1JPXA

Mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. wild type.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
59
Chain Sequence
b'GIVQQQQQLLDVVKRQQELLRLTVWGTKQEWERKVDFLEENITALLEEAQIQQEKNMYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 envelope protein
publication title Mutations that destabilize the gp41 core are determinants for stabilizing the simian immunodeficiency virus-CPmac envelope glycoprotein complex.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 25
structure length 59
sequence length 73
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2001-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jpxA00
2EZPA 3P30A 5KA6A 4FK5C 4FJCC 1F23A 4JF3A 2M7WA 3K9AA 3CYOA 5CMUA 5KA5A 4N21A 5HFLA 1MG1A 3GWOA 1ENVA 1EBOA 1K33A 1I5XA 4JGSA 4FIPC 1QR8A 1DF5A 3MHHC 2EBOA 1QR9A 3B8NA 3MHSC 1Y66A 2P6JA 1JPXA 1DLBA 3B8MA 5H9CA 3B77A 1DF4A 5CN0A 1QCEA 4E2LA 4G2KA 2EZOA 4JPRA 4N23A 1I5YA 1QBZA 2OT5A 3M99B 1SZTA 3CP1A 3H01A 1Y4MA 1MOFA 2MK3A 3WFVA 2X7RB 1JQ0A 5HFMA 2LP7A 1K34A
chains in the Genus database with same CATH superfamily
1M56B 1M4UA 1QLEC 1K4CC 2M7WA 1IBLO 2OTLV 1OHHG 3CRQA 4KHPB 1VARA 1OCZC 4DR5B 1EZJA 3JASB 1SQVH 1G1XB 4IYHA 1KU9A 4Z1VA 1VQ9V 3B77A 3LDDA 4X64O 2F4VO 1H8HG 3WB1A 4JTDB 1V55C 4WFFA 5JVDB 2IJKA 3WB2A 5IJ9A 3FYEB 4U3JB 2QM8A 2WLKA 4LFBB 1HR0B 5B1NA 4JYCA 3EFFK 2VQEO 1OCRC 1SRYA 1JMKC 3E86A 4K0KB 4MW3A 2ZDIA 1YVWA 3QTCA 4O4LB 1YXBA 4X89A 3G67A 1XUQA 3CP1A 1VQ5V 2IJIA 1SQBH 4KUMA 3PN1A 2ILMA 3SPCA 4MVOA 4U3JA 1IBKB 5H6RA 2HJFC 2LGQA 2EIKC 4FVMA 2HP8A 3MHHC 3P3PA 1XBLA 5JJJB 1ZL8B 1N33O 3RYIB 1VIBA 2CAZC 5CN0A 3LNNA 2KKWA 1ZLZA 1T5EA 4KXRA 5C8YB 3ZMUA 1JR9A 2Z5UA 4NR1A 2UUCB 3L75H 1VF6A 2RNBA 1YHQV 4JI3O 4FM2A 4FPPA 3ASNB 1BHAA 3OE7G 4OPHA 4RUFA 1HW7A 1Y76A 1RSOA 4FZ1A 5B3SC 4UVCA 1SF9A 1SQGA 3AG1C 1QLNA 3K5NA 1K34A 2GUZB 1JOYA 2DQ3A 2QEXV 3AG7A 5C8YA 4PD4F 4D7TA 2X6BA 3BFRA 4LC1A 4BR6A 3SYOA 3FYIB 4TT3G 1OZ0A 3ZMTA 3ABMB 2EIMB 2R72A 3FAVA 4P2ZA 2ZKOA 2FMLA 1AJNA 4MTOA 1HNZB 3JD1A 2IU0A 1HR0O 1JQ0A 1EM1A 2XAGA 4K3AA 2HVJC 2QWRB 1XMOB 5HFLA 5H2FZ 2CUGA 2QM7A 3GWKC 4AQYO 2ZM6O 1FS0G 2EBOA 4WF9V 3ZRVA 1Y66A 1M9NA 5LXTB 3DC5A 4CS2A 2ZQMA 1PL0A 2ZXWC 3FB6C 4TSFG 1KQSU 5CA1B 2Q7EA 3OMAB 3RVYA 4CS3A 1IBKO 3TCUA 3WG7C 4I50B 4LF4O 1NVPB 4K35A 1LNQA 4TUYA 1S5HC 4N21A 4RQEA 4PHZA 1ZWIC 3N2GB 1P49A 2Y4UA 2W6JG 1LUWA 4WFGA 3QO5A 2QWOB 4JPRA 2JRIA 4TV8A 3AG3B 4WCEV 4BIOA 1M56C 1X59A 2XAJA 4Z2WA 4I9QA 4A5UB 3SR2C 1TAEA 4J41A 4ABMA 4K8XA 4JGSA 1H38A 5EBWC 4JYAB 2Y69B 5EK0A 1YEWA 3K06A 2WLLA 3E22A 1IX9A 4LFCB 5IDJA 2ETNA 4HNAB 5KHGA 4OGQB 1Q43A 4CC6A 1NH2B 1MSWD 1XHZA 4PA7A 4QNHB 3AG2B 2YIDA 3P3NA 4DV0O 5H5NA 2CH7B 2Q73A 2PF4E 1XL4A 1HNZO 5EBMC 1AP5A 1UJWB 1M93A 3D3IA 1YJ9V 3JCUZ 5J9PC 1YZBA 3ZS8C 1IXMA 3HPLC 4QE9A 1N8RW 2A0LA 3W7XA 3J7AU 3Q4HA 4Z1MG 2P22C 1NKDA 3JD2A 3OD4A 4EB6A 4YIPA 2IJHA 4H37A 1M1KW 1Z5WA 2K9PA 3STZC 1ZSPA 4X8AA 4EEQA 2VRZA 4FK5C 1F23A 5KX5A 3T4ZA 3A0RA 4F6EA 1JJ2U 1KC8W 3OGIB 1XEQA 3ASNC 3K5MA 4Q6GA 2RCVA 3BY6A 5GTHZ 4LF9O 3T1HB 4AI8A 1WPXA 3JD0A 2N05A 1MOFA 3W7UA 4FFBB 1N0JA 4DV1B 2Y0IA 4GKJB 2HR3A 3OUSA 2JK5C 3DTUB 4FFKA 2YIBA 4F6RB 3KKYA 2XNDG 2VWJA 1Y67A 3K0GA 3AK2A 2DJVA 2B1GA 2EIMC 1NI8A 1R3LC 3SYCA 3KCYA 4GZRB 1GMGA 3ABTA 1NR1A 3I56V 1XNRB 1BMFG 5LMNO 2UUBO 1N34B 1OCCB 4PDMA 4JYBA 5B1AB 2EINB 1URFA 3AK3A 4O4JA 3CC4V 1B6QA 5FNVA 3SPIA 4B3RB 5K1PA 2ZCEA 4JI8B 1B06A 4X1KA 3JATA 3BRCA 4MT8A 2HHHO 4NKGB 2PI4A 3NXSA 1VP7A 2QKAA 3BHPA 4P9PA 3SJCC 2R9RB 1FYJA 1SESA 2P5OA 1KP2A 3SPGA 4B3SB 4NB5A 5F2VO 4HBNA 1K8AW 2FB5A 3O9OA 5JH7A 4DK0A 4NXNO 4RQFA 2CGOA 3T1CA 4DV6B 3QG5A 3WFVA 3T1YB 2LP7A 4DYLA 1BT8A 3DXRA 4IIJB 3HKDB 2WLHA 4FJCC 3M7MX 3N27A 4JF3A 3H1KH 1YSCA 2EJ7A 5LA6A 1H2SB 4UFZA 2WLJA 3LDCA 4UCOA 4FLYA 3ZRSA 1B3QA 4MS2A 2PUSA 4PA3A 1MABG 4JI7B 3JYCA 1FPOA 5CA3A 2XUMA 2Y69C 2BTQB 4DV1O 4GKJO 4JASA 1XILA 4JAAA 3W7WA 5IYZA 3A8TA 5KAFZ 3F5TA 1R3IC 4I4TB 3AG2C 5LGUA 1US6A 1K73W 1K5SA 3UKMA 4DW1A 4TWKA 3APQA 5BMVB 4J42A 3FKSG 3SGIA 2QTOA 1H2MA 1GM7A 1KP3A 1J5EO 5EYPA 5LGTA 4JZ2A 4H0LB 2WA3A 3OFNG 1GAXA 5AG2A 3E8HA 2Y0PA 1S5JA 2F93B 5IJ0B 2P06A 2Q9LA 4JI1B 3SJQC 4DUYB 1GN6A 4JI5B 3S3WA 1QR9A 2ZE5A 4MTGA 1L1FA 4UVAA 4PDLA 3LUTB 4PV1B 1Q6UA 4NTWA 1M5IA 4YJ3A 4BAYA 1Y4MA 4DRXB 4I55B 5KA5A 2PZSA 2Q69A 4LWSA 2Q5ZA 3OR7C 4KP4A 4B3SO 4NTXA 5EIBD 5E79Z 1ENVA 5IJ0A 2DQ0A 2CDYA 3UT5B 5IY5B 2X6CA 1IBLB 1P7BA 1THZA 4LR3A 4DV6O 3HKCA 3T1YO 4X1YA 5B1BC 1SKVA 4X64B 2F4VB 1VEWA 4Q20A 1S72V 3JSNA 1E79G 1IDSA 4DV7B 3ZHRA 1SERA 2H3OA 1XNQO 4MVZA 5B66Z 2LW7A 4JI7O 1PM9A 4LFAO 3K5LA 3N2KB 2VQEB 3JAKB 2YXHA 1VQPV 1VQ4V 1BS3A 3K79A 3H1IH 1G6UA 2ZT9B 4UCVA 3DSQA 1W0JG 5EIBC 1V54B 3CRAA 1R73A 2XHBA 2WSSG 5JCOC 1N32O 2YC0A 3H1JH 4I0XA 1OCCC 4GUNA 3SPJA 2AZ0A 5B1AC 2EINC 4U7OA 1FFXB 2UXCO 2LFRA 4OPAA 2QSAA 1U96A 4DK1A 3IFXA 4RWUA 4UVBA 1AJPA 1AR4A 4LP8A 4JI1O 4DV5B 3CMEV 4DUYO 4JI5O 3CCQV 2E76B 4HAMA 4JI2B 5EC2C 3MHSC 2HG5C 1GN3A 4WFEA 4JI3B 2Z0AA 1GH6A 1FKAO 5CB4A 3BABA 5LOVA 2DWDC 5H9CA 4RO2A 1CPYA 3FX7A 3C3SA 3OUFA 5KUMA 2CK3G 1EBOA 5JJEB 4MVRA 2UU9B 3JAWA 1S76D 5K1XA 1RM1C 3UCSC 3CXCU 3AEIA 4FLTA 2CTPA 2XT9A 1V9PA 4D6TH 2V1DA 3GVMA 3CWBH 4CBCA 4DV7O 1MNGA 2W0FC 5J2UB 1G4YB 2HVKC 1EFRG 3I55V 4CC5A 2JGDB 1S3JA 2ITDC 1VQKV 2GSMB 5KUKA 1VQOV 2GDSA 4IT5A 1KD1W 