1JQ3A

Crystal structure of spermidine synthase in complex with transition state analogue adodato
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
295
structure length
295
Chain Sequence
RTLKELERELQPRQHLWYFEYYTGNNVGLFMKMNRVIYSGQSDIQRIDIFENPDLGVVFALDGITMTTEKDEFMYHEMLAHVPMFLHPNPKKVLIIGGGDGGTLREVLKHDSVEKAILCEVDGLVIEAARKYLKQTSCGFDDPRAEIVIANGAEYVRKFKNEFDVIIIDSTDPTAGQGGHLFTEEFYQACYDALKEDGVFSAETEDPFYDIGWFKLAYRRISKVFPITRVYLGFMTTYPSGMWSYTFASKGIDPIKDFDPEKVRKFNKELKYYNEEVHVASFALPNFVKKELGLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of spermidine synthase with a multisubstrate adduct inhibitor.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Spermidine synthase
total genus 91
structure length 295
sequence length 295
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.16: Spermidine synthase.
pdb deposition date 2001-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01564 Spermine_synth Spermine/spermidine synthase domain
A PF17284 Spermine_synt_N Spermidine synthase tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.140.10 Mainly Beta Roll Spermidine Synthase; Chain: A, domain 2 Spermidine synthase, tetramerisation domain 1jq3A02
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jq3A01
3SX0A 4CTKA 5F2NA 3DLCA 1NW8A 1BHJA 4PYNA 4EKGA 5C9ZA 2H1RA 1WY7A 2B25A 5ICGA 3GCZA 4LWPA 2VS1A 4C08A 1O54A 3G5LA 3HTXA 5DRYA 5EHGA 5EMKA 2HTEA 3MGGA 3OZTA 1ZGJA 4X1OA 1KYWA 1KPGA 3EMDA 5CUQA 4RSRA 1WZNA 1I4WA 3C0KA 1DUSA 2QY6A 3KQMA 4HSGA 3ELUA 5E9JA 1VLMA 3I64A 1ZHFA 5IH3A 2JHAA 2O06A 2NNWB 3NW9A 4R05A 1NV9A 3KR2A 4Y30A 5T6BA 5CM2Z 3S68A 3FUXA 4DA4A 1I9GA 1X1AA 2C7QA 4RWZA 1R8XA 2FYTA 3KQPA 4M37A 5U4XA 5KQSA 1L3IA 3C3YA 4AZWA 2IIPA 1YF3A 1AQIA 3HCBA 1KHHA 3KPVA 1FP1D 2IBSA 2OYRA 3KQQA 2IPXA 2BR5A 4DM3A 5GWXA 2EFJA 2PX4A 4E30A 2BZGA 5LSAA 3EVBA 3I58A 4FSXA 4HRAA 3KR1A 3UA4A 2XYVA 1G8SA 2AOTA 4WXHA 4F86A 3HCFA 2AOVA 4PYKA 5E1BA 4DMGA 1Y8CA 3TQSA 1JSXA 2FRXA 1G8AA 1KP9A 5CCXA 3G88A 2OY0A 2PSSA 2ZVJA 4MQ4A 2PWYA 4KDRA 4WVLA 1ZQ9A 5E2AA 3GRZA 5LQUA 1XDSA 2B78A 4B17A 5CVDA 3G2MA 4EQZA 2UYHA 4PYOA 5EPEA 1JG2A 3GGDA 5HILA 3DMHA 3UFBA 3A7DA 2G1PA 3LHDA 2C7OA 1O9HA 2PJDA 3DUWA 3P2IA 4HTFA 2XBMA 3MCTA 4QQKA 3I53A 4CKCA 3EEYA 3DXYA 3LCVB 1OR8A 1X1DA 2XYQA 4PCAA 5E1OA 5EHIA 5C1IA 3VYWA 3KQWA 2C7PA 2Z6QA 5EZSA 5GIPE 5P8WA 2BM9A 3OPNA 3EVZA 3C3PA 1TPYA 3OU6A 3UJAA 1D2GA 3SGLA 3CJQA 3LDUA 1QAOA 2QM3A 2AVNA 3TKAA 5K05A 4GC5A 5BW5A 3FPGA 3UA3A 3UJ9A 3T7RA 2AZTA 1JQEA 3DH0A 5DWQA 4FZVA 4RTJA 3JWGA 4PWYA 2IH2A 3H2BA 4QTUB 3HA7A 2F8LA 2ZBPA 4P7KA 4RX1A 1NW7A 3BT7A 2DULA 4C05A 3G8AA 5EGSA 5HEKA 2FHPA 3R0QA 3LBFA 5F2OA 4BLUA 2ZIFA 2IH5A 1VL5A 5K03A 1UWVA 4OBWA 2YUIA 4IWNA 4CKBA 1HNNA 3PFHA 4XUCA 4PYJA 1KPIA 4R8SA 1IY9A 1NBHA 2PX2A 2VDWA 3ELWA 3I9FA 3LDGA 2ZBRA 4QPPA 2YR0A 3FPHA 3G7UA 3KQVA 3P71T 3FTCA 5HIKA 3PVCA 2WK1A 3K0BA 2CWWA 5LQCA 3M6VA 1JQ3A 1N2XA 3HP7A 1XDUA 5EKXA 1Q0SA 2LD4A 5DSXA 5K0JA 2G8NA 3MTIA 5DXJA 5FHQA 3TM5A 2NYUA 4IV8A 4U7TB 5K8VA 5DX8A 2NP7A 3FRIA 3ER8A 3EVAA 4RTRA 3ERCA 3NVKI 2VP3A 5FADA 4ER6A 5BW4A 2DPMA 3FUWA 1DL5A 2B9EA 3PS9A 3KQSA 4GF5A 1RI5A 5EMLA 5LQRA 2ORED 3KU1A 3MQ2A 3O31A 2IGTA 1RI4A 1RI1A 1T43A 3MTEA 5CVEA 2I9KA 4P7FA 3FUVA 2ZSUA 3O4FA 3C6MA 1AQJA 3HM2A 1P1CA 2I6GA 3CC8A 4M7RA 1XTPA 3E8SA 4QDJA 3UWPA 4EVIA 1JSZA 5GP1A 2QRVB 3G89A 4IKPA 1P91A 4FS8A 3M6XA 2P7HA 5EKUA 3X0DA 1L3BA 1Z3CA 3UJ8A 3VC2A 3PLAE 1JTEA 1R18A 3A26A 5DRTA 3SR4A 5HOQA 2P7IA 2HR1A 1NT2A 3AY0A 2Y1XA 5FCDA 2UZ4A 3B3FA 5DPMA 3C6KA 2ZZKA 2AOWA 4A6EA 5CD1A 3EVCA 2ONYA 2JH9A 4GUAA 3BZBA 3GJYA 2O05A 2AN5A 3IYLW 2N47A 3KKZA 3FZGA 5HIMA 2IDKA 1INLA 4QQNA 5D1NA 4E32A 4EMSA 4CWAA 2P35A 3P2EA 4PCLA 4YMGA 3FPEA 5BP7A 2EJUA 5CCBA 3ER9A 4KIFA 1JG3A 2PXAA 3EVDA 2HV9A 5GM1A 4ER3A 4KIGA 4P58A 4E33A 4PYLA 3PB3A 3MAGA 2JHCA 4XCXA 3RIEA 3B7PA 4LWOA 5GOZA 4R6WA 2PLWA 3ME5A 1SKMA 4X61A 3EVEA 2IDJA 4GOOD 5CVJA 3FPJA 4E2ZA 4YV0A 2ZIEA 4YV2A 1NV8A 3E23A 3TLJA 7MHTA 1WXWA 1RI3A 4M36A 5DXAA 3DR5A 3NWBA 2BM8A 2PV0A 4E2WA 3MERA 2C7RA 4RTLA 4PIPA 4ATNA 5K0CA 3P9NA 3RODA 2ZW9A 1L3CA 4ZTBA 4FSDA 4Z2YA 3UJ6A 3MCZA 4PNEA 5G02A 5DM2A 3A7EA 5HZMA 3BKXA 2P41A 3LDFA 4HGZA 4E2XA 4RVHA 4BY9E 3KR0A 3KHKA 3QV2A 3R9XB 4AZSA 2PKWA 5EIFA 3OE5A 3SSNA 5H02A 4YV1A 4C4AA 8MHTA 2YVLA 1RJFA 4YUVA 1NBIA 2PX5A 4HG2A 3OZRA 2OBFA 2OPBA 5T67A 1XDZA 2IFTA 1WG8A 2VDUE 5M5BA 4E70A 1R6AA 4YUWA 4RVGA 4JXJA 2P40A 3ELDA 3THRA 3TOSA 5GM2A 1BC5A 2CKDA 2EG5A 5K01A 1YFJA 5E9QA 1NW6A 3DMGA 3OU2A 4RTQA 1WXXA 2ZBQA 1JG1A 1MJFA 2UYOA 3LKDA 5FUBA 3Q87B 1XCJA 5FA8A 2AOUB 3TKYA 