2PWDA 2C0AA 5DEZA 5C54A 3RM9A 2CLHA 2I9UA 1R3VA 1R47A 2EPKX 4L6OA 3TNBA 3KOXA 2PDKA 3W1RA 3H7VA 4YWSA 1VH7A 4EE9A 3ZWSA 3KWXA 3W7QA 2F6XA 1XX1A 3ABZA 1W1VA 2ZC8A 3A47A 4P7LA 4LV4A 4GGHA 5LA2A 4M5PA 5T91A 2Z26A 1L6WA 3C86A 3ITGA 4HNOA 4HMNA 4AHPA 3A22A 4DZAA 4GJIA 1XLKA 2Z2UA 4JTQA 1JD7A 1W1B1 1CBGA 1MXSA 4R27A 1MW1A 2PDWA 1S2VA 2GVJA 2TMDA 1UIPA 1YBQA 2BOGX 1ECQA 1MSSA 3KRUA 2YOCA 4AWEA 2HXTA 2INFA 3WF0A 2JF7A 3KBSA 3ABQA 5BRQA 1KLZA 5C2XA 2NSOA 3LCGA 2Z1XA 5ECVA 2ZZ4A 4XZBA 3W7MA 3MDWA 3W1AA 5AFDA 1JF5A 4WZHA 4EXAA 4A8LA 3WDJA 1PJ9A 3ISIX 2WXDM 1CXKA 2ZUTA 3B06A 3UCCA 1XRVA 4L4OA 3SAZA 1XBXA 2VT0A 5DXYA 2GDUA 1ZGDA 3CZEA 2GDQA 3EA2A 2A2IA 3SSJA 5LA0A 1GZ1A 2V68A 2C1GA 3FGCB 1EZWA 3VD7A 2ALRA 1F4HA 3CLMA 4K7YA 1EB3A 4JIHA 1LG1A 4MWAD 1WKFA 4PMUA 2QDHA 4LX4A 1Y5VA 2XSXA 3TSMA 1RSCA 2ZA3A 5FESA 4C5ZA 2CCRA 4S3AA 1D9EA 2QUUA 2Y88A 3V0SA 3M6YA 1QWGA 3T4WA 1V02A 2GOUA 3SFKA 1HJQA 5HNUA 2YCLA 3T08A 3OBAA 3UA3A 1F5ZA 4GIEA 1DHKA 4IQLA 2YDSA 3GXNA 4WOQA 2EG7A 3OJGA 4JNYA 3AQUA 3W6YA 3U3HA 5H8UA 5D03A 1HO1A 2Y7DA 4DUVA 2W67A 3TQPA 1NWUA 4UFKA 3CZKA 2Y89A 1HVXA 4V1YA 1ZENA 2E5BA 2INZA 6A3HA 2WBGA 4HNLA 4MB3A 3SEPA 1XYMA 1JFXA 2RDTA 3OZYA 5IRPA 2ZIDA 2X30A 1ADDA 3M0VA 1LBLA 2QCGA 2WQDA 4US5D 5FIPA 1L6SA 1OG0A 3L4TA 5A6TC 5CC5A 1OSEA 2XH0A 1KKRA 4PA8A 1HFBA 2O9PA 1GJWA 1E3XA 4TTGA 4CU8A 3FW6A 2XINA 1PHWA 2XU2A 1HKKA 1ONXA 2Z25A 3R12A 4HMDA 3VKDA 2JEQA 3H54A 3G1RA 3AWOA 2VL4A 3QZAA 4PMOA 2P53A 5TIMA 4NZ1A 4UFJA 3U48A 4M6UA 2VFGA 1A4MA 1AG1O 4E8GA 3FS2A 4H6EA 2O55A 3RU6A 1GVFA 1TMHA 3ICJA 3UZJA 2G96A 4LT9A 3BLLA 4J2MA 2WPBA 3RN6A 1UWAA 3QSTA 1XYFA 2QMKA 1GONA 3NL3A 2Z24A 4NZ4A 1AL7A 1L8NA 2P88A 4I7UA 5FJIA 4IG2A 3AO0A 2ZUSA 2ZXQA 3VGFA 4DLFA 4H41A 4NSBA 4LFYA 3IVTA 5HUOA 4CN1A 3FHAA 4OV4A 3N1AA 5TNVA 3ARVA 4JCMA 4FR1A 5CLTA 5F4XA 2IKJA 4W7UA 2ACQA 4U5IA 4ICNA 2CLPA 3CASA 4WDUA 4M24A 1YNPA 2DFAA 3EMQA 5E93A 4POCA 2XFRA 4DXKA 3RCNA 4GQGA 4G8TA 2Y5EA 3BXWA 4Q4OA 3WJYA 1O1ZA 4ROPA 4XAYA 5EFDA 1PZ0A 4HN8A 2VFEA 2CHOA 3BSHA 3DHFA 4IOTA 3CZGA 2BMBA 4ZTYA 4A3RA 4CCDA 1GOQA 1OX6A 4LUYA 3OG2A 3H12A 3AHZA 1US2A 4J3WA 2ZXDA 2C14A 2B7OA 4W4QA 2EKGA 4Z0SA 1PCKA 1VFFA 1ZBVA 5HWMA 4YS1A 3GKFA 1OYBA 3NPWA 2HS6A 3QR3A 1J0IA 2WLYA 1UWUA 1TELA 1SZEA 4E2VA 1K3UA 3AIEA 2ZX8A 4B4FA 2PUZA 2OCZA 1W3JA 4D6IA 3WH7A 2PTZA 2E67A 1OFEA 2J88A 1XS2A 1YPXA 3URAA 4PSPA 1U1HA 2VR2A 4LY8A 3K2GA 2UY2A 3MKCA 4YVXA 4O13A 3N11A 4UTTA 3QHNA 7TIMA 1EF3A 2ZX9A 1J2WA 3MHUA 2E9MA 3GTFA 4LNCA 3DFHA 2IQ0A 1PS9A 3K8LA 3PZOA 2AGTA 4KFOA 1L2QA 1OT2A 4GMEA 4NXKA 3LI0A 4Q8MA 3GK0A 1I1XA 1Z41A 4NHVA 4J9JA 1KR0A 4DWSC 1TVNA 2DW6A 4HPJA 3DU0A 1BGAA 1C29A 3KDNA 2QNEA 3O06A 2HWGA 4Z2KA 4E4PA 3VX1A 2FVMA 3QGVA 1XLJA 3KOFA 5CKSA 7PTDA 1V0LA 3HB9A 5HMFA 3TCEA 1IZKA 1K77A 3LOTA 4KCUA 4WK9A 1PL9A 3S9IA 2PDBA 1M01A 1TUXA 5EU9A 4UMAA 3L5MA 2A3CA 1SJCA 2MANA 4KKXA 2WM0A 3OW1A 3LHVA 1KGUA 1Q6EA 1EGMA 1PX3A 1HUVA 3UXLA 4F9DA 1GEHA 3HQNA 3WLIA 3ZJ7A 5J04A 2VZVA 1EA0A 4U5KA 2RJGA 1LL4A 2OO0A 3BV7A 2WNZA 3P14A 1R3YA 1S46A 3R4IA 2FPYA 4H7ZA 2H8XA 5D05A 5CC7A 2CETA 5D30A 3KBJA 4DJDC 2QCDA 2J8FA 2R94A 2I9EA 1U5VA 4IMAA 3FJNA 4G7EB 5HWNA 4UR7A 2X8RA 3VIOA 1CW2A 2D0GA 1FWNA 4QG6A 5EKYA 3L5LA 1E9YB 3GZAA 6XIMA 3MJMA 2B7PA 5TD4A 3M5XA 5DMLA 3U4AA 1FCBA 5A8GA 2PF8A 3TMQA 3GC4A 3R0KA 3CUFA 1S2TA 2G8ZA 2AQOA 4LXFA 1VFHA 3MP5A 2O9TA 4EF9A 5I3JA 1EDTA 3LHWA 4GABA 2ZBTA 1WUFA 3AXMA 5IBXA 1IEWA 