2WLNA 5L3EA 4PI0A 3ZJZA 4AQYB 3E35A 3OGCC 5D5QA 4DR2B 2ZM6B 1K97A 3JASA 1WB8A 4PA9A 1G8MA 3QO8A 4BIZA 5BY1A 4ZBMA 3VQXA 3CJHB 4E4EA 4NTYA 3P30A 4LNUB 2HJDA 1Q6IA 5JVDA 4QPKA 3THOA 1GKFA 2UXXA 4R6ZA 2JGDA 4LF4B 4GLXA 2B1IA 1NTMH 3W7TA 2P6JA 3LSUA 5KHJA 1S77D 1EZVH 2ZE6A 2IBZH 4K8ZA 2JS5A 5BR8O 3H1LH 2Y4TA 5BXZA 1ORQC 4O4LA 4DV5O 3PJSK 4FLWA 1IZ3A 1H2KA 4MVSA 3CCUV 3OR6C 1GO3F 1XOUA 4JI2O 1VQ8V 4FLXA 3ETEA 4U3FH 5IY5C 4UV8A 5L3CA 1ZL8A 4WFAV 1Y74B 3RYIA 3ZX6A 2OWOA 4BW9A 1TUEB 1HWYA 4BW5A 1D5NA 1LUVA 4DR6B 4PDVA 3RYHB 2AW9A 4IHJB 2UU9O 2ZINA 3QVNA 2DYRC 2Z3YA 4FIPC 2UXDB 4DR3O 4DV0B 4CH4A 2AXTZ 3J80N 1SC5B 1AI6A 1Q5OA 1K92A 2KG7B 1AI7A 1V54C 3CMAV 2D3OW 3ZHSA 1DK1A 2X6AA 3CYOA 1JFFB 3RYHA 2GUZA 2DYSC 5IYBO 4DR2O 1JCHA 4JI0O 2V7QG 1D5AA 4MVMA 4QJFB 1QCEA 4GX1A 3R65A 2HFEC 4JAUA 4CH3A 4CH5A 1FXVA 1IURA 5IE9A 2BSKB 4UCRA 2FL4A 3HKBB 3FB7C 3GWOA 2AHZA 3ML0A 1GTOA 3EVKA 3VQVA 4IGGA 1F4MA 3CPWU 4O4HB 5LXTA 3VQYA 4N23A 1RP3B 3ZEDA 3RVZA 1W2BU 2X7RB 1D2DA 2DW4A 4LF9B 1DTOA 5CA1A 4JTCB 4I50A 5JWPA 2EX3A 3B8NA 1SQFA 3ABUA 3N2GA 1PKXA 1XI1A 3RYCB 4DR6O 1HNWB 1Q6HA 2QR4A 1QHTA 2R9IA 1YDXA 2AGAA 5EZYB 3VQWA 5J2TB 5IYDO 2UXDO 1NS1A 5LMNB 2UUBB 1HP8A 2YXYA 3LSSA 5E1AC 5KHKA 3ZBHA 3BAAA 3UO2A 2EZOA 5DM6V 3JD3A 4WBNB 1QVFU 5LHHA 4PA4A 3K58A 2YI9A 4FLUA 4GT1A 1BGYH 1IVSA 4HNAA 4JAVA 2HHHB 4EFEA 1PV0A 3QNEA 1WLEA 2Q6AA 1P84F 2CH7A 3RFRA 4QPJA 2DOSA 3SPHA 1SA0B 3JCZA 1PD3A 1GM9A 2JEXA 2GHYA 3UQ8A 4LCUC 1XMQO 4DV4O 2X0LA 2K1EA 4ZIBA 2EULA 1KBHA 2E74B 4NYKA 2A06H 3G4SV 4NXNB 1KUQA 3CHXA 3HB3B 2ADPA 2IM9A 5LP6B 3ABLB 1JPXA 4OXSA 5CA0B 3ZN1A 3KG2A 3ZHUA 4B3TB 2KQXA 2P67A 2IH3C 4X88A 4LF7B 2CGNA 3F5WC 2G38A 3H1HH 1ROPA 3JARB 1DGSA 4C7UA 3LNMB 2LQTA 2VQFB 4ZOLB 3JSLA 3RYFB 1W0KG 1ZUQA 4H13B 1HNWO 4X1IB 2UXBO 1PNLA 3ABMC 1VQNV 4IYIA 3F7VC 3G6BA 5GW7A 3B4SA 3BA9A 1GN2A 5FLXN 3ZHTA 1CP9A 2EZPA 1J5EB 3K5OA 4FFBA 1PNMA 4RUEA 2P90A 4X9QA 2CTWA 1Q81W 4RAIA 1R1BA 1M90W 5LL6Y 1QVGU 3QO7A 4F6RA 1MMMA 2ZNIA 4X20B 1OJHA 1WB7A 3LSQA 3AG4B 2HKOA 4TV9B 2E3CA 2PI5A 1E1QG 4MTFA 1JA8A 5KMGB 5IYCO 3G80A 1F51A 1K5QA 5JCOA 4AILC 3OEHG 3ETDA 4DV3O 1O9GA 1DF5A 2E5LB 3TK1A 3CCRV 3WU2Z 2WLIB 2XAFA 1TUBB 3RN4A 4B3MO 3JALB 4GX5A 1JJOA 3G6EV 4J9ZB 2CTRA 1YIJV 2W0XA 3SJAC 4UV9A 2ZNJA 4J7JA 3AG3C 1Z5VA 2IW5A 2Q7GA 2AHYA 2OTJV 3K0DA 1XNQB 1TA8A 4XDKA 4B3TO 1VMGA 1XHXA 4J10A 1NTZH 4YJ2B 5JQGB 2QWNB 4R50A 4LFAB 4GCZA 1TUBA 4TQFA 4LF7O 4TOIA 1I7FA 2BCCH 1S0VA 3FB5C 2VQFO 3CXHF 3KCXA 3B09A 1UFIA 4IIJA 3SDLA 3HKDA 5B5EZ 1OCZB 2ITCC 4H44B 1N32B 3K57A 3LDEA 2A9HA 1P7GA 3ICXA 3L70H 2EIJB 3UM7A 2ZE8A 1QBZA 4ZHQB 1H2LA 4JYYA 5JQGA 2P4KA 5BZBA 4FZ0A 1L0NH 1I94B 2MK3A 3E89A 1COWG 2BTQA 2UXCB 4FLVA 2GBOA 4X65B 4J9YB 3K08A 4I4TA 4W4KA 3OAAG 3QF7A 3ETGA 3K59A 1WJZA 5BMVA 1K7DA 2BTOA 1W59A 4O2AB 4AHCA 2QTSA 3CCSV 4LF6B 5CBFA 3CRRA 2E5LO 5DECA 2RQ6A 4EKWA 5LP6C 1XQ8A 5ITZB 4ZI7B 2B5UA 2N04A 1AJQA 3L71H 4FMTA 3ABLC 2LW1A 3TJTA 4O4IB 4DW0A 1WAZA 1AP6A 2RDCA 4DRXA 4DV2O 1VF7A 3ABKB 4I55A 4CZZA 4WFHA 1K33A 3OW2U 5H6QA 3UT5A 1K4DC 3APOA 3AG1B 3M99B 3IC9A 3ZRWB 2V4DA 2GTSA 2L35A 1FXHA 5HFMA 4D7SA 3CS5A 2FKXA 4MVQA 2D2CB 2UXNA 2FYUH 4B7EA 2XAQA 2UUAO 3G71V 4FM1A 2QDOA 2JGUA 1IBMO 1NT2B 4BWAA 4PJ0Z 1I94O 1OV9A 3N2KA 2E75B 2YEVB 3JAKA 1H2GA 1AB3A 3AG4C 4X65O 1WA8B 3HKEB 3D36A 3TGUH 5BR8B 3MAQA 2Q0OC 1NBMG 2BE3A 1FAFA 2ZE7A 2LFSA 1GRJA 1IXBA 3OT7A 1YF2A 2QWPB 1FD9A 1A32A 5L3DA 4E2LA 4LH6A 1K3EA 4LF6O 3CCLV 4L87A 1KECA 3BPZA 1FFXA 1BQ0A 3EHBB 2PTMA 1N0NA 2JVDA 3CX5F 1MA1A 4UCUA 4IL6Z 3SJBC 3ZIAG 3TETA 1L8DA 2JJ2G 2YXLA 1N4CA 3C3TA 3FB8C 4P9OA 2NN4A 2EJRA 2PGGA 1RFYA 2PY5A 5TISZ 1H8EG 3O65A 1H2NA 4DR3B 2F95B 1BCCH 5IJ9B 1AI4A 2B9ZA 4MW8A 3X2QB 1MZFA 3JAMN 3E8GA 1Q8IA 4MTXA 3K03A 1K9MW 3T4DA 1JVMA 1NR7A 1BL8A 1WPBA 4YY3B 4UXNA 2QA4V 1ZAUA 3OEEG 1YJNV 3ZHQA 2F1MA 1O9HA 1AR1B 1VQMV 4JI0B 2EIJC 2WA4A 4X62B 2JS3A 3TXQA 5J2UA 3A0BZ 3H9VA 2DE0X 4PI2A 3CD6V 2MW2B 3ZMVA 4HYOA 3CCJV 1YJWV 4FM0A 2OT5A 4UCSA 3U11A 3C90A 1Q90D 1QNMA 3CJHA 2LJ2A 1Y6XA 1WN7A 3IJ4A 4LNUA 1PPJH 4LF5B 3RT3C 5LHGA 1Y76B 2NNUA 1RSOB 1Q3EA 4YHHB 2YICA 3JD4A 2Q8VA 3FD9A 4DR1O 1YTFD 1N36O 1P4RA 5L3FA 1BHBA 3ABKC 2DWEC 4LF8O 1EN6A 2R70A 1GM8A 3FAVB 2OCCB 4PELA 1AR5A 4NXMB 1XL6A 1FJGB 2M6YA 5LBQA 4DR7B 3E83A 3RW0A 1TGOA 1SETA 1CEZA 1Y74A 1NJIW 3D36C 4F4LA 1PNKA 4KHPO 2F23A 4DR5O 5LHIA 4YY3O 4IHJA 3AK1A 2XASA 3ZHVA 4LBEC 4X62O 3ZRXA 2YI8A 4R8CA 4LFBO 3H01A 4TUYB 5CBGA 1XMQB 2KG7A 4DV4B 1UPGA 4JI6B 5A2QN 2VWKA 2Q4PA 1R3JC 4K0KO 2Q0AA 1JFFA 2PYJA 1AROP 2BOCC 4TV8B 1AILA 4DR4B 2LO1A 3BEHA 4TQDA 1I5XA 3CRCA 3A0HZ 3T2MA 3L74H 2ZIMA 2BSKA 1MG1A 4LF5O 2RJZA 3HKBA 2KSDA 5A9GA 4PDRA 4H33A 1Q82W 2YIAA 4YHHO 3IC7A 2WLLB 2N74A 4HZ3A 3E22B 3CEIA 3L9DA 1WP8A 2YUAA 3KZIZ 2DMXA 2YDEA 2UXBB 4O4HA 4GX0A 2UUCO 1OCOB 3BCCH 4QE7A 3X2QC 4I5SA 2YS8A 1GN4A 2ZR3A 3K9AA 3RWRD 2ARHA 3MD0A 4NXMO 1NU1H 3HR0A 1FJGO 3E8BA 1FXKB 2ZDIC 4DR7O 3B40A 1CXZB 2OIGA 2OIEA 1J95A 3CC7V 1R6TA 3UO3A 2Y48A 1VQ7V 3RYCA 1ZTEA 3Q4HB 4O2BB 2NLJC 1MZEA 2JJ1G 3CSXA 1M57B 5EZYA 3S3XA 4EB6B 5J2TA 3ZN0A 1QR8A 1RPOA 3MDSA 5L3BA 4CH6A 5L3GA 4YXWG 5JJNB 3DC6A 4DV3B 1FXKA 3OMIB 3CE2A 3CB2A 4JI6O 2QJ1A 5KX5B 1XMOO 2CE4A 4B3MB 1BQZA 4WBNA 1VF6C 2ZIOA 1KKDA 4O2BA 1ZX3A 4QIWF 4XDLA 1B04A 1R3KC 2WLMA 1XREA 2FTKA 3B8MA 4DR4O 4G2KA 5LYJB 1X4TA 4MVUA 1SA0A 5FPOA 