3AXSA 2IH4A 3HVJA 3SSOA 3UJ7A 1P1BA 1D2CA 1B42A 5D1HA 3PX3A 1DCTA 4KWCA 3G8BA 2G70A 5DLYA 3BGIA 2GB4A 3VC1A 3G5TA 1IM8A 2OB1A 5EOVA 3SMQA 1FBNA 1FP2A 3BWBA 3TR6A 2FCAA 2NP6A 1TW3A 2ZIGA 3CGGA 4RTNA 2B3TA 5EEGA 3IEIA 4QPNA 4QDKA 5EMMA 4AX8A 2G71A 2O57A 3GXOA 2Z6AA 3LECA 3B3GA 4LECA 3JWJA 4QVKA 4RTMA 5F2KA 4OX9Y 4FT2A 3G2OA 3KPJA 3CKKA 1KXZA 2GA9A 3CBGA 3GDHA 3HCAA 2XVAA 4V0RA 4DF3A 1YZHA 5DM0A 4PGHA 4OQEA 5CVVA 4OA5A 5E2BA 3FYDA 3E7PA 5ICCA 4ISCA 3I5UA 3FTDA 3P97A 3PFGA 3EMBA 2GPYA 3EEOA 3DMFA 5E1MA 5E9WA 3O7WA 4K6MA 3G2PA 1IXKA 3HA3A 3OZSA 3NVMB 1PRYA 3P9CA 5JUWA 1JR4A 5LQJA 1YUBA 3Q7EA 2VZ9A 2PXCA 4YUZA 1YZ3A 2E5WA 4ER7A 4DKJA 2B2CA 1NE2A 2GAFA 3KQYA 5DT2A 3V8VA 1F38A 2BR3A 3B89A 4HH4A 3FTEA 3EPPA 2ZULA 4LG1A 4GC9A 4KW7A 5FHRA 2ZCJA 3HCCA 2O07A 2NXEA 2P3OA 3LSTA 4XUDA 2ZLBA 3G2QA 4FT4A 1Q0TA 2JG3A 2I7CA 1D2HA 3F4KA 1NKVA 3FYCA 3HVIA 3OFJA 3TM4A 9MHTA 2KW5A 3D2LA 1M6EX 1V39A 1X1BA 1KYZA 3AWIA 1VP9A 1KIAA 2HNKA 5FQOA 2BR4A 5K0NA 4BP1A 3A27A 3KPWA 1RJEA 3MB5A 5FWDA 4MIKA 1ZG3A 2ZZNA 5C0OE 3M6UA 1AF7A 2ERCA 1NW5A 4V0QA 4BP3A 3HEMA 5DSTA 5HFJA 1JG4A 4POOA 2OKCA 4BLVA 5GINE 3FUUA 4RVFA 2OXTA 3KR9A 4R8RA 4AZVA 1YB2A 3AJDA 5DX0A 1G38A 4YMHA 2P3QA 3JWIA 3NJRA 1UFKA 4EKIA 2PT9A 4O29A 4U7PB 1JQDA 5FWAA 3T7SA 3GRRA 4ER0A 5KS2A 5EMJA 2NXCA 3IHTA 3OCJA 3THSA 3U81A 1VBFA 2AOXA 3KPUA 5CVUA 2FPOA 1RJGA 3ID6C 5DX1A 2QRVA 3SVZA 4DCGA 4RTSA 2AOTB 3P2KA 4PGGA 2JH8A 4XUEA 4A6DA 1SQFA 1EAMA 2R6ZA 5EC8A 2YXEA 4UOEA 2OB2A 3OFKA 1L9KA 3FPFA 4MWZA 3GO4A 4OQDA 5ERGB 3OU7A 3DXZA 5E8JA 2ZWAA 5LQNA 2WA2A 5FTWA 3BKWA 1EJ6A 3SXJA 1QANA 4YUYA 5CIYA 5KVAA 5HIIA 5DM4A 3HVHA 2YX1A 4BLWA 5ICEA 1YFLA 2A14A 3GRUA 3DXXA 3E05A 1VP3A 1VQ1A 3DULA 3K6RA 1ORHA 4GOMD 2AR0A 1JTFA 2PXXA 5FA5A 4C07A 3CVOA 5HIJA 1FJXA 2IP2A 4KVZA 3TMAA 2EX4A 2CL5A 2PY6A 4PYQA 4P7JA 3EGIA 4KRGA 1R00A 3GIWA 2HWKA 1KPHA 1XJ5A 3QOXA 5DTQA 4HGYA 3VSEA 2G72A 5EEHA 4RYLA 2NXNA 1SQGA 4C04A 1N7JA 4F84A 4GOND 2CMHA 5K0LA 3T0IA 3BWCA 4F85A 3LKZA 1ZKDA 2QYOA 1O9GA 3BGDA 1U2ZA 1XVAA 1M0EA 2Q41A 3NMUF 4IV0A 2ZTHA 3KQOA 1L1EA 2YQZA 3QOWA 3CJTA 3LL7A 1FPQA 3PX2A 2CMGA 2BH2A 3M6WA 2PT6A 2EJTA 4PIMA 3UJBA 4QVGA 1G60A 4GEKA 5FQNA 2WA1A 5FULA 2YXDA 4FGZA 3FTFA 2AOUA 2P8JA 1X1CA 4DQ0A 1EIZA 3KQTA 3PT9A 5DTMA 4CKEA 3NDJA 2UYCA 3DOUA 3PTAA 1QYRA 4GOLD 3TFWA 2ADMA 2PWPA 3M33A 2AS0A 2PGXA 3EGEA 2GS9A 5LQAA 1RI2A 2AN3A 3P9IA 3EGVA 2R3SA 3DP7A 3HCEA 1R8YA 3GRYA 2ZFUA 1ORIA 3REOA 5DTRA 1M6YA 2FK8A 3HNRA 3GRVA 4RTKA 2H00A 1AV6A 3L8DA 2QE6A 1XCLA 2ZWVA 3DLIA 2H11A 2OZVA 1SUIA 5EIWA 3BWYA 3A25A 3ELYA 4L7VA 4X41A 1EG2A 1QAQA 2AVDA 4RV9A 3LGAA 5KYGA 3LX6A 3UJCA 3LPMA 1G6Q1 2PX8A 3HA5A 1ZGAA 1P39A 3M70A 1QZZA 2XYRA 3M4XA 3LCUA 3BUSA 3P9KA 5ICFA 5T64A 1HMYA 5E8RA 4E31A 4PINA 1VE3A 4ER5A 5JR3A 3LBYA 5K0GA 5K0BA 4GQBA 4QTTB 2I62A 3UBTA 2O0LA 1RJDA 5K0FA 4RTOA 2ESRA 3BGVA 3LCCA 4NECA 1SVUA 4PYIA 3NTVA 1F3LA 2UYQA 4AUKA 1SUSA 5K0EA 1UIRA 3A4TA 10MHA 3R3HA 3R6TA 4PONA 3EVFA 4P7GA 4OA8A 3EVGA 4DZRA 3DTNA 3BXOA 1BOOA 4OBXA 3UZUA 3JWHA 1G55A 1MHTA 2GLUA 2P1DA 4EK9A 1TW2A 4KDCA 5K09A 3NDIA 4FR0A 4CXMA 5EG5A 3ORHA 3GNLA 4M38A 5E1DA 5KQRA 4RTPA 1PJZA 4YUXA 1R74A 3V97A 2NXJA 2VDVE 3WSTA 5BXYA 4R6XA 3IV6A 1I1NA 1X19A 2PBFA 2V7EA 3B3JA 1WS6A 3T7TA 5LQKA 4X63A 4C03A 4MHTA 1BKYA 1SG9A 2HMYB 1EJ0A 3SM3A 5GIOE 2YXLA 3OE4A 4GBED 3FUTA 3TPZA 2IBTA 3P8ZA 3SSMA 2YTZA 3CJRA 5LR6A 4H0NA 2JJQA 4FP9A 4X60A 4Y2HA 2ZZMA 2AN4A 2JHPA 2Y1WA 3GWZA 3HCDA 1EQAA 2Z6UA 5IKMA 2K4MA 2OO3A 4E2YA 3NWEA 3ANXA 5EQJB 3RW9A 1VIDA 5EVJA 3CCFA 3UJDA 1QAMA 3BWMA 3FRHA 2P3LA 4DCMA 3AXTA 2FK7A 2V74B 4MTLA 4AZTA 5MHTA 4HTFB 4G56A 2XVMA 4HC4A 4CTJA 4PYMA 1XXLA 3B5IA 3MHTA 3KPYA 1N7IA 3TRKA 3R24A 5DM1A 1KR5A 4C06A 3HVKA 2PVCA 2GH1A 5EZQA 3GU3A 1H1DA 4RVDA 1NW3A 5B1SA 1VPTA 2ONZA
chains in the Genus database with same CATH superfamily
3HN2A 4CM5A 4TL7A 2XDQA 1DFIA 4X8HA 4DNPA 1GEEA 3ULKA 1SH7A 6NULA 5M04A 3DVAB 5TQVA 2LTAA 4LDRA 3HZZA 4C01A 3O2QB 1O08A 3V8EA 4PX3A 1UPFA 3WLEA 4C6SA 3I32A 1ZGJA 2QNRA 3FIJA 3U0VA 3DEZA 4MHOA 4XCQA 2GSWA 1E9BA 1N9GA 1T25A 2HO5A 3O3MB 3C0KA 4G67A 4I9NA 4KUEA 4TVBA 3KL4A 2DKOA 1VLVA 4BQSA 2W2LA 5DGCA 1SIBE 3EMVA 3OLZA 3RM3A 4GMFA 2O06A 3I8SA 1IRIA 3HBLA 4X20B 1YOVB 5CNJA 3ZW7A 4Z4FA 1JR6A 3FUXA 3Q1KA 4KN5A 3PI7A 1ZIOA 3S1AA 4PG8A 2V7QD 4LYDA 1X2BA 2D5IA 2XJ9A 1ES9A 1PR3A 3CRW1 1K5PA 1YJQA 3CT6A 4GE3A 1YF3A 1GNTA 1P7CA 4LJ5A 2P6PA 4MUAA 2J0QA 4IQ0A 3QLUC 4DDKA 3N86A 4RVCA 4A1FA 2FR8A 4EBBA 1W581 2BFMA 3SF0A 2HLDA 2PX4A 2XAUA 1D9XA 1EWTA 3V1MA 1VECA 1X7DA 2YFKA 3GVPA 1W0KA 2QE7A 2AEFA 4TXLA 4ZO6A 2W6JA 