3APTA 4WQ6A 4S3BA 3YPIA 1GTEA 1VLWA 1X98A 3TXZA 2FTWA 2ZXBA 1V6UA 1WYIA 1U5JA 4QNEA 4DO5A 3NYZA 1T99A 3HJZA 3IEBA 3PWIA 4G7EA 3TU9A 5CPNA 5A69A 1SFJA 2BVYA 5I00A 4MZ8A 3WQ8A 1UKOA 2J66A 3PAOA 5A6JA 4AWTA 1OQFA 2QJGA 1SJBA 3HF3A 2BTMA 1FWCC 3RILA 4XZWA 2BSLA 1BF2A 4CD7A 2CBUA 3N2OA 2CYGA 5GPRA 4XKYA 3MA8A 3E0LA 4GXWA 5I3HA 4QITA 5BU9A 5REQA 3DC8A 5I3GA 5C70A 3K30A 4AUBA 3M07A 2VFFA 2IUZA 2IXUA 4HN4A 2DDXA 4MSSA 1XF0A 2R1KA 4J28A 2PP3A 1B3WA 1H7OA 4HQVA 3M5VA 3EB2A 1DQWA 2ZFAA 3VX0A 3FA3A 3OTRA 3RO8A 1MDRA 3CHEA 4WSHA 1WXJA 3RIKA 5I06A 4HSOA 3CIXA 1I2OA 3MC5A 3CV1A 5FSEC 3TA6A 3BK0A 3B9NA 5JXQA 4HHPA 1LM1A 2WZHA 4W85A 1XKJA 2RGLA 3FFSA 1TWZA 1NJJA 1TR1A 5DO8A 4UNIA 4Y6GA 2WVVB 4XX6A 4J3VA 3URNA 4WLCA 3MZNA 4JQ1A 4AYGA 4FX8A 3AZTA 4MMWA 4NZ5A 4LCRA 3H2CA 4D6DA 4ZQCA 1DYSA 3RUBL 1Q5MA 2VEGA 2EPOA 2ASHA 4IHCA 1ZP4A 1XLIA 4JX4A 4RDZA 3UNTA 2PWHA 4TMCA 3LU2A 1KCKA 2QCNA 3SQSA 3W7OA 4G6CA 3HTWA 4M51A 5M2FX 1ZUAX 4XZMX 4LJ3A 2XSAA 4O57A 5JH1A 4LSBA 3N9KA 2ICSA 4AH7A 4N0RA 5CZJA 2R6OA 5A2BA 1S5VA 2GQ9A 3TR2A 1BTMA 4J3ZA 2WWDA 3TKFA 4AD0A 3TC7A 2QGHA 4V15A 3SY8A 2GVEA 2VGBA 4R3UA 4GX8A 2I16A 5J5RA 1E1EA 3EWUA 2ZRUA 1E55A 3COTA 1EH9A 1O12A 3EWBX 3OLDA 3EWDA 1OD8A 3KTSA 2WHMA 4GH1A 3WDQA 3PTKA 4RPQA 5M5DA 2PEVA 5CC3A 1JDAA 1DE6A 4DJED 3W1UA 3VK5A 2PDXA 1K4HA 3O6DA 4DN1A 1LZOA 2GLKA 1J11A 5I6SA 3WLPA 1MZRA 4PTNA 3EX3A 4CQDA 1UBSA 3BG3A 3LNMA 1R3QA 3TA9A 2EQDA 4JQ2A 2J7GA 1XH0A 1O60A 1LYXA 4ERAA 4DPQA 2H6RA 2D22A 3UJRA 1PSCA 5DN1A 3SR7A 1NY1A 1GJUA 4I5RA 1LQ2A 1TPDA 3R8GA 5A94A 5LA1A 3G8EA 4A8IA 3AIQA 1J4EA 1RZMA 6XIAA 3L4VA 1V7YA 2ZWYA 4L5ZA 3LDVA 4GKLA 3SI9A 1JYVA 6REQA 2NQ5A 1GHRA 2ZUWA 3R11A 3EXSA 4CCZA 2WMGA 1ZNNA 3QR1A 4BEQA 4PCPA 3NZGA 3GWQA 3GVVA 1KQYA 4Z2LA 4HIBA 4E8CA 1IWBA 6CGTA 1E4NA 1KM3A 3QQ0A 4O8RA 3NQDA 4A3UA 2RGMA 5FI8A 3BVJA 3SCWA 1FP8A 2OEJA 1E6ZA 1E6XM 2Q8ZA 3PS7A 1SO5A 2WANA 2XVGA 2ZX7A 4LVFA 3HQ1A 3L2IA 2Z0IA 4DBEA 4A2RA 3N4EA 3MSDA 3G2GA 1E15A 4Q4KA 3UNDA 3S5SA 1N2VA 5CEWA 1FVPA 1XW8A 1SO3A 1RP8A 3ARYA 1S2CA 7ODCA 4JTAA 3GDBA 3VOGA 2INEA 3BAYA 3G18A 3DGBA 3OGRA 2R1PA 4NL1A 3EPOA 1SMAA 4IF2A 4WEVX 4AMCA 2GGJA 3STPA 4LUJA 3DDMA 2D24A 1VJZA 1N8FA 1S3TC 3A3HA 1WNOA 4HNUA 4HK5A 2FZ8A 3HFYA 3OO2A 1PIIA 1XIIA 3O0FA 3U7BA 3GTNA 3RLHA 5CZSA 5IFTA 1QR7A 3TV8A 2OELA 4XAGA 4NAEA 2C15A 3BMWA 3LY0A 4ZOEA 3CJPA 1VQTA 4LAUA 4CVUA 1KTBA 3HPZA 4ZE4A 1RQHA 1QPQA 4FLOA 2MUCA 2VWSA 4C6MA 2A3EA 2V5LA 3VILA 5I77A 5IOBA 1RCOB 4IJBA 2IPFA 2J8GA 3CO8A 3WJWA 4JPGA 3OVGA 4GKTA 3WK0A 1VLIA 3LHTA 1S2UA 1YE6A 5JH2A 4RZ5A 4TMBA 3WLNA 3ZSTA 3E2RA 1VYRA 5A6BA 1CB7B 1OGGA 4B9ZA 4RE0A 3L12A 3KX6A 3F4VA 2ZDRA 2ZWZA 4I9TA 4C90A 3DGRA 3W7JA 3S2CA 1MYRA 2BP1A 4M6QA 3EKLA 1I4NA 3GBEA 3HV8A 4PBGA 1QBBA 2OQLA 4F79A 2NQJA 4HMEA 4EPDC 2FTYA 4HGXA 3SRFA 1F6YA 1OFDA 4NI8A 4U2ZA 4QSHA 3TONA 4RNHA 3TYEA 3KBMA 4GO9A 1E9LA 4EWJA 2OKTA 4K1WA 4AD5A 2XGZA 3ITVA 3ES7A 4LS1A 4I6VA 1LBFA 2DP3A 2BB0A 1WZAA 4O52A 3GXIA 1TG7A 2VCBA 2R1MA 1G4TA 4QRNA 1XISA 4AAJA 4H6QA 5L9FA 1Q8JA 3SGZA 4P5UA 1P5BA 1BD0A 1JDFA 1ZB5A 3VKAA 1U1JA 1KO0A 5GJMA 3VFLA 3VZXA 5G2WA 1QPOA 1G5AA 2KX9A 4KWVA 3IJIA 1MFUA 4PCNA 2XIBA 4DJEC 2VVSA 3GIYA 2OMAA 2X40A 1J0ZA 3W3OA 5AZ1A 5GVJA 2XWEA 2Y5SA 3EWZA 1LT7A 2DT2A 2HRWA 1GNXA 2DIEA 3HGRA 2JEPA 2HZGA 4LS2A 4R5EA 1AW2A 2AMXA 2UZ9A 3CM4A 1NEYA 4BY3A 2C7FA 4NNBA 3KAOA 3AS2A 3OHMB 3H22A 4ADTA 4BWLA 5LNUA 4R9OA 5A6AA 5TAOA 3BV4A 4YYFA 