1GK9A 2IU3A 5FL7G 3E8FA 5KHHA 1F4NA 1SQQH 4DUZB 4L8JA 1VQLV 2JEUA 3D8CA 1NQTA 2Q67A 4OX9B 2YSUB 4G28B 2OCCC 2Q68A 5LP6A 3F7YC 5B1BB 4JV5B 5CA0A 4J7KA 3RBZA 4ASUG 4DXWA 3ASOB 5LYJA 3R66A 1XDCA 3CCMV 3L72H 1PP9H 4CS4A 3GB7C 3I5DA 5LGNA 3DGEA 5IWAB 4NVPA 3WB0A 3CCEV 3J81N 4O4JB 3JARA 2GTAA 2A79B 2ODMA 4JYAO 1AVMA 2ADQB 1VQ6V 4J11A 1NVPD 5FNVB 4I9WA 1YITV 1KMIZ 4ZOLA 3L73H 3TXSA 3RYFA 3ZMSA 4LFCO 4X1KB 3JATB 2W6IG 4X1IA 3A2FA 1KYOF 2QGNA 3ZCCA 3CRMA 1S5LZ 5CBHA 1SS3A 1YI2V 4WFBV 3OMNB 5JH7B 1RPRA 4GKKB 4LH7A 3VBBA 4QGPA 4I7ZB 4EFBA 2EILB 1EN5A 3DXRB 2R9AA 2OCHA 1SQPH 1R6KA 4X20A 1VF5B 5LA6B 2IJJA 5B1OA 1QQCA 4TV9A 1WNSA 2P4VA 5KMGA 4UB8Z 2Q7HA 1PL4A 1F7YA 2HEPA 4DV2B 1BE3H 4GYCB 4J7ZA 1NH2D 2XAHA 2JDIG 2CTQA 3RGBA 4ZKIA 3VOUA 1QU7A 2WLIA 1TVKB 4W4LA 4XDJA 5IYZB 3ZMZA 5KHIA 2WWWA 4UUJC 2F43G 3JALA 4DUZO 1OCOC 1QLEB 1FFTB 4X66B 2XTAA 3OM3B 1LR1A 5D5PA 4OX9O 4JTAB 1RM1B 4R7CA 3K04A 1FXKC 3NR7A 3T1HO 5LMUB 2UUAB 4JV5O 5EYPB 5IT9N 5C93A 1IBMB 2QKSA 1HDJA 1V55B 3BVOA 4YJ2A 3M8AA 2O57A 1TVKA 5IWAO 3OTOB 5CMUA 1Q86W 5GONB 1OCRB 1M57C 2HLDG 4XBFA 2H94A 2RMKB 3FFQA 4PA6A 3CCVV 2H8PC 5EC1C 2KB1A 2YIBD 2QM4A 4YJ3B 5DN6G 1XNRO 1I5YA 4LWSB 3IGAC 1KKCA 1N34O 4ZHQA 4J80A 1BZKA 4YIOA 2F66C 2EIKB 1I0HA 3W7SA 1MSDA 4GKKO 3EXAA 2A3QA 1WP7A 5GONA 2A7WA 3K9SA 3IAYA 4B3RO 3HKCB 2ZD9A 4X1YB 1HNXB 4JI8O 1E1RG 1JX9A 3P32A 5KLVH 4JI4B 2WAMA 2ATKC 2P7TC 1YCIA 4O2AA 1EN4A 5KA6A 1NTKH 2LGWA 4KFMA 1SZXA 3SYAA 4B7KA 2WPDG 4G27B 5ITZA 4ZI7A 5B3SB 3E2EA 1NZ6A 2QE7G 2XOKG 2DN9A 1AI5A 4X66O 4O4IA 3ASOC 3K3WA 4I0XB 1KB9F 1I08A 2DYRB 3D3QA 1R6NA 1Q7YW 5GTIZ 5LMUO 1L0LH 3ETQA 1DLBA 2BOBC 1YTFB 4UB6Z 3SYQA 1DF4A 3U0ZA 2GV9A 3OTOO 4UCTA 1SZTA 2JIZG 5KAIZ 4FLZA 1SQXH 3BA8A 4MSWC 3ZRWA 1BSMA 4KL1A 4P30A 2DYSB 3U10A 2L6LA 4JZGA 2NR5A 2OYQA 2ZXWB 5CB4B 2ZR2A 4U7NA 5LOVB 2EILC 1Z2GA 1N33B 2IH1C 2VS0A 3WG7B 2YEVA 5DEDA 2RN9A 3STLC 4ICGA 3SYPA 3JAWB 4BIUA 4DR1B 5EBLC 4DO2A 1WA8A 3HKEA 1N36B 5FPRA 1HNXO 3OTFA 2C2AA 4LF8B 4JI4O 4GX2A 3B2EE 4B08A 1U97A 2QKCA 2AZ2A 3CC2V 2QWQB 2PYLA
chains in the Genus database with same CATH topology
1M56B 3OFNG 5CBGA 3F5WC 1ROPA 3E8HA 1QLEC 1K4CC 2M7WA 3LNMB 2OTLV 1OHHG 1R3JC 3SJQC 1OCZC 1EZJA 1AROP 1W0KG 1QR9A 1L1FA 4MTGA 4UVAA 2BOCC 4PDLA 1VQ9V 3B77A 1PNLA 3ABMC 3LUTB 3LDDA 1VQNV 3F7VC 1H8HG 5GW7A 4JTDB 1V55C 4BAYA 1Y4MA 3BEHA 4WFFA 5KA5A 2IJKA 1I5XA 2Q69A 1CP9A 3FYEB 2EZPA 2QM8A 2WLKA 3T2MA 3OR7C 4KP4A 1PNMA 5B1NA 4JYCA 1MG1A 4RUEA 3EFFK 1ENVA 2P90A 1OCRC 2DQ0A 5IY5B 1Q81W 4RAIA 2X6CA 4PDRA 4H33A 1SRYA 1Q82W 3E86A 1P7BA 1THZA 1M90W 4MW3A 3IC7A 2WLLB 2ZDIA 4HZ3A 1QVGU 3QO7A 4X89A 3LSQA 3CP1A 5B1BC 1VQ5V 3AG4B 2HKOA 2PI5A 4GX0A 2IJIA 1E1QG 1OCOB 4MTFA 4KUMA 4Q20A 4QE7A 5IYCO 3X2QC 3SPCA 4I5SA 1S72V 4MVOA 1E79G 1F51A 2ZR3A 3K9AA 1SERA 1K5QA 5H6RA 3OEHG 2HJFC 3ETDA 4MVZA 2EIKC 3MD0A 3MHHC 1DF5A 3TK1A 3CCRV 3E8BA 1FXKB 2ZDIC 2WLIB 1VQPV 2XAFA 1VQ4V 1J95A 3K79A 3CC7V 5CN0A 4GX5A 1W0JG 2Y48A 1VQ7V 3G6EV 4J9ZB 1V54B 1YIJV 1R73A 3ZMUA 2WSSG 4UV9A 2NLJC 2JJ1G 3AG3C 2Z5UA 1M57B 2IW5A 1YHQV 1OCCC 3SPJA 3ZN0A 2AHYA 1QR8A 1RPOA 5L3BA 5L3GA 2OTJV 3K0DA 4FPPA 4YXWG 5B1AC 3ASNB 2EINC 4U7OA 1BHAA 4XDKA 1FXKA 3OE7G 3OMIB 4R50A 4GCZA 4RUFA 2LFRA 5B3SC 4UVCA 3AG1C 3IFXA 1QLNA 1K34A 4UVBA 1AJPA 1S0VA 1JOYA 2DQ3A 3FB5C 4LP8A 2QEXV 3CMEV 1KKDA 2X6BA 4LC1A 3CCQV 1OCZB 2ITCC 4QIWF 4HAMA 4XDLA 5EC2C 3SYOA 1R3KC 3FYIB 2HG5C 3MHSC 2WLMA 1OZ0A 3LDEA 4TT3G 2A9HA 2FTKA 3ABMB 3ZMTA 3B8MA 2EIMB 4WFEA 4P2ZA 2EIJB 4G2KA 1AJNA 3UM7A 1QBZA 4MTOA 3JD1A 4MVUA 5BZBA 2IU0A 1GK9A 2MK3A 3E89A 1JQ0A 2DWDC 2IU3A 1COWG 5FL7G 5H9CA 3E8FA 4RO2A 1CPYA 2XAGA 2HVJC 4J9YB 5HFLA 1F4NA 3K08A 3OUFA 5KUMA 2QM7A 2CK3G 1EBOA 4MVRA 1S76D 1VQLV 2JEUA 1NQTA 1FS0G 2EBOA 2Q67A 2YSUB 3OAAG 4WF9V 1RM1C 4G28B 3ZRVA 1Y66A 1M9NA 2OCCC 2Q68A 3ETGA 3CXCU 3AEIA 2ZQMA 1K7DA 1PL0A 3F7YC 2ZXWC 5B1BB 3FB6C 4TSFG 2V1DA 1KQSU 3RBZA 4ASUG 4DXWA 3ASOB 3OMAB 3RVYA 3CCMV 4CBCA 2W0FC 3GB7C 1G4YB 3TCUA 3CCSV 2HVKC 1EFRG 3WG7C 5CBFA 3I55V 1NVPB 5LGNA 1LNQA 3DGEA 1S3JA 2ITDC 1S5HC 4N21A 4RQEA 1VQKV 2GSMB 5KUKA 3CCEV 1VQOV 2A79B 1KD1W 1ZWIC 1VQ6V 4EKWA 2WLNA 5L3EA 1NVPD 2B5UA 2W6JG 4I9WA 1AJQA 4FMTA 3ABLC 3ZJZA 1YITV 3E35A 3OGCC 4WFGA 3ZMSA 1K97A 3QO5A 4JPRA 2W6IG 4PA9A 1G8MA 3QO8A 4BIZA 4ZBMA 3ZCCA 5CBHA 3AG3B 4WCEV 1M56C 2XAJA 3P30A 1YI2V 3ABKB 4QPKA 4CZZA 4WFHA 4WFBV 1GKFA 2UXXA 1K33A 4R6ZA 4JGSA 2B1IA 3OMNB 3OW2U 5H6QA 3W7TA 1RPRA 2P6JA 1H38A 5EBWC 3VBBA 1K4DC 1S77D 2Y69B 5EK0A 2EILB 3K06A 3AG1B 3M99B 2WLLA 3ZRWB 1ORQC 1FXHA 5IDJA 1R6KA 3PJSK 5HFMA 4MVSA 1NH2B 3CCUV 1MSWD 2IJJA 5B1OA 3OR6C 4PA7A 4MVQA 4QNHB 2UXNA 3AG2B 1GO3F 2XAQA 1VQ8V 3G71V 3ETEA 1NH2D 2XAHA 5IY5C 2JDIG 1XL4A 4UV8A 5L3CA 5EBMC 4ZKIA 4WFAV 3VOUA 1UJWB 2YEVB 2WLIA 3D3IA 4XDJA 1H2GA 1YJ9V 1TUEB 5J9PC 1HWYA 3ZMZA 4BW5A 2WWWA 3AG4C 2F43G 4UUJC 1IXMA 3HPLC 4PDVA 4QE9A 1OCOC 1QLEB 1FFTB 3D36A 1N8RW 2A0LA 3OM3B 3W7XA 1NBMG 4Z1MG 2DYRC 1NKDA 3JD2A 2Z3YA 4FIPC 4JTAB 1RM1B 4R7CA 2LFSA 3K04A 1FXKC 2IJHA 4H37A 1M1KW 5C93A 3STZC 5L3DA 2QKSA 4E2LA 1AI6A 1K92A 1V55B 1K3EA 4X8AA 3CCLV 1AI7A 4L87A 1KECA 1V54C 3CMAV 3EHBB 2D3OW 4FK5C 1F23A 2X6AA 3CYOA 3T4ZA 5CMUA 1Q86W 3A0RA 3ZIAG 1OCRB 1M57C 3TETA 2HLDG 4XBFA 2H94A 4PA6A 2JJ2G 3CCVV 2DYSC 1JJ2U 5IYBO 2H8PC 5EC1C 1KC8W 1JCHA 3FB8C 4P9OA 2KB1A 2V7QG 2EJRA 3ASNC 1H8EG 3BY6A 