1QHXA 3AL2A 3BPSA 1G8SA 1RP7A 3UCXA 3F6EX 3H9CA 2OCYC 1O57A 2MHCA 3WC4A 1XRSB 3FCXA 4TZKA 3Q7QA 2V4ZA 1G3IA 1PLKA 4RD6A 1K06A 1P73A 1WPGA 4PFKA 2JZCA 3VVLA 5JT1A 1Z5GA 4XVHA 1OWMA 3KSZO 3LHDA 3JATB 1FMLA 3G13A 1V95A 1YHZA 1I30A 3ZWCA 5CB4B 4R1OA 1JEJA 2GN4A 2XYQA 4RDIA 1FY2A 3QIVA 4DT1B 1MC1A 2D4AA 3HRHA 1E69A 3GJSA 2WUFA 4Y9RA 5EZSA 4RF2A 1E89A 1G4UR 2GPJA 4WNCA 3ZBTA 1XTZA 1IQUA 5HM8A 3AI2A 4G9EA 2IGBA 4DSOA 2QM3A 4BAZA 3JYLA 4DDMA 3WMRA 3ZD7A 4YONB 1HYBA 4N6NA 3T7RA 1URPA 4QHYA 4R9SA 4GW3A 4XB1A 1U28C 4D4LA 5J2TF 4JQSA 4B7CA 1LGYA 3JQ8B 1WOYA 2GX6A 4MQMA 1A95A 3G5AA 1N0IA 3H2BA 3MUOA 4LI0A 4X95A 3DOOA 4YYEA 2UVDA 2ZJAA 3BZWA 5DNCA 3CBQA 5IBCA 4M98A 4BLUA 4JVSB 5ER9A 1UJ4A 1A76A 4PYJA 2OQVA 1P2FA 1Z0IA 3FNBA 3IVCA 8ADHA 1AVTA 2BHRA 3GLFE 4NCAA 4R8SA 1NBHA 4ETWA 1AY0A 4KXVA 4C76A 2ZBRA 1IEWA 1JJIA 1K8XB 4CMEC 1RXUA 4ND7A 4QRHA 1SCQA 4B5LA 2ZJ1A 4MZDA 3K0FA 4QU5A 2CWWA 1O89A 1WXFA 5LLSA 1GGVA 1QGUB 2IIVA 2ZTVA 1XB2A 1XDUA 3GFOA 2CDRA 3OAAA 6CHYA 1U3DA 4B4DA 3O82A 1GQOA 1MVNA 3O6VA 4RTRA 1OWOA 3ZFPA 3P9ZA 4TWIA 2JLAA 3FMOB 3JQ7A 4L2IA 4LY6A 4XWTA 2X4GA 5KHOC 1J8QA 5DNEA 2BEUA 2OV6A 2EGGA 4P93A 4B74A 4ASUA 3GJZA 5BRAA 3DKIA 3N7AA 1N2CE 4AMVA 1JFSA 4F4HA 5KNDH 1PS9A 3AILA 1IPEA 1L7OA 3FW1A 3HL4A 1C81A 3D3WB 4F9FA 1MGOA 1XTPA 1I7DA 1T24A 2WWFA 2PL1A 5KAMA 3UXHA 1JSZA 5GP1A 3LS2A 2C29D 1X7GA 1KFKB 2EG9A 1LI5A 1I2ZA 2CDNA 2NQ8A 2P7HA 3JATA 3G2JA 3KAJA 5FYDA 3VDQA 2P6RA 1Z0DA 3KWMA 5EIHA 5CB4A 4EW6A 1DIAA 3URKA 3CNNA 5BWOA 5BPHA 4GRIA 1QG6A 1TPZA 4K2HA 2OWDA 3RS4A 1IDOA 3CXRA 1AUQA 3CY6A 4CF6A 5JBIA 2Z5GA 4CCYB 1NQOA 3WLKX 5AI9A 3REQA 1XRLA 5K3AA 1E1CA 4GM1A 1GNPA 3K1ZA 2HAEA 1B6GA 1WP9A 1X8XA 4F4IA 5FL7A 4D45A 2D62A 4FE7A 4AQDA 4WADA 4NX2A 2QORA 4PO8A 2G08A 4FZ3A 4GBMA 1PU2A 3STUA 1BEUB 2H65A 3OJLA 1IHOA 5A02A 2FDCA 1MJNA 1KNXA 1OAAA 1RBMA 2OV2A 3LK6A 4BXOB 3C7CB 2C5HA 2JBAB 4ZVNA 3SYRA 1UPBA 3ZCRA 4E2ZA 1SCNE 2GAAA 4B4WA 1M7GA 3O74A 2JK1A 2JFUA 4QYIA 4ALLA 3T5AA 1PEDA 1TCUA 2L0XA 2OGZA 4MUJA 4E2WA 1EM8A 1Q57A 3IA2A 3FBWA 4PNEA 4W5RA 1Z37A 2PFKA 2C20A 1W1WA 3OIVA 1HBJA 4B09A 1CZUA 3WYEA 1WA5A 5D3ZA 4EW3A 5A4MS 1WZIA 1R7RA 3ZD9A 3B7GA 1M6VB 4G1MB 3EIFA 2OBFA 5B7PA 3R3UA 1YC5A 5M5BA 5EP1A 1NWCA 4I55B 3TL2A 1GCIA 1O95A 3TGWA 3UANA 2VZEA 1T6NA 3DSRA 1O0CA 4H77A 3NYIA 2ZCUA 3SSAA 1U9IC 2R84A 1NVDA 5KX5F 3HR8A 2VHUA 3EXG1 3PQFA 1ZK1A 1ORWA 5CXXA 3RIYA 3VJLA 2GZ1A 3ZWBA 1EEXB 4OJNA 5GONF 2BTEA 3ZHVA 2G70A 4EGJA 5HZHA 2HMSA 4IKOA 2WFAA 2B36A 4XWWA 5LKAA 2QAIA 2NP6A 3CGGA 2GQ0A 3HZHA 1X8JA 1QYCA 2OD2A 1TT5A 1KJYA 1NFFA 3BIXA 3M83A 5B53A 3U1TA 3ACDA 1VGRA 4U7FA 3SM9A 2XXJA 3R41A 4ZQCB 5FR1A 4LECA 5E7JA 2I3BA 3GCWA 1GG9A 4OFBA 1MAAA 4Y7CA 1BIFA 3H11B 3OZDA 4C0QC 4AVYA 1L4NA 1LF0A 3DL4A 1JMKC 3IILA 4IEFB 4RHUA 3PVSA 2RC6A 1YIDA 4LRWA 4MRMA 3FTPA 4MV6A 3Q8LA 5F12A 2XI4A 4MO2A 2ZYAA 4PGHA 1R0YA 5E2BA 1G8GA 1QOQB 2P5TB 2AMYA 1L0BA 3DEHA 1L5KA 3ZV3A 5ICCA 1C1DA 3RD5A 2YIVX 4WZBE 2XTMA 5FO1A 4R5HA 3UNXA 3QNUA 4LFAB 1PBNA 2OMEA 3DWIA 3TECE 4BJ3A 2FWIA 4DOMA 4M21A 3TIIA 2C8JA 4X20A 1U8YA 5KTOA 1QIKA 1MXHA 5DHPA 4BFZA 1RQ7A 1JR4A 2R8OA 2WU4A 3Q7EA 3QW2A 1CNFA 1DG9A 1COZA 4ER7A 1UKAA 1LNQA 2E4WA 3U4QB 2J6IA 2PUHA 1L4MA 1MZVA 4HMOA 4MQFA 1F6DA 2W90A 3FVRA 3KDSE 3BTVA 4R1TA 3VVMA 1QZXA 3G8DA 3HDYA 3C15C 5ITZB 4MGKR 4XJXA 3QI7A 1LJUA 3IVAA 3JTEA 4GKVA 1SQ6A 1ODIA 2X0KA 2F8MA 2P68A 4LCBA 2QZZA 1X1BA 1XA0A 4D8VA 3I1JA 1ZI8A 5EFOA 1EFTA 1SMKA 2D1SA 4RZSA 4XD7A 3MB5A 4BZPA 1Z5PA 1SPXA 1JAYA 2TECE 1HG0A 1L4YA 3FWZA 3GGOA 2NVBA 4BFWA 1NW5A 1Y3HA 2OD7A 4BNIA 1BVHA 3B6ZA 1W6UA 4KQ2A 1SUCA 2P6OA 2O2EA 3WOVA 4POOA 1EYZA 4CQMD 2OAEA 1M34E 2VNHA 3DD1A 4WAUA 3LT0A 3UC9A 2PZLA 4YCJA 5H9WA 3AEKA 4MW9A 1GUAA 1ISSA 1MABA 3SYKA 4OFXA 1WMSA 3QXHA 3S55A 1SZPA 3D6FA 4DGQA 3BXHA 4P4TA 5ELMA 1VL8A 5CDUA 2V7VA 2QD1A 3JALA 3UOAB 5JXWA 1HZJA 1MUUA 2QX9A 2YHAA 3D7RA 3D2CA 4NZZA 3SC6A 1NMYA 2VK2A 4G09A 1EB9A 3ZGNA 2X7JA 1GAQA 3CM0A 1U7OA 1GG2A 1RJGA 4GI3A 2OC4A 2XAAA 3BGSA 1BXGB 1DO8A 5DLEA 5DX1A 4RTSA 2ACWA 4D4KA 1ZM7A 1AQYA 3A32A 4L9SA 2BRUA 1A7AA 2C4TA 3I6BA 4GVLA 1BXKA 4HB3A 5H68A 5TY0A 2C4MA 4MWZA 1LBQA 2PEZA 5HKLA 4TV9F 3IPLA 4LRTB 2VYFA 4RORA 1GXSA 2GWRA 5LLTA 1TTTA 2NUAB 3MA0A 3VR5A 1S8OA 3H4TA 2ONKA 5FTWA 1N0WA 4G65A 3R75A 3WIOA 1W34A 2YFQA 5KIAA 3S1LA 4B3HA 2VHTA 4WK0B 5KVAA 1KS9A 1E1QD 2QUIA 4P2GA 3ASZA 3OJXA 4WBSA 2YJ3A 3PFBA 521PA 5IFKA 2V1UA 1YR6A 3DXXA 4L5BA 1QFJA 1Y1LA 3GLKA 5DSZA 3PD1A 4FMBB 4I1YA 1H05A 1PQYA 3AG5A 2ZUDA 4FUQA 3VUEA 4F60A 5L4LA 4OHBA 3ZEIA 1JLKA 1VXRA 3T38A 3I52A 3VKHA 4OO3A 5JECA 3K8OE 1SK8A 1OAOC 