1OYAA 1A47A 3V1HA 2OX1A 3S6OA 4IISA 1BTCA 3H7RA 3H23A 1J8VA 1W54A 4ECLA 4LCQA 4D2JA 4W87A 4GO8A 3MB9A 4FOKA 1M03A 4DO4A 4KS0A 2D20A 3SRKA 3CHVA 3B8TA 2CLIA 2WC3A 4QNWA 4MKNA 5FA5A 1DWAM 1YDNA 3LPFA 3L2MA 5EA9A 3NPXA 4ZQMA 4UCGA 3SY1A 1M68A 5D9PA 5BRPA 4HHHA 2Q3RA 1IHIA 4ZSTA 5AC5A 3CZ8A 4O1BA 1PCWA 1RA0A 1ZSXA 3WDPP 2I57A 2WSQA 2RJHA 1EFZA 3E49A 3WLSA 4MWAB 4YXGA 3VNZA 4HT3A 4WJEA 5K9XA 2QR6A 3VIFA 2WNNA 4RR4A 1YDOA 5FJJA 1P0BA 3VIGA 1NWRA 4MIMA 3FDGA 4HYWA 4CD6A 5C7HA 1OFOA 1FXQA 4H9UA 1M9HA 3BW3A 3WIJA 4INFA 1J18A 5HXMA 4OUEA 3S4TA 1UKSA 4GFIA 3S1WA 4JNMA 3MBDA 3R79A 1P0NA 4G5DA 3KBVA 2J7HA 3P0WA 2QVHA 3AYTA 4V2XA 2PF0A 5HR6A 1A5AA 5BW6A 3ZZ1A 2WLZA 1C91A 3HQOA 1GVOA 4PMXA 1EBGA 1PB0A 5I07A 2OZ3A 1TA3A 3L0GA 2KAUC 3VIMA 4JY9A 3T0CA 4H01A 4PYSA 2G41A 3HGOA 4HCHA 3N12A 1XCFA 2CFFA 3I7SA 5F4SA 2GVLA 3GG7A 3HGSA 3N3MA 1K6WA 1BYDA 5EMMA 3REQB 2Y1HA 3LK6A 3T6CA 1FHLA 3HG4A 3SIMA 3E2VA 3N15A 4QBXA 5D2TA 6REQB 2WKGA 1VJIA 2W91A 4GCAA 2FZMA 3VMPA 1W1TA 4PN2A 3QPZA 2I5GA 5E0FA 4MGGA 1OD0A 2JIEA 3EOEA 3GNPA 4PODA 3BW4A 3LTSA 1QWKA 1BWVA 3CIVA 5G5IA 2X1UA 2HROA 1TIWA 3ARXA 3GM8A 3BGJA 1OHLA 5AC7A 2X05A 4L4LA 5EMKA 2VX6A 3C0QA 1UR4A 3GU1A 4DYKA 2FFCA 3RYSA 1HQTA 5G4EA 4GQBA 3BCFA 3W25A 4XISA 4QJ3B 3W85A 1B9BA 4P7QA 4JKMA 2OZTA 4PUKA 4XZ9A 4NAFB 1E73M 4JKKA 3RM8A 3QQWA 3KVKA 3CAVA 5A6KA 1IR1A 5F4WA 3B8IA 3JR2A 4W7WA 3R8RA 1Q4WA 3O16A 2DZUA 5D2VA 5FKYA 5BWFA 4FNRA 2E5DA 1BRLA 1XDJA 5HNNA 1JEZA 2BXZA 1U30A 3LCLA 4MG4A 4FR6A 1EIXA 4LYQA 1XCWA 4QJ1A 4NJJA 4TOQA 3GR4A 2WHKA 5I79A 3RJXA 2QCHA 4A05A 1IT8A 1MFVA 3PSVA 4URIA 3MV11 4AD4A 1WO2A 2FZDA 2YXOA 4WDXA 4D8AA 2GJRA 5LGZA 2CXEA 3L7RA 4CKQA 1J0KA 4LS0A 2H8ZA 4KH2A 1QCWA 2X0YA 3O6AA 2G3IA 3WQPA 1W0MA 2DORA 2BZNA 4XO6A 4M7SA 3ZR4A 3K8KA 4NF7A 1V8EA 5LZLA 3LENA 2E6DA 1EKOA 4AZGA 2DSVA 1S1RA 4RV3A 3AXKA 2VFHA 3G5EA 4JTSA 3FJ4A 2V3EA 4D6GA 2ACSA 2VR5A 1P6CA 2IS7A 3GUGA 1IWAA 3NDZA 1VKFA 2Y8UA 4X2PA 3QV8A 2HNEA 3AJXA 1VFUA 2WV8A 3W84A 4FK9A 3W71A 3OBKA 3H70A 2OSWA 2Y4SA 4M80A 2DV0A 4KT2A 4DXVA 2F9RA 1RJQA 4C6OA 4UTTC 1FFRA 4PMVA 5AVNA 5HR7A 1GEQA 3GO2A 5I09A 4AIEA 4UFHA 5I2UA 4GWEA 5IDZA 4PMDA 4OE7A 1N8IA 4GYPA 1TWSA 2Y2WA 1TJ1A 2DVXA 3VOFA 3S2LA 1DXIA 2PTWA 3CT7A 4C6LA 5HOSA 4LGXA 3SGUA 1BKSA 1FCVA 3WJZA 5HJYA 1R2SA 4L61A 3DHUA 5CSRA 1NARA 5CPMA 5EB8A 3A9BA 1YDYA 3M47A 1SGJA 2G0WA 4IM4A 4TVCA 3MWAA 3KFTA 4JTDA 3ZVHB 1DBTA 2WM1A 2X0SA 3SQMA 2I5QA 1KFJA 1TQJA 4UOQA 1R5YA 3R6IA 4AZBA 3UESA 3FYPA 2FKPA 1F6PA 1BYAA 4KRUA 4QE5A 2Q09A 3P93A 2PDLA 3GNDA 1EBHA 4L1GA 2FJUB 1JUEA 1MNSA 1BXNA 4L9XA 3LTYA 3ID7A 3QF0A 7XIMA 4IJCA 3QRHA 5ABFB 3WH5A 3WMSA 2DQXA 1ZBKA 4PC8A 1QNRA 4Q7BA 4FB7A 4C6PA 1EF2A 3BMVA 4WKFA 3IS4A 1TE6A 4HK7A 1Z32X 1DJNA 3NOYA 4U31A 2PDCA 5M03A 3APGA 3AMCA 3G0UA 1RBAA 2BODX 2PA6A 1P7TB 1BGGA 1GW1A 3RR4A 4B5SA 2NQ9A 1R6WA 3HO8A 3DYOA 4HKPA 2UY5A 2QF8A 4A21A 3TCSA 3G6LA 5FF3A 3TNOA 1TZZA 3HGJA 1W5MA 5LNRA 2FMNA 1A5UA 2C6QA 3VNIA 2QJMA 4DNHA 4OBSA 1JRBA 3QTPA 1OABA 3CTLA 3G22A 3UT0A 3H2MA 4HMCA 1XG3A 5F2GA 4HOXA 4UQEA 2VEFA 1ZJHA 4TU1A 4UFMA 1A5LC 3ZVIA 3P3BA 4XTDA 3W7LA 3QV9A 5AC8A 2E5CA 1W9PA 1DQXA 1I75A 1CIUA 1CGTA 4R7OA 4IUGA 1E56A 1NFPA 3NOEA 2JKAA 3FAWA 1VRXA 1BWLA 3IJLA 5A8MA 1W8GA 1XDLA 3WLOA 3IACA 3IPWA 1PIGA 3VD4A 2PDUA 2ISSA 2Y8KA 1Y8BA 1KXVA 4WDTA 3VMOA 3M0JA 1AQMA 4GC3A 4ZO9A 3D3FA 2Q8LA 3W7EA 3SCPA 3CBWA 1FWGC 1ML1A 3AOFA 3WX7A 2J7FA 1RBOB 1J0YA 3ONCA 1M1BA 