4MVMA 4QJFB 5DN6G 1QCEA 4GX1A 3R65A 2HFEC 4JAUA 1I5YA 1FXVA 1WPXA 1AI4A 3JD0A 1MOFA 4MW8A 3W7UA 3IGAC 3X2QB 2HR3A 3OUSA 3E8GA 4MTXA 2EIKB 3FB7C 2JK5C 3GWOA 3K03A 3W7SA 1K9MW 3DTUB 3T4DA 1JVMA 1NR7A 2AHZA 3ML0A 1BL8A 1GTOA 4UXNA 2XNDG 2QA4V 3OEEG 2ZD9A 1YJNV 3K0GA 1E1RG 1AR1B 1F4MA 3CPWU 2B1GA 2EIMC 1JX9A 1R3LC 3P32A 3SYCA 1VQMV 4N23A 2WAMA 2EIJC 1GMGA 3RVZA 3ABTA 1NR1A 1W2BU 3I56V 2X7RB 2ATKC 2DW4A 1DTOA 2P7TC 1BMFG 5KA6A 4JTCB 1OCCB 4KFMA 4PDMA 3SYAA 4JYBA 5B1AB 3CD6V 2EINB 3B8NA 3ZMVA 2WPDG 4HYOA 3CCJV 3CC4V 1B6QA 4G27B 3ABUA 1YJWV 1PKXA 3SPIA 5B3SB 2OT5A 3E2EA 2QE7G 2XOKG 1AI5A 3ASOC 4MT8A 2R9IA 3K3WA 2PI4A 3NXSA 5IYDO 2DYRB 4P9PA 2R9RB 1SESA 1R6NA 1KP2A 3SPGA 1Q7YW 5LHGA 1K8AW 1DLBA 2NNUA 2BOBC 3LSSA 1YTFB 5E1AC 3SYQA 1DF4A 2EZOA 5DM6V 3JD4A 3JD3A 1SZTA 2JIZG 5LHHA 4RQFA 1QVFU 3T1CA 3WFVA 1YTFD 2LP7A 4MSWC 4PA4A 3ZRWA 1P4RA 2WLHA 4GT1A 4FJCC 4JF3A 5L3FA 1BHBA 3ABKC 1YSCA 4JAVA 4P30A 2DWEC 2DYSB 2WLJA 3LDCA 3QNEA 1GM8A 1WLEA 3ZRSA 2Q6AA 4MS2A 2OCCB 4PELA 4PA3A 1XL6A 1MABG 4QPJA 3JYCA 3SPHA 5CA3A 2ZXWB 5LBQA 2ZR2A 3JCZA 1PD3A 1GM9A 2JEXA 2Y69C 4U7NA 2EILC 2GHYA 4LCUC 2IH1C 4JASA 2X0LA 3E83A 3RW0A 2K1EA 3W7WA 3WG7B 1SETA 1CEZA 2YEVA 1NJIW 4F4LA 3STLC 1PNKA 1R3IC 3G4SV 3SYPA 4BIUA 5LHIA 3AG2C 5LGUA 5EBLC 4DO2A 1K73W 1K5SA 3UKMA 3HB3B 4TWKA 2XASA 2C2AA 3ABLB 1JPXA 4OXSA 3FKSG 4GX2A 2QTOA 1GM7A 3ZN1A 3KG2A 3CC2V 1KP3A 4LBEC 3ZRXA 4R8CA 3H01A 5LGTA 2P67A 2IH3C 4X88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZP A;  3P30 A;  5KA6 A;  4FK5 C;  4FJC C;  1F23 A;  4JF3 A;  2M7W A;  3K9A A;  3CYO A;  5CMU A;  5KA5 A;  4N21 A;  5HFL A;  1MG1 A;  3GWO A;  1ENV A;  1EBO A;  1K33 A;  1I5X A;  4JGS A;  4FIP C;  1QR8 A;  1DF5 A;  3MHH C;  2EBO A;  1QR9 A;  3B8N A;  3MHS C;  1Y66 A;  2P6J A;  1JPX A;  1DLB A;  3B8M A;  5H9C A;  3B77 A;  1DF4 A;  5CN0 A;  1QCE A;  4E2L A;  4G2K A;  2EZO A;  4JPR A;  4N23 A;  1I5Y A;  1QBZ A;  2OT5 A;  3M99 B;  1SZT A;  3CP1 A;  3H01 A;  1Y4M A;  1MOF A;  2MK3 A;  3WFV A;  2X7R B;  1JQ0 A;  5HFM A;  2LP7 A;  1K34 A; 
#chains in the Genus database with same CATH topology
 1M56 B;  1M4U A;  1QLE C;  1K4C C;  2M7W A;  1IBL O;  2OTL V;  1OHH G;  3CRQ A;  4KHP B;  1VAR A;  1OCZ C;  4DR5 B;  1EZJ A;  3JAS B;  1SQV H;  1G1X B;  4IYH A;  1KU9 A;  4Z1V A;  1VQ9 V;  3B77 A;  3LDD A;  4X64 O;  2F4V O;  1H8H G;  3WB1 A;  4JTD B;  1V55 C;  4WFF A;  5JVD B;  2IJK A;  3WB2 A;  5IJ9 A;  3FYE B;  4U3J B;  2QM8 A;  2WLK A;  4LFB B;  1HR0 B;  5B1N A;  4JYC A;  3EFF K;  2VQE O;  1OCR C;  1SRY A;  1JMK C;  3E86 A;  4K0K B;  4MW3 A;  2ZDI A;  1YVW A;  3QTC A;  4O4L B;  1YXB A;  4X89 A;  3G67 A;  1XUQ A;  3CP1 A;  1VQ5 V;  2IJI A;  1SQB H;  4KUM A;  3PN1 A;  2ILM A;  3SPC A;  4MVO A;  4U3J A;  1IBK B;  5H6R A;  2HJF C;  2LGQ A;  2EIK C;  4FVM A;  2HP8 A;  3MHH C;  3P3P A;  1XBL A;  5JJJ B;  1ZL8 B;  1N33 O;  3RYI B;  1VIB A;  2CAZ C;  5CN0 A;  3LNN A;  2KKW A;  1ZLZ A;  1T5E A;  4KXR A;  5C8Y B;  3ZMU A;  1JR9 A;  2Z5U A;  4NR1 A;  2UUC B;  3L75 H;  1VF6 A;  2RNB A;  1YHQ V;  4JI3 O;  4FM2 A;  4FPP A;  3ASN B;  1BHA A;  3OE7 G;  4OPH A;  4RUF A;  1HW7 A;  1Y76 A;  1RSO A;  4FZ1 A;  5B3S C;  4UVC A;  1SF9 A;  1SQG A;  3AG1 C;  1QLN A;  3K5N A;  1K34 A;  2GUZ B;  1JOY A;  2DQ3 A;  2QEX V;  3AG7 A;  5C8Y A;  4PD4 F;  4D7T A;  2X6B A;  3BFR A;  4LC1 A;  4BR6 A;  3SYO A;  3FYI B;  4TT3 G;  1OZ0 A;  3ZMT A;  3ABM B;  2EIM B;  2R72 A;  3FAV A;  4P2Z A;  2ZKO A;  2FML A;  1AJN A;  4MTO A;  1HNZ B;  3JD1 A;  2IU0 A;  1HR0 O;  1JQ0 A;  1EM1 A;  2XAG A;  4K3A A;  2HVJ C;  2QWR B;  1XMO B;  5HFL A;  5H2F Z;  2CUG A;  2QM7 A;  3GWK C;  4AQY O;  2ZM6 O;  1FS0 G;  2EBO A;  4WF9 V;  3ZRV A;  1Y66 A;  1M9N A;  5LXT B;  3DC5 A;  4CS2 A;  2ZQM A;  1PL0 A;  2ZXW C;  3FB6 C;  4TSF G;  1KQS U;  5CA1 B;  2Q7E A;  3OMA B;  3RVY A;  4CS3 A;  1IBK O;  3TCU A;  3WG7 C;  4I50 B;  4LF4 O;  1NVP B;  4K35 A;  1LNQ A;  4TUY A;  1S5H C;  4N21 A;  4RQE A;  4PHZ A;  1ZWI C;  3N2G B;  1P49 A;  2Y4U A;  2W6J G;  1LUW A;  4WFG A;  3QO5 A;  2QWO B;  4JPR A;  2JRI A;  4TV8 A;  3AG3 B;  4WCE V;  4BIO A;  1M56 C;  1X59 A;  2XAJ A;  4Z2W A;  4I9Q A;  4A5U B;  3SR2 C;  1TAE A;  4J41 A;  4ABM A;  4K8X A;  4JGS A;  1H38 A;  5EBW C;  4JYA B;  2Y69 B;  5EK0 A;  1YEW A;  3K06 A;  2WLL A;  3E22 A;  1IX9 A;  4LFC B;  5IDJ A;  2ETN A;  4HNA B;  5KHG A;  4OGQ B;  1Q43 A;  4CC6 A;  1NH2 B;  1MSW D;  1XHZ A;  4PA7 A;  4QNH B;  3AG2 B;  2YID A;  3P3N A;  4DV0 O;  5H5N A;  2CH7 B;  2Q73 A;  2PF4 E;  1XL4 A;  1HNZ O;  5EBM C;  1AP5 A;  1UJW B;  1M93 A;  3D3I A;  1YJ9 V;  3JCU Z;  5J9P C;  1YZB A;  3ZS8 C;  1IXM A;  3HPL C;  4QE9 A;  1N8R W;  2A0L A;  3W7X A;  3J7A U;  3Q4H A;  4Z1M G;  2P22 C;  1NKD A;  3JD2 A;  3OD4 A;  4EB6 A;  4YIP A;  2IJH A;  4H37 A;  1M1K W;  1Z5W A;  2K9P A;  3STZ C;  1ZSP A;  4X8A A;  4EEQ A;  2VRZ A;  4FK5 C;  1F23 A;  5KX5 A;  3T4Z A;  3A0R A;  4F6E A;  1JJ2 U;  1KC8 W;  3OGI B;  1XEQ A;  3ASN C;  3K5M A;  4Q6G A;  2RCV A;  3BY6 A;  5GTH Z;  4LF9 O;  3T1H B;  4AI8 A;  1WPX A;  3JD0 A;  2N05 A;  1MOF A;  3W7U A;  4FFB B;  1N0J A;  4DV1 B;  2Y0I A;  4GKJ B;  2HR3 A;  3OUS A;  2JK5 C;  3DTU B;  4FFK A;  2YIB A;  4F6R B;  3KKY A;  2XND G;  2VWJ A;  1Y67 A;  3K0G A;  3AK2 A;  2DJV A;  2B1G A;  2EIM C;  1NI8 