2RHDA 5CT4A 4PC7A 2Q5JA 4CG3A 4NQRA 3VA7A 3D81A 1LLCA 1OAKA 2QRKA 4YBRA 1YI8A 1Q1NA 1UT8A 4J16A 4Y2UA 1A69A 2OLKA 4RQAA 1O8BA 1KIMA 3ECCA 4LJYA 3GUUA 3EZGA 1SPBS 1W8DA 1G42A 4M0LA 1J9GA 5C18A 2CVFA 4LTMA 4MGIR 3RNOA 1NVWQ 1EFCA 1DPFA 1O9GA 2HA0A 2AFHB 2P2YA 4BBPA 7AT1A 1C1YA 4NDZA 4DILA 2BMEA 1M0EA 1EB8A 1Z6XA 3ZTWA 3I62A 5IXSA 1J5EB 3OJCA 2QJWA 4Q05A 1O5IA 5JSUA 1XALA 2YL2A 3LL7A 4PPFA 1PV2A 3C5VA 2YWGA 3I28A 5HX7A 3FVQA 1G291 3OOWA 2O2GA 4D3FA 3Q1LA 1O1YA 2X7HA 1NMQA 3NM4A 2CCKA 1HDZA 4LMRA 3NR2A 1N2EA 4Q4AA 1ECJA 1Y3DE 4LDZA 1UC9A 2WP8J 1C4OA 4QBGB 3CEJA 5JASA 5ALRA 3F5SA 1JIUA 5K4GA 3WLFA 3H0CA 1YUMA 3A04A 1GLVA 2AN9A 1ZD1A 2IP4A 4GDMA 4COKA 3QEAZ 5K3OA 1WU7A 1M6NA 1ZESA 3DDWA 1D6NA 5AVQA 4LFBB 3PNSA 2XKKA 1US8B 1GEGA 1MRSA 3NWJA 1QGDA 4M1QA 3SHWA 2JLZA 2H1SA 3IUSA 2DP4E 3DOFA 3OQOA 4MUEA 1P6UA 1UOEA 3FCEA 5KTPA 5DCYA 3VKWA 3WVNA 2IHZA 3ZHSA 4OHXA 4DJ5X 4KQJA 3TLBA 1DOAA 1GPLA 3GARA 4HRXA 4JVLA 3O93A 4FHFA 4G4JA 4F4CA 5U9CA 3RNLA 3MMZA 3UICA 2YINC 8ATCA 4L7VA 4TRRA 3D7KA 5JWOA 2JZNA 2HM7A 4YHHB 3OECA 1I1OA 3ZJVA 1EZZA 3O38A 2IY9A 2RHBA 1PG2A 2FN7A 1TA9A 2Q5FA 1WDWB 2VBFA 3Q0TA 4REQB 3IAS1 2F48A 4UFNA 3NX4A 1C9MA 3HMKA 4EYSA 5ICFA 4D9JA 2VCEA 5JNRA 2APJA 2FMIA 3DMPA 1M6VA 1RYZA 5E8RA 3VU1A 5LOVB 3EIQA 2VPQA 2YDXA 1X2EA 4W5NA 4KDEA 3LXUX 4C0AC 4M4SA 5HJEA 3EODA 4X65B 3B3AA 3LCCA 3WK6A 2Z4SA 3ZQKA 3PDUA 2QR3A 4BZXA 3QUQA 2A92A 3W8DA 1QGOA 3OCUA 1UIRA 2P9GA 5A71A 1RR6A 1V7PC 2WHPA 3SYLA 1VYVA 1QH8B 2OAQ1 1T8SA 1E64A 3AHFA 2DUJA 3OZUA 2OUKA 4BLRA 4BO2A 1NN0A 4KDCA 4EB6A 1MV5A 3IAEA 2RJ3A 1DAKA 4W9NA 1LLFA 3UAYA 5BNTA 5CAEA 2POCA 1NKTA 3AR4A 1W5FA 2C3PA 3QVMA 1VKRA 2D5BA 2ZXFA 2ZBGA 3PUJA 2OHJA 4CVNA 3QHQA 2NXJA 1NQUA 2G76A 3DS8A 3I04A 3I6ZA 3LXRA 5DYIA 2P9JA 3GLSA 2IPLA 1JVSA 3KXPA 2XCSB 3FHTA 1SG9A 2TSYB 1WAMA 2JLSA 3AF5A 4P2BA 3SM3A 1O87A 4MDYA 1PJSA 4S2UA 4LOAA 3R7SA 4TLCA 2O2CA 5L6MB 4JJIA 2Y71A 3AOGA 2PGJA 2QQGA 3N2ZB 3EA0A 1FQOA 3UK2A 5FYQA 5JS2A 4KQKA 2YDYA 2G1UA 3IOMA 4F72A 1OA1A 1QUFA 4G86A 1JT9A 4YDSA 1H65A 3CNHA 4II7A 3U7QA 2O8VA 3AKEA 3NWEA 1G5HA 3ZX5A 3A3PA 1MJGA 4AJOA 2C04A 3A1EA 2AB0A 2QDXA 4URHA 3OQ1A 4LYAA 4ODIA 3ZX4A 1EWKA 3D9QX 3VDXA 1PN3A 3KV3O 3K35A 2QOEA 2H1OA 1XA3A 5MHTA 1YT5A 4RHTA 2WAOA 3KYCB 4LV8B 1Z2AA 1NOIA 1PYGA 1BQ4A 1XXLA 2RC5A 4UEWA 3CWZA 4K6FA 4UDOA 3E58A 3R24A 1DX9A 1TEHA 3IXLA 1LS1A 4NOMA 3B2QA 1JAHA 4DTCA 2GHRA 1NW3A 1MIHA 1VPTA 2Q2OA 2FSFA 3E8XA 3OY2A 3SX0A 1DPGA 1XEAA 3ON5A 1J23A 1DZIA 3N28A 5K3EA 1GPDG 1PTKA 1VJDA 3HCRA 3CR7A 5DOZA 4E5PA 2BMDA 1MAWA 4ZVOA 4ZMSA 4TXNA 1DFHA 1FLNA 1G1MA 1GVHA 1KO5A 4HZIA 5ALSA 4DA0A 1FTNA 2CBGA 2OHXA 4UATA 4UUBA 3RVRA 2M1XA 3ILYA 3L0ZA 5EY5B 2J5BA 4EP1A 4NU8X 3FYUB 1WZNA 3VNSA 3KZMA 1R8SA 4A91A 1E2BA 2H1FA 3CXUA 3DV2A 1KZHA 4DIFA 4ZHQF 3U3DA 3DE2X 5IULC 2NNWB 1B74A 1SHKA 3IELA 1CYEA 2WPDA 3MSXA 5JMPA 2FZVA 3K8YA 4OJYA 4HZUA 3BFPA 3M8KA 4ZOEA 5KQSA 1QKKA 2C96A 1L3IA 1TZ2A 4KPYA 1OI4A 5AKXA 1AMOA 3HY3A 4X6LA 2IIPA 4N0EA 3LWZA 2ZJ3A 4PAGA 1OC4A 3NHMA 5LD2B 1EX1A 3TJMA 2EF0A 1TOAA 4F98A 3I45A 1YE8A 2E4UA 1XXHA 2DFDA 3H9QA 4P6VF 1NP3A 1Q17A 3WRWA 3GAFA 3TVTA 4DYVA 4B71A 2A5DA 4MVJE 4DY6A 4NJMA 3TINA 1RC0A 3WLQA 2YFHA 3IUBA 2XYVA 4EPRA 1YZNA 3TNFA 3HCFA 1YMUA 1ZD3A 3OJ0A 4O2LA 2FWJA 4G4SP 3SZRA 2R2AA 1MQSA 1LPOA 1WUYA 5J9FA 1OF1A 4F12A 5BSGA 3H7IA 1P4SA 4L22A 2HQRA 4B6RA 5E6UB 4ZN6A 2DB3A 2HRZA 3IAHA 4V24A 3U6BA 2DU8A 4YXWA 2CUKA 2CDCA 5IM4A 4KLZA 1VBMA 3Q3VA 2AH5A 2C5LA 5IVIA 1OX4B 4E0BA 5IYZB 1EVJA 1BU8A 1U0JA 4PLZA 2C7OA 4RF3A 2NAFA 5L7YA 2ZJYA 4IF6A 4GP7A 2KE5A 3EEYA 4N9QA 5E1OA 1A4UA 3GGSA 1V8OA 2B8EA 2AG0A 4GS5A 5C32A 1D9ZA 2LXNA 2BZ1A 1XRPA 2C58A 2IOYA 1Z0SA 2SKEA 4JNKA 4S1TA 4INAA 2X0RA 3EVZA 3TSAA 1QRUA 5IP5A 1OB2A 3CZ9A 2JGAA 3T9AA 1DKUA 1EWYA 1WTAA 3HV0A 4UVHA 3WDKA 2GZSA 5HJ2A 1EFPB 4E11A 3JPYA 4E88A 2J3DA 2ZI4A 3O5AA 1OLXB 1DC6A 5FV4A 3ABQB 5EJGA 4OY3A 5T7BA 3IMKA 4QTUB 1JA9A 1SU4A 1SOUA 4XE5A 4TS1A 4XOUA 4EQ6B 4V02A 5LP6F 4H59A 1B16A 1Q7EA 3D4OA 3G8AA 2UYGA 4NS1A 4V0LA 3CVUA 2AC7A 2YCBA 5EGSA 1BMFA 3R0QA 4X8MA 2ZIFA 1VG0B 2NQTA 5K03A 1RLIA 2YUIA 3LPNA 4EHDA 5BY2A 1XDBA 2AFHA 2GETA 3WGMA 5JAHA 1FJGB 3L18A 1I94B 2FFRA 4M7OA 3L0BA 3SHOA 2WUWE 5THXA 5JAMA 1RBZA 2WK1A 1FDTA 5AKZA 5LDDC 1SUDA 2VP6A 3SNKA 2BE9A 1NHGA 1Q0SA 1XCMA 3H6HA 1IZYA 4U5XA 3SEAA 4D0GA 4PAWA 3V8QA 5DK4A 1OPRA 2IYAA 3Q5GA 4YRQA 2OLEA 1BO6A 1VI6A 1W94A 2CFRA 1E6MA 2R8YA 2O2DA 3DCYA 4J4BA 3K30A 1V11B 4BV2A 4YJGB 4ZJUA 1X1SA 3RSHA 1M5RA 3HV2A 4BMXA 3KU1A 4F2PA 1GKYA 5J2UA 3GLGA 4GGMX 4A5SA 1T6BY 3FJ1A 3BE5A 1RZVA 2JKZA 1TTPB 1X87A 3F7OA 