1JPXA

Mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. wild type.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
59
Chain Sequence
GIVQQQQQLLDVVKRQQELLRLTVWGTKQEWERKVDFLEENITALLEEAQIQQEKNMYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords gp41 envelope protein
publication title Mutations that destabilize the gp41 core are determinants for stabilizing the simian immunodeficiency virus-CPmac envelope glycoprotein complex.
pubmed doi rcsb
source organism Simian immunodeficiency virus
molecule tags Viral protein
total genus 25
structure length 59
sequence length 73
chains with identical sequence D, G
ec nomenclature
pdb deposition date 2001-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1jpxA00
1DF4A 1QCEA 4N21A 4FK5C 1SZTA 3M99B 3B77A 2P6JA 3CP1A 4FIPC 3MHHC 3B8NA 5CMUA 5H9CA 3WFVA 3P30A 1I5XA 1MG1A 1QBZA 3GWOA 1I5YA 3MHSC 5HFLA 1JQ0A 1K34A 1QR8A 4N23A 2OT5A 3B8MA 5HFMA 1JPXA 2MK3A 4FJCC 4JGSA 5KA5A 1F23A 2X7RB 4G2KA 1MOFA 1QR9A 1Y66A 3CYOA 4JF3A 4E2LA 2M7WA 3H01A 2EZOA 1K33A 2EBOA 4JPRA 5KA6A 2EZPA 1EBOA 2LP7A 1DLBA 5CN0A 1Y4MA 3K9AA 1ENVA 1DF5A
chains in the Genus database with same CATH superfamily
4GX5A 4X62O 3E22A 4X66O 4LH6A 1N0NA 4FM2A 3UT5B 4EFEA 2YIAA 5GONB 1H2GA 1WP7A 5LMNO 3CX5F 1SS3A 1HNXO 2F4VO 4DR6O 2ZE5A 5D5PA 3HKDB 4FFKA 4LH7A 2V4DA 2E74B 1MMMA 5BXZA 1NH2D 1VEWA 4PDVA 4OX9O 1GMGA 3E8FA 5JJJB 1X4TA 3P30A 4PHZA 2GTAA 2YIBA 1NQTA 3H1HH 3LNMB 5J2UA 3RYFB 3D36C 4K8ZA 3U11A 2CH7B 1IBKO 4G2KA 1URFA 1JA8A 5EYPA 1QNMA 3M8AA 2AXTZ 4U7OA 4G28B 1W0JG 5C8YB 4D7SA 2JIZG 3ASOC 2JRIA 3AG2C 5B1BC 1E79G 2RQ6A 1U97A 4TQFA 3AG2B 3K0GA 5B1BB 2OCCB 4Q20A 5IJ0B 4UXNA 4BW5A 3F5WC 4GKKB 3BPZA 1IURA 4D7TA 1UJWB 3ZRWA 2PI4A 4O4HB 1IBLO 2Q67A 4GT1A 5IY5C 5H6RA 3B77A 2EIMC 3BRCA 5IY5B 1D2DA 4J42A 1IDSA 2EIMB 1W2BU 3UCSC 5JCOA 4FLYA 1XILA 2W0XA 5CA1B 3WB0A 1B04A 1VQPV 4FLUA 3GWKC 4JI2O 2ZIOA 3Q4HB 2ZNJA 4UVAA 3CB2A 4J9ZB 1YJ9V 4ZI7A 3VQXA 3JAMN 2IJJA 1JX9A 3L9DA 2WWWA 3CP1A 3HKBA 1COWG 4DR2O 3FD9A 4O4IA 2NN4A 1EM1A 2HJFC 3ML0A 1HNZO 2ZIMA 1ORQC 3W7TA 2Q69A 4JI4B 2BCCH 5EZYB 1NR7A 1HWYA 4EB6A 3M7MX 3FAVB 2R72A 3F5TA 2ITCC 3K5LA 3BABA 1PKXA 4H13B 1BQ0A 2HP8A 4K0KO 2IW5A 1YJWV 3K9SA 3ETQA 2IJHA 2E5LB 3IGAC 3C3SA 3TK1A 3CEIA 1Y74A 1AR5A 1MA1A 5J2TB 3CCJV 1AI5A 1QHTA 2Q9LA 5DN6G 4JI7B 4KHPO 1NI8A 1QCEA 4FIPC 4LF6O 5B3SC 1YDXA 4PA7A 3U0ZA 1FFXB 3F7VC 4B3MO 3FYIB 3N2GA 5K1PA 5B3SB 4DK1A 1TUBA 5LP6C 1KMIZ 3K3WA 4JTAB 2F93B 1O9HA 2X7RB 5KHKA 2VS0A 1I94O 1BZKA 2O57A 4NTXA 4CH5A 4OXSA 1SZXA 3SGIA 2UXDO 1OCZB 2QGNA 3RYIA 2OCHA 3B8NA 3MHHC 2YEVB 5L3BA 4DR5B 4MSWC 3AK3A 1GN2A 4ZOLB 4GYCB 3SPIA 2R70A 3BHPA 4LBEC 4ZHQA 2X6AA 4MS2A 4JASA 4TV9A 3BEHA 2LGWA 1NVPD 2E3CA 4LF9O 1ZX3A 1CEZA 5KLVH 1GAXA 1I5YA 4I50B 4FM1A 3B40A 1R73A 4JZGA 4QPJA 5IJ9A 3JD4A 2EZOA 3RN4A 1EBOA 2BOCC 2ZXWC 3CRRA 3HKCB 2KG7B 1NTKH 4O2AB 2F23A 1G1XB 4UV9A 1FJGB 2XAJA 4JYBA 1TUEB 1Q6HA 2P22C 1Y6XA 4X1IA 2WLNA 4DR3B 3D3IA 4I4TA 1AI7A 2Y0IA 1M5IA 4UCUA 1VF6C 3CCSV 1YEWA 3OW2U 1KKCA 2HG5C 1K3EA 1N32O 2WLIA 4I55A 3SPHA 1GH6A 2ILMA 4DR7B 2Z3YA 4PA4A 1IXBA 1VQ7V 5LYJB 4JI3B 2GV9A 5FPRA 5LOVA 5EBMC 3OT7A 4O4LA 2A06H 3AG1C 4P9PA 2H94A 3SYCA 3SYQA 4J41A 3AG1B 2JVDA 2UUCO 3A0BZ 2UXBO 3OR7C 5JJNB 5TISZ 3SYPA 4UCVA 4F4LA 2DYSB 1V54C 4DV0O 2CUGA 4DRXB 5GTHZ 1SESA 3EFFK 3J7AU 1L1FA 4HNAA 1VQNV 4TOIA 4O4JB 1R3KC 2AZ0A 1NTMH 3LSQA 3UM7A 5CA0B 1IXMA 1T5EA 1JMKC 1ZSPA 2IH3C 4JTDB 3OEHG 4MTXA 2Q6AA 2ZM6B 3LSSA 4LFBO 2ZQMA 5IYZB 4WBNA 4FLZA 1PP9H 4X62B 1VF5B 5FPOA 1U96A 4F6RA 4X66B 4NR1A 1K92A 1WN7A 3JAKB 3ZJZA 3ABMC 1AILA 3O9OA 1R6TA 3UO2A 3AG3C 3ABMB 3W7WA 5LMNB 1HNXB 2F4VB 2WLLB 4DR6B 3TGUH 1PNLA 2Y4TA 4B7EA 4X20A 1AI6A 2MW2B 2BE3A 5CA3A 1OCOB 3N27A 3WFVA 3A0RA 1QLEC 5B1NA 1M90W 2D3OW 5D5QA 1QLEB 2A79B 5LBQA 5LMUO 1IBKB 1Q86W 1JJ2U 2W6JG 4P2ZA 3SYOA 2GBOA 2XHBA 4X1YA 1M93A 1YTFB 2UXXA 5A2QN 4RO2A 2WLJA 1GK9A 1ZAUA 2RMKB 5BMVB 3T1HO 3CJHB 2OT5A 2ZD9A 1XL4A 3P3PA 4J10A 1MABG 2QWPB 1P49A 1KUQA 3RW0A 4JI0O 1S5HC 2B5UA 5KHJA 3L72H 2JJ2G 4BR6A 3ZMVA 3OFNG 1WJZA 4LNUB 2K1EA 3DXRA 3JALB 4FLXA 1IBLB 2UXCO 2P06A 1N34O 2WSSG 1SC5B 4DV7O 1Q90D 4N23A 1S77D 2DOSA 2LJ2A 5FNVA 4X1KB 2IU3A 2AHYA 2LO1A 4FZ0A 4AQYB 1NKDA 5LA6A 4FZ1A 1VQ4V 2CE4A 4JI2B 1B3QA 4U3FH 4GX1A 2GDSA 3OAAG 4MVRA 2Y48A 4CC6A 1N4CA 3WB1A 1MSDA 3K03A 4DV3B 3OTOO 4JAAA 2UU9O 2OTLV 4DR2B 2EIKC 3GWOA 2DQ3A 1XHZA 1FXHA 1HNZB 1XEQA 2CTWA 4MVZA 1Q6IA 4DV2O 4R6ZA 1YCIA 4J11A 2IU0A 2F66C 4LC1A 3ETDA 2GUZA 2RCVA 5KHIA 2CAZC 5H9CA 2OYQA 5EC1C 2KSDA 4K0KB 4LF4O 1I08A 4JI1O 3G6EV 3FFQA 2CGOA 4XBFA 2AGAA 1NT2B 1WA8B 4JYYA 1TVKA 4L8JA 3ZRVA 3R66A 2HLDG 3L71H 3JSLA 4JTCB 1KYOF 3JAWB 4AI8A 1HNWB 3RYHA 1KU9A 2QR4A 3ZHSA 2R9RB 1SQFA 4KHPB 2WLHA 1I5XA 3T1YO 4LF6B 3CCUV 4B3MB 1M4UA 3E8BA 2QM7A 4DR4O 5BR8B 4UCSA 3C90A 1AJNA 2YI9A 4RAIA 3LDCA 4FFBB 1IZ3A 4PDMA 1GTOA 2R9AA 1HR0B 3X2QC 2CGNA 3TXSA 2XAQA 1WPXA 3X2QB 1N33O 4QGPA 1VQLV 1YSCA 3JYCA 3E35A 3JD3A 4PA9A 2CTRA 2NNUA 1RSOA 4X65O 3SJAC 3RWRD 2ZT9B 4UCRA 2PZSA 1SQGA 2D2CB 3SYAA 4RUEA 3CS5A 1K8AW 4X89A 1M56B 4RQFA 2Q68A 4LF9B 3AEIA 3CE2A 1DK1A 2UUBO 5JCOC 1FXKA 4LCUC 2GHYA 2DYRC 3T4DA 2VQFO 2K9PA 4UCTA 2DYRB 1R1BA 4D6TH 4I0XB 5JH7A 1SETA 4U7NA 3CRAA 1DF5A 4ZKIA 5KUKA 1VQOV 4BAYA 1S5JA 4TV8A 4WFAV 4IL6Z 3GB7C 2KKWA 4PJ0Z 3HKBB 2XASA 3TXQA 3JASA 4YJ2A 1ZWIC 