A;  1R3L C;  3SYC A;  3KCY A;  4GZR B;  1GMG A;  3ABT A;  1NR1 A;  3I56 V;  1XNR B;  1BMF G;  5LMN O;  2UUB O;  1N34 B;  1OCC B;  4PDM A;  4JYB A;  5B1A B;  2EIN B;  1URF A;  3AK3 A;  4O4J A;  3CC4 V;  1B6Q A;  5FNV A;  3SPI A;  4B3R B;  5K1P A;  2ZCE A;  4JI8 B;  1B06 A;  4X1K A;  3JAT A;  3BRC A;  4MT8 A;  2HHH O;  4NKG B;  2PI4 A;  3NXS A;  1VP7 A;  2QKA A;  3BHP A;  4P9P A;  3SJC C;  2R9R B;  1FYJ A;  1SES A;  2P5O A;  1KP2 A;  3SPG A;  4B3S B;  4NB5 A;  5F2V O;  4HBN A;  1K8A W;  2FB5 A;  3O9O A;  5JH7 A;  4DK0 A;  4NXN O;  4RQF A;  2CGO A;  3T1C A;  4DV6 B;  3QG5 A;  3WFV A;  3T1Y B;  2LP7 A;  4DYL A;  1BT8 A;  3DXR A;  4IIJ B;  3HKD B;  2WLH A;  4FJC C;  3M7M X;  3N27 A;  4JF3 A;  3H1K H;  1YSC A;  2EJ7 A;  5LA6 A;  1H2S B;  4UFZ A;  2WLJ A;  3LDC A;  4UCO A;  4FLY A;  3ZRS A;  1B3Q A;  4MS2 A;  2PUS A;  4PA3 A;  1MAB G;  4JI7 B;  3JYC A;  1FPO A;  5CA3 A;  2XUM A;  2Y69 C;  2BTQ B;  4DV1 O;  4GKJ O;  4JAS A;  1XIL A;  4JAA A;  3W7W A;  5IYZ A;  3A8T A;  5KAF Z;  3F5T A;  1R3I C;  4I4T B;  3AG2 C;  5LGU A;  1US6 A;  1K73 W;  1K5S A;  3UKM A;  4DW1 A;  4TWK A;  3APQ A;  5BMV B;  4J42 A;  3FKS G;  3SGI A;  2QTO A;  1H2M A;  1GM7 A;  1KP3 A;  1J5E O;  5EYP A;  5LGT A;  4JZ2 A;  4H0L B;  2WA3 A;  3OFN G;  1GAX A;  5AG2 A;  3E8H A;  2Y0P A;  1S5J A;  2F93 B;  5IJ0 B;  2P06 A;  2Q9L A;  4JI1 B;  3SJQ C;  4DUY B;  1GN6 A;  4JI5 B;  3S3W A;  1QR9 A;  2ZE5 A;  4MTG A;  1L1F A;  4UVA A;  4PDL A;  3LUT B;  4PV1 B;  1Q6U A;  4NTW A;  1M5I A;  4YJ3 A;  4BAY A;  1Y4M A;  4DRX B;  4I55 B;  5KA5 A;  2PZS A;  2Q69 A;  4LWS A;  2Q5Z A;  3OR7 C;  4KP4 A;  4B3S O;  4NTX A;  5EIB D;  5E79 Z;  1ENV A;  5IJ0 A;  2DQ0 A;  2CDY A;  3UT5 B;  5IY5 B;  2X6C A;  1IBL B;  1P7B A;  1THZ A;  4LR3 A;  4DV6 O;  3HKC A;  3T1Y O;  4X1Y A;  5B1B C;  1SKV A;  4X64 B;  2F4V B;  1VEW A;  4Q20 A;  1S72 V;  3JSN A;  1E79 G;  1IDS A;  4DV7 B;  3ZHR A;  1SER A;  2H3O A;  1XNQ O;  4MVZ A;  5B66 Z;  2LW7 A;  4JI7 O;  1PM9 A;  4LFA O;  3K5L A;  3N2K B;  2VQE B;  3JAK B;  2YXH A;  1VQP V;  1VQ4 V;  1BS3 A;  3K79 A;  3H1I H;  1G6U A;  2ZT9 B;  4UCV A;  3DSQ A;  1W0J G;  5EIB C;  1V54 B;  3CRA A;  1R73 A;  2XHB A;  2WSS G;  5JCO C;  1N32 O;  2YC0 A;  3H1J H;  4I0X A;  1OCC C;  4GUN A;  3SPJ A;  2AZ0 A;  5B1A C;  2EIN C;  4U7O A;  1FFX B;  2UXC O;  2LFR A;  4OPA A;  2QSA A;  1U96 A;  4DK1 A;  3IFX A;  4RWU A;  4UVB A;  1AJP A;  1AR4 A;  4LP8 A;  4JI1 O;  4DV5 B;  3CME V;  4DUY O;  4JI5 O;  3CCQ V;  2E76 B;  4HAM A;  4JI2 B;  5EC2 C;  3MHS C;  2HG5 C;  1GN3 A;  4WFE A;  4JI3 B;  2Z0A A;  1GH6 A;  1FKA O;  5CB4 A;  3BAB A;  5LOV A;  2DWD C;  5H9C A;  4RO2 A;  1CPY A;  3FX7 A;  3C3S A;  3OUF A;  5KUM A;  2CK3 G;  1EBO A;  5JJE B;  4MVR A;  2UU9 B;  3JAW A;  1S76 D;  5K1X A;  1RM1 C;  3UCS C;  3CXC U;  3AEI A;  4FLT A;  2CTP A;  2XT9 A;  1V9P A;  4D6T H;  2V1D A;  3GVM A;  3CWB H;  4CBC A;  4DV7 O;  1MNG A;  2W0F C;  5J2U B;  1G4Y B;  2HVK C;  1EFR G;  3I55 V;  4CC5 A;  2JGD B;  1S3J A;  2ITD C;  1VQK V;  2GSM B;  5KUK A;  1VQO V;  2GDS A;  4IT5 A;  1KD1 W;  2WLN A;  5L3E A;  4PI0 A;  3ZJZ A;  4AQY B;  3E35 A;  3OGC C;  5D5Q A;  4DR2 B;  2ZM6 B;  1K97 A;  3JAS A;  1WB8 A;  4PA9 A;  1G8M A;  3QO8 A;  4BIZ A;  5BY1 A;  4ZBM A;  3VQX A;  3CJH B;  4E4E A;  4NTY A;  3P30 A;  4LNU B;  2HJD A;  1Q6I A;  5JVD A;  4QPK A;  3THO A;  1GKF A;  2UXX A;  4R6Z A;  2JGD A;  4LF4 B;  4GLX A;  2B1I A;  1NTM H;  3W7T A;  2P6J A;  3LSU A;  5KHJ A;  1S77 D;  1EZV H;  2ZE6 A;  2IBZ H;  4K8Z A;  2JS5 A;  5BR8 O;  3H1L H;  2Y4T A;  5BXZ A;  1ORQ C;  4O4L A;  4DV5 O;  3PJS K;  4FLW A;  1IZ3 A;  1H2K A;  4MVS A;  3CCU V;  3OR6 C;  1GO3 F;  1XOU A;  4JI2 O;  1VQ8 V;  4FLX A;  3ETE A;  4U3F H;  5IY5 C;  4UV8 A;  5L3C A;  1ZL8 A;  4WFA V;  1Y74 B;  3RYI A;  3ZX6 A;  2OWO A;  4BW9 A;  1TUE B;  1HWY A;  4BW5 A;  1D5N A;  1LUV A;  4DR6 B;  4PDV A;  3RYH B;  2AW9 A;  4IHJ B;  2UU9 O;  2ZIN A;  3QVN A;  2DYR C;  2Z3Y A;  4FIP C;  2UXD B;  4DR3 O;  4DV0 B;  4CH4 A;  2AXT Z;  3J80 N;  1SC5 B;  1AI6 A;  1Q5O A;  1K92 A;  2KG7 B;  1AI7 A;  1V54 C;  3CMA V;  2D3O W;  3ZHS A;  1DK1 A;  2X6A A;  3CYO A;  1JFF B;  3RYH A;  2GUZ A;  2DYS C;  5IYB O;  4DR2 O;  1JCH A;  4JI0 O;  2V7Q G;  1D5A A;  4MVM A;  4QJF B;  1QCE A;  4GX1 A;  3R65 A;  2HFE C;  4JAU A;  4CH3 A;  4CH5 A;  1FXV A;  1IUR A;  5IE9 A;  2BSK B;  4UCR A;  2FL4 A;  3HKB B;  3FB7 C;  3GWO A;  2AHZ A;  3ML0 A;  1GTO A;  3EVK A;  3VQV A;  4IGG A;  1F4M A;  3CPW U;  4O4H B;  5LXT A;  3VQY A;  4N23 A;  1RP3 B;  3ZED A;  3RVZ A;  1W2B U;  2X7R B;  1D2D A;  2DW4 A;  4LF9 B;  1DTO A;  5CA1 A;  4JTC B;  4I50 A;  5JWP A;  2EX3 A;  3B8N A;  1SQF A;  3ABU A;  3N2G A;  1PKX A;  1XI1 A;  3RYC B;  4DR6 O;  1HNW B;  1Q6H A;  2QR4 A;  1QHT A;  2R9I A;  1YDX A;  2AGA A;  5EZY B;  3VQW A;  5J2T B;  5IYD O;  2UXD O;  1NS1 A;  5LMN B;  2UUB B;  1HP8 A;  2YXY A;  3LSS A;  5E1A C;  5KHK A;  3ZBH A;  3BAA A;  3UO2 A;  2EZO A;  5DM6 V;  3JD3 A;  4WBN B;  1QVF U;  5LHH A;  4PA4 A;  3K58 A;  2YI9 A;  4FLU A;  4GT1 A;  1BGY H;  1IVS A;  4HNA A;  4JAV A;  2HHH B;  4EFE A;  1PV0 A;  3QNE A;  1WLE A;  2Q6A A;  1P84 F;  2CH7 A;  3RFR A;  4QPJ A;  2DOS A;  3SPH A;  1SA0 B;  3JCZ A;  1PD3 A;  1GM9 A;  2JEX A;  2GHY A;  3UQ8 A;  4LCU