3GFXA 3ZQ9A 5ABTA 1F3WA 1KV5A 4AD1A 2WPGA 3ZR5A 4QAIA 1KW1A 3LPGA 1Q6FA 1FTXA 4Q4QA 2H9AB 1TCDA 1EHAA 2PC8A 4KRZA 3AALA 2V2CA 3IRSA 4PUMA 2EBNA 3U9IA 4JTTA 3HPAA 4LW7A 1AVAA 4IQDA 3WEZA 3A3XA 1EGVA 3KL3A 1QW8A 2HEJA 1DJGA 1GW9A 1M6JA 4RDWA 3VC5A 3EDJA 4U10A 4HNNA 3VD9A 4UFLA 5A6MA 1JQVA 4DJFD 5AECA 4GH3A 1Q7ZA 3C0JA 1DJYA 1W9UA 4AFYA 2OZ0A 2CZ5A 3MJYA 3A9IA 2JFEX 4GPNA 4AYSA 3ITOA 1D8CA 1ZJIA 2GJXB 3UEQA 1Q6QA 4D1JA 3AROA 5DX7A 3IV8A 3LXCA 4U2YA 2OT0A 3T2OA 4KMQA 1NDYA 4B2DA 4LBUA 2CESA 3CWNA 4HTBA 5D9NA 2VGIA 4AD2A 2C3ZA 2QDGA 1UD6A 2P3ZA 3MHFA 2DT0A 3WLHA 1DIDA 1UJPA 4ZZ9A 1C8VA 3NQGA 3AYRA 1KFKA 1P6WA 3V1PA 3MANA 4G1KA 1W1A1 4L1WA 8XIMA 5IBXC 3H2AA 3MHGA 3I6EA 3SCVA 3D5HA 2D3LA 4W8AA 2OT1A 3C2FA 3DEQA 1K9EA 2OYLA 2V63A 1TMQA 3E2QA 2PLKA 2Z1BA 3P67A 1Z89A 4DB7A 1U33A 1UR8A 1G67A 3IGHX 1FOBA 4WRHA 3IIXA 1AW5A 1EJRC 3HIJA 2ODOA 3BG5A 1R3RA 3C3NA 3QHOA 5AYBA 4YVPA 3PBWA 4OWGA 3URBA 1J6PA 1MNZA 4D9PA 1W91A 3PBUA 5JBFA 3S2JA 1K02A 4NUWA 3R13A 1H63A 2E77A 1K70A 2FGLA 2P3EA 3EWXA 1HIZA 4FALA 1HJVA 1RQBA 3LXAA 2VD9A 4B2DD 1A80A 1DIKA 1UR0A 1KM2A 5BMXA 3NAVA 1OFQA 2JE8A 5BOOA 1HXJA 1GYMA 4BR1A 3IUIA 4J40A 3G8RA 4Y96A 3KCJA 3ENLA 1UD4A 1EO5A 4FNTA 5H2ZA 5AZ0A 5I24A 3QGKC 3BSMA 2ZDSA 4A6GA 2DJLA 3VNMA 2IKGA 2ZZ2A 2GQAA 3MUXA 1Q7QA 1DIOA 2P10A 5T26A 1X8FA 4X60A 1K8XA 4GX9A 1TPB1 4O0KA 1C7TA 1XRFA 5CPTA 3CB8A 1SFSA 2J25A 1DL3A 1LP6A 2WVTA 3VOHA 1JDEA 2WJEA 1Z9AA 4PMJA 3TZNA 3OYXA 4E8DA 4L9ZA 3NQEA 4AQLA 3MSGA 1EX1A 4ASTA 2XIOA 4GC4A 2JBMA 4S1FA 5JIPA 1T96A 3QR0A 1TCMA 2PDFA 5C9WA 1ME9A 8A3HA 2VRQA 3QLLA 5AYYA 1J93A 2P0OA 3LRLA 3S1GA 1W3NA 3EOUA 4BF7A 4KEVA 1SPQA 4LC8A 3L66A 3QY7A 5KETA 3LB0A 2DZAA 4OECA 3STGA 2WZIA 3LV5A 5T9CE 1DXFA 3FHQA 4UTHA 4N42A 3QBUA 1ENUA 3LCXA 4DM2A 1DV7A 4QR6A 1Z42A 1BFNA 5GJNA 4C6DA 2QUNA 4DBWA 5HPCA 3KVMA 2BNJA 4PTDA 4DNMA 1K8YA 1TJRA 1QI2A 3R8HA 1JR1A 4X9YA 3UY7A 1I2RA 1GUVA 4LH8A 1GWJA 1YX1A 2AOSA 1JYWA 5FL1A 3HPXA 3O0KA 3TN4A 5AHNA 3LUTA 1NH6A 1GVQA 4FIRA 1QRQA 1FRBA 3CIWA 3F4DA 3WQ6A 5DANA 5HNTA 4GUHA 3GVQA 1HZYA 2FHCA 3W2NA 5KEZA 1PKYA 4RV8A 3GDMA 4AZIA 3PSWA 3T09A 3UR7A 1ODUA 1FDJA 4MOZA 2B31A 2NUYA 3HZ3A 4AWUA 4PMNA 2WOQA 3GQYA 3GR7A 2YL8A 4PB5A 2ZE3A 4S3CA 5F7UA 1QBAA 1VC4A 1GOWA 5HBFA 4GUJA 2A7PA 4O12A 2PZNA 2B0MA 2RDXA 1KBBA 4P7RA 4DO7A 4KWSA 3TW7A 4N02A 3HQPA 1QU4A 1AMYA 1IYXA 5JBDA 1PTDA 2QV4A 3N29A 1AQ0A 1TR9A 5KZDA 2QULA 1QUMA 1TIMA 2YIHA 1IEXA 3QN3A 5CPSA 3M0YA 1HNYA 2BX7A 3NL6A 2OGYA 3N6JA 3VUPA 2ESCA 5AOUA 4ATLA 1B3OA 1E5JA 1RUSA 5M17A 1PEZA 3O7UA 2GK1B 4ZQOA 3QY8A 1JYXA 4F4RA 3LS9A 1AW1A 1TFVA 4ORIA 3LHYA 3DI1A 4XK2A 2QYGA 4Y9PA 3STFA 2PRHA 1GQJA 1S5WA 4YTUA 1I0DA 4CQBA 3WYZA 4DYEA 3R5EA 1FXPA 1KXHA 1TRDA 3TAOA 1OFAA 2XUCA 1J9YA 1YHTA 2X1SA 3W00A 4OUIA 2Q8XA 3RGTA 5FEXA 3WF2A 4AF0B 5AHFA 3A3WA 2FZBA 1E9IA 5A6LA 2ZUUA 3GE7A 3JUGA 2DVUA 3KRSA 2CBIA 3B4YA 3WQ4A 4BQ5A 8XIAA 1B54A 1EGZA 1NDZA 3VXGA 1VHCA 3TYZA 4UTUA 4JHMA 3V3WA 2ZVRA 4M81A 3NYDA 4JOMA 1UA7A 1X38A 1UR2A 1RA5A 2PD9A 3BO9A 1TWWA 3QGAC 4FOJA 4GIRA 2B7NA 4KWUA 3WK3A 3A6OA 3WH9A 4MADA 2I7GA 2EPMX 3W0KA 2A6NA 2VZTA 4OKDA 4M6VA 1DEDA 3PWGA 2QW5A 1PV8A 3SUVA 1TPUA 4B5UA 1TTIA 2C8NA 3L4YA 3OVRA 4Q32A 3W29A 1ADOA 2PCEA 1H5VA 5KITA 2NWRA 3ITYA 3I6TA 1YLVA 4WKAA 4FLSA 4MFEA 4AF0A 4M7TA 4LOCA 4JFSA 3M0LA 3GHRA 1S5MA 4RE4A 2ADAA 4E4UA 1FWDC 2WHLA 4AWSA 1JXJA 1ONWA 3UYIA 4NASA 2QAFA 2FLIA 2NT0A 5A5WA 1N55A 3GHUA 1LQAA 