3O65A 2C2AA 1TAEA 1Q5OA 3GVMA 1P7GA 1PL4A 4EB6B 1R3JC 3CRQA 2WLMA 1O9GA 1N32B 3A8TA 3QTCA 4KP4A 3A2FA 5CBGA 4ZBMA 3BFRA 3APOA 1PD3A 1AP5A 3STZC 1EN6A 3E8HA 3K5MA 4WFGA 3WG7C 1KP2A 3QG5A 3WG7B 3VBBA 1K4CC 4K3AA 1DLBA 4EKWA 1Y74B 2UXBB 1FD9A 3E83A 4DV4O 3HB3B 3OMIB 5JJEB 4TWKA 1OCCC 2ZNIA 4DV0B 4CH3A 3ASOB 1BQZA 1OCCB 1BMFG 3N2GB 1TUBB 4ABMA 4DXWA 4W4KA 2GSMB 4O2BA 3CCMV 1RPRA 1F51A 3DC5A 1WLEA 4LFBB 4F6EA 1L0LH 4R8CA 3NXSA 3OE7G 3RYIB 1UPGA 1S72V 3ZS8C 1YZBA 2VWJA 1NR1A 1NS1A 4ZHQB 5IDJA 3J81N 2WA4A 5LGUA 4JAUA 1ZL8A 5KX5A 1GM7A 3JATA 1M9NA 2DWEC 2CTPA 1L0NH 4DUYO 2X6CA 4CBCA 1GKFA 5IE9A 4LP8A 1JFFA 2EZPA 3CD6V 3UT5A 1VP7A 2PTMA 1R3IC 2XAGA 2FTKA 3OD4A 1R6NA 3G80A 1KP3A 4PDRA 4E4EA 4U3JA 1WP8A 3HKDA 3ZMSA 4B3RO 2ADQB 1SQXH 4GUNA 4UFZA 3E86A 4FJCC 5JQGB 3T1HB 4DW1A 4P9OA 2FKXA 1TA8A 2Z5UA 2EBOA 4YHHO 2UUAO 4JI0B 3DGEA 1ZLZA 1K73W 4I4TB 2M7WA 4G27B 4Z2WA 2HFEC 3RYFA 4HAMA 2UXCB 1N34B 4J7ZA 5CB4A 3MDSA 4DV7B 1SQQH 4XDKA 3J80N 4E2LA 5LP6B 3OTFA 5LOVB 1OCRC 4RQEA 3RGBA 3RT3C 2ZR2A 3SDLA 2EX3A 5LXTB 4CZZA 5B5EZ 2DMXA 1WB8A 5L3FA 4BWAA 5IJ0A 3QO7A 4YJ3B 1HP8A 3OTOB 2UU9B 3H1LH 4CS4A 1EN4A 3KKYA 4B3TO 1QVFU 4HNAB 4O4HA 4DV2B 4JI6O 2BTQA 3CSXA 4X8AA 4JYAO 3UKMA 5CN0A 4H33A 5LHHA 4LF7B 1FYJA 5KHHA 1BSMA 1XNQB 5CA1A 5ITZA 2DN9A 4JI5O 3KG2A 1S76D 2B9ZA 1Q82W 2OWOA 4LF4B 4JI1B 2EULA 4TUYA 4FM0A 2QTSA 3DSQA 2HVKC 4YIPA 3A0HZ 4LFCO 1K4DC 2Q7HA 1SF9A 5EIBD 2LQTA 3LNNA 3M99B 2ZXWB 2Q8VA 5EZYA 3MAQA 4LF8O 4KXRA 4UB6Z 4BIOA 2HHHO 3T1YB 2YC0A 3JARA 4JGSA 1EZJA 4ZIBA 1W59A 3K08A 4J9YB 1H2NA 3E2EA 1N36O 5JVDB 4EEQA 2CDYA 2WA3A 4X1YB 1YITV 5B1AC 1N33B 3ZRSA 1QR8A 3K58A 4QE9A 4RWUA 5J2TA 5IWAO 3OMAB 4LF5B 3VQYA 3ZCCA 1BT8A 3IC7A 4MVOA 2Q4PA 3R65A 4DW0A 4OGQB 2EJ7A 2EJRA 3W7XA 1B6QA 2ZINA 5IT9N 4DV6B 2DJVA 3DXRB 2IJIA 1V54B 3QO5A 3VOUA 5C93A 2UUBB 2VQFB 1K33A 5KA6A 3T2MA 4WFHA 4FLWA 2A3QA 3OGIB 2A7WA 3THOA 4ZOLA 5B1OA 3ABUA 2N05A 1MNGA 5A9GA 3H9VA 5KHGA 1E1QG 1AB3A 1BCCH 1X59A 2P67A 1NTZH 2YXLA 3S3XA 1HW7A 3AG3B 5CBHA 4I50A 3OEEG 1AR4A 3OMNB 4OX9B 3EHBB 1DTOA 3HKEB 4TSFG 2JDIG 3CHXA 4DYLA 1SA0A 1SQPH 4B3SO 4H44B 1YIJV 3CMEV 4WFBV 3RYCA 2QKSA 3BA9A 3LUTB 5AG2A 2KG7A 3L73H 4NXMO 1WAZA 1PNMA 1TVKB 4UV8A 1Q6UA 1IVSA 4DV5O 4JV5O 3K57A 4RUFA 2EILC 1LNQA 2JEXA 2B1GA 4PA3A 4DV4B 2EILB 1KQSU 1PPJH 4UB8Z 4Q6GA 4IHJB 2QTOA 2B1IA 2H8PC 1JJOA 3EXAA 2EINC 3ZHTA 5H6QA 4X64O 2EINB 2PI5A 2PF4E 1YF2A 3N2KA 4MW3A 3TJTA 1PNKA 2Y0PA 1JVMA 2X6BA 3VQWA 1NH2B 4I9QA 1QLNA 5IYCO 1S0VA 3LDEA 4IIJA 1GM9A 1WPBA 2CK3G 4YXWG 4LFAO 2G38A 4J80A 1SQBH 2ZE7A 1H2LA 5KMGB 1XDCA 1AJPA 3FKSG 4GLXA 1VQ9V 1KBHA 1EN5A 1BGYH 4O4JA 5BZBA 1XMOO 2H3OA 1Z5VA 1V9PA 5CA0A 3MD0A 2QEXV 3W7UA 2VQEO 2ZE6A 1JR9A 2EIKB 3SPJA 1FXKC 5IYZA 4DUYB 2QSAA 2YI8A 5LGTA 5FLXN 4KUMA 4YIOA 2PGGA 5JH7B 3JAKA 4BIUA 2AZ2A 3B2EE 1JQ0A 3E22B 3CRCA 2WLLA 4PV1B 3ZHUA 4B3RB 1Y76A 1Q7YW 3JASB 4H0LB 5E79Z 1QQCA 1FKAO 2LW1A 1XMQO 2JS5A 4PD4F 3ETEA 4NTYA 4EFBA 3RFRA 1Q8IA 4PA6A 1MSWD 2YSUB 3NR7A 4QJFB 1XUQA 1FS0G 2JJ1G 2XUMA 4I5SA 1SKVA 3OUSA 2JGDA 2PYJA 5J2UB 5BY1A 3DTUB 4K35A 1GRJA 1I94B 5EYPB 4LR3A 1Z5WA 2BSKA 3STLC 5BMVA 3SPCA 2UXDB 1HDJA 3OR6C 1YI2V 3OGCC 4NXNO 2XT9A 3BA8A 4DUZO 3ZX6A 4QIWF 5DM6V 2Y69C 4GKJO 1FXVA 3ABLC 3AK1A 1RPOA 4JI6B 4CH6A 2ARHA 2XTAA 1WNSA 1M57C 1ZUQA 4O2BB 1M57B 3UO3A 1A32A 3ZRWB 1G4YB 2DW4A 4NTWA 3ETGA 2Q5ZA 3H1JH 2QWNB 4HYOA 1LR1A 2LGQA 2Q7GA 1EZVH 1E1RG 2ZDIA 3CCLV 5EBLC 2HEPA 1J5EO 1AI4A 1IBMO 2VRZA 3E89A 1VQMV 4ZI7B 1OV9A 5L3GA 1XQ8A 2QKCA 3K5NA 4LF8B 2V1DA 1K97A 3ZMUA 5KX5B 2HHHB 1AJQA 4O4IB 1YTFD 3UQ8A 2FMLA 2KQXA 3JATB 2ZM6O 2FYUH 4I7ZB 3OUFA 3ZN0A 3B4SA 4QNHB 2LP7A 2FB5A 2F1MA 1JFFB 2M6YA 1N36B 2YICA 4ASUG 1WA8A 4FVMA 4AHCA 4QPKA 4TT3G 3QNEA 2L35A 1NVPB 3ZMZA 1LUWA 4U3JB 5IWAB 3JAWA 3EVKA 1I0HA 2F43G 2WAMA 1EFRG 4HZ3A 5B66Z 1S5LZ 2JK5C 1UFIA 2HR3A 3JCUZ 3ZMTA 2UUCB 3G71V 3SR2C 5EIBC 2XAFA 4XDJA 5KUMA 1KB9F 1H2KA 1GM8A 4WFEA 3VQVA 3ZHVA 3K79A 5KA5A 4FFBA 4WFFA 1JOYA 1MOFA 5CB4B 1QVGU 4DR1O 3FB6C 2YS8A 1N0JA 4NKGB 3ASNC 1YHQV 4K8XA 3CPWU 3BCCH 3ASNB 4LWSA 4PDLA 1P7BA 2E75B 4IGGA 1BS3A 1XBLA 2HJDA 1N8RW 1WB7A 2OCCC 1ROPA 2ATKC 2ETNA 3ZBHA 2UXNA 3CYOA 3CC2V 5IYBO 4MTGA 2JGUA 4MW8A 1Q81W 4KFMA 4HBNA 2PY5A 2BTQB 3G4SV 4TV9B 4MVMA 3TETA 3KCYA 5L3DA 3SJCC 3H1KH 4MVQA 1D5AA 1Q43A 3SJQC 4UVBA 5ITZB 1VMGA 4I0XA 4B3SB 4AQYO 3CC7V 4NYKA 4X9QA 4WF9V 3H01A 3OM3B 4I9WA 4YY3O 1H2MA 4TUYB 3ABTA 1SRYA 5LMUB 4DV3O 2QWQB 5IJ9B 1ENVA 4NXMB 1BL8A 3KZIZ 1THZA 5IYDO 3AK2A 2YIBD 4C7UA 1PM9A 5GONA 4DV5B 1B06A 4JV5B 2VWKA 3PJSK 1FPOA 2JS3A 3P3NA 4DV1O 1KKDA 5GTIZ 1K9MW 1CP9A 4J7JA 3E8GA 3JARB 4X1IB 5L3EA 1XNRO 3I55V 4X64B 4GCZA 1NBMG 4P30A 3HR0A 4UVCA 2P6JA 2CH7A 3K0DA 3D36A 2WLIB 4I55B 5L3CA 3LSUA 4LFAB 1KC8W 4PI2A 2OIGA 1HNWO 5C8YA 4O4LB 1RP3B 3APQA 1OCRB 3IJ4A 2QDOA 4R7CA 1JCHA 2NR5A 4B08A 1XMOB 4IYIA 4B7KA 3AG7A 2FL4A 5BR8O 2LFRA 1VQ6V 2P7TC 2VQEB 3DC6A 1OCZC 4JPRA 1HR0O 2QM8A 1KD1W 1CPYA 1Y4MA 3LDDA 1MZEA 3I5DA 2GTSA 2P4KA 1M1KW 5HFLA 2IH1C 4WBNB 1FAFA 1OHHG 3Q4HA 4F6RB 1JPXA 2W6IG 1CXZB 2ZE8A 5FL7G 1SERA 3QVNA 4UCOA 3ZIAG 3KCXA 3F7YC 3SPGA 2A0LA 4JI8O 5EC2C 4JZ2A 2HKOA 2YUAA 1XOUA 2DQ0A 1R3LC 1XMQB 4NVPA 1D5NA 3FYEB 4X20B 2JEUA 1VF7A 3FAVA 3B8MA 1GN6A 2QWRB 2YXYA 5E1AC 1SA0B 3C3TA 4DR4B 2P90A 3RYCB 1P4RA 3K9AA 3TCUA 2QM4A 2IM9A 2P4VA 2WPDG 1R6KA 5JQGA 3FB8C 3PN1A 3WU2Z 