C;  1XMQ O;  4DV4 O;  2X0L A;  2K1E A;  4ZIB A;  2EUL A;  1KBH A;  2E74 B;  4NYK A;  2A06 H;  3G4S V;  4NXN B;  1KUQ A;  3CHX A;  3HB3 B;  2ADP A;  2IM9 A;  5LP6 B;  3ABL B;  1JPX A;  4OXS A;  5CA0 B;  3ZN1 A;  3KG2 A;  3ZHU A;  4B3T B;  2KQX A;  2P67 A;  2IH3 C;  4X88 A;  4LF7 B;  2CGN A;  3F5W C;  2G38 A;  3H1H H;  1ROP A;  3JAR B;  1DGS A;  4C7U A;  3LNM B;  2LQT A;  2VQF B;  4ZOL B;  3JSL A;  3RYF B;  1W0K G;  1ZUQ A;  4H13 B;  1HNW O;  4X1I B;  2UXB O;  1PNL A;  3ABM C;  1VQN V;  4IYI A;  3F7V C;  3G6B A;  5GW7 A;  3B4S A;  3BA9 A;  1GN2 A;  5FLX N;  3ZHT A;  1CP9 A;  2EZP A;  1J5E B;  3K5O A;  4FFB A;  1PNM A;  4RUE A;  2P90 A;  4X9Q A;  2CTW A;  1Q81 W;  4RAI A;  1R1B A;  1M90 W;  5LL6 Y;  1QVG U;  3QO7 A;  4F6R A;  1MMM A;  2ZNI A;  4X20 B;  1OJH A;  1WB7 A;  3LSQ A;  3AG4 B;  2HKO A;  4TV9 B;  2E3C A;  2PI5 A;  1E1Q G;  4MTF A;  1JA8 A;  5KMG B;  5IYC O;  3G80 A;  1F51 A;  1K5Q A;  5JCO A;  4AIL C;  3OEH G;  3ETD A;  4DV3 O;  1O9G A;  1DF5 A;  2E5L B;  3TK1 A;  3CCR V;  3WU2 Z;  2WLI B;  2XAF A;  1TUB B;  3RN4 A;  4B3M O;  3JAL B;  4GX5 A;  1JJO A;  3G6E V;  4J9Z B;  2CTR A;  1YIJ V;  2W0X A;  3SJA C;  4UV9 A;  2ZNJ A;  4J7J A;  3AG3 C;  1Z5V A;  2IW5 A;  2Q7G A;  2AHY A;  2OTJ V;  3K0D A;  1XNQ B;  1TA8 A;  4XDK A;  4B3T O;  1VMG A;  1XHX A;  4J10 A;  1NTZ H;  4YJ2 B;  5JQG B;  2QWN B;  4R50 A;  4LFA B;  4GCZ A;  1TUB A;  4TQF A;  4LF7 O;  4TOI A;  1I7F A;  2BCC H;  1S0V A;  3FB5 C;  2VQF O;  3CXH F;  3KCX A;  3B09 A;  1UFI A;  4IIJ A;  3SDL A;  3HKD A;  5B5E Z;  1OCZ B;  2ITC C;  4H44 B;  1N32 B;  3K57 A;  3LDE A;  2A9H A;  1P7G A;  3ICX A;  3L70 H;  2EIJ B;  3UM7 A;  2ZE8 A;  1QBZ A;  4ZHQ B;  1H2L A;  4JYY A;  5JQG A;  2P4K A;  5BZB A;  4FZ0 A;  1L0N H;  1I94 B;  2MK3 A;  3E89 A;  1COW G;  2BTQ A;  2UXC B;  4FLV A;  2GBO A;  4X65 B;  4J9Y B;  3K08 A;  4I4T A;  4W4K A;  3OAA G;  3QF7 A;  3ETG A;  3K59 A;  1WJZ A;  5BMV A;  1K7D A;  2BTO A;  1W59 A;  4O2A B;  4AHC A;  2QTS A;  3CCS V;  4LF6 B;  5CBF A;  3CRR A;  2E5L O;  5DEC A;  2RQ6 A;  4EKW A;  5LP6 C;  1XQ8 A;  5ITZ B;  4ZI7 B;  2B5U A;  2N04 A;  1AJQ A;  3L71 H;  4FMT A;  3ABL C;  2LW1 A;  3TJT A;  4O4I B;  4DW0 A;  1WAZ A;  1AP6 A;  2RDC A;  4DRX A;  4DV2 O;  1VF7 A;  3ABK B;  4I55 A;  4CZZ A;  4WFH A;  1K33 A;  3OW2 U;  5H6Q A;  3UT5 A;  1K4D C;  3APO A;  3AG1 B;  3M99 B;  3IC9 A;  3ZRW B;  2V4D A;  2GTS A;  2L35 A;  1FXH A;  5HFM A;  4D7S A;  3CS5 A;  2FKX A;  4MVQ A;  2D2C B;  2UXN A;  2FYU H;  4B7E A;  2XAQ A;  2UUA O;  3G71 V;  4FM1 A;  2QDO A;  2JGU A;  1IBM O;  1NT2 B;  4BWA A;  4PJ0 Z;  1I94 O;  1OV9 A;  3N2K A;  2E75 B;  2YEV B;  3JAK A;  1H2G A;  1AB3 A;  3AG4 C;  4X65 O;  1WA8 B;  3HKE B;  3D36 A;  3TGU H;  5BR8 B;  3MAQ A;  2Q0O C;  1NBM G;  2BE3 A;  1FAF A;  2ZE7 A;  2LFS A;  1GRJ A;  1IXB A;  3OT7 A;  1YF2 A;  2QWP B;  1FD9 A;  1A32 A;  5L3D A;  4E2L A;  4LH6 A;  1K3E A;  4LF6 O;  3CCL V;  4L87 A;  1KEC A;  3BPZ A;  1FFX A;  1BQ0 A;  3EHB B;  2PTM A;  1N0N A;  2JVD A;  3CX5 F;  1MA1 A;  4UCU A;  4IL6 Z;  3SJB C;  3ZIA G;  3TET A;  1L8D A;  2JJ2 G;  2YXL A;  1N4C A;  3C3T A;  3FB8 C;  4P9O A;  2NN4 A;  2EJR A;  2PGG A;  1RFY A;  2PY5 A;  5TIS Z;  1H8E G;  3O65 A;  1H2N A;  4DR3 B;  2F95 B;  1BCC H;  5IJ9 B;  1AI4 A;  2B9Z A;  4MW8 A;  3X2Q B;  1MZF A;  3JAM N;  3E8G A;  1Q8I A;  4MTX A;  3K03 A;  1K9M W;  3T4D A;  1JVM A;  1NR7 A;  1BL8 A;  1WPB A;  4YY3 B;  4UXN A;  2QA4 V;  1ZAU A;  3OEE G;  1YJN V;  3ZHQ A;  2F1M A;  1O9H A;  1AR1 B;  1VQM V;  4JI0 B;  2EIJ C;  2WA4 A;  4X62 B;  2JS3 A;  3TXQ A;  5J2U A;  3A0B Z;  3H9V A;  2DE0 X;  4PI2 A;  3CD6 V;  2MW2 B;  3ZMV A;  4HYO A;  3CCJ V;  1YJW V;  4FM0 A;  2OT5 A;  4UCS A;  3U11 A;  3C90 A;  1Q90 D;  1QNM A;  3CJH A;  2LJ2 A;  1Y6X A;  1WN7 A;  3IJ4 A;  4LNU A;  1PPJ H;  4LF5 B;  3RT3 C;  5LHG A;  1Y76 B;  2NNU A;  1RSO B;  1Q3E A;  4YHH B;  2YIC A;  3JD4 A;  2Q8V A;  3FD9 A;  4DR1 O;  1YTF D;  1N36 O;  1P4R A;  5L3F A;  1BHB A;  3ABK C;  2DWE C;  4LF8 O;  1EN6 A;  2R70 A;  1GM8 A;  3FAV B;  2OCC B;  4PEL A;  1AR5 A;  4NXM B;  1XL6 A;  1FJG B;  2M6Y A;  5LBQ A;  4DR7 B;  3E83 A;  3RW0 A;  1TGO A;  1SET A;  1CEZ A;  1Y74 A;  1NJI W;  3D36 C;  4F4L A;  1PNK A;  4KHP O;  2F23 A;  4DR5 O;  5LHI A;  4YY3 O;  4IHJ A;  3AK1 A;  2XAS A;  3ZHV A;  4LBE C;  4X62 O;  3ZRX A;  2YI8 A;  4R8C A;  4LFB O;  3H01 A;  4TUY B;  5CBG A;  1XMQ B;  2KG7 A;  4DV4 B;  1UPG A;  4JI6 B;  5A2Q N;  2VWK A;  2Q4P A;  1R3J C;  4K0K O;  2Q0A A;  1JFF A;  2PYJ A;  1ARO P;  2BOC C;  4TV8 B;  1AIL A;  4DR4 B;  2LO1 A;  3BEH A;  4TQD A;  1I5X A;  3CRC A;  3A0H Z;  3T2M A;  3L74 H;  2ZIM A;  2BSK A;  1MG1 A;  4LF5 O;  2RJZ A;  3HKB A;  2KSD A;  5A9G A;  4PDR A;  4H33 A;  1Q82 W;  2YIA A;  4YHH O;  3IC7 A;  2WLL B;  2N74 A;  4HZ3 A;  3E22 B;  3CEI A;  3L9D A;  1WP8 A;  2YUA A;  3KZI Z;  2DMX A;  2YDE A;  2UXB B;  4O4H A;  4GX0 A;  2UUC O;  1OCO B;  3BCC H;  4QE7 A;  3X2Q C;  4I5S A;  2YS8 A;  1GN4 A;  2ZR3 A;  3K9A A;  3RWR D;  2ARH A;  3MD0 A;  4NXM O;  1NU1 H;  3HR0 A;  1FJG O;  3E8B A;  1FXK B;  2ZDI C;  4DR7 O;  3B40 A;  1CXZ B;  2OIG A;  2OIE A;  1J95 A;  3CC7 V;  1R6T A;  3UO3 A;  2Y48 A;  1VQ7 V;  3RYC A;  1ZTE A;  3Q4H B;  4O2B B;  2NLJ C;  1MZE A;  2JJ1 G;  3CSX A;  1M57 