3L1UA 3ENVA 3LUBA 1WL8A 1PYDA 3NBFA 4UCXA 3LFTA 1RYFA 4MYSA 3F96A 2EQ5A 2I67A 1MTZA 1Q1AA 1BRMA 3L4BC 2R7MA 1A8IA 2F62A 3UIEA 4JASB 1JL3A 1E18A 1J99A 1GGMA 1JDPA 1U11A 1DZ3A 2DJIA 5G40A 5JRJA 3R0VA 5CVTA 4LF6B 1YZVA 2OCAA 3L40A 2HJSA 1ZL2A 3LVFO 1M2WA 1KYVA 1GRRA 1K8QA 1KH2A 3HXLA 3RANA 4MQ5A 3UM9A 4MVJA 4AF7A 2KJQA 1L7XA 1UMDA 4HDCA 5GADl 1KS2A 1VPDA 2WPDD 1VE1A 2NIPA 3CSSA 5ALIA 1HDCA 4BVJA 5JEEA 4OHVA 5J1TB 2EKLA 1IQRA 1FS5A 1U0SY 2PUWA 3FPEA 5IC5A 4AU1A 2HY7A 3H3FA 3C3WA 3A37A 4MINA 4WK4B 3OETA 4ZOAA 4RK6A 1WXIA 2NN3C 3DE7X 4B6SA 1EKXA 3ISJA 1IJBA 3O47A 2BFCA 4NFHA 1EVKA 2B0JA 4MHSA 5EIBD 4J03A 4XCXA 5B1DA 3AQIA 3SQLA 4AIIA 1RADA 4QG3A 5E0KB 1R1DA 1CZKA 2VAXA 3Q9SA 4GL4A 3ZY2A 4E1BA 5LL6P 3DE4X 1RYMA 2FW0A 3DOEA 4ENTA 3LSYA 5HRAA 2R6DA 2QMYA 4MYTA 1RCFA 2R7AA 1DUIA 2YXPX 5CAEB 1QIDA 1QGED 1VKOA 3DE6X 4HFRA 4R1LA 1TD9A 3EF3A 2XWJI 4W82A 3HU2A 3QV2A 1M7BA 4LZNA 1D8TA 3FGOA 4L85A 3SSNA 8MHTA 1M9NA 2BP7B 3F4BA 4Z4IA 4LJLA 4DV0B 4HG2A 2VJOA 1I1QB 2Z0MA 5T67A 4QUJA 2I87A 1FMFA 4QOEA 4ARSA 5FTNA 3V9PA 2HSEA 4JIMA 2JD2A 2QMQA 2YRWA 2EG5A 3EBOA 3UH0A 1D3AA 3Q11A 1PR2A 1I5OA 1Z29A 2M32A 3B8EA 4DXAA 1F0YA 3GFPA 4PRYA 1RYBA 1D2AA 4KTTE 4CE6A 2UYOA 5LJLA 1YB1A 2XQKA 3EFEA 4C22A 4DANA 2CZQA 1Q6ZA 3QTLA 1BJTA 2R85A 3AKZA 3AFOA 3WNZA 3O1IC 3OC6A 5I8WA 1G98A 3WIUA 2EL7A 3F71A 4MPTA 4OQYA 4B2YA 2F64A 2DY0A 4QPNA 3RH0A 4G0ZA 3F6SA 1IXYA 2O57A 3C6QA 1NMXA 1XQ1A 2Y2UA 1U1CA 3H5RA 3IQFA 1FUUA 1HE5A 2AQKA 4OXQA 4B81A 1UC4B 1X94A 2R8RA 3DYIA 5B3LA 4V0RA 1QFYA 5KHAA 3NHAA 5BN5A 2CNKA 1PVOA 4J6FA 4BVEA 3FDZB 3GJQA 4EA7A 4LZZA 4FX2A 3E7PA 1FMJA 1I3CA 1O7JA 1CR0A 4M9UA 3OCYA 4NDAA 4O33A 1JXAA 3V34A 4MVJM 5TVGA 2OYCA 1NBOA 2C0QA 1OZHA 3N2EA 2MCFA 4ILEA 2OENG 3HPRA 1JYSA 4X54A 4XASA 5DM60 2AWOA 5LNK6 4MNTA 4KX5A 3O1HB 5DNVA 1UT6A 4QUHA 3UQYS 2E5WA 3WK7A 3UAVA 2B2CA 3PBKA 3DW1X 1QTQA 1TYCA 2BJVA 2HLPA 4K9RA 5AUOB 3L4SO 3WYAA 4DCTA 2JD1A 3FB1A 4YI3A 1SD5A 1VIVA 1QVRA 5JMWA 2FPIA 3AESB 5TJHA 4CM6A 3AI3A 5C7YA 2XB9A 5EJ6A 3OE7A 1R5NA 4RVSA 2NSYA 3O2SB 2JG3A 1RKUA 3WXMA 5JZSA 2PRSA 3F4KA 5LB2A 2Z5VA 3M4ZA 2VA8A 5F1KA 4XGNA 1U2SA 4B6GA 4IY1A 1KK2A 4FEYA 4JITA 4OB6A 3VYRB 1RAAA 2A67A 3EK2A 4W5JA 2QW8A 4EJSC 2XNHA 3THOA 1C3OB 2ZZNA 3FPSA 1FB5A 2ERCA 3GEBA 1Q11A 4TVSA 3TIVA 2Z3VA 3B12A 4KXFB 2QN9A 2QSZA 5DSTA 4H3VA 4Q3EA 3AIKA 3VUFA 3FUUA 2PX3A 2REOA 2CLEB 2HJVA 1ICEA 3FSRA 2NV0A 5EWMB 3N1UA 4LN1A 2PS0A 4YMHA 2JJ2A 2P3QA 3LZ6A 4J0KA 4BEWA 4OLHA 4WXPA 1UFKA 5AMXA 4KR6A 2FG7C 2NTYC 2HBRA 3CE6A 4DCOA 5BO5A 1BCRA 1ZVJA 3FPBA 1KHTA 1Z0KA 2VNAA 1ZI9A 2I3AA 2UUOA 3JQAB 1X92A 5C2JB 2V03A 2FPOA 4DSTA 4PLCA 4FHCA 2QRVA 2NSDA 1JDNA 3GJ8A 4WLNA 1H2HA 5CA1F 1CUHA 1SQFA 1CDDA 1FJHA 2NU8B 2HC9A 3D02A 4YJ2F 2Y0DA 1TA0A 1V71A 2Z4TA 4L4UA 4UEJA 1H6CA 1NX6A 3CX3A 5EXXA 1JJAA 1H0KA 3ZVRA 5KYWA 1U31A 1LVGA 1ZUNB 2AJBA 2CL6X 2W6MA 5LQNA 1T4DA 3NP9A 4K9PA 1T9GR 3GR6A 1PR5A 2M6RA 4QICA 1UC8A 2PD3A 4RIEA 4R84A 4X1YB 1ZH4A 4YP6A 3SYNA 4FDUA 1T10A 4G0VA 1FL9A 1T15A 1T34A 3B51X 3O4VA 1U0OC 4TTTS 5TQ0B 1QQBA 5ALKA 4XWYA 1VP3A 2CDAA 3GEEA 3I3SR 3K6RA 3OTOB 221PA 4G0OA 4GECA 4AMZA 3S7TA 3CNOA 1QF9A 1TVKA 1E58A 1HQDA 3ELBA 2VUTA 2VHXA 3W3AA 2IP2A 4CMGA 3ODPA 2B99A 3IIKA 1YS7A 3CZPA 4UE3S 4ZALA 5ED0A 1T36A 3BL8A 4LQLA 3JAWA 1E2UA 5FT9A 5IT5A 5FPQA 1JAIA 1KPHA 2CC2A 5CTAA 3REFA 3MT7A 1K7SN 2CT8A 5EE0A 1K1EA 4EPWA 1PNQA 2DR3A 4C04A 1XO1A 3CW9A 4K9LA 4FFOA 2JAXA 4R1UA 4GR5A 3G1UA 4FR5A 1PWZA 4D26A 4UHFA 4FWTA 3WGVA 3KU4A 4EAAA 4S12A 3MWLA 4EKNB 2YV1A 5K7SA 3II6X 2Z3WA 3J81k 1LI7A 4JK3A 1JKIA 4YHBA 3W6UA 5IXJA 1L1EA 2C2HA 4N40A 4PAQA 3WKBA 4TV9A 1KSHA 1B6RA 1J4AA 1YKFA 2HRRA 2CJYA 3COVA 2PGDA 4JBHA 1XJWA 4FGZA 2AOUA 4ALKA 2HFJA 2WSBA 1J22A 2ZEJA 3O91A 3L9WA 1E7QA 1F14A 3V32A 2GM5A 1AS0A 4TUYA 2NU8A 1IZZA 1YQ9A 3AU9A 4EB0A 1EIWA 3M33A 3BRCA 1LW6E 2AS0A 2PGXA 2IHBA 3EQ7A 3PUXA 1E4VA 1LDGA 1TT5B 2ZRGA 5LQAA 4D56A 1YFKA 1MA0A 3TW8B 1ZGHA 2BFFB 3WLLA 1V43A 1XWIA 3SLKA 1UF9A 4BP9A 2XKBA 2QZ9A 2OFFA 1XFAA 2V5VA 3WE7A 1SEPA 3HNRA 4W6ZA 3CO5A 3IV7A 3ER6A 4N3BA 2W6CX 1FU8A 5ILGA 3AIOA 4ID9A 5AOVA 1MJ5A 1H2YA 1R6XA 3VNQA 4L9AA 2FPRA 3QGMA 4JXKA 5FOTA 2GKGA 1LSOA 3WADA 3ZDQA 1DRKA 4IQ8A 3IIEA 1H0SA 1YONA 4WESA 1G6Q1 4B3CA 1U8ZA 1GPJA 1P39A 1W46A 2EDAA 2OCLA 3TLCA 3ZIAA 4BO7A 5KSYA 1WZEA 5L4NA 2HGZA 2PUTA 4HB4A 4ROSA 3A1WA 3INNA 4J29A 1J7JA 3LYHA 3BJMA 1ZK2A 3A31A 2O3SA 2HA6A 1LZKA 1JIXA 1XYVA 1B1AA 3ZHRA 4MDHA 2ZB2A 3BGVA 4F38A 3KYDB 4I8DA 1G21B 5I4BA 1U2GC 3OT5A 4GOXA 4BVBA 5IANA 1QO7A 2WD7A 2GEKA 5BT9A 3CB4A 3WKCA 5L9AA 1WCWA 5K45A 2YXNA 2I65A 3KELA 2XTZA 