1US6A 5B1AB 2KB1A 3ZHQA 4NXNB 1W0KG 4DO2A 2Q0AA 4DUZB 1F7YA 3AG4C 4X65B 2N74A 3AG4B 4GKJB 5EK0A 2XNDG 2Q0OC 1FFXA 2E76B 2HVJC 2Q73A 4MT8A 4AILC 3N2KB 4Z1MG 5LP6A 2AW9A 3CCVV 1F4NA 3BY6A 1OZ0A 2NLJC 4IIJB 5LXTA 1P84F 2EIJC 5FNVB 1K7DA 2BTOA 2YEVA 2DYSC 1H8EG 4YJ3A 2ODMA 2EIJB 4BIZA 2CTQA 4JAVA 1J5EB 1Y67A 5LA6B 1IBMB 3CCRV 4BW9A 2L6LA 4WCEV 3S3WA 1FFTB 2N04A 1V55C 4GKKO 1AROP 2MK3A 3JD0A 4FLTA 1Y66A 1V55B 5H5NA 1VQKV 1ZTEA 4H37A 3CXCU 3L74H 1LUVA 1IX9A 5DEDA 5J9PC 2QKAA 1PL0A 2GUZB 1MG1A 2YIDA 4MVUA 1NJIW 5GW7A 1YXBA 3I56V 4DK0A 4QE7A 2Y4UA 4CS3A 4FLVA 3CCQV 3H1IH 1NU1H 3HKCA 3FX7A 1Y76B 1OCOC 4NB5A 2XOKG 3QO8A 4O2AA 3CRMA 3FB7C 5KAIZ 2LW7A 4MVSA 3RYHB 4JI4O 3B09A 1VIBA 1K5SA 5DECA 1F23A 1VF6A 4L87A 2OTJV 5JVDA 3CMAV 3G67A 4UUJC 5CBFA 2RJZA 4DR1B 1Q3EA 2JGDB 3SJBC 1DF4A 3ZRXA 1MZFA 5LYJA 5LL6Y 1QBZA 1AR1B 2BSKB 1I7FA 2LFSA 2AHZA 1XL6A 2E5LO 1F4MA 3CCEV 1PV0A 2Q7EA 1BHAA 2WLKA 2QA4V 1KECA 4JI7O 2YDEA 1RSOB 3BVOA 3HPLC 4DRXA 1BHBA 2DE0X 1XI1A 1H8HG 5EBWC 1H2SB 5F2VO 3ZHRA 4OPAA 4CC5A 1AVMA 4IT5A 1QR9A 2OIEA 4J7KA 1FXKB 3T1CA 3L75H 4YY3B 4CH4A 2ZDIC 1S3JA 3D3QA 5CMUA 5H2FZ 3P32A 1G6UA 1TGOA 3IFXA 4DR5O 3ICXA 1L8DA 1DGSA 2RN9A 1GN3A 3U10A 1VARA 3T4ZA 2QJ1A 3D8CA 4X88A 4TV8B 1VQ5V 5LGNA 2IJKA 4XDLA 4DV1B 2ZKOA 4R50A 4LF7O 3WB2A 4YJ2B 5LHIA 2Z0AA 4FPPA 2ADPA 4IYHA 1XNQO 4YHHB 2UUAB 1XNRB 4JYCA 3HKEA 1SQVH 4KL1A 3K59A 2ITDC 3JD2A 1QU7A 2P5OA 3RBZA 4CS2A 5JWPA 3JCZA 4MTFA 1Z2GA 1GN4A 3FB5C 1H38A 3JD1A 1YVWA 1OJHA 4JF3A 2RDCA 1XHXA 4W4LA 1VQ8V 2F95B 5KAFZ 3CC4V 3ABKC 1NZ6A 3W7SA 1SZTA 3ABKB 4IHJA 1AP6A 3CJHA 1FJGO 1RM1C 3ZEDA 3G6BA 1RM1B 2IBZH 4GX0A 1RFYA 4DR3O 3QF7A 1G8MA 2XAHA 2BOBC 4GX2A 3RVYA 4B3TB 4LNUA 2RNBA 3JALA 3IC9A 4OPHA 2Y69B 3ABLB 4JYAB 3RVZA 2DWDC 4DR7O 3L70H 3IAYA 1J95A 4JI3O 2QWOB 4PELA 4LWSB 4LF5O 5KMGA 4X1KA 1K34A 4PI0A 4JI5B 3CWBH 1BE3H 4FMTA 5LHGA 3ZN1A 2ZR3A 2V7QG 1M56C 2X0LA 1YJNV 2ZCEA 4DV6O 2YXHA 4JI8B 4N21A 4LFCB 4FK5C 3BAAA 2PUSA 3K5OA 4ICGA 4Z1VA 3MHSC 3JSNA 1XREA 4TQDA 1ZL8B 3CXHF 5K1XA 5HFMA 4MTOA 2PYLA 3K06A 2R9IA 1GO3F 2QE7G 2A9HA 1K5QA 4A5UB 4GZRB 3K04A 2W0FC
chains in the Genus database with same CATH topology
3W7XA 1B6QA 4GX5A 2P6JA 3K03A 2OTLV 2EIKC 3K0DA 2IJIA 3GWOA 2DQ3A 3D36A 2WLIB 1V54B 1FXHA 5L3CA 1H2GA 3QO5A 3VOUA 5C93A 4MVZA 4R6ZA 1KC8W 1K33A 2IU0A 4LC1A 5KA6A 3ETDA 3T2MA 4WFHA 1NH2D 4PDVA 1OCRB 1GMGA 3E8FA 4R7CA 5B1OA 1JCHA 5H9CA 3P30A 3ABUA 5EC1C 1NQTA 3LNMB 3G6EV 2LFRA 1VQ6V 2P7TC 1E1QG 4XBFA 4G2KA 2P67A 3ZRVA 1OCZC 2HLDG 4JPRA 2QM8A 1KD1W 1CPYA 1Y4MA 3AG3B 4JTCB 5CBHA 3LDDA 4U7OA 2R9RB 3OEEG 4G28B 1W0JG 2WLHA 2JIZG 3OMNB 3ASOC 1I5XA 3AG2C 5B1BC 3EHBB 1E79G 1DTOA 3CCUV 1M1KW 5HFLA 2IH1C 3AG2B 3K0GA 4TSFG 5B1BB 2JDIG 3E8BA 1OHHG 2QM7A 1JPXA 2OCCB 2W6IG 4Q20A 3CMEV 4UXNA 5FL7G 4WFBV 1YIJV 1SERA 4BW5A 3F5WC 2QKSA 1AJNA 3LUTB 3ZIAG 4RAIA 3LDCA 3F7YC 3SPGA 1UJWB 2A0LA 3ZRWA 2PI4A 5EC2C 4PDMA 1PNMA 1GTOA 2HKOA 2Q67A 4GT1A 4UV8A 5IY5C 5H6RA 3X2QC 2DQ0A 2EIMC 2XAQA 3B77A 5IY5B 1R3LC 4RUFA 2EILC 1WPXA 3X2QB 1LNQA 3FYEB 2EIMB 2JEXA 1W2BU 2B1GA 4PA3A 1YSCA 1VQLV 2EILB 3JYCA 2JEUA 3E35A 3JD3A 1KQSU 4PA9A 3B8MA 2NNUA 1VQPV 2QTOA 2B1IA 2H8PC 2EINC 5E1AC 5H6QA 2P90A 3SYAA 4UVAA 4RUEA 2EINB 2PI5A 4J9ZB 1P4RA 1YJ9V 3K9AA 1K8AW 4X89A 3TCUA 1M56B 4RQFA 2IJJA 1JX9A 4MW3A 2WWWA 3CP1A 2WPDG 1COWG 1R6KA 2Q68A 1PNKA 3FB8C 1JVMA 2HJFC 2X6BA 3AEIA 3ML0A 1NH2B 1QLNA 1ORQC 3W7TA 5IYCO 2Q69A 1S0VA 3LDEA 1GM9A 2CK3G 2KB1A 5B1AB 4YXWG 1FXKA 4LCUC 1W0KG 2DYRC 2GHYA 3T4DA 1NR7A 1HWYA 4DO2A 3AG4C 2DYRB 1AJPA 3FKSG 3AG4B 2ITCC 5EK0A 1VQ9V 1PKXA 1SETA 2XNDG 4U7NA 1DF5A 4ZKIA 5KUKA 5BZBA 1VQOV 4BAYA 2HVJC 4WFAV 4MT8A 3GB7C 3MD0A 2IW5A 2QEXV 1YJWV 3W7UA 4Z1MG 2XASA 2EIKB 2IJHA 3CCVV 1F4NA 3BY6A 3SPJA 1OZ0A 3IGAC 1FXKC 1ZWIC 2NLJC 3TK1A 2C2AA 3CCJV 5LGTA 1AI5A 2EIJC 1K7DA 1R3JC 2YEVA 4KUMA 5DN6G 2DYSC 1H8EG 2EIJB 2WLMA 4BIZA 4JAVA 1QCEA 4FIPC 4KP4A 3OAAG 3CCRV 4BIUA 5B3SC 4PA7A 3F7VC 5CBGA 4ZBMA 3FYIB 4WCEV 5B3SB 1JQ0A 1FFTB 2WLLA 1V55C 1AROP 1PD3A 2MK3A 3JD0A 3K3WA 3STZC 3E8HA 4JTAB 4WFGA 3WG7C 2X7RB 1Y66A 1V55B 1VQKV 1KP2A 4H37A 1Q7YW 3WG7B 3CXCU 3VBBA 1K4CC 1DLBA 4EKWA 4OXSA 5J9PC 1OCZB 3ETEA 3MHHC 3B8NA 1PL0A 2YEVB 3E83A 3HB3B 3OMIB 1MG1A 4TWKA 1OCCC 5L3BA 4PA6A 4MVUA 1MSWD 1NJIW 2YSUB 4MSWC 3ASOB 1OCCB 1BMFG 4QJFB 1FS0G 5GW7A 2JJ1G 3I56V 3SPIA 4LBEC 4I5SA 3OUSA 4QE7A 2X6AA 4MS2A 4JASA 4DXWA 3CCQV 2GSMB 3DTUB 1OCOC 3BEHA 3CCMV 1RPRA 1F51A 2XOKG 3QO8A 1NVPD 3STLC 1WLEA 3SPCA 4R8CA 3OR6C 3FB7C 1YI2V 1CEZA 3NXSA 3OGCC 4MVSA 3OE7G 1I5YA 1K5SA 1R73A 1S72V 4QPJA 1F23A 4QIWF 4L87A 5DM6V 2OTJV 3CMAV 3JD4A 2Y69C 1FXVA 2EZOA 1NR1A 3ABLC 4UUJC 5CBFA 1RPOA 1EBOA 2BOCC 1M57C 2ZXWC 5IDJA 1DF4A 3ZRXA 1M57B 5LGUA 4JAUA 3ZRWB 1G4YB 1QBZA 2DW4A 1AR1B 1GM7A 2LFSA 2AHZA 4UV9A 2XAJA 4JYBA 1XL6A 1TUEB 3ETGA 1M9NA 1F4MA 2DWEC 3CCEV 4HYOA 2WLNA 1BHAA 3D3IA 1AI7A 2WLKA 2X6CA 2QA4V 1KECA 4CBCA 3CCSV 1GKFA 1E1RG 4LP8A 2EZPA 3OW2U 3HPLC 2ZDIA 3CCLV 3CD6V 5EBLC 2HG5C 1BHBA 1K3EA 1AI4A 2WLIA 1H8HG 1R3IC 5EBWC 3E89A 3SPHA 2XAGA 1VQMV 2FTKA 1R6NA 1KP3A 2Z3YA 4PDRA 4PA4A 5L3GA 1VQ7V 2V1DA 1K97A 3ZMUA 3ZMSA 1AJQA 5EBMC 3E86A 4FJCC 1YTFD 3AG1C 1QR9A 4P9PA 2H94A 3SYCA 3SYQA 3OUFA 4P9OA 3ZN0A 2Z5UA 1FXKB 2EBOA 3AG1B 3T1CA 4QNHB 2LP7A 3DGEA 1K73W 3OR7C 2M7WA 2ZDIC 4G27B 3SYPA 1S3JA 5CMUA 2HFEC 3P32A 4F4LA 2DYSB 4HAMA 