1UOZA 1RJPA 4Y9AA 1PZ2A 3NO3A 2PLCA 2CU0A 4XKYB 3TYDA 3S0CA 4YL2A 1KM0A 2OEKA 2Z29A 4AZ6A 5REQB 3SCUA 2VFDA 4DPPA 4TX8A 4YU1A 4FEZA 3O6YX 2WBKA 4XB3A 5I03A 4GISA 1BLIA 2PWFA 1C8YA 5ABHA 5E6ZA 3REQA 4LRSA 3MZ2A 2ZC1A 3HMJG 3UWZA 4G2DA 4BWLC 4UTMA 1GG0A 2D69A 4QSFA 5DCDA 4UR9A 1OC5A 5HNRA 5A8QA 1ADSA 3VNJA 3ARWA 3GH5A 1I9CB 4W8LA 3K5XA 3M6DA 3GNRA 4CU6A 4GI9A 1F8IA 4O28A 1HP4A 4ZO6A 3IJDA 3AXHA 1KTNA 1VS1A 1M7JA 2D0HA 5E1QA 5BWAA 1UH4A 4MB4A 1UD3A 3Q58A 1GQKA 4LAZA 1E6PA 1QATA 1JDDA 4Z42C 4W7VA 1KV8A 1W5NA 4D1IA 4WXYA 3HG5A 4PGLA 1ZJAA 3WLMA 9RUBA 2CW6A 3IVSA 4QIUA 4L4MA 1HP5A 1QO5A 3LLDA 1XQLA 3DESA 3PK7A 3NQBA 1BEUA 2XHYA 4WD0A 1B57A 3W38A 4HJFA 3TN6A 2F38A 2GGIA 5FAJA 4XIMA 2CHNA 3W88A 1FDYA 3WH6A 3LHUA 1CT5A 3BGGA 1B1YA 2W79A 3S5ZA 3P61A 1IXPA 2B7QA 2WB5A 4KF1A 3VDGA 4DEFA 1QT1A 2CNCA 3KLLA 3P60A 3SRDA 1HG3A 1YPFA 3LV6A 3RPTA 4RNIA 2NWSA 4US6A 3V5CA 4CCEA 1G4EA 3B0YA 1QVBA 1T7LA 2YW3A 1TPFA 4LCSA 3LPOA 2PB1A 4OQVA 5CJNA 3WBXA 2XGIA 1EDGA 2QAPA 3BWWA 9CGTA 3DXIA 1J96A 1QASA 2FPTA 4Q4RA 3TOPA 4IMCA 4NT0A 2W0UA 3SIZA 1CWYA 3ANYA 3LZ3A 1B9ZA 4C6BA 3PPGA 5EYWA 1KM1A 4S3JA 5D8ZA 1Q65A 2J9ZA 3EDDA 2BLEA 4I5UA 5EL1A 4GYKA 1TJ0A 2GJPA 4MB5A 4MTVA 2AQWA 3AIVA 1YQ2A 2E09A 3I7RA 3CUXA 3K13A 2ZRXA 2E68A 1NM9A 1FWJC 4MLRA 3MKVA 3WQOA 1EJVC 3BANA 1V4YA 3GVGA 1XH2A 1QJWA 4W89A 2GOKA 2J74A 4E4FA 1UZDA 1EQCA 5DT7A 3WELA 4HPHA 4ZFMA 2PDMA 4MJMA 4RK8A 3VGDA 5KZMA 3FIGA 4UNLA 2R8WA 4JFWA 5CSYA 2ACUA 4JQ4A 1A0EA 3FYYA 1BVNP 2D73A 2WMKA 1R3TA 1XYZA 4QLKA 4DELA 1JPHA 1CI1A 1SO4A 3VZZA 1HJXA 2PGFA 3OU8A 1DJHA 1ITUA 2HK0A 3RDKA 2QPXA 1XLHA 1QXLA 4LBSA 3C52A 3T44A 3O63A 3WBAA 3V36A 3AIWA 2YXXA 1MW2A 3H4GA 4H7CA 4HD5A 3S83A 2Q6ZA 3H4XA 4BI5A 4WIWA 5AC4A 3LA4A 1LL6A 2GUYA 1XIGA 3O2LA 2Q02A 1MW0A 4YTSA 5K9CA 5E9AA 2EGZA 5ABFA 5G1YA 3CEUA 1F7BA 3MUAA 1G69A 3VGGA 1PKNA 4N6EA 1V6WA 5A8PA 1UPPA 4I5XA 2PPGA 4MAZA 2YDRA 3LNPA 3TX9A 5H6HA 2GGHA 2ZTJA 4AZ7A 3SZ8A 1UUOA 3RF9A 3W01A 3OG3A 3WNMA 4OHQA 3HMCA 1TV7A 2PDYA 1D3HA 5G4WA 1JPKA 1MQRA 2GVGA 4QAWA 4GD0A 4Z0JA 2W6RA 4C6FA 3M64A 1HKIA 3CEPA 3VAVA 4JD4A 1E1CA 3VO0A 3WO8A 3QZEA 2VM8A 1EJXC 2JQXA 1E0UA 4H6RA 2E25A 1EQPA 5K9DA 1A49A 4DZ5A 3KVJA 1ZPTA 4Z08A 4QISA 5DMYA 3SCRA 2XZ7A 3N13A 5AC6A 3PB0A 4F40A 3MV01 1VF8A 3DG3A 3THUA 1CX9A 3GYEA 4CLMA 3E0FA 4GVIA 3NEHA 4H8NA 1OEPA 4D6EA 4MAVA 3W7RA 1V0NA 3GH7A 1EJWC 3F2DA 5GJPA 1VEPA 4MDPA 3L0KA 1XLAA 3N2MA 1ZFJA 4O15A 3UG3A 2ZA2A 2PI6A 5GNYA 1VFSA 4YTTA 3EDKA 3CV7A 3ERPA 3UPBA 4AVOA 4DWSD 2NVAA 2NUWA 4QCFA 3W70A 3CZLA 2AKZA 4UQ9A 4EPKA 2WMHA 4NJGA 3AS0A 3RMEA 3CV2A 4REQB 4NJIA 4LVDA 3J7HA 4PFMA 3CL8A 3VOJA 3EA3A 3ALFA 1LRQA 1E4MM 3WZ0E 2RAGA 3IK4A 3CH9A 3P2VA 2V3GA 1UQYA 1UPMB 1PWMA 4AEFA 3KOWA 1SR0A 3N34A 4O1AA 3HM7A 2Y24A 4GZJA 2WVUA 4M0XA 1OX4A 4OV9A 4J3TA 4ZL1A 4ZMGA 4GK8A 1Q8AA 5AYXA 1GHSA 2TODA 2X42A 3PPFA 1H09A 1DWIM 2NXGA 1S2AA 2P76A 3BURA 1POJA 3E5BA 4BK9A 1RY0A 1HW6A 4Q3MA 4L6DA 5K3VA 2JIWA 1OX5A 3W1PA 1P4CA 3PZVA 4I6KA 3W1QA 1KFLA 3WLRA 4LYKA 4QCEA 1ISVA 4UTLA 3ME3A 2YBTA 3SQLA 5FF7A 1FP9A 3D6NA 3OLIA 2O56A 3TC6A 3BAIA 2FFIA 1GG1A 1QPRA 3T0AA 3FXGA 5KINA 3ZT6A 3T42A 4JN8A 1TV2A 1RK5A 2ZRWA 3LMYA 1JCNA 3SCNA 3TXVA 3AHYA 4JHZA 5FOOA 1UP3A 3P84A 3WK2A 3UPWA 3LCFA 1JDCA 3O3RA 3NQAA 1EP1A 4IX0A 3BG9A 4JFUA 1UJQA 1EL3A 2YJQA 4NYYA 1MVYA 4TUFA 3DKJA 4YTQA 1NWSA 2V3FA 4H8UA 1THFD 2W9MA 1QPKA 1L9WA 1Q6OA 1FWAC 1CEOA 3SB0A 5D2XA 4ERGA 5JMUA 