3QJYA 4N0QA 2C2BA 1G55A 4M8LA 4RPIA 5IVDA 1ZGBA 1J97A 4ECAA 4IWYA 1KC1A 4P1ZA 2PGIA 2AI1A 3ABIA 3VC3A 3F6RA 5ESXA 5EG5A 4YT2A 2D2FA 3DZGA 2CXNA 1QPZA 1CJSA 1E9CA 3RIGA 4ALIA 1QC5A 1DBWA 2GKSA 3G8CA 4KAFA 5CNIA 5SZJA 3WSTA 1JIVA 1TYBE 4CIAA 2FDRA 4IIUA 1D5CA 1N2SA 3F47A 1VB5A 3K2BA 1PWEA 4C2UA 2Q6IA 2WRZA 2O2JA 1K6JA 3OA0A 3WGYA 4ZVVA 1ZD4A 1VL1A 2YJTD 3EC2A 5HE8A 3VHRA 1XPUA 1OFIA 5TMEA 5BT8A 2QP3A 5BN5B 2H4ZA 1OXKB 3AERB 3NHKA 2UKDA 4Y9UA 4C9BA 5F1OA 5CFPA 1KYXA 3N8IA 3DVLA 4OIMA 4YMIA 4PSUA 3RQIA 1JW9B 2E37A 1Z5ZA 2K4MA 3K71B 4U8GA 3ANXA 2ZT6A 2ZAMA 3HK2A 3OI7A 5JMOA 4F2WA 1YIAA 2G28A 1Q2UA 2VJYA 4LRXA 3VHLB 1KF0A 1P9RA 2Z56A 2FN4A 4WCFB 4AZTA 3IPYA 4BNMA 3I61A 2DBQA 2JFPA 2BM1A 3SF8B 3WNVA 4ETMA 3CLKA 1CKEA 2YW2A 5DHSA 3CSUA 4YRIA 5KOYA 2CB9A 2BONA 3IBTA 3TD2A 2PZKA 2GJKA 3ITDA 1A5AB 2XMZA 3UT0A 5JRZA 3M0EA 1USGA 4UAUA 1HDGO 3TW0A 3DLCA 5L7WA 1RIIA 2OILA 4ZZ1A 3C3CA 3PRJA 4KODA 4Y2PA 2H1RA 1WY7A 1KAMA 2K87A 3QVVA 2OO7A 3AUTA 3OJEA 1C9YA 4CL0A 3U49A 1O54A 3DNMA 4HQ0A 4R3NA 3N2KB 5KTKA 1JDJA 5AM1A 3EG9B 1M3SA 2HWUA 4RPGA 1DQYA 2E1PA 1PCXA 4LZPA 3W7VA 1GG5A 3ELUA 4FZ5A 2WIFA 4BFUA 3NW9A 4KI0A 5B55A 2M6SA 4O63O 1I9GA 5ESRA 2M2IA 4BIMA 1PFUA 5U4XA 2A3NA 2Z9BA 2J9GA 4FSHA 2FV8A 4XGRA 4DIOA 3C3YA 2VIIA 4LXGA 2R87A 4UEKA 3KPVA 1XVTA 2W37A 3NCHA 1QFXA 1U1IA 3DB1A 3H2GA 3SN6A 1HNZB 3L3BA 1L5VA 2VJMA 4KFUA 3UCEA 2QRMA 4B4KA 5KX5A 3QXCA 4CKWB 4R8LA 5GWXA 3EUEA 3LM8A 1YRLA 2MTBA 3ZHZA 2FQ1A 4NTZA 1AF4A 1WDMA 3A6DA 4G37A 4NNOA 1AOXA 1QWSA 4BE4A 2XUZA 3PIRA 4UU7A 5L6LB 5F9FA 3HCOA 5C1OA 1A9ZA 2HPHA 5JDCC 1F12A 1B14A 5JCXA 3GD5A 2CVOA 4DT1A 1AKUA 4YR7A 2PPLA 1GR0A 2QR5A 1GZSA 1EUYA 1JUDA 2JGMA 3C87A 4B17A 2X6RA 2ZRBA 1Z3IX 4IVPA 3TBKA 2QRJA 3LPAA 5C5CA 2WG2A 1OJLA 1TDJA 4MLZA 4KCGA 2W4IA 1KR2A 2AMLA 2REQB 3DBHB 2VPIA 1D0VA 1VMDA 1CBUA 4PCAA 1YRWA 1QOPB 3RDPA 1KMMA 2EYUA 2FEXA 2G1KA 2CXPA 3EISA 3Q7IA 2HIAA 4XLZA 1QO0A 5FLXA 3IBSA 1RXSA 4RZQA 4GXNA 3L43A 2H4WA 3ZUPA 3IERA 5AKIA 2Q3DA 2NNLD 4EZEA 5CG1A 3RS0A 3BXPA 3SXUA 2JFBA 1TE2A 3BWVA 3E81A 5AW1A 1CZLA 1MEOA 2HEGA 5DBHX 4DY4A 2WJ3A 1VLZA 3WQRA 5FUMA 4HF7A 3JV7A 2E82A 2WTAA 4A2CA 3EJWA 5HIAA 3LYUA 4G97A 5K5EA 3E5MA 1HQKA 4AJNA 4E13A 5F5XA 4WGFA 1L5SA 2F8LA 2VP2A 4NZPA 1R0XA 3WL4A 3OOSA 4MP6A 4PZAA 4BQRA 5K8IA 1EFRA 3IRVA 4EJSA 1Z56C 1EX7A 1W47A 2HJRA 1MH9A 2BGRA 1QXSA 2OE2A 3VR0A 1A1SA 4Z7OB 1JNXX 5BV0A 5LOVF 5DEOA 2Y1KA 3BHJA 4LYJA 4A2WA 4YTEA 5AW3A 3ZGVA 4Y2GA 4LUCA 4N0DA 5HE9A 3FG9A 1KMIY 3BB3A 3KUDA 4JJZA 3HE3A 1FUEA 3ZK9A 2FPXA 3P5BA 5K6RA 2OGUA 5ES4B 2IX3A 1TFRA 3IAFA 4KE9A 1XNGA 3L4EA 2EU8A 4JH0A 4GGOA 5JQGA 2V7WA 3AR2A 3RRXA 4PYRA 4L57A 5FHQA 3UK6A 3CTMA 1U0NA 4H9KA 2C8VA 2C9BA 1GQFA 3I01M 3EE6A 5DX8A 3KQHA 3HYNA 4EKDA 4HWTA 2PA3A 1E96A 3FUWA 1BE0A 2X5KO 3HCWA 5IJ0A 2OZEA 1L7BA 1EFAA 1BWQA 3MQ2A 1E2DA 1V7QA 4F4UA 4DLXA 3BMOA 1VLQA 1RI1A 4J7CA 4WZAE 3S3TA 1E0SA 3FVWA 3KEOA 4AG6A 5KYYA 5DHQA 1FBTA 1FYWA 2I6GA 4IHJF 3E8SA 4A23A 5J5VA 3KSDO 2GVNA 1KI1A 1Z25A 1Y33E 3MWEB 3PXUA 1I5RA 1R9MA 1S1CA 2VRNA 3W6PA 1JTEA 5HOQA 4ZA2A 4RKRA 4FFBA 5BQPA 2XWSA 2WE7A 4DLWA 1JF8A 4FFSA 2RHJA 3T0GA 2QL9A 1QO9A 3ND9A 1QQTA 2JH9A 1GHTA 1SCUB 4X93A 3NRCA 5EXDA 1PNTA 3G9UA 4ED9A 2ZVPX 5GOTA 5BP7A 4OP3A 4EGQA 1QE3A 2ZG6A 1F0PA 1PEYA 3KEMA 1PFGA 1TIPA 3QIAA 1D0IA 2EFHB 3LHKA 2NQ2C 2ZJ8A 3KVRA 3W5BA 2NV6A 3PB3A 2X3YA 4NEHB 1T4BA 3QLTA 4M8IA 3EGDB 3E53A 1KAOA 2PKYX 1TEZA 5K8CA 3IDSA 2VJPA 2WD7B 4GOOD 2QUHA 1T35A 4RMNA 3NUQA 3X3HA 1AM4D 1GDHA 4M9XA 2I4LA 2A57A 3L6RA 1GFWA 3LYAA 3GA5A 2YWHA 3NM6B 5TGDA 4O0LA 5BMVF 4EYOA 5JJ5A 1DRWA 3KLPX 2I7TA 1U5BB 3PQ5A 4WX2B 1TCAA 1WDKA 2LBPA 3CKMA 5A4DA 1T9CA 4V1CB 4XM2A 4XB6B 3AV3A 3FDXA 3Q4GA 3VV3A 4Z2YA 1QSGA 1HT2E 4BQIA 3DWGA 3MJDA 3HJNA 3PJGA 1CCWA 4Q3NA 2JVKA 2JIZD 1KZ6A 2DCUA 4FYPA 3FNHA 4BO9A 5FWNA 1K7EB 5BURA 2QM7A 3JYHA 4MYDA 2ZB7A 1T6ZA 1EZ1A 2Z1MA 3DZFA 1QH1A 4PCVA 5TEVA 1LBHA 2H6EA 1ZSYA 3DBVO 4G4GA 4F11A 4XR9A 1AO3A 4DIBA 1ZX1A 4FOPA 3SU8A 1C8BA 2AYXA 5IWAB 4WECA 3IP6A 3PPXA 4HWPA 2JNWA 4NCJA 1R0ZA 1HQCA 1KK1A 5CIYA 2QPOA 1ZBDA 4NJOA 1PDOA 1IVSA 3UJ7A 1I4OA 3D5TA 1DBRA 3HI6A 4IJ5A 5KNCD 3A1NA 1TQ8A 2J9FB 3F9RA 2GB4A 3OFNA 2MINA 5EOVA 2B2NA 1RACA 3R3ZA 3DDHA 4QOHA 1TVFA 4RAQA 3U1VA 3WMFA 5FI1B 5JS1A 5J2UF 1CQWA 2CW5A 4P3XA 5DVZA 5LXTF 1ISHA 4ZT6A 1YACA 3T7DA 2W2LD 3CV3A 5KOJB 3T1QA 1JRLA 4C6HA 2B4YA 4MLPA 1XNQB 1S4QA 4AICA 4HS9A 4C0LA 2C4KA 3TQFA 3S29A 5FX2A 4Q7KA 2C1ZA 4H1HA 2HCRA 4M86A 4XUGB 1X3SA 4JC5A 3OTGA 2DQKA 3P97A 3EEOA 1RWBA 4XSHA 5KDLA 4PQFA 1JPUA 3OZBA 5E9WA 3O7WA 4IIGA 5DB4A 4ND2A 4BKMA 1P2BA 4MVWA 