4ASUG 3IFXA 1V54C 1SESA 3EFFK 1L1FA 1VQNV 4QPKA 4TT3G 3QNEA 3T4ZA 1R3KC 1NVPB 4XDKA 4X88A 3ZMZA 1VQ5V 5LGNA 2IJKA 3LSQA 3UM7A 1IXMA 4E2LA 2IH3C 4XDLA 2F43G 4JTDB 4R50A 2WAMA 1EFRG 3OEHG 4MTXA 4HZ3A 2Q6AA 1OCRC 4RQEA 2JK5C 5LHIA 3LSSA 4FPPA 2ZR2A 2ZQMA 2HR3A 3ZMTA 4JYCA 4CZZA 3G71V 5L3FA 2ITDC 3JD2A 3QO7A 1K92A 2XAFA 4XDJA 5KUMA 3RBZA 1GM8A 3JCZA 4MTFA 4WFEA 3ZJZA 3K79A 3FB5C 5KA5A 3JD1A 1H38A 1QVFU 3ABMC 4WFFA 1JOYA 1MOFA 4JF3A 1QVGU 3FB6C 3AG3C 3ABMB 3W7WA 2WLLB 4X8AA 1VQ8V 1PNLA 3UKMA 3ASNC 5CN0A 4H33A 5LHHA 1YHQV 3CC4V 1AI6A 3ABKC 3W7SA 5CA3A 3CPWU 3ASNB 4PDLA 1OCOB 1P7BA 1SZTA 3ABKB 4P30A 3WFVA 1N8RW 1RM1C 3A0RA 2OCCC 3KG2A 1S76D 1RM1B 1QLEC 1ROPA 2ATKC 5B1NA 4GX0A 1Q82W 1M90W 2D3OW 1QLEB 2A79B 5LBQA 2UXNA 3CYOA 3CC2V 5IYBO 1G8MA 2XAHA 2BOBC 4GX2A 4MTGA 3RVYA 1Q86W 1JJ2U 2W6JG 4P2ZA 2HVKC 4MW8A 3SYOA 1Q81W 4KFMA 2Y69B 1K4DC 3ABLB 1YTFB 2UXXA 3RVZA 3G4SV 4RO2A 4MVMA 3TETA 3M99B 2DWDC 5L3DA 2ZXWB 1J95A 4MVQA 2WLJA 4PELA 3SJQC 1GK9A 4UVBA 1K34A 2OT5A 2ZD9A 1XL4A 4JGSA 1MABG 4FMTA 5LHGA 1EZJA 3CC7V 3ZN1A 4WF9V 3RW0A 3H01A 1S5HC 2ZR3A 3OM3B 2V7QG 3K08A 4I9WA 1M56C 4J9YB 2B5UA 2X0LA 3ABTA 2JJ2G 1SRYA 3ZMVA 1YJNV 3E2EA 1ENVA 3OFNG 2K1EA 1BL8A 4N21A 4FK5C 1THZA 5IYDO 1YITV 2WSSG 5B1AC 3MHSC 3ZRSA 1QR8A 4N23A 1S77D 3PJSK 4QE9A 3OMAB 5HFMA 4MTOA 1KKDA 2IU3A 2AHYA 3K06A 3ZCCA 1K9MW 1CP9A 3IC7A 4MVOA 3E8GA 3R65A 2R9IA 1NKDA 1VQ4V 1GO3F 2QE7G 5L3EA 2A9HA 3I55V 1K5QA 4GCZA 4GX1A 1NBMG 2EJRA 3K04A 2W0FC 4MVRA 4UVCA 2Y48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DF4 A;  1QCE A;  4N21 A;  4FK5 C;  1SZT A;  3M99 B;  3B77 A;  2P6J A;  3CP1 A;  4FIP C;  3MHH C;  3B8N A;  5CMU A;  5H9C A;  3WFV A;  3P30 A;  1I5X A;  1MG1 A;  1QBZ A;  3GWO A;  1I5Y A;  3MHS C;  5HFL A;  1JQ0 A;  1K34 A;  1QR8 A;  4N23 A;  2OT5 A;  3B8M A;  5HFM A;  1JPX A;  2MK3 A;  4FJC C;  4JGS A;  5KA5 A;  1F23 A;  2X7R B;  4G2K A;  1MOF A;  1QR9 A;  1Y66 A;  3CYO A;  4JF3 A;  4E2L A;  2M7W A;  3H01 A;  2EZO A;  1K33 A;  2EBO A;  4JPR A;  5KA6 A;  2EZP A;  1EBO A;  2LP7 A;  1DLB A;  5CN0 A;  1Y4M A;  3K9A A;  1ENV A;  1DF5 A; 
#chains in the Genus database with same CATH topology
 4GX5 A;  4X62 O;  3E22 A;  4X66 O;  4LH6 A;  1N0N A;  4FM2 A;  3UT5 B;  4EFE A;  2YIA A;  5GON B;  1H2G A;  1WP7 A;  5LMN O;  3CX5 F;  1SS3 A;  1HNX O;  2F4V O;  4DR6 O;  2ZE5 A;  5D5P A;  3HKD B;  4FFK A;  4LH7 A;  2V4D A;  2E74 B;  1MMM A;  5BXZ A;  1NH2 D;  1VEW A;  4PDV A;  4OX9 O;  1GMG A;  3E8F A;  5JJJ B;  1X4T A;  3P30 A;  4PHZ A;  2GTA A;  2YIB A;  1NQT A;  3H1H H;  3LNM B;  5J2U A;  3RYF B;  3D36 C;  4K8Z A;  3U11 A;  2CH7 B;  1IBK O;  4G2K A;  1URF A;  1JA8 A;  5EYP A;  1QNM A;  3M8A A;  2AXT Z;  4U7O A;  4G28 B;  1W0J G;  5C8Y B;  4D7S A;  2JIZ G;  3ASO C;  2JRI A;  3AG2 C;  5B1B C;  1E79 G;  2RQ6 A;  1U97 A;  4TQF A;  3AG2 B;  3K0G A;  5B1B B;  2OCC B;  4Q20 A;  5IJ0 B;  4UXN A;  4BW5 A;  3F5W C;  4GKK B;  3BPZ A;  1IUR A;  4D7T A;  1UJW B;  3ZRW A;  2PI4 A;  4O4H B;  1IBL O;  2Q67 A;  4GT1 A;  5IY5 C;  5H6R A;  3B77 A;  2EIM C;  3BRC A;  5IY5 B;  1D2D A;  4J42 A;  1IDS A;  2EIM B;  1W2B U;  3UCS C;  5JCO A;  4FLY A;  1XIL A;  2W0X A;  5CA1 B;  3WB0 A;  1B04 A;  1VQP V;  4FLU A;  3GWK C;  4JI2 O;  2ZIO A;  3Q4H B;  2ZNJ A;  4UVA A;  3CB2 A;  4J9Z B;  1YJ9 V;  4ZI7 A;  3VQX A;  3JAM N;  2IJJ A;  1JX9 A;  3L9D A;  2WWW A;  3CP1 A;  3HKB A;  1COW G;  4DR2 O;  3FD9 A;  4O4I A;  2NN4 A;  1EM1 A;  2HJF C;  3ML0 A;  1HNZ O;  2ZIM A;  1ORQ C;  3W7T A;  2Q69 A;  4JI4 B;  2BCC H;  5EZY B;  1NR7 A;  1HWY A;  4EB6 A;  3M7M X;  3FAV B;  2R72 A;  3F5T A;  2ITC C;  3K5L A;  3BAB A;  1PKX A;  4H13 B;  1BQ0 A;  2HP8 A;  4K0K O;  2IW5 A;  1YJW V;  3K9S A;  3ETQ A;  2IJH A;  2E5L B;  3IGA C;  3C3S A;  3TK1 A;  3CEI A;  1Y74 A;  1AR5 A;  1MA1 A;  5J2T B;  3CCJ V;  1AI5 A;  1QHT A;  2Q9L A;  5DN6 G;  4JI7 B;  4KHP O;  1NI8 A;  1QCE A;  4FIP C;  4LF6 O;  5B3S C;  1YDX A;  4PA7 A;  3U0Z A;  1FFX B;  3F7V C;  4B3M O;  3FYI B;  3N2G A;  5K1P A;  5B3S B;  4DK1 A;  1TUB A;  5LP6 C;  1KMI Z;  3K3W A;  4JTA B;  2F93 B;  1O9H A;  2X7R B;  5KHK A;  2VS0 A;  1I94 O;  1BZK A;  2O57 A;  4NTX A;  4CH5 A;  4OXS A;  1SZX A;  3SGI A;  2UXD O;  1OCZ B;  2QGN A;  3RYI A;  2OCH A;  3B8N A;  3MHH C;  2YEV B;  5L3B A;  4DR5 B;  4MSW C;  3AK3 A;  1GN2 A;  4ZOL B;  4GYC B;  3SPI A;  2R70 A;  3BHP A;  4LBE C;  4ZHQ A;  2X6A A;  4MS2 A;  4JAS A;  4TV9 A;  3BEH A;  2LGW A;  1NVP D;  2E3C A;  4LF9 O;  1ZX3 A;  1CEZ A;  5KLV H;  1GAX A;  1I5Y A;  4I50 B;  4FM1 A;  3B40 A;  1R73 A;  4JZG A;  4QPJ A;  5IJ9 A;  3JD4 A;  2EZO A;  3RN4 A;  1EBO A;  2BOC C;  2ZXW C;  3CRR A;  3HKC B;  2KG7 B;  1NTK H;  4O2A B;  2F23 A;  1G1X B;  4UV9 A;  1FJG B;  2XAJ A;  4JYB A;  1TUE B;  1Q6H A;  2P22 C;  1Y6X A;  4X1I A;  2WLN A;  4DR3 B;  3D3I A;  4I4T A;  1AI7 A;  2Y0I A;  1M5I A;  4UCU A;  1VF6 C;  3CCS V;  1YEW A;  3OW2 U;  1KKC A;  2HG5 C;  1K3E A;  1N32 O;  2WLI A;  4I55 A;  3SPH A;  1GH6 A;  2ILM A;  4DR7 B;  2Z3Y A;  4PA4 A;  1IXB A;  1VQ7 V;  5LYJ B;  4JI3 B;  2GV9 A;  5FPR A;  5LOV A;  5EBM C;  3OT7 A;  4O4L A;  2A06 H;  3AG1 C;  4P9P A;  2H94 A;  3SYC A;  3SYQ A;  4J41 A;  3AG1 B;  2JVD A;  2UUC O;  3A0B Z;  2UXB O;  3OR7 C;  5JJN B;  5TIS Z;  3SYP A;  4UCV A;  4F4L A;  2DYS B;  1V54 C;  