1V3IA 1R30A 4TVDA 2QHAA 1P48A 4FI4A 5B7ZA 2PDPA 1MUCA 4FA3A 1ELSA 2ABAA 4D8LA 5EGRA 1E5NA 1BF6A 2HE5A 3UWVA 4Z1DA 3B4UA 2CLFA 1E0XA 1LF1A 2QCCA 2ABBA 1UKPA 4U3AA 3MYPA 3KWSA 1Q2RA 5D32A 4LAOA 1UUMA 1L6YA 3OVQA 3EWCA 5CBBA 3KCLA 2IMRA 1TUFA 3O1NA 1H61A 3PN8A 4NRSA 4Q8UA 1JRCA 2ZZ7A 3TK7A 3T0DA 4IGSA 1D8WA 4B91A 3IIVA 3W9ZA 3OOQA 3PUEA 3B3DA 5G2HA 4YHEA 1YYAA 3WD4A 4ZGYA 4X61A 3PG8A 1E0WA 3VFCA 3UYCA 1LOSA 4KWWA 3P82A 3VCNA 3I3BA 1TJ2A 4Q8OA 3RAOA 2DZSA 3LGEA 4YHGA 3A13A 4WF7A 3WQVA 5F2LA 2BVDA 4LALA 2F7FA 3CXOA 1YDVA 2VC9A 1P6BA 2H3DA 1HO4A 2VENA 1A53A 3FY1A 2IKIA 2QUTA 2W61A 3V18A 2ZCGA 3PFMA 2V3DA 4JAWA 2J9YA 2D23A 3N9SA 3BOFA 3WDHA 3PZMA 3UWEA 4DBSA 3CK5A 3FSTA 3RFAA 2FHFA 4LYRA 2A4AA 3PTMA 3MO7A 3PF3A 3QOMA 2E8ZA 4AIOA 3CUJA 3IIPA 3SBFA 4XKMA 3AHTA 1SVDA 5LHEA 2CWXA 4L1XA 3GKAA 3GR8A 4F3HA 4CQCA 2C1HA 1VCFA 2V81A 3HFTA 2W5FA 3VKKA 2BXVA 3B0XA 4Z17A 3OYZA 4A35A 3EZ4A 3NQMA 4N9BA 3MVTA 4B9YA 5CPLA 4JY8A 3T05A 4RE2A 3II1A 3LX9A 3MY9A 2DU2A 3T8QA 1VBJA 1VAHA 4LUIA 1F2JA 1XL9A 4JTEA 1WXYA 1YNYA 3PULA 1EUNA 4AY1A 2E0PA 3BLPX 1H62A 3L9CA 1L0PA 1XR2A 1V0MA 4S3DA 3R89A 2ZQ0A 1T40A 1BKHA 1CLKA 3G1SA 4O18A 1RV8A 2EO7A 1LJYA 1X39A 5C5YA 4PTMA 5CSSA 3NGJA 4O17A 4Y9MA 4JQ3A 2J77A 3BLEA 1H0IA 4B3ZA 3HG3A 4M19A 3EYPA 3NJ3A 4H8HA 3FKRA 3EKZA 3VM7A 4E2BA 3VUSA 1H1ZA 4DWSA 1W5OA 4LAMA 2DJXA 2X1IA 3CWOX 5IXEA 4GRSA 4Q8VA 4AW7A 1UC5A 1LDCA 2DGAA 1MWOA 5I78A 2JK2A 2ZOXA 4W5ZA 3CTTA 2XSBA 4OU1A 3DBPA 3UZZA 2A6LA 4LUSA 3TSDA 1OK6A 3W24A 2W63A 4QJ5B 1SZNA 3UQNA 5K7JA 2DUZA 3W7PA 1E1CB 3AZSA 3W7IA 2XPKA 4CD8A 4ADSA 1XYAA 3CPGA 4J27A 4LANA 3GXDA 2VOTA 5FEZA 3MPGA 1LWHA 3SO7A 1R46A 4DWSB 5F1VA 2NX3A 5BOEA 1SFLA 3PC0A 2PCQA 3L2LA 5BCAA 5BZAA 4GINA 3CUIA 2OZ8A 4FP1A 3FSUA 1XPYA 4E5TA 1AD1A 4LC6A 5K4ZA 3GTHA 5MF5A 4AIBA 1W1YA 1KD0A 1XC6A 4DXXA 3WNKA 4M3PA 2RDWA 4C6IA 5I02A 3JZEA 1EYWA 4ZE5A 3BARA 3EDEA 3BSGA 3SCQA 3NZPA 2D1ZA 3QPEA 3CAWA 4K37A 2FB2A 3MSYA 4XBKA 5I0DA 3IV3A 4MZ1A 2VOMA 4GY0A 4KIEA 1U22A 4FX6M 1PHQA 3UJFA 4AU0A 1MEWA 1XIFA 3ZVHA 3OZPA 4JDYA 4JDBA 3GW0A 2Q71A 4IFKB 1WDWA 2EG8A 5ECUA 3ZT7A 5J5DA 4J1OA 1VB9A 1MQQA 4GZEA 1NDWA 3VDHA 1FH9A 3H21A 2PTDA 2UBPC 1VEOA 1OX4B 2CITA 1H2JA 4JX6A 4HA0A 4A2SA 1XKYA 1JVNA 3Q4DA 2NUXA 3S3GA 3SN0A 4KGJA 2WCAA 2WSYA 3MP3A 3S2NA 2ZXAA 3P0XA 2AL1A 1Q6RA 4TO8A 4XD4A 1TWIA 1MXGA 4B3KA 1KRMA 2YZRA 5E5CA 4O50A 1B3XA 5D09A 2YCJA 4EANA 1C9WA 4JNZA 1MUWA 2CLKA 3NQFA 1LWIA 1XUZA 3UW6A 2CKRA 2GFTA 2VD8A 3V5FA 1F3EA 4CN4A 1SJDA 2BVWA 3LEPA 4IMEA 3AS1A 3QXBA 3L4XA 3VGEA 3F7JA 5CC6A 5A6SA 1G4PA 1R0MA 3PTDA 5DFAA 1JGMA 2QUMA 3E0WA 1FFQA 1Z3NA 3R7MA 4DHGA 3RHGA 5CQ1A 4QDWA 4JTCA 3SURA 3BAXA 5HULA 4DBUA 2HDJA 3DC0A 2TYSA 4G56A 2HTMA 1C8QA 3LBOA 3KRZA 5GQBA 4LWWA 3GSMA 2O4QA 3GS6A 2PRMA 1NDVA 2OQYA 2WO5A 4HCLA 3GTIA 1GORA 1FQ0A 4B5TA 1NAL1 3GRIA 4R85A 2PTYA 3VD3A 1GPFA 2QS8A 5AN7A 2OOGA 1JJKA 3A64A 3U4FA 4ZQNA 2HXUA 1B4KA 3E12A 3OLEA 3QZ6A 3NDOA 2HBVA 2Q3OA 2YSWA 4MY8A 3KXQA 2XVPA 3KTXA 1KWGA 1VZWA 3LI1A 1MW3A 1IXNA 2PZ0A 2RH9A 3T55A 4NZ3A 1UQZA 3QW3A 1T5AA 3WEMA 1XPGA 2Z00A 3UD6A 1OF8A 1TPVA 2XVNA 1K7XA 2UV8G 1VHNA 4H1ZA 1UYQA 2WNWA 1ZAHA 2ISFA 2A7RA 2EKCA 4IXHA 2X7WA 1WXZA 2GUBA 3A4JA 4FNQA 3ZR6A 3TLQA 1OADA 2UY4A 3LMZA 1IE7C 4N9DA 4W84A 4S3KA 2FB3A 1YTKA 4C7FA 2YCLB 3NXLA 3BAKA 1X1NA 2VFIA 1XD0A 5CXPA 2NQHA 4RW3A 1R3SA 5TQLA 2VZOA 4FLRA 3E9AA 1UD5A 4DUXA 4PMYA 3LBMA 4O1FA 5CZTA 5G2IA 1C7SA 5CBIA 