4DLSA 1S9DA 1Z4NA 3K5HA 1HOTA 1YU9A 3EDQA 3RTCA 1YUBA 2PH1A 3HXMA 2O2YA 2WMDA 3OZAA 3R0ZA 1S8FA 5C5DA 5KTTA 2BFAA 3H5OA 3F5DA 4HH4A 2HX1A 4O4JB 1A2KC 1NW4A 2GPNA 5LP6C 3B1WA 3LQ4A 2ZCJA 2F43A 2F1HA 1E2IA 3QX7A 2RGYA 5ED4A 4E1AA 2AX3A 1D2HA 1VRWA 1NKVA 1Z2DA 3CEAA 3D1JA 3QWBA 2CLDX 3BXXA 1LX6A 3AWIA 1XHEA 3PD7A 3PC4A 4OLFA 5E0OA 4O6VA 2WWVD 1H6DA 1MABB 4P0PB 5FWDA 4QYWA 4CT0A 1T2UA 3QI2A 1YB5A 1T2CA 4IUBS 4QEDA 1H8HD 2QG9A 2QTRA 1KDTA 3LHSA 1WUHS 2BAGA 2VT7A 2O19A 1E3EA 3N0RA 1YB4A 4BP3A 3QU2A 4HYQA 4OXIA 4MR8B 1IE3A 2XYPA 4TKVB 2UU9B 2Z2YA 3VR3A 4BLVA 3BAFA 3T5MA 4BQPA 4RVFA 3VPCA 2PUVA 4EKEA 1DEOA 3FOBA 4BVHA 2MINB 1UOPA 3TSWA 4E21A 3B78A 4IDAA 4N5MA 1HA3A 2E5FA 5IN4A 3D0RA 4PHGA 4CM3A 4K6CA 5IF9A 2JF0A 2Z2IA 2GO7A 3HU1A 3QUCA 2X8JA 1G1AA 1OC2A 2A0FA 2UUCB 1GTSA 3IXMA 1CQJB 2JS7A 3L49A 4DAEA 2VSQA 3DAFA 1W5BA 4UW9A 5HBRA 1N1MA 1ZA1A 3PF8A 1RVV1 2YZ7A 3NANA 4YO8A 2AW5A 4OJQA 5CFQA 4KQEA 1P61B 4DLKA 2O7NA 3A0UA 2IPAB 3O3OB 4KLAA 4CQLB 2RGAA 2WJVA 5DW3A 3TIFA 1KIFA 2XRYA 4ZT7A 1EH5A 4KVAA 5AFSA 5CP8A 5CBPB 2O59A 3OTHA 1NURA 4HGRA 5I4IA 5F73A 3OT1A 3TZKA 1UADA 2WQ7A 1TA4A 1DCKA 2BSQA 1EE2A 2V45A 2AQHA 3K4PA 2XT6A 2J3MA 3P19A 1MW9X 2EFGA 3BDIA 4AP5A 4BS9A 1LQTA 5CG2A 1AT1A 1XR3A 1YFLA 1J24A 2HCTA 1RAGA 2VWQA 3PKJA 2QVZX 3R5TA 3L7YA 1R4MB 2E89A 3C8ZA 5CDYA 4CG2A 5KMGB 3WFJA 1ABEA 4B33A 2WP0A 1FDRA 3Q2KA 3WGKA 4DRXB 3UPTA 4W7IA 2YHSA 3R9KA 3X44A 4GG1A 1JFFB 1FRNA 1KU0A 3H5AA 3EGIA 4WVFA 4PSKA 3NHPA 3K05A 3NHSA 4Y0AA 2FG6C 1WSDA 3BCRA 5T4FA 5CB6A 3ZXSA 1T8YA 1XF1A 3MJEA 2HA5A 4J1TC 1REQB 4YLGA 3AR9A 1EVYA 1U0BB 1U9CA 3K6SB 1QO0D 1GA1A 1W2GA 3BWCA 3MOIA 4JJKA 1MF7A 2VF4X 2W2KB 4BQOA 4F6CA 4MJLA 1RLUA 4R2LA 1N2JA 4FOOA 4N5DA 1P0MA 3JZIA 3PR3A 3W8NA 4E2FA 1L7AA 2FQWA 4IGAA 4HUTA 4EL0A 3AOEC 2HJ9A 5T41A 4FMCF 4QODA 1MGPA 3QJGA 1YZTA 3IMGA 2WHQA 3GUVA 2V0GA 1YS6A 1CVLA 1OWLA 3GDOA 2VPZA 4NVRA 3WLPA 3ONNA 4RABA 1T2NA 2WU1A 2G7ZA 3NDJA 3ZDCA 2OV1A 5BNWA 2W98A 4V3CA 1ML4A 3A1CA 4YA6A 2NUTB 1GKIA 1C0LA 3SBXA 5DYWA 3L01A 1R0RE 5HBGA 3AIIA 4I46A 1G4AE 3ONVA 3RCBA 4YAGA 2QQ0A 1Q2XA 3EGVA 3P9IA 3TNDA 4Y1EA 4IUYA 1J21A 3L93A 5DDIP 4W6QA 2XRFA 4WNAB 4AJ9A 3JQ9A 4KGXA 5AM3A 4N3AA 4DR6B 2B7BA 4IX1A 1FIUA 3HO8A 2RHWA 4RTKA 1JTVA 1NRWA 3DW3X 1KP2A 1KEEA 4FYMA 2FUNB 1SUIA 4MQEB 4BB5A 1P3JA 4X41A 3DZCA 3T7JA 3T1HB 4QEZA 1OV6A 2DLCX 4QECA 2PO7A 1GZDA 1SB9A 2PO5A 1WSBA 4IX9A 4JI1B 4CDNA 3NRBA 3EIUA 1W75A 5IUNC 4UC0A 1G5PA 4GXTA 1AMUA 3BUSA 3LLMA 4NU5A 4E31A 4ZJYA 1ZJ6A 3LBYA 4GPIB 3AHIA 5I51A 1LPAB 2B20A 3SBDA 1Z6YA 1L4UA 2OMKA 4LNHA 4ZQHA 5JSFA 2ESRA 2WJZB 4UD6A 4KN6A 1F8UA 3NTVA 4ZAWA 4QM7A 4REQA 4AUKA 3K6SA 4B8YA 1UINA 3QW4B 1J1UA 1R0SA 1QBGA 4C5BA 1WD5A 1BCSA 2AKEA 4X94A 1QORA 3MGBA 1EFVB 2A7XA 3DG9A 3W4JA 2JCVA 1RRKA 1J0XO 1XZJA 1EJBA 2J9FA 2OAP1 2V3WA 1NI5A 4N18A 3AL0C 2G67A 2ZU0C 3EXEB 3M9XA 4IIJF 4JB8A 4Z9XA 5HMLA 7ADHA 2ZKLA 3OC0A 4Q3OA 2Y9MB 5IDYA 1SVSA 5C4GB 2G36A 2IV7A 3T3EA 5KQRA 4YUXA 2YHIB 2VYND 5KSPA 1GSHA 1P0FA 5AHKA 5TE9A 2CWDA 3UT6A 4BEJA 5KEIA 4O4LB 5MFPA 4X63A 2WI8A 4C03A 3R7WA 3GDGA 3HWRA 1OW3B 3C3DA 4YFVA 1YVPA 3KHUA 2NZXA 2OVFA 5BVHB 1EMDA 2ZWMA 2WYIA 1FP4B 4IIXA 1Y4AE 3B6EA 2CUZA 3I0MA 3ZVNA 4IIBA 4MR7A 1EUZA 4JLAA 1FX0B 1Z0ZA 3MJSA 3TAUA 2BMFA 2UVQA 3GUYA 1M8JA 3GWZA 3KVVA 4I4TA 3RHZA 4EW2A 3BCHA 1GWNA 5EXEA 1FTWA 1RQLA 3BD7A 3SC2B 3WAJA 4E09A 1OXBB 4NONA 4E2YA 4BL5A 2ZUCA 3OX2A 4MSUA 4AM8A 1E1CB 4UBLA 4B47A 2LZ0A 2C5EA 5ICSA 1WCIB 2GKOA 2R00C 3ROGA 2IHUA 1V4BA 3K7EA 2YASA 2HLNA 3TZLA 2Q4DA 4OU4A 4UVDA 4W1QA 4DSNA 1N7IA 3G3EA 4A0GA 2FMTA 2FRDA 2PXHA 3QBVA 3DB2A 4H17A 4NYJR 2HPVA 2PVCA 5BR4A 4H7KA 5IASA 3RFVA 2LUOA 5EKTA 3IEXA 3L6CA 1S2IA 4NBUA 1KJ9A 5K6AA 3I4CA 7YASA 4DADA 5CVCA 1PSZA 2WSSA 3LCMA 5I7UA 4BX0A 2PUBA 1Y1RA 5EMKA 1FFXB 2WTUA 1YQTA 3BIOA 4J91A 3EMDA 5KYUB 2PKRA 1QJ4A 5DU2A 2BEVB 3FPCA 3GT0A 2VQEB 1I4WA 1QHIA 4V0SA 4YAOA 1U7XA 4JI2B 1GTJ1 1E3LA 1XXHB 3F3YA 1MHPA 3A0RB 3D6MA 4NS4A 2IY7A 4R2XA 4XD7D 5DHAA 5EI5A 1M72A 4PX2A 4BU1A 4AMBA 3BE8A 1Z39A 1V7ZA 3G9XA 3V4OA 1PD1A 2FQQA 3A9UA 1XZBA 1MP0A 1ZNQO 2Q4OA 3KQPA 3FNQA 3KP1A 1SHLA 3TNJA 2O8CA 4GZ5A 5F4ZA 4KIWA 1ESDA 2F9LA 2H1HA 5TV2A 4AZWA 4B3DA 3R9WA 1W2WB 2ISSD 1GD1O 2Z2KA 4FJ0A 4F5WA 4EZBA 2C31A 3L7NA 3VR5D 1U6KA 5M7EA 3N2GA 2XGGA 2RBEA 4TMVA 3UHOA 3R7WB 4XWGA 3D3NA 1SC6A 5F77A 3SEZA 4DUZB 2AG5A 4IXDA 3EQZA 4ZP1A 5C34B 1MBZA 1C7EA 4YCBA 3AF2A 1CS0A 2R68A 1YCDA 1ZNWA 3QHAA 2AOVA 2PKEA 4GLBA 1MCZA 1I13A 2JRLA 2HSDA 1JSXA 1G2QA 1TLFA 2PN1A 1OOEA 3ZZNA 1DINA 2D0OB 2ZYHA 2IWRA 1BD3A 2ZVJA 3FYHA 4G0WA 4CGYA 3I73A 3Q88A 2H29A 2D0PB 