4DV0 O;  2CUG A;  4DRX B;  5GTH Z;  1SES A;  3EFF K;  3J7A U;  1L1F A;  4HNA A;  1VQN V;  4TOI A;  4O4J B;  1R3K C;  2AZ0 A;  1NTM H;  3LSQ A;  3UM7 A;  5CA0 B;  1IXM A;  1T5E A;  1JMK C;  1ZSP A;  2IH3 C;  4JTD B;  3OEH G;  4MTX A;  2Q6A A;  2ZM6 B;  3LSS A;  4LFB O;  2ZQM A;  5IYZ B;  4WBN A;  4FLZ A;  1PP9 H;  4X62 B;  1VF5 B;  5FPO A;  1U96 A;  4F6R A;  4X66 B;  4NR1 A;  1K92 A;  1WN7 A;  3JAK B;  3ZJZ A;  3ABM C;  1AIL A;  3O9O A;  1R6T A;  3UO2 A;  3AG3 C;  3ABM B;  3W7W A;  5LMN B;  1HNX B;  2F4V B;  2WLL B;  4DR6 B;  3TGU H;  1PNL A;  2Y4T A;  4B7E A;  4X20 A;  1AI6 A;  2MW2 B;  2BE3 A;  5CA3 A;  1OCO B;  3N27 A;  3WFV A;  3A0R A;  1QLE C;  5B1N A;  1M90 W;  2D3O W;  5D5Q A;  1QLE B;  2A79 B;  5LBQ A;  5LMU O;  1IBK B;  1Q86 W;  1JJ2 U;  2W6J G;  4P2Z A;  3SYO A;  2GBO A;  2XHB A;  4X1Y A;  1M93 A;  1YTF B;  2UXX A;  5A2Q N;  4RO2 A;  2WLJ A;  1GK9 A;  1ZAU A;  2RMK B;  5BMV B;  3T1H O;  3CJH B;  2OT5 A;  2ZD9 A;  1XL4 A;  3P3P A;  4J10 A;  1MAB G;  2QWP B;  1P49 A;  1KUQ A;  3RW0 A;  4JI0 O;  1S5H C;  2B5U A;  5KHJ A;  3L72 H;  2JJ2 G;  4BR6 A;  3ZMV A;  3OFN G;  1WJZ A;  4LNU B;  2K1E A;  3DXR A;  3JAL B;  4FLX A;  1IBL B;  2UXC O;  2P06 A;  1N34 O;  2WSS G;  1SC5 B;  4DV7 O;  1Q90 D;  4N23 A;  1S77 D;  2DOS A;  2LJ2 A;  5FNV A;  4X1K B;  2IU3 A;  2AHY A;  2LO1 A;  4FZ0 A;  4AQY B;  1NKD A;  5LA6 A;  4FZ1 A;  1VQ4 V;  2CE4 A;  4JI2 B;  1B3Q A;  4U3F H;  4GX1 A;  2GDS A;  3OAA G;  4MVR A;  2Y48 A;  4CC6 A;  1N4C A;  3WB1 A;  1MSD A;  3K03 A;  4DV3 B;  3OTO O;  4JAA A;  2UU9 O;  2OTL V;  4DR2 B;  2EIK C;  3GWO A;  2DQ3 A;  1XHZ A;  1FXH A;  1HNZ B;  1XEQ A;  2CTW A;  4MVZ A;  1Q6I A;  4DV2 O;  4R6Z A;  1YCI A;  4J11 A;  2IU0 A;  2F66 C;  4LC1 A;  3ETD A;  2GUZ A;  2RCV A;  5KHI A;  2CAZ C;  5H9C A;  2OYQ A;  5EC1 C;  2KSD A;  4K0K B;  4LF4 O;  1I08 A;  4JI1 O;  3G6E V;  3FFQ A;  2CGO A;  4XBF A;  2AGA A;  1NT2 B;  1WA8 B;  4JYY A;  1TVK A;  4L8J A;  3ZRV A;  3R66 A;  2HLD G;  3L71 H;  3JSL A;  4JTC B;  1KYO F;  3JAW B;  4AI8 A;  1HNW B;  3RYH A;  1KU9 A;  2QR4 A;  3ZHS A;  2R9R B;  1SQF A;  4KHP B;  2WLH A;  1I5X A;  3T1Y O;  4LF6 B;  3CCU V;  4B3M B;  1M4U A;  3E8B A;  2QM7 A;  4DR4 O;  5BR8 B;  4UCS A;  3C90 A;  1AJN A;  2YI9 A;  4RAI A;  3LDC A;  4FFB B;  1IZ3 A;  4PDM A;  1GTO A;  2R9A A;  1HR0 B;  3X2Q C;  2CGN A;  3TXS A;  2XAQ A;  1WPX A;  3X2Q B;  1N33 O;  4QGP A;  1VQL V;  1YSC A;  3JYC A;  3E35 A;  3JD3 A;  4PA9 A;  2CTR A;  2NNU A;  1RSO A;  4X65 O;  3SJA C;  3RWR D;  2ZT9 B;  4UCR A;  2PZS A;  1SQG A;  2D2C B;  3SYA A;  4RUE A;  3CS5 A;  1K8A W;  4X89 A;  1M56 B;  4RQF A;  2Q68 A;  4LF9 B;  3AEI A;  3CE2 A;  1DK1 A;  2UUB O;  5JCO C;  1FXK A;  4LCU C;  2GHY A;  2DYR C;  3T4D A;  2VQF O;  2K9P A;  4UCT A;  2DYR B;  1R1B A;  4D6T H;  4I0X B;  5JH7 A;  1SET A;  4U7N A;  3CRA A;  1DF5 A;  4ZKI A;  5KUK A;  1VQO V;  4BAY A;  1S5J A;  4TV8 A;  4WFA V;  4IL6 Z;  3GB7 C;  2KKW A;  4PJ0 Z;  3HKB B;  2XAS A;  3TXQ A;  3JAS A;  4YJ2 A;  1ZWI C;  3O65 A;  2C2A A;  1TAE A;  1Q5O A;  3GVM A;  1P7G A;  1PL4 A;  4EB6 B;  1R3J C;  3CRQ A;  2WLM A;  1O9G A;  1N32 B;  3A8T A;  3QTC A;  4KP4 A;  3A2F A;  5CBG A;  4ZBM A;  3BFR A;  3APO A;  1PD3 A;  1AP5 A;  3STZ C;  1EN6 A;  3E8H A;  3K5M A;  4WFG A;  3WG7 C;  1KP2 A;  3QG5 A;  3WG7 B;  3VBB A;  1K4C C;  4K3A A;  1DLB A;  4EKW A;  1Y74 B;  2UXB B;  1FD9 A;  3E83 A;  4DV4 O;  3HB3 B;  3OMI B;  5JJE B;  4TWK A;  1OCC C;  2ZNI A;  4DV0 B;  4CH3 A;  3ASO B;  1BQZ A;  1OCC B;  1BMF G;  3N2G B;  1TUB B;  4ABM A;  4DXW A;  4W4K A;  2GSM B;  4O2B A;  3CCM V;  1RPR A;  1F51 A;  3DC5 A;  1WLE A;  4LFB B;  4F6E A;  1L0L H;  4R8C A;  3NXS A;  3OE7 G;  3RYI B;  1UPG A;  1S72 V;  3ZS8 C;  1YZB A;  2VWJ A;  1NR1 A;  1NS1 A;  4ZHQ B;  5IDJ A;  3J81 N;  2WA4 A;  5LGU A;  4JAU A;  1ZL8 A;  5KX5 A;  1GM7 A;  3JAT A;  1M9N A;  2DWE C;  2CTP A;  1L0N H;  4DUY O;  2X6C A;  4CBC A;  1GKF A;  5IE9 A;  4LP8 A;  1JFF A;  2EZP A;  3CD6 V;  3UT5 A;  1VP7 A;  2PTM A;  1R3I C;  2XAG A;  2FTK A;  3OD4 A;  1R6N A;  3G80 A;  1KP3 A;  4PDR A;  4E4E A;  4U3J A;  1WP8 A;  3HKD A;  3ZMS A;  4B3R O;  2ADQ B;  1SQX H;  4GUN A;  4UFZ A;  3E86 A;  4FJC C;  5JQG B;  3T1H B;  4DW1 A;  4P9O A;  2FKX A;  1TA8 A;  2Z5U A;  2EBO A;  4YHH O;  2UUA O;  4JI0 B;  3DGE A;  1ZLZ A;  1K73 W;  4I4T B;  2M7W A;  4G27 B;  4Z2W A;  2HFE C;  3RYF A;  4HAM A;  2UXC B;  1N34 B;  4J7Z A;  5CB4 A;  3MDS A;  4DV7 B;  1SQQ H;  4XDK A;  3J80 N;  4E2L A;  5LP6 B;  3OTF A;  5LOV B;  1OCR C;  4RQE A;  3RGB A;  3RT3 C;  2ZR2 A;  3SDL A;  2EX3 A;  5LXT B;  4CZZ A;  5B5E Z;  2DMX A;  1WB8 A;  5L3F A;  4BWA A;  5IJ0 A;  3QO7 A;  4YJ3 B;  1HP8 A;  3OTO B;  2UU9 B;  3H1L H;  4CS4 A;  1EN4 A;  3KKY A;  4B3T O;  1QVF U;  4HNA B;  4O4H A;  4DV2 B;  4JI6 O;  2BTQ A;  3CSX A;  4X8A A;  4JYA O;  3UKM A;  5CN0 A;  4H33 A;  5LHH A;  4LF7 B;  1FYJ A;  5KHH A;  1BSM A;  1XNQ B;  5CA1 A;  5ITZ A;  2DN9 A;  4JI5 O;  3KG2 A;  1S76 D;  2B9Z A;  1Q82 W;  2OWO A;  4LF4 B;  4JI1 B;  2EUL A;  4TUY A;  4FM0 A;  2QTS A;  3DSQ A;  2HVK C;  4YIP A;  3A0H Z;  4LFC O;  1K4D C;  2Q7H A;  1SF9 A;  5EIB D;  2LQT A;  3LNN A;  3M99 B;  2ZXW B;  2Q8V A;  5EZY A;  3MAQ A;  4LF8 O;  4KXR A;  4UB6 Z;  4BIO A;  2HHH O;  3T1Y B;  2YC0 A;  3JAR