B;  5EZY A;  3S3X A;  4EB6 B;  5J2T A;  3ZN0 A;  1QR8 A;  1RPO A;  3MDS A;  5L3B A;  4CH6 A;  5L3G A;  4YXW G;  5JJN B;  3DC6 A;  4DV3 B;  1FXK A;  3OMI B;  3CE2 A;  3CB2 A;  4JI6 O;  2QJ1 A;  5KX5 B;  1XMO O;  2CE4 A;  4B3M B;  1BQZ A;  4WBN A;  1VF6 C;  2ZIO A;  1KKD A;  4O2B A;  1ZX3 A;  4QIW F;  4XDL A;  1B04 A;  1R3K C;  2WLM A;  1XRE A;  2FTK A;  3B8M A;  4DR4 O;  4G2K A;  5LYJ B;  1X4T A;  4MVU A;  1SA0 A;  5FPO A;  1GK9 A;  2IU3 A;  5FL7 G;  3E8F A;  5KHH A;  1F4N A;  1SQQ H;  4DUZ B;  4L8J A;  1VQL V;  2JEU A;  3D8C A;  1NQT A;  2Q67 A;  4OX9 B;  2YSU B;  4G28 B;  2OCC C;  2Q68 A;  5LP6 A;  3F7Y C;  5B1B B;  4JV5 B;  5CA0 A;  4J7K A;  3RBZ A;  4ASU G;  4DXW A;  3ASO B;  5LYJ A;  3R66 A;  1XDC A;  3CCM V;  3L72 H;  1PP9 H;  4CS4 A;  3GB7 C;  3I5D A;  5LGN A;  3DGE A;  5IWA B;  4NVP A;  3WB0 A;  3CCE V;  3J81 N;  4O4J B;  3JAR A;  2GTA A;  2A79 B;  2ODM A;  4JYA O;  1AVM A;  2ADQ B;  1VQ6 V;  4J11 A;  1NVP D;  5FNV B;  4I9W A;  1YIT V;  1KMI Z;  4ZOL A;  3L73 H;  3TXS A;  3RYF A;  3ZMS A;  4LFC O;  4X1K B;  3JAT B;  2W6I G;  4X1I A;  3A2F A;  1KYO F;  2QGN A;  3ZCC A;  3CRM A;  1S5L Z;  5CBH A;  1SS3 A;  1YI2 V;  4WFB V;  3OMN B;  5JH7 B;  1RPR A;  4GKK B;  4LH7 A;  3VBB A;  4QGP A;  4I7Z B;  4EFB A;  2EIL B;  1EN5 A;  3DXR B;  2R9A A;  2OCH A;  1SQP H;  1R6K A;  4X20 A;  1VF5 B;  5LA6 B;  2IJJ A;  5B1O A;  1QQC A;  4TV9 A;  1WNS A;  2P4V A;  5KMG A;  4UB8 Z;  2Q7H A;  1PL4 A;  1F7Y A;  2HEP A;  4DV2 B;  1BE3 H;  4GYC B;  4J7Z A;  1NH2 D;  2XAH A;  2JDI G;  2CTQ A;  3RGB A;  4ZKI A;  3VOU A;  1QU7 A;  2WLI A;  1TVK B;  4W4L A;  4XDJ A;  5IYZ B;  3ZMZ A;  5KHI A;  2WWW A;  4UUJ C;  2F43 G;  3JAL A;  4DUZ O;  1OCO C;  1QLE B;  1FFT B;  4X66 B;  2XTA A;  3OM3 B;  1LR1 A;  5D5P A;  4OX9 O;  4JTA B;  1RM1 B;  4R7C A;  3K04 A;  1FXK C;  3NR7 A;  3T1H O;  5LMU B;  2UUA B;  4JV5 O;  5EYP B;  5IT9 N;  5C93 A;  1IBM B;  2QKS A;  1HDJ A;  1V55 B;  3BVO A;  4YJ2 A;  3M8A A;  2O57 A;  1TVK A;  5IWA O;  3OTO B;  5CMU A;  1Q86 W;  5GON B;  1OCR B;  1M57 C;  2HLD G;  4XBF A;  2H94 A;  2RMK B;  3FFQ A;  4PA6 A;  3CCV V;  2H8P C;  5EC1 C;  2KB1 A;  2YIB D;  2QM4 A;  4YJ3 B;  5DN6 G;  1XNR O;  1I5Y A;  4LWS B;  3IGA C;  1KKC A;  1N34 O;  4ZHQ A;  4J80 A;  1BZK A;  4YIO A;  2F66 C;  2EIK B;  1I0H A;  3W7S A;  1MSD A;  4GKK O;  3EXA A;  2A3Q A;  1WP7 A;  5GON A;  2A7W A;  3K9S A;  3IAY A;  4B3R O;  3HKC B;  2ZD9 A;  4X1Y B;  1HNX B;  4JI8 O;  1E1R G;  1JX9 A;  3P32 A;  5KLV H;  4JI4 B;  2WAM A;  2ATK C;  2P7T C;  1YCI A;  4O2A A;  1EN4 A;  5KA6 A;  1NTK H;  2LGW A;  4KFM A;  1SZX A;  3SYA A;  4B7K A;  2WPD G;  4G27 B;  5ITZ A;  4ZI7 A;  5B3S B;  3E2E A;  1NZ6 A;  2QE7 G;  2XOK G;  2DN9 A;  1AI5 A;  4X66 O;  4O4I A;  3ASO C;  3K3W A;  4I0X B;  1KB9 F;  1I08 A;  2DYR B;  3D3Q A;  1R6N A;  1Q7Y W;  5GTI Z;  5LMU O;  1L0L H;  3ETQ A;  1DLB A;  2BOB C;  1YTF B;  4UB6 Z;  3SYQ A;  1DF4 A;  3U0Z A;  2GV9 A;  3OTO O;  4UCT A;  1SZT A;  2JIZ G;  5KAI Z;  4FLZ A;  1SQX H;  3BA8 A;  4MSW C;  3ZRW A;  1BSM A;  4KL1 A;  4P30 A;  2DYS B;  3U10 A;  2L6L A;  4JZG A;  2NR5 A;  2OYQ A;  2ZXW B;  5CB4 B;  2ZR2 A;  4U7N A;  5LOV B;  2EIL C;  1Z2G A;  1N33 B;  2IH1 C;  2VS0 A;  3WG7 B;  2YEV A;  5DED A;  2RN9 A;  3STL C;  4ICG A;  3SYP A;  3JAW B;  4BIU A;  4DR1 B;  5EBL C;  4DO2 A;  1WA8 A;  3HKE A;  1N36 B;  5FPR A;  1HNX O;  3OTF A;  2C2A A;  4LF8 B;  4JI4 O;  4GX2 A;  3B2E E;  4B08 A;  1U97 A;  2QKC A;  2AZ2 A;  3CC2 V;  2QWQ B;  2PYL A; 
#chains in the Genus database with same CATH homology
 1M56 B;  3OFN G;  5CBG A;  3F5W C;  1ROP A;  3E8H A;  1QLE C;  1K4C C;  2M7W A;  3LNM B;  2OTL V;  1OHH G;  1R3J C;  3SJQ C;  1OCZ C;  1EZJ A;  1ARO P;  1W0K G;  1QR9 A;  1L1F A;  4MTG A;  4UVA A;  2BOC C;  4PDL A;  1VQ9 V;  3B77 A;  1PNL A;  3ABM C;  3LUT B;  3LDD A;  1VQN V;  3F7V C;  1H8H G;  5GW7 A;  4JTD B;  1V55 C;  4BAY A;  1Y4M A;  3BEH A;  4WFF A;  5KA5 A;  2IJK A;  1I5X A;  2Q69 A;  1CP9 A;  3FYE B;  2EZP A;  2QM8 A;  2WLK A;  3T2M A;  3OR7 C;  4KP4 A;  1PNM A;  5B1N A;  4JYC A;  1MG1 A;  4RUE A;  3EFF K;  1ENV A;  2P90 A;  1OCR C;  2DQ0 A;  5IY5 B;  1Q81 W;  4RAI A;  2X6C A;  4PDR A;  4H33 A;  1SRY A;  1Q82 W;  3E86 A;  1P7B A;  1THZ A;  1M90 W;  4MW3 A;  3IC7 A;  2WLL B;  2ZDI A;  4HZ3 A;  1QVG U;  3QO7 A;  4X89 A;  3LSQ A;  3CP1 A;  5B1B C;  1VQ5 V;  3AG4 B;  2HKO A;  2PI5 A;  4GX0 A;  2IJI A;  1E1Q G;  1OCO B;  4MTF A;  4KUM A;  4Q20 A;  4QE7 A;  5IYC O;  3X2Q C;  3SPC A;  4I5S A;  1S72 V;  4MVO A;  1E79 G;  1F51 A;  2ZR3 A;  3K9A A;  1SER A;  1K5Q A;  5H6R A;  3OEH G;  2HJF C;  3ETD A;  4MVZ A;  2EIK C;  3MD0 A;  3MHH C;  1DF5 A;  3TK1 A;  3CCR V;  3E8B A;  1FXK B;  2ZDI C;  2WLI B;  1VQP V;  2XAF A;  1VQ4 V;  1J95 A;  3K79 A;  3CC7 V;  5CN0 A;  4GX5 A;  1W0J G;  2Y48 A;  1VQ7 V;  3G6E V;  4J9Z B;  1V54 B;  1YIJ V;  1R73 A;  3ZMU A;  2WSS G;  4UV9 A;  2NLJ C;  2JJ1 G;  3AG3 C;  2Z5U A;  1M57 B;  2IW5 A;  1YHQ V;  1OCC C;  3SPJ A;  3ZN0 A;  2AHY A;  1QR8 A;  1RPO A;  5L3B A;  5L3G A;  2OTJ V;  3K0D A;  4FPP A;  4YXW G;  5B1A C;  3ASN B;  2EIN C;  4U7O A;  1BHA A;  4XDK A;  1FXK A;  3OE7 G;  3OMI B;  4R50 A;  4GCZ A;  4RUF A;  2LFR A;  5B3S C;  4UVC A;  3AG1 C;  3IFX A;  1QLN A;  1K34 A;  4UVB A;  1AJP