4H9TA 1UKTA 1D3GA 2A1YA 1PWLA 1UWQA 4YVVA 2VC6A 4UOZA 2VC5A 1JFHA 2G3NA 1NFGA 4EWND 3BAJA 4ZA0A 1VBUA 4FNPA 5J8LA 1AZ2A 1Z7AA 4NRRA 2WZMA 5CBJA 4A3HA 1ISWA 5H8MA 1FHDA 3L68A 3VGBA 1LWJA 2OWWA 4NILA 3EX4A 1ZCOA 2OXNA 4U28A 1YADA 3WQWA 3N19B 4UTWA 4WKHA 1Q45A 2CHRA 1R86A 1JCMP 1RPKA 3GLCA 3CHCA 1H4PA 3EEZA 3V0TA 1Q66A 3WEOA 1HN1A 2NX1A 5EBUA 2CXGA 3NPUA 2VDGA 4P8XA 3KL0A 4DAIA 2ZZ6A 3W74A 2NV9A 1JD9A 3GHSA 4I90A 4Y9NA 4L64A 2FMOA 2DZTA 3ABSA 1R85A 1EWEA 2HSAA 5CPQA 2EAWA 3HV9A 1QFEA 5HATA 1OZQA 1RR2A 8TIMA 3ARTA 3TYUA 2BS9A 5EMLA 1B4EA 1P43A 1KRAC 1XIDA 4HVXA 3BOXA 4J4KA 5HMEA 2HV5A 2EHHA 3AAMA 3QTGA 5C2CA 1QMLA 1R9XA 1V7AA 3WF4A 3PFRA 4CNSA 3KL5A 4XD3A 1EC7A 3VE9A 1WDSA 4R34A 4DLMA 1PUDA 2BHUA 1PDZA 1OBAA 3WJSA 3WNNA 1DJXA 3TQ0A 4LUSB 1SZRA 3NDYA 3SJNA 3U7VA 4CQ9A 4X0NA 2REQA 1VP5A 3GU9A 3PJWA 4IMGA 3K4DA 2PSNA 1I0BA 4NAFA 2WC4A 3H8AA 4ROQA 3GFYA 2H3BA 3O15A 4DYJA 3TJLA 3B0UX 3N6HA 2GDVA 3LYEA 1GCYA 3DERA 1ICPA 2ISVA 2QCEA 4EP8C 4IT1A 2WYSA 1R9ZA 3QFEA 4UCFA 2F2KA 2J13A 4X2RA 4H9ZA 7CGTA 1VPQA 4XBJA 1KGWA 2XIMA 2OR2A 4JTRA 1V5XA 1W1IE 1JZ6A 3UF9A 1RY8A 1H7PA 3UWWA 1WZLA 3KS5A 3STEA 1OC6A 2V82A 1B3YA 1SM9A 1X97A 5M3WA 1JIBA 1REQB 3KHJA 4H04A 1FY6A 3KCOA 4WY0A 4XD5A 2UWFA 3BLFA 3NNTA 3WKZA 3VI2A 3QLDA 2YA0A 1LT8A 3CUHA 4QGCA 1KM5A 5E0KA 3WD3A 3IJ7A 5ABEA 1J10A 1O5RA 1RAKA 3NTYA 4PUWA 2DSZA 3H26A 3VABA 1BAGA 3TAKA 1SYTA 3THCA 2DH2A 3QFWA 2VGFA 2P5NA 4AY7A 3LPPA 3ABOA 3B8UA 3OA3A 5EMJA 3C8NA 2X41A 1F3TA 5C9UA 4JHOA 2P0IA 1W37A 2OOFA 1YIXA 3NQ2A 5FL0A 2DSUA 3NVDA 1EO7A 2VELA 2E6AA 3FA4A 2L5HA 2MNRA 4BEUA 1UH3A 2NXIA 4UTFA 2FYMA 4C65A 1E72M 2V67A 2DSKA 3V35A 3EBVA 2E1DA 1H7XA 2FGBA 3WUEA 2PRLA 4X0VA 1O5XA 4UZUA 5HK4A 1QNVA 1SFTA 3ZLHA 3I65A 1SU5A 4QM1A 3R0DA 4BKNA 3N4FA 3UG8A 4DUWA 1PIFA 4Q8NA 2E8YA 6TIMA 1NWTA 2G3MA 1LLWA 1WQ5A 5C8BB 1FKWA 4KCVA 3FDKA 2QPSA 1YNQA 2BOEX 5EFFA 4DI8A 4R88A 1G7UA 3WBEA 4DJFA 1W9BM 3WLQA 4QS6A 3GVRA 3WDRA 3LQLA 1LUCB 1PX4A 1IF2A 3VIHA 2XVKA 5LNWA 3JVAA 3QYSA 3OIHA 3NO5A 1VRDA 2E40A 3LN3A 3DENA 4J3XA 2C0HA 3QYQA 4GNJA 4X3ZA 4R7WA 1W2VA 4BFAA 4D8ZA 2PU0A 5XIMA 5KZ6A 4NKCA 3UP8A 1EZ2A 1YXCA 3LXBA 3IJ9A 5U7SA 2IXVA 3IANA 4RDYA 2FVLA 3ITCA 1W9DM 3W7DA 4AMAA 2Y5JA 2IQDA 5C7VA 4HA3A 3NGFA 4W9TA 4MWAE 3DIPA 3AFBA 4JYDA 4XVEA 4PMRA 3W27A 4DRSA 2WCSA 4ACYA 1JPIA 1GQIA 5ABGA 4LAKA 3WLLA 4HU0A 3W1NA 2O92A 3MCNA 4GIAA 3W07A 4IJRA 4W5UA 3PZIA 1Y0EA 4OBTA 1WDPA 3N4AA 3KS6A 1JNDA 1QI0A 1VJSA 3PUGA 4ZTXA 4D6HA 3WNPA 3TR9A 9XIAA 1V93A 4LVGA 3IARA 1JAEA 2F6UA 3EAUA 1A3XA 4PFHA 3W1TA 2O9OA 1QI4A 1KCLA 3W7KA 1P1MA 1EHNA 4JN7A 4PTWA 4HSNA 3WENA 1RK6A 4RCXA 1FH8A 4GA8A 2WVSA 3W6LA 1JCLA 1WKDA 4UQDA 4IPLA 2WHJA 4MNKA 4OTKA 1PX8A 4RKAA 3CLWA 4K8EA 3U2OA 1XICA 1ZZMA 3DYPA 5FAGA 1CGXA 5CCZA 1VBRA 4JKLA 2RHGA 1L6GA 1TV8A 4XBSA 3PZNA 2V2DA 5HJLA 4UTIA 4Q8QA 1SQ7A 2DZVA 4ES4A 3DG6A 3GY1A 5DMMA 4M56A 5AHLA 1VYPX 4C6NA 3LQGA 1VIZA 4TV6A 3UETA 2FPVA 3KM8A 5BYWA 4OJYA 3I68A 5D33A 1V02E 1LRTA 1BVWA 1Q7MA 2YA1A 3UU0A 4IH3A 4OOZA 5LIUX 3NR0A 2XN0A 1W56A 4PCSA 5MKGA 3EXRA 2HVOA 4EK7A 1GOKA 5L6UA 4W88A 1HGWA 3R0UA 3OB8A 3I3DA 3P8IA 3M0KA 4AZHA 2A5HA 3BMXA 2VP8A 3KVLA 4M1RA 3RPDA 3W2MA 4WSJA 1G94A 4JBRA 4LY4A 5HQMA 1YTDA 3QV7A 1R7AA 2OEMA 3WLJA 3O07A 3KEHA 4XZHA 4F2BA 3GB6A 4F0MA 1TX2A 1JZ8A 3C5QA 4YWIA 1DQUA 3U6WA 2HK1A 1XSKA 1A5OC 1KFWA 4PEEA 4GUFA 4EPBC 3BCDA 4D72A 1KBLA 5ENLA 3DZ1A 1SSGA 3CZJA 1PVNA 4NJHA 1DE5A 4XZNX 