A;  4JGS A;  1EZJ A;  4ZIB A;  1W59 A;  3K08 A;  4J9Y B;  1H2N A;  3E2E A;  1N36 O;  5JVD B;  4EEQ A;  2CDY A;  2WA3 A;  4X1Y B;  1YIT V;  5B1A C;  1N33 B;  3ZRS A;  1QR8 A;  3K58 A;  4QE9 A;  4RWU A;  5J2T A;  5IWA O;  3OMA B;  4LF5 B;  3VQY A;  3ZCC A;  1BT8 A;  3IC7 A;  4MVO A;  2Q4P A;  3R65 A;  4DW0 A;  4OGQ B;  2EJ7 A;  2EJR A;  3W7X A;  1B6Q A;  2ZIN A;  5IT9 N;  4DV6 B;  2DJV A;  3DXR B;  2IJI A;  1V54 B;  3QO5 A;  3VOU A;  5C93 A;  2UUB B;  2VQF B;  1K33 A;  5KA6 A;  3T2M A;  4WFH A;  4FLW A;  2A3Q A;  3OGI B;  2A7W A;  3THO A;  4ZOL A;  5B1O A;  3ABU A;  2N05 A;  1MNG A;  5A9G A;  3H9V A;  5KHG A;  1E1Q G;  1AB3 A;  1BCC H;  1X59 A;  2P67 A;  1NTZ H;  2YXL A;  3S3X A;  1HW7 A;  3AG3 B;  5CBH A;  4I50 A;  3OEE G;  1AR4 A;  3OMN B;  4OX9 B;  3EHB B;  1DTO A;  3HKE B;  4TSF G;  2JDI G;  3CHX A;  4DYL A;  1SA0 A;  1SQP H;  4B3S O;  4H44 B;  1YIJ V;  3CME V;  4WFB V;  3RYC A;  2QKS A;  3BA9 A;  3LUT B;  5AG2 A;  2KG7 A;  3L73 H;  4NXM O;  1WAZ A;  1PNM A;  1TVK B;  4UV8 A;  1Q6U A;  1IVS A;  4DV5 O;  4JV5 O;  3K57 A;  4RUF A;  2EIL C;  1LNQ A;  2JEX A;  2B1G A;  4PA3 A;  4DV4 B;  2EIL B;  1KQS U;  1PPJ H;  4UB8 Z;  4Q6G A;  4IHJ B;  2QTO A;  2B1I A;  2H8P C;  1JJO A;  3EXA A;  2EIN C;  3ZHT A;  5H6Q A;  4X64 O;  2EIN B;  2PI5 A;  2PF4 E;  1YF2 A;  3N2K A;  4MW3 A;  3TJT A;  1PNK A;  2Y0P A;  1JVM A;  2X6B A;  3VQW A;  1NH2 B;  4I9Q A;  1QLN A;  5IYC O;  1S0V A;  3LDE A;  4IIJ A;  1GM9 A;  1WPB A;  2CK3 G;  4YXW G;  4LFA O;  2G38 A;  4J80 A;  1SQB H;  2ZE7 A;  1H2L A;  5KMG B;  1XDC A;  1AJP A;  3FKS G;  4GLX A;  1VQ9 V;  1KBH A;  1EN5 A;  1BGY H;  4O4J A;  5BZB A;  1XMO O;  2H3O A;  1Z5V A;  1V9P A;  5CA0 A;  3MD0 A;  2QEX V;  3W7U A;  2VQE O;  2ZE6 A;  1JR9 A;  2EIK B;  3SPJ A;  1FXK C;  5IYZ A;  4DUY B;  2QSA A;  2YI8 A;  5LGT A;  5FLX N;  4KUM A;  4YIO A;  2PGG A;  5JH7 B;  3JAK A;  4BIU A;  2AZ2 A;  3B2E E;  1JQ0 A;  3E22 B;  3CRC A;  2WLL A;  4PV1 B;  3ZHU A;  4B3R B;  1Y76 A;  1Q7Y W;  3JAS B;  4H0L B;  5E79 Z;  1QQC A;  1FKA O;  2LW1 A;  1XMQ O;  2JS5 A;  4PD4 F;  3ETE A;  4NTY A;  4EFB A;  3RFR A;  1Q8I A;  4PA6 A;  1MSW D;  2YSU B;  3NR7 A;  4QJF B;  1XUQ A;  1FS0 G;  2JJ1 G;  2XUM A;  4I5S A;  1SKV A;  3OUS A;  2JGD A;  2PYJ A;  5J2U B;  5BY1 A;  3DTU B;  4K35 A;  1GRJ A;  1I94 B;  5EYP B;  4LR3 A;  1Z5W A;  2BSK A;  3STL C;  5BMV A;  3SPC A;  2UXD B;  1HDJ A;  3OR6 C;  1YI2 V;  3OGC C;  4NXN O;  2XT9 A;  3BA8 A;  4DUZ O;  3ZX6 A;  4QIW F;  5DM6 V;  2Y69 C;  4GKJ O;  1FXV A;  3ABL C;  3AK1 A;  1RPO A;  4JI6 B;  4CH6 A;  2ARH A;  2XTA A;  1WNS A;  1M57 C;  1ZUQ A;  4O2B B;  1M57 B;  3UO3 A;  1A32 A;  3ZRW B;  1G4Y B;  2DW4 A;  4NTW A;  3ETG A;  2Q5Z A;  3H1J H;  2QWN B;  4HYO A;  1LR1 A;  2LGQ A;  2Q7G A;  1EZV H;  1E1R G;  2ZDI A;  3CCL V;  5EBL C;  2HEP A;  1J5E O;  1AI4 A;  1IBM O;  2VRZ A;  3E89 A;  1VQM V;  4ZI7 B;  1OV9 A;  5L3G A;  1XQ8 A;  2QKC A;  3K5N A;  4LF8 B;  2V1D A;  1K97 A;  3ZMU A;  5KX5 B;  2HHH B;  1AJQ A;  4O4I B;  1YTF D;  3UQ8 A;  2FML A;  2KQX A;  3JAT B;  2ZM6 O;  2FYU H;  4I7Z B;  3OUF A;  3ZN0 A;  3B4S A;  4QNH B;  2LP7 A;  2FB5 A;  2F1M A;  1JFF B;  2M6Y A;  1N36 B;  2YIC A;  4ASU G;  1WA8 A;  4FVM A;  4AHC A;  4QPK A;  4TT3 G;  3QNE A;  2L35 A;  1NVP B;  3ZMZ A;  1LUW A;  4U3J B;  5IWA B;  3JAW A;  3EVK A;  1I0H A;  2F43 G;  2WAM A;  1EFR G;  4HZ3 A;  5B66 Z;  1S5L Z;  2JK5 C;  1UFI A;  2HR3 A;  3JCU Z;  3ZMT A;  2UUC B;  3G71 V;  3SR2 C;  5EIB C;  2XAF A;  4XDJ A;  5KUM A;  1KB9 F;  1H2K A;  1GM8 A;  4WFE A;  3VQV A;  3ZHV A;  3K79 A;  5KA5 A;  4FFB A;  4WFF A;  1JOY A;  1MOF A;  5CB4 B;  1QVG U;  4DR1 O;  3FB6 C;  2YS8 A;  1N0J A;  4NKG B;  3ASN C;  1YHQ V;  4K8X A;  3CPW U;  3BCC H;  3ASN B;  4LWS A;  4PDL A;  1P7B A;  2E75 B;  4IGG A;  1BS3 A;  1XBL A;  2HJD A;  1N8R W;  1WB7 A;  2OCC C;  1ROP A;  2ATK C;  2ETN A;  3ZBH A;  2UXN A;  3CYO A;  3CC2 V;  5IYB O;  4MTG A;  2JGU A;  4MW8 A;  1Q81 W;  4KFM A;  4HBN A;  2PY5 A;  2BTQ B;  3G4S V;  4TV9 B;  4MVM A;  3TET A;  3KCY A;  5L3D A;  3SJC C;  3H1K H;  4MVQ A;  1D5A A;  1Q43 A;  3SJQ C;  4UVB A;  5ITZ B;  1VMG A;  4I0X A;  4B3S B;  4AQY O;  3CC7 V;  4NYK A;  4X9Q A;  4WF9 V;  3H01 A;  3OM3 B;  4I9W A;  4YY3 O;  1H2M A;  4TUY B;  3ABT A;  1SRY A;  5LMU B;  4DV3 O;  2QWQ B;  5IJ9 B;  1ENV A;  4NXM B;  1BL8 A;  3KZI Z;  1THZ A;  5IYD O;  3AK2 A;  2YIB D;  4C7U A;  1PM9 A;  5GON A;  4DV5 B;  1B06 A;  4JV5 B;  2VWK A;  3PJS K;  1FPO A;  2JS3 A;  3P3N A;  4DV1 O;  1KKD A;  5GTI Z;  1K9M W;  1CP9 A;  4J7J A;  3E8G A;  3JAR B;  4X1I B;  5L3E A;  1XNR O;  3I55 V;  4X64 B;  4GCZ A;  1NBM G;  4P30 A;  3HR0 A;  4UVC A;  2P6J A;  2CH7 A;  3K0D A;  3D36 A;  2WLI B;  4I55 B;  5L3C A;  3LSU A;  4LFA B;  1KC8 W;  4PI2 A;  2OIG A;  1HNW O;  5C8Y A;  4O4L B;  1RP3 B;  3APQ A;  1OCR B;  3IJ4 A;  2QDO A;  4R7C A;  1JCH A;  2NR5 A;  4B08 A;  1XMO B;  4IYI A;  4B7K A;  3AG7 A;  2FL4 A;  5BR8 O;  2LFR A;  1VQ6 V;  2P7T C;  2VQE B;  3DC6 A;  1OCZ C;  4JPR A;  1HR0 O;  2QM8 A;  1KD1 W;  1CPY A;  1Y4M A;  3LDD A;  1MZE A;  3I5D A;  2GTS A;  2P4K A;  1M1K W;  5HFL A;  2IH1 C;  4WBN B;  1FAF A;  1OHH G;  3Q4H A;  4F6R B;  1JPX A;  2W6I G;  1CXZ B;  2ZE8 A;  5FL7 G;  1SER A;  3QVN A;  4UCO A;  3ZIA G;  3KCX A;  3F7Y