A;  1S0V A;  1JOY A;  2DQ3 A;  3FB5 C;  4LP8 A;  2QEX V;  3CME V;  1KKD A;  2X6B A;  4LC1 A;  3CCQ V;  1OCZ B;  2ITC C;  4QIW F;  4HAM A;  4XDL A;  5EC2 C;  3SYO A;  1R3K C;  3FYI B;  2HG5 C;  3MHS C;  2WLM A;  1OZ0 A;  3LDE A;  4TT3 G;  2A9H A;  2FTK A;  3ABM B;  3ZMT A;  3B8M A;  2EIM B;  4WFE A;  4P2Z A;  2EIJ B;  4G2K A;  1AJN A;  3UM7 A;  1QBZ A;  4MTO A;  3JD1 A;  4MVU A;  5BZB A;  2IU0 A;  1GK9 A;  2MK3 A;  3E89 A;  1JQ0 A;  2DWD C;  2IU3 A;  1COW G;  5FL7 G;  5H9C A;  3E8F A;  4RO2 A;  1CPY A;  2XAG A;  2HVJ C;  4J9Y B;  5HFL A;  1F4N A;  3K08 A;  3OUF A;  5KUM A;  2QM7 A;  2CK3 G;  1EBO A;  4MVR A;  1S76 D;  1VQL V;  2JEU A;  1NQT A;  1FS0 G;  2EBO A;  2Q67 A;  2YSU B;  3OAA G;  4WF9 V;  1RM1 C;  4G28 B;  3ZRV A;  1Y66 A;  1M9N A;  2OCC C;  2Q68 A;  3ETG A;  3CXC U;  3AEI A;  2ZQM A;  1K7D A;  1PL0 A;  3F7Y C;  2ZXW C;  5B1B B;  3FB6 C;  4TSF G;  2V1D A;  1KQS U;  3RBZ A;  4ASU G;  4DXW A;  3ASO B;  3OMA B;  3RVY A;  3CCM V;  4CBC A;  2W0F C;  3GB7 C;  1G4Y B;  3TCU A;  3CCS V;  2HVK C;  1EFR G;  3WG7 C;  5CBF A;  3I55 V;  1NVP B;  5LGN A;  1LNQ A;  3DGE A;  1S3J A;  2ITD C;  1S5H C;  4N21 A;  4RQE A;  1VQK V;  2GSM B;  5KUK A;  3CCE V;  1VQO V;  2A79 B;  1KD1 W;  1ZWI C;  1VQ6 V;  4EKW A;  2WLN A;  5L3E A;  1NVP D;  2B5U A;  2W6J G;  4I9W A;  1AJQ A;  4FMT A;  3ABL C;  3ZJZ A;  1YIT V;  3E35 A;  3OGC C;  4WFG A;  3ZMS A;  1K97 A;  3QO5 A;  4JPR A;  2W6I G;  4PA9 A;  1G8M A;  3QO8 A;  4BIZ A;  4ZBM A;  3ZCC A;  5CBH A;  3AG3 B;  4WCE V;  1M56 C;  2XAJ A;  3P30 A;  1YI2 V;  3ABK B;  4QPK A;  4CZZ A;  4WFH A;  4WFB V;  1GKF A;  2UXX A;  1K33 A;  4R6Z A;  4JGS A;  2B1I A;  3OMN B;  3OW2 U;  5H6Q A;  3W7T A;  1RPR A;  2P6J A;  1H38 A;  5EBW C;  3VBB A;  1K4D C;  1S77 D;  2Y69 B;  5EK0 A;  2EIL B;  3K06 A;  3AG1 B;  3M99 B;  2WLL A;  3ZRW B;  1ORQ C;  1FXH A;  5IDJ A;  1R6K A;  3PJS K;  5HFM A;  4MVS A;  1NH2 B;  3CCU V;  1MSW D;  2IJJ A;  5B1O A;  3OR6 C;  4PA7 A;  4MVQ A;  4QNH B;  2UXN A;  3AG2 B;  1GO3 F;  2XAQ A;  1VQ8 V;  3G71 V;  3ETE A;  1NH2 D;  2XAH A;  5IY5 C;  2JDI G;  1XL4 A;  4UV8 A;  5L3C A;  5EBM C;  4ZKI A;  4WFA V;  3VOU A;  1UJW B;  2YEV B;  2WLI A;  3D3I A;  4XDJ A;  1H2G A;  1YJ9 V;  1TUE B;  5J9P C;  1HWY A;  3ZMZ A;  4BW5 A;  2WWW A;  3AG4 C;  2F43 G;  4UUJ C;  1IXM A;  3HPL C;  4PDV A;  4QE9 A;  1OCO C;  1QLE B;  1FFT B;  3D36 A;  1N8R W;  2A0L A;  3OM3 B;  3W7X A;  1NBM G;  4Z1M G;  2DYR C;  1NKD A;  3JD2 A;  2Z3Y A;  4FIP C;  4JTA B;  1RM1 B;  4R7C A;  2LFS A;  3K04 A;  1FXK C;  2IJH A;  4H37 A;  1M1K W;  5C93 A;  3STZ C;  5L3D A;  2QKS A;  4E2L A;  1AI6 A;  1K92 A;  1V55 B;  1K3E A;  4X8A A;  3CCL V;  1AI7 A;  4L87 A;  1KEC A;  1V54 C;  3CMA V;  3EHB B;  2D3O W;  4FK5 C;  1F23 A;  2X6A A;  3CYO A;  3T4Z A;  5CMU A;  1Q86 W;  3A0R A;  3ZIA G;  1OCR B;  1M57 C;  3TET A;  2HLD G;  4XBF A;  2H94 A;  4PA6 A;  2JJ2 G;  3CCV V;  2DYS C;  1JJ2 U;  5IYB O;  2H8P C;  5EC1 C;  1KC8 W;  1JCH A;  3FB8 C;  4P9O A;  2KB1 A;  2V7Q G;  2EJR A;  3ASN C;  1H8E G;  3BY6 A;  4MVM A;  4QJF B;  5DN6 G;  1QCE A;  4GX1 A;  3R65 A;  2HFE C;  4JAU A;  1I5Y A;  1FXV A;  1WPX A;  1AI4 A;  3JD0 A;  1MOF A;  4MW8 A;  3W7U A;  3IGA C;  3X2Q B;  2HR3 A;  3OUS A;  3E8G A;  4MTX A;  2EIK B;  3FB7 C;  2JK5 C;  3GWO A;  3K03 A;  3W7S A;  1K9M W;  3DTU B;  3T4D A;  1JVM A;  1NR7 A;  2AHZ A;  3ML0 A;  1BL8 A;  1GTO A;  4UXN A;  2XND G;  2QA4 V;  3OEE G;  2ZD9 A;  1YJN V;  3K0G A;  1E1R G;  1AR1 B;  1F4M A;  3CPW U;  2B1G A;  2EIM C;  1JX9 A;  1R3L C;  3P32 A;  3SYC A;  1VQM V;  4N23 A;  2WAM A;  2EIJ C;  1GMG A;  3RVZ A;  3ABT A;  1NR1 A;  1W2B U;  3I56 V;  2X7R B;  2ATK C;  2DW4 A;  1DTO A;  2P7T C;  1BMF G;  5KA6 A;  4JTC B;  1OCC B;  4KFM A;  4PDM A;  3SYA A;  4JYB A;  5B1A B;  3CD6 V;  2EIN B;  3B8N A;  3ZMV A;  2WPD G;  4HYO A;  3CCJ V;  3CC4 V;  1B6Q A;  4G27 B;  3ABU A;  1YJW V;  1PKX A;  3SPI A;  5B3S B;  2OT5 A;  3E2E A;  2QE7 G;  2XOK G;  1AI5 A;  3ASO C;  4MT8 A;  2R9I A;  3K3W A;  2PI4 A;  3NXS A;  5IYD O;  2DYR B;  4P9P A;  2R9R B;  1SES A;  1R6N A;  1KP2 A;  3SPG A;  1Q7Y W;  5LHG A;  1K8A W;  1DLB A;  2NNU A;  2BOB C;  3LSS A;  1YTF B;  5E1A C;  3SYQ A;  1DF4 A;  2EZO A;  5DM6 V;  3JD4 A;  3JD3 A;  1SZT A;  2JIZ G;  5LHH A;  4RQF A;  1QVF U;  3T1C A;  3WFV A;  1YTF D;  2LP7 A;  4MSW C;  4PA4 A;  3ZRW A;  1P4R A;  2WLH A;  4GT1 A;  4FJC C;  4JF3 A;  5L3F A;  1BHB A;  3ABK C;  1YSC A;  4JAV A;  4P30 A;  2DWE C;  2DYS B;  2WLJ A;  3LDC A;  3QNE A;  1GM8 A;  1WLE A;  3ZRS A;  2Q6A A;  4MS2 A;  2OCC B;  4PEL A;  4PA3 A;  1XL6 A;  1MAB G;  4QPJ A;  3JYC A;  3SPH A;  5CA3 A;  2ZXW B;  5LBQ A;  2ZR2 A;  3JCZ A;  1PD3 A;  1GM9 A;  2JEX A;  2Y69 C;  4U7N A;  2EIL C;  2GHY A;  4LCU C;  2IH1 C;  4JAS A;  2X0L A;  3E83 A;  3RW0 A;  2K1E A;  3W7W A;  3WG7 B;  1SET A;  1CEZ A;  2YEV A;  1NJI W;  4F4L A;  3STL C;  1PNK A;  1R3I C;  3G4S V;  3SYP A;  4BIU A;  5LHI A;  3AG2 C;  5LGU A;  5EBL C;  4DO2 A;  1K73 W;  1K5S A;  3UKM A;  3HB3 B;  4TWK A;  2XAS A;  2C2A A;  3ABL B;  1JPX A;  4OXS A;  3FKS G;  4GX2 A;  2QTO A;  1GM7 A;  3ZN1 A;  3KG2 A;  3CC2 V;  1KP3 A;  4LBE C;  3ZRX A;  4R8C A;  3H01 A;  5LGT A;  2P67 A;  2IH3 C;  4X88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...