4QQ3A 3L21A 2WMIA 3HBLA 1MI3A 2XJ7A 4IQJA 1PYFA 1MQPA 2OTDA 3LD5A 4KW2A 3MVIA 1R9YA 1H51A 5BU6A 4F66A 7A3HA 5FJRA 5DT5A 2W3ZA 2GL5A 5LXXA 4L9YA 4H2HA 1Q6GA 1OCJA 5C55A 2PGEA 3LCWA 3S8HA 1JUBA 2BDQA 3IAQA 3K46A 4IIFA 2F84A 4HTYA 2NQLA 3VVGA 3G3MA 3L4UA 3MTWA 4MNLA 3W7CA 3O8AA 3T81A 5AHEA 2TPSA 4ADUA 4QFUA 3WMBA 3FK4A 1QI3A 1D3CA 3LSCA 1VEMA 1W32A 3UFYA 4Z1BA 3TMLA 3N2TA 4Q33A 1XLCA 3D3AA 2WJZA 3PZ9A 3WDIA 4F48A 2Z7GA 1F74A 3FNDA 1UR1A 4S2CA 3WNLA 1W3HA 1VFTA 3M0IA 4QX4A 1FWRA 2QMJA 4ZSUA 1AJ0A 3E3HA 3VM5A 2XIIA 1QTWA 4JFVA 1F3XA 2D2GA 2GVYA 1RJRA 2Z2BA 2X1TA 3LM3A 4UTKA 4ZFCA 5DRIA 3USZA 3KRBA 1B30A 4JEJA 1M41A 3ZSSA 3FVMA 3VNDA 4CNOA 1REQA 3CQIA 4PTVA 1A3WA 1K8ZA 3VE7A 2E7FA 1L2UA 2FDSA 1D7KA 1B90A 1QNSA 4ZQRA 2YPIA 3SFWA 3CHDA 3TTEA 3MW7A 1W2PA 1VIWA 5RUBA 4C7DA 3ZO9A 1UB3A 1XIEA 3CYJA 3BPWA 3PBVA 1DVJA 1HX0A 2NVCA 3O9NA 5HAOA 4GI6A 1B0IA 3WN6A 3LGDA 1EC8A 3MYOA 4BJHA 4LBRA 1LOQA 1SSDA 4HHLA 4Q6JA 4RXGA 4B16A 1HGYA 3OA5A 2P8CA 1RQEA 4HYVA 1N82A 1KBKA 4IIEA 1JGIA 3EDFA 5MHBA 3O6CA 3S5OA 2QJJA 2PURA 2YCEA 3NIYA 3K1DA 1DWGM 2V69A 1MDLA 3BE7A 4HZMA 4H9MA 4LEFA 2FDMA 4D6JA 5C2GA 4DZIA 3F5KA 5DXXA 5G4HC 1PDYA 2BHYA 1XLGA 4QQUA 3FJ6A 3PP7A 2Y62A 4Z1AA 4LU0A 3ITXA 2RKXA 1IEVA 3MUIA 2D0FA 4LUTB 4J5NA 2OU4A 2SFPA 1PZ1A 2VVNA 1OFRA 2J7EA 4HPXA 4TX6A 3TJIA 3WSUA 1R3WA 2CZVA 2YYTA 1LL7A 3Q65A 3TJ4A 4IFOA 2QDDA 1F6KA 1LG2A 3BLOA 1EP3A 3GBDA 1SUXA 1X1ZA 3W6MA 1PZ3A 3PZTA 1KGXA 3TN3A 4PTXA 1WV2A 4JTGA 1ZALA 1T6MA 1V03A 2DZPA 3NO1A 4J3SA 3EOLA 3TFCA 5HMSA 3FX4A 1IGWA 4O14A 1OJXA 1GVRA 1ICQA 1PPIA 4MPKA 4DJFC 4IL0A 3WF1A 4M82A 1QO2A 1H3GA 3B0PA 1RH9A 2VX4A 4S3FA 3PHAA 3UJEA 2C91A 1EIBA 2H90A 3S47A 2GJLA 1U5HA 4UQBA 4LRTA 3KUMA 3QKEA 3AZRA 1E6SM 2DPEA 4NZFA 4TIMA 3NWRA 4M1BA 4JTFA 2OYMA 4Y8EA 5BOFA 1YBQB 3H6OA 1JZ7A 2A3AA 3A21A 3PZQA 1V3MA 1VYSX 2W4XA 2G50A 2YL6A 3NSMA 1OM0A 1CYGA 2WJDA 2WW5A 3W7HA 4NNAA 1M3UA 3VTRA 1OK4A 3AMKA 4C6KA 4ORMA 3CL6A 3AU2A 3IJQA 1A5SA 2GK1A 3GG0A 5B80A 2WAGA 1HL9A 4HU4A 1R2TA 1GQNA 4BA0A 1H5YA 2VEMA 3EX2A 3T4CA 1KWKA 4EX4A 1WAUA 3P8JA 3GVWA 2Y0FA 2HMCA 1AMKA 4RXFA 4AZCB 3DH7A 3W7NA 1HJWA 3C2RA 3RR1A 1FCQA 3FJLA 3E2SA 3NL2A 2OPJA 4NG3A 3TYBA 4MJ2A 1JZ3A 1XD1A 3SUUA 2HPIA 4BQ2A 3TC3A 1M53A 2NT1A 2P50A 1C92A 4MYXA 3T7VA 3B03A 3ZM8A 4HCDA 4JYFA 4HHMA 4N9CA 2CEQA 1XFBA 1QK2A 2DSWA 4ZO8A 2OYKA 4MJZA 1C9DA 4N9EA 4HP5A 1BXCA 1YEYA 3GIPA 3OQ8A 4JTJA 2BV9A 2D2HA 3S9ZA 1TRIA 3BICA 1UA3A 3SGGA 4L65A 5BXTA 1K8CA 2JALA 3OHIA 3UCQA 3XINA 3G24A 1C3FA 4FMVA 1MRAA 3ARRA 3M5YA 3NM3A 1UWRA 4ZOCA 2V8ZA 4H9YA 4NY2A 2YCIX 1F07A 1FWSA 4CGTA 4GBUA 1TA3B 4O16A 2R82A 1CPUA 5A2CA 4PMQA 2W92A 2WSPA 3TOYA 2HBXA 3CPRA 3VIJA 3DFPA 4TVUA 4O0ZA 1JULA 1WX0A 3I10A 4XO7A 5D04C 4JCLA 1DORA 3U5YA 1ALDA 3ZLGA 1BXBA 2PFHA 3RCMA 3R1ZA 4LVBA 2Z6IA 1QHPA 4XSMA 4IXXA 4XSLA 3G77A 2VCAA 1O5QA 1TMLA 3SDOA 3S1XA 3PJTA 3CWHA 3B9DA 1CXIA 5XIAA 4YN5A 3G0SA 4K6AA 3GTXA 2NX9A 1US0A 1JPMA 1J6OA 4B4HA 3L65A 4J3UA 2KZHA 3WQDA 4O1CA 2DUAA 2IPJA 2GWNA 4CU7A 2XYLA 4GYJA 4N6FA 5D9OA 3AIRA 4PB3A 3HA1A 3INPA 4PH6A 3TYAA 2E6YA 2NV2A 3RJYA 3VU2A 3BJTA 5AYIA 2DEPA 3I7QA 2QLYA 5DY2A 4U4MA 4UNKA 3NCOA 5K4XA 3NM1A 1UCWA 2GJNA 4OFCA 4P8VA 1KR1A 1BQGA 1JQXA 3Q2DA 1HF6A 5AHMA 3H7UA 1YMYA 2XM2A 3TJXA 3EGJA 4AY8A 2VUYA 1XGEA 1H41A 4K2SA 4ATDA 1OIFA 3CNYA 1UWIA 2AMGA 1DJWA 5D4YA 3W75A 4Y8FA 1QOXA 5D9MA 4C6EA 3MT1A 3LLXA 1J5TA 3LBCA 4MB1A 3GC5A 3QMSA 3QPYA 2X0HA