C;  3SPG A;  2A0L A;  4JI8 O;  5EC2 C;  4JZ2 A;  2HKO A;  2YUA A;  1XOU A;  2DQ0 A;  1R3L C;  1XMQ B;  4NVP A;  1D5N A;  3FYE B;  4X20 B;  2JEU A;  1VF7 A;  3FAV A;  3B8M A;  1GN6 A;  2QWR B;  2YXY A;  5E1A C;  1SA0 B;  3C3T A;  4DR4 B;  2P90 A;  3RYC B;  1P4R A;  3K9A A;  3TCU A;  2QM4 A;  2IM9 A;  2P4V A;  2WPD G;  1R6K A;  5JQG A;  3FB8 C;  3PN1 A;  3WU2 Z;  1US6 A;  5B1A B;  2KB1 A;  3ZHQ A;  4NXN B;  1W0K G;  4DO2 A;  2Q0A A;  4DUZ B;  1F7Y A;  3AG4 C;  4X65 B;  2N74 A;  3AG4 B;  4GKJ B;  5EK0 A;  2XND G;  2Q0O C;  1FFX A;  2E76 B;  2HVJ C;  2Q73 A;  4MT8 A;  4AIL C;  3N2K B;  4Z1M G;  5LP6 A;  2AW9 A;  3CCV V;  1F4N A;  3BY6 A;  1OZ0 A;  2NLJ C;  4IIJ B;  5LXT A;  1P84 F;  2EIJ C;  5FNV B;  1K7D A;  2BTO A;  2YEV A;  2DYS C;  1H8E G;  4YJ3 A;  2ODM A;  2EIJ B;  4BIZ A;  2CTQ A;  4JAV A;  1J5E B;  1Y67 A;  5LA6 B;  1IBM B;  3CCR V;  4BW9 A;  2L6L A;  4WCE V;  3S3W A;  1FFT B;  2N04 A;  1V55 C;  4GKK O;  1ARO P;  2MK3 A;  3JD0 A;  4FLT A;  1Y66 A;  1V55 B;  5H5N A;  1VQK V;  1ZTE A;  4H37 A;  3CXC U;  3L74 H;  1LUV A;  1IX9 A;  5DED A;  5J9P C;  2QKA A;  1PL0 A;  2GUZ B;  1MG1 A;  2YID A;  4MVU A;  1NJI W;  5GW7 A;  1YXB A;  3I56 V;  4DK0 A;  4QE7 A;  2Y4U A;  4CS3 A;  4FLV A;  3CCQ V;  3H1I H;  1NU1 H;  3HKC A;  3FX7 A;  1Y76 B;  1OCO C;  4NB5 A;  2XOK G;  3QO8 A;  4O2A A;  3CRM A;  3FB7 C;  5KAI Z;  2LW7 A;  4MVS A;  3RYH B;  4JI4 O;  3B09 A;  1VIB A;  1K5S A;  5DEC A;  1F23 A;  1VF6 A;  4L87 A;  2OTJ V;  5JVD A;  3CMA V;  3G67 A;  4UUJ C;  5CBF A;  2RJZ A;  4DR1 B;  1Q3E A;  2JGD B;  3SJB C;  1DF4 A;  3ZRX A;  1MZF A;  5LYJ A;  5LL6 Y;  1QBZ A;  1AR1 B;  2BSK B;  1I7F A;  2LFS A;  2AHZ A;  1XL6 A;  2E5L O;  1F4M A;  3CCE V;  1PV0 A;  2Q7E A;  1BHA A;  2WLK A;  2QA4 V;  1KEC A;  4JI7 O;  2YDE A;  1RSO B;  3BVO A;  3HPL C;  4DRX A;  1BHB A;  2DE0 X;  1XI1 A;  1H8H G;  5EBW C;  1H2S B;  5F2V O;  3ZHR A;  4OPA A;  4CC5 A;  1AVM A;  4IT5 A;  1QR9 A;  2OIE A;  4J7K A;  1FXK B;  3T1C A;  3L75 H;  4YY3 B;  4CH4 A;  2ZDI C;  1S3J A;  3D3Q A;  5CMU A;  5H2F Z;  3P32 A;  1G6U A;  1TGO A;  3IFX A;  4DR5 O;  3ICX A;  1L8D A;  1DGS A;  2RN9 A;  1GN3 A;  3U10 A;  1VAR A;  3T4Z A;  2QJ1 A;  3D8C A;  4X88 A;  4TV8 B;  1VQ5 V;  5LGN A;  2IJK A;  4XDL A;  4DV1 B;  2ZKO A;  4R50 A;  4LF7 O;  3WB2 A;  4YJ2 B;  5LHI A;  2Z0A A;  4FPP A;  2ADP A;  4IYH A;  1XNQ O;  4YHH B;  2UUA B;  1XNR B;  4JYC A;  3HKE A;  1SQV H;  4KL1 A;  3K59 A;  2ITD C;  3JD2 A;  1QU7 A;  2P5O A;  3RBZ A;  4CS2 A;  5JWP A;  3JCZ A;  4MTF A;  1Z2G A;  1GN4 A;  3FB5 C;  1H38 A;  3JD1 A;  1YVW A;  1OJH A;  4JF3 A;  2RDC A;  1XHX A;  4W4L A;  1VQ8 V;  2F95 B;  5KAF Z;  3CC4 V;  3ABK C;  1NZ6 A;  3W7S A;  1SZT A;  3ABK B;  4IHJ A;  1AP6 A;  3CJH A;  1FJG O;  1RM1 C;  3ZED A;  3G6B A;  1RM1 B;  2IBZ H;  4GX0 A;  1RFY A;  4DR3 O;  3QF7 A;  1G8M A;  2XAH A;  2BOB C;  4GX2 A;  3RVY A;  4B3T B;  4LNU A;  2RNB A;  3JAL A;  3IC9 A;  4OPH A;  2Y69 B;  3ABL B;  4JYA B;  3RVZ A;  2DWD C;  4DR7 O;  3L70 H;  3IAY A;  1J95 A;  4JI3 O;  2QWO B;  4PEL A;  4LWS B;  4LF5 O;  5KMG A;  4X1K A;  1K34 A;  4PI0 A;  4JI5 B;  3CWB H;  1BE3 H;  4FMT A;  5LHG A;  3ZN1 A;  2ZR3 A;  2V7Q G;  1M56 C;  2X0L A;  1YJN V;  2ZCE A;  4DV6 O;  2YXH A;  4JI8 B;  4N21 A;  4LFC B;  4FK5 C;  3BAA A;  2PUS A;  3K5O A;  4ICG A;  4Z1V A;  3MHS C;  3JSN A;  1XRE A;  4TQD A;  1ZL8 B;  3CXH F;  5K1X A;  5HFM A;  4MTO A;  2PYL A;  3K06 A;  2R9I A;  1GO3 F;  2QE7 G;  2A9H A;  1K5Q A;  4A5U B;  4GZR B;  3K04 A;  2W0F C; 
#chains in the Genus database with same CATH homology
 3W7X A;  1B6Q A;  4GX5 A;  2P6J A;  3K03 A;  2OTL V;  2EIK C;  3K0D A;  2IJI A;  3GWO A;  2DQ3 A;  3D36 A;  2WLI B;  1V54 B;  1FXH A;  5L3C A;  1H2G A;  3QO5 A;  3VOU A;  5C93 A;  4MVZ A;  4R6Z A;  1KC8 W;  1K33 A;  2IU0 A;  4LC1 A;  5KA6 A;  3ETD A;  3T2M A;  4WFH A;  1NH2 D;  4PDV A;  1OCR B;  1GMG A;  3E8F A;  4R7C A;  5B1O A;  1JCH A;  5H9C A;  3P30 A;  3ABU A;  5EC1 C;  1NQT A;  3LNM B;  3G6E V;  2LFR A;  1VQ6 V;  2P7T C;  1E1Q G;  4XBF A;  4G2K A;  2P67 A;  3ZRV A;  1OCZ C;  2HLD G;  4JPR A;  2QM8 A;  1KD1 W;  1CPY A;  1Y4M A;  3AG3 B;  4JTC B;  5CBH A;  3LDD A;  4U7O A;  2R9R B;  3OEE G;  4G28 B;  1W0J G;  2WLH A;  2JIZ G;  3OMN B;  3ASO C;  1I5X A;  3AG2 C;  5B1B C;  3EHB B;  1E79 G;  1DTO A;  3CCU V;  1M1K W;  5HFL A;  2IH1 C;  3AG2 B;  3K0G A;  4TSF G;  5B1B B;  2JDI G;  3E8B A;  1OHH G;  2QM7 A;  1JPX A;  2OCC B;  2W6I G;  4Q20 A;  3CME V;  4UXN A;  5FL7 G;  4WFB V;  1YIJ V;  1SER A;  4BW5 A;  3F5W C;  2QKS A;  1AJN A;  3LUT B;  3ZIA G;  4RAI A;  3LDC A;  3F7Y C;  3SPG A;  1UJW B;  2A0L A;  3ZRW A;  2PI4 A;  5EC2 C;  4PDM A;  1PNM A;  1GTO A;  2HKO A;  2Q67 A;  4GT1 A;  4UV8 A;  5IY5 C;  5H6R A;  3X2Q C;  2DQ0 A;  2EIM C;  2XAQ A;  3B77 A;  5IY5 B;  1R3L C;  4RUF A;  2EIL C;  1WPX A;  3X2Q B;  1LNQ A;  3FYE B;  2EIM B;  2JEX A;  1W2B U;  2B1G A;  4PA3 A;  1YSC A;  1VQL V;  2EIL B;  3JYC A;  2JEU A;  3E35 A;  3JD3 A;  1KQS U;  4PA9 A;  3B8M A;  2NNU A;  1VQP V;  2QTO A;  2B1I A;  2H8P C;  2EIN C;  5E1A C;  5H6Q A;  2P90 A;  3SYA A;  4UVA A;  4RUE A;  2EIN B;  2PI5 A;  4J9Z B;  1P4R A;  1YJ9 V;  3K9A A;  1K8A W;  4X89 A;  3TCU A;  1M56 B;  4RQF A;  2IJJ A;  1JX9 A;  4MW3 A;  2WWW A;  3CP1 A;  2WPD G;  1COW G;  1R6K A;  2Q68 A;  1PNK A;  3FB8 C;  1JVM A;  2HJF C;  2X6B A;  3AEI A;  3ML0 A;  1NH2 B;  1QLN A;  1ORQ C;  3W7T A;  5IYC O;  2Q69 A;  1S0V A;  3LDE A;  1GM9 A;  2CK3 G;  2KB1 A;  5B1A B;  4YXW G;  1FXK A;  4LCU C;  1W0K G;  2DYR C;  2GHY A;  3T4D A;  1NR7 A;  1HWY A;  4DO2 A;  3AG4 C;  2DYR B;  1AJP A;  3FKS G;  3AG4 B;  2ITC C;  5EK0 A;  1VQ9 V;  1PKX A;  1SET A;  2XND G;  4U7N A;  1DF5 A;  4ZKI A;  5KUK A;  5BZB A;  1VQO V;  4BAY A;  2HVJ C;  4WFA V;  4MT8 A;  3GB7 C;  3MD0 A;  2IW5 A;  2QEX V;  1YJW V;  3W7U A;  4Z1M G;  2XAS A;  2EIK B;  2IJH A;  3CCV V;  1F4N A;  3BY6 A;  3SPJ A;  1OZ0 A;  3IGA C;  1FXK C;  1ZWI C;  2NLJ C;  3TK1 A;  2C2A A;  3CCJ V;  5LGT A;  1AI5 A;  2EIJ C;  1K7D A;  1R3J C;  2YEV A;  4KUM A;  5DN6 G;  2DYS C;  1H8E G;  2EIJ B;  2WLM A;  4BIZ A;  4JAV A;  1QCE A;  4FIP C;  4KP4 A;  3OAA G;  3CCR V;  4BIU A;  5B3S C;  4PA7 A;  3F7V C;  5CBG A;  4ZBM A;  3FYI B;  4WCE V;  5B3S B;  1JQ0 A;  1FFT B;  2WLL A;  1V55 C;  1ARO P;  1PD3 A;  2MK3 A;  3JD0 A;  3K3W A;  3STZ C;  3E8H A;  4JTA B;  4WFG A;  3WG7 C;  2X7R B;  1Y66 A;  1V55 B;  1VQK V;  1KP2 A;  4H37 A;  1Q7Y W;  3WG7 B;  3CXC U;  3VBB A;  1K4C C;  1DLB A;  4EKW A;  4OXS A;  5J9P C;  1OCZ B;  3ETE A;  3MHH C;  3B8N A;  1PL0 A;  2YEV B;  3E83 A;  3HB3 B;  3OMI B;  1MG1 A;  4TWK A;  1OCC C;  5L3B A;  4PA6 A;  4MVU A;  1MSW D;  1NJI W;  2YSU B;  4MSW C;  3ASO B;  1OCC B;  1BMF G;  4QJF B;  1FS0 G;  5GW7 A;  2JJ1 G;  3I56 V;  3SPI A;  4LBE C;  4I5S A;  3OUS A;  4QE7 A;  2X6A A;  4MS2 A;  4JAS A;  4DXW A;  3CCQ V;  2GSM B;  3DTU B;  1OCO C;  3BEH A;  3CCM V;  1RPR A;  1F51 A;  2XOK G;  3QO8 A;  1NVP D;  3STL C;  1WLE A;  3SPC A;  4R8C A;  3OR6 C;  3FB7 C;  1YI2 V;  1CEZ A;  3NXS A;  3OGC C;  4MVS A;  3OE7 G;  1I5Y A;  1K5S A;  1R73 A;  1S72 V;  4QPJ A;  1F23 A;  4QIW F;  4L87 A;  5DM6 V;  2OTJ V;  3CMA V;  3JD4 A;  2Y69 C;  1FXV A;  2EZO A;  1NR1 A;  3ABL C;  4UUJ C;  5CBF A;  1RPO A;  1EBO A;  2BOC C;  1M57 C;  2ZXW C;  5IDJ A;  1DF4 A;  3ZRX A;  1M57 B;  5LGU A;  4JAU A;  3ZRW B;  1G4Y B;  1QBZ A;  2DW4 A;  1AR1 B;  1GM7 A;  2LFS A;  2AHZ A;  4UV9 A;  2XAJ A;  4JYB A;  1XL6 A;  1TUE B;  3ETG A;  1M9N A;  1F4M A;  2DWE C;  3CCE V;  4HYO A;  2WLN A;  1BHA A;  3D3I A;  1AI7 A;  2WLK A;  2X6C A;  2QA4 V;  1KEC A;  4CBC A;  3CCS V;  1GKF A;  1E1R G;  4LP8 A;  2EZP A;  3OW2 U;  3HPL C;  2ZDI A;  3CCL V;  3CD6 V;  5EBL C;  2HG5 C;  1BHB A;  1K3E A;  1AI4 A;  2WLI A;  1H8H G;  1R3I C;  5EBW C;  3E89 A;  3SPH A;  2XAG A;  1VQM V;  2FTK A;  1R6N A;  1KP3 A;  2Z3Y A;  4PDR A;  4PA4 A;  5L3G A;  1VQ7 V;  2V1D A;  1K97 A;  3ZMU A;  3ZMS A;  1AJQ A;  5EBM C;  3E86 A;  4FJC C;  1YTF D;  3AG1 C;  1QR9 A;  4P9P A;  2H94 A;  3SYC A;  3SYQ A;  3OUF A;  4P9O A;  3ZN0 A;  2Z5U A;  1FXK B;  2EBO A;  3AG1 B;  3T1C A;  4QNH B;  2LP7 A;  3DGE A;  1K73 W;  3OR7 C;  2M7W A;  2ZDI C;  4G27 B;  3SYP A;  1S3J A;  5CMU A;  2HFE C;  3P32 A;  4F4L A;  2DYS B;  4HAM A;  4ASU G;  3IFX A;  1V54 C;  1SES A;  3EFF K;  1L1F A;  1VQN V;  4QPK A;  4TT3 G;  3QNE A;  3T4Z A;  1R3K C;  1NVP B;  4XDK A;  4X88 A;  3ZMZ A;  1VQ5 V;  5LGN A;  2IJK A;  3LSQ A;  3UM7 A;  1IXM A;  4E2L A;  2IH3 C;  4XDL A;  2F43 G;  4JTD B;  4R50 A;  2WAM A;  1EFR G;  3OEH G;  4MTX A;  4HZ3 A;  2Q6A A;  1OCR C;  4RQE A;  2JK5 C;  5LHI A;  3LSS A;  4FPP A;  2ZR2 A;  2ZQM A;  2HR3 A;  3ZMT A;  4JYC A;  4CZZ A;  3G71 V;  5L3F A;  2ITD C;  3JD2 A;  3QO7 A;  1K92 A;  2XAF A;  4XDJ A;  5KUM A;  3RBZ A;  1GM8 A;  3JCZ A;  4MTF A;  4WFE A;  3ZJZ A;  3K79 A;  3FB5 C;  5KA5 A;  3JD1 A;  1H38 A;  1QVF U;  3ABM C;  4WFF A;  1JOY A;  1MOF A;  4JF3 A;  1QVG U;  3FB6 C;  3AG3 C;  3ABM B;  3W7W A;  2WLL B;  4X8A A;  1VQ8 V;  1PNL A;  3UKM A;  3ASN C;  5CN0 A;  4H33 A;  5LHH A;  1YHQ V;  3CC4 V;  1AI6 A;  3ABK C;  3W7S A;  5CA3 A;  3CPW U;  3ASN B;  4PDL A;  1OCO B;  1P7B A;  1SZT A;  3ABK B;  4P30 A;  3WFV A;  1N8R W;  1RM1 C;  3A0R A;  2OCC C;  3KG2 A;  1S76 D;  1RM1 B;  1QLE C;  1ROP A;  2ATK C;  5B1N A;  4GX0 A;  1Q82 W;  1M90 W;  2D3O W;  1QLE B;  2A79 B;  5LBQ A;  2UXN A;  3CYO A;  3CC2 V;  5IYB O;  1G8M A;  2XAH A;  2BOB C;  4GX2 A;  4MTG A;  3RVY A;  1Q86 W;  1JJ2 U;  2W6J G;  4P2Z A;  2HVK C;  4MW8 A;  3SYO A;  1Q81 W;  4KFM A;  2Y69 B;  1K4D C;  3ABL B;  1YTF B;  2UXX A;  3RVZ A;  3G4S V;  4RO2 A;  4MVM A;  3TET A;  3M99 B;  2DWD C;  5L3D A;  2ZXW B;  1J95 A;  4MVQ A;  2WLJ A;  4PEL A;  3SJQ C;  1GK9 A;  4UVB A;  1K34 A;  2OT5 A;  2ZD9 A;  1XL4 A;  4JGS A;  1MAB G;  4FMT A;  5LHG A;  1EZJ A;  3CC7 V;  3ZN1 A;  4WF9 V;  3RW0 A;  3H01 A;  1S5H C;  2ZR3 A;  3OM3 B;  2V7Q G;  3K08 A;  4I9W A;  1M56 C;  4J9Y B;  2B5U A;  2X0L A;  3ABT A;  2JJ2 G;  1SRY A;  3ZMV A;  1YJN V;  3E2E A;  1ENV A;  3OFN G;  2K1E A;  1BL8 A;  4N21 A;  4FK5 C;  1THZ A;  5IYD O;  1YIT V;  2WSS G;  5B1A C;  3MHS C;  3ZRS A;  1QR8 A;  4N23 A;  1S77 D;  3PJS K;  4QE9 A;  3OMA B;  5HFM A;  4MTO A;  1KKD A;  2IU3 A;  2AHY A;  3K06 A;  3ZCC A;  1K9M W;  1CP9 A;  3IC7 A;  4MVO A;  3E8G A;  3R65 A;  2R9I A;  1NKD A;  1VQ4 V;  1GO3 F;  2QE7 G;  5L3E A;  2A9H A;  3I55 V;  1K5Q A;  4GCZ A;  4GX1 A;  1NBM G;  2EJR A;  3K04 A;  2W0F C;  4MVR A;  4UVC A;  2Y48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...