1UWCA 2WZCA 1COWA 2P9CA 4QAQA 1ZK4A 3FKJA 3G2MA 3KXDA 5TDHA 3DHVA 2D00A 5EIAA 1CC1S 1PR9A 1B2LA 1Q3KA 3P26A 4HTFA 4G4IA 1GITA 2JLCA 3OEWA 5C8VA 5JYCA 1J0DA 2C97A 3LCVB 1UFQA 3DP9A 2VT6A 2JGLA 1MPTA 2NO1A 2IEAA 2VSYA 1YJCA 2YYAA 2O0JA 1MX1A 3X1ZA 3L4KA 1B76A 3ESYA 4M0FA 2Q6OA 4REOA 2XY4A 2AKAB 3CUYA 4LOHA 1I6LA 1VJGA 4QWWA 5CURA 3SQDA 2R6JA 1FXWF 1V7CA 3CRQA 3QBEA 4PLWA 3WK5A 4PR3A 3MJTA 3FPGA 1NAIA 5HKKD 2XUHA 2JGJA 3JQBC 5K4AA 3C6XA 1XYGA 5BW8A 1FSZA 4YAIA 4MVJD 1R9GA 1EGQA 1OCEA 2H4YA 3NAZA 1RMTA 1DIGA 1A9TA 1Y5NA 2J08A 2YIJA 3F97A 3UV7A 4BMNA 4C05A 1D7AA 3IE0A 1J00A 1NQAO 3JAKB 3IAS6 5AW9A 5KWIA 3KSRA 1J8FA 3IAUA 3IQHX 4ZC1A 1EVIA 2VHJA 3JQGB 2IYUA 3WB0A 4L4ZA 2RH5A 1GKUB 1STOA 3G7SA 4EM6A 3HDJA 5AM0A 4AS2A 5AM2A 4FYJA 3FPHA 3VKGA 2DY1A 3UFXB 4MCIA 3R7DA 3PVCA 3RHFA 4PXAA 4NAVA 5EHQA 3OQMA 1CXZA 1TMKA 2DRIA 2QAGB 3DPUA 4PG4A 4DMCA 2J07A 2OV4A 5EP2A 4N1AA 4NFSA 4DDVA 4IV8A 1W2HA 1PTJC 3ZE1B 1JU9A 2B1IA 1GAXA 3ETDA 1IN6A 1M8PA 4Q1AA 2O14A 3M2TA 2IW3A 1J6UA 5C5IA 4M7WA 4BCDA 5BWBA 5I4KA 5LU9A 3O4FA 1X7ZA 4I5GA 2AFRA 4HUQA 5DF1A 3H2ZA 4IMPA 3RHTA 4QUBA 3A2MA 1G3UA 4C89A 4LX0A 1GSOA 5JS6A 4R98A 1JS1X 4QPDA 1L3BA 1P80A 3ZWNA 2FTKE 4H7PA 3UPDA 3UMMA 1K5DA 4WKOA 4ZV7A 3SXPA 1KFBB 2ODQA 1LPPA 3I05A 1CP3A 1DHTA 4P4SB 4AG5A 4NLLA 5A9TA 2CXRA 4BRWA 3VGPA 4YX9A 1E77A 1ZK3A 1F2TB 1KKMA 4GUAA 3BZBA 3N2NA 2NU9B 3L1VA 4C29A 1RCUA 2PH5A 2JIMA 3PE4A 4UREA 3WG9A 3SR3A 4MUBA 4A4DA 1PL7A 3RADC 1ZGZA 2X4IA 3BERA 5CX4A 3KQLA 4ND1A 4NYJQ 1J42A 3C4JA 3CKLA 1DAPA 2HV9A 3HB9A 3EA4A 4HAVA 4YCSA 4CKWA 4JSYA 5I7FA 5L95A 1PWXA 2XMPA 1T91A 4TQUS 2FUG1 3PQDA 4IO1A 1LSJA 3ORRA 4J90A 4QYSA 4A8JA 5AVYA 4GR9A 3TBFA 5FBWB 3EVEA 3IP8A 3DZJA 4X62B 1JEEA 1E0JA 3R23A 5CVJA 5CLFA 4CT5A 2ZIEA 1G8YA 5GZ3A 4G5YA 3RUDA 3FOAA 4PEVA 5T5QA 2BP7A 3RYFA 3E1KA 4B3MB 1PIWA 3PC8C 1JZQA 2BM8A 2XOXA 2PV0A 2C7RA 4RTLA 1TJ5A 4ATNA 2G9QA 1Z45A 3W5AA 3F2IA 4F4FA 1A8SA 1OHHA 3QLEA 1WPQA 2BL4A 1FFEA 3A8TA 4J43A 4JA0A 1Z8HA 4JD5A 4MYRA 4RK0A 4RLFA 1KAGA 1XZQA 5DTEA 4UJ5A 5DOVA 5IG2A 8GPBA 5I01A 1BHQ1 2WE8A 3TX2A 1VJTA 1WF6A 4DWWA 5JSHA 2ILTA 3QPUA 5EIFA 1WETA 2EBHX 4IL5A 1C3EA 1NOJA 3F3MA 1KOLA 1AZLA 1RJFA 3L04A 1OTYA 1AMNA 5AHRA 2D6FA 5BXQC 3GP3A 1QNFA 1NI4B 1R6AA 1CVIA 2P40A 3ELDA 1YZYA 1D6JA 3O90A 4LNUB 4NMWA 5AHWA 1N5IA 1UT5A 2Y77A 3I92A 4E5NA 1UP7A 4HN4B 3PL5A 3W9UA 3EX7C 1TYAE 1J20A 3EUWA 3MS4A 1GCAA 2MMCA 1O94C 1TADA 4O5AA 1FP7A 2QPAA 3DTVB 5C8YA 4GKAA 3Q87B 5L45A 2DXIA 4Q4AB 3NIGB 4PPYA 2BISA 1GTRA 3N5CA 4OHZA 4BMPB 2ZE8A 2BH9A 5DLYA 2R4TA 1SVLA 4NU0A 1Z2PX 5DGXA 1V47A 5JCOA 3USES 5BSKA 3ZZ1A 1P2TA 3OQVA 1TW3A 1PK8A 1II0A 4B7AA 3BA6A 2EBWA 2V0NA 2HRCA 5BSRA 1TD1A 3FN4A 1QFSA 2KB0A 2ZYTX 3VKVA 3TQIA 2J0SA 3CIOA 1U5AA 3A2LA 4J6EA 4KC0A 4YJ3B 3EZ7A 5KTMA 3CNEA 4R9RA 1O2DA 1EZ4A 5AIBA 1V16A 1AHIA 4IJVA 5AICA 5TF0A 3W0LB 1HE3A 3OIFA 4HB0A 4DSAA 1GUFA 5KVVA 1ADJA 4ZQGA 1DVRA 1E3TA 1T1IA 2OOSA 4HQLA 4Q66C 4RFSB 2XMSA 5IC4A 4ZYXA 3OQPA 4ML3A 2FPIB 3AESA 1DCFA 1JQKA 2HK9A 2ZSKA 1Z2OX 3RTAA 1THTA 3RE1A 1GFZA 3DO6A 4XYEA 1RRFA 5I3ZA 1CP2A 1IXKA 4PCUA 5G1OA 1RM0A 4EHBA 3EASA 1U99A 2V59A 1LTQA 1E2QA 4HDQB 4AC9A 5E7MA 4A15A 4HAZA 2W0SA 3NJ8A 1A88A 4TLAA 5H16A 3SMVA 1JSRA 1WMAA 5E6RA 2UXCB 4D0RA 1GRQA 3NOOA 4KQHA 4MUMA 5MGNA 3B9QA 1FVOA 4FU0A 1DEAA 3VO8A 5IT9A 2XDQB 1FE8A 2IEDA 4ZAFA 3KCQA 2C1EA 1OU4A 2DFPA 3DT8A 1GPMA 4FBLA 5FQOA 2HMAA 2Q0HA 3S2FA 4IXMA 4ZQFA 2WYVA 4G8BA 4W1RA 3VO9A 4W9RA 3KNZA 1LF5A 4XWKA 2VQFB 1TCCA 3C3MA 4MWEA 5AI8A 1RS0A 5AM5A 1C8VB 2EIHA 2J9ZB 3A3KA 1JHOA 1YD7A 4MDEA 4MS3B 1ODLA 1T0PA 2CY0A 1PK7A 2R8EA 4EEXA 1WW3A 3DXFA 2Z1DA 1VBKA 3T52A 2WLTA 2G3YA 1ZMRA 3BMOB 4BFXA 1GT6A 4L8VA 3BICA 1B6TA 2EP5A 1FX1A 1I51A 3K53A 1KZYC 4UBOA 1VBFA 1G6OA 4MJXA 4B6FA 4DJEC 2ZDHA 1BKDR 3RVNA 3FBTA 3OEED 2X1LA 3KLOA 3SVZA 4DCGA 2WYUA 3DHYA 4OXYA 3EIWA 4RU1A 4LHXA 4Y2SA 5AJUA 3UHFA 3IPXA 6LDHA 4PGGA 1AURA 1E6LA 4A6DA 1EAMA 1GOTA 1DEXA 3VI3B 1PEAA 2P67A 2VDRB 3L5KA 1X86B 3N6XA 3KSBC 4G0UA 1TJ4A 1BCRB 3UB3A 1WRBA 1VIMA 3PXXA 1ZQ1A 3DO8A 1QQ7A 1QM5A 5EXSA 4UHJA 2HOQA 5GJCA 1RYYA 1GR1A 1KQNA 3AHEA 3NM5A 3KG2A 2GILA 4N01A 3ZQJA 3IE1A 5IK2D 1TM5E 1FPMA 1AK9A 3Q72A 4LYYA 4QDOA 5JAQA 2R44A 3W8FA 1LJLA 3HVUA 3I9KA 1P2GA 3DHNA 4BLWA 1Y8ZA 3ZCVA 3L7JA 1HLDA 1NF2A 4XYGA 3CSDA 4B35A 3BDVA 3QP9A 2O8FA 4C7MA 4NL4H 1WOMA 3GCXA 1SOMA 4TTAA 4EVQA 4KE8A 1BQEA 5K1ZA 3NBMA 2BGIA 3CYFA 1N2GA 4Y1FA 1E2PA 4ADSG 1Y42X 3K16A 4EY3A 1XIVA 2W22A 3RUAA 2JGNA 1FFSA 3NIFB 3Q7RA 3EVNA 2NYVA 1B26A 3VSEA 1XMSA 4LJAA 3QXGA 4EHJA 2G72A 5HQJA 4Z1MD 1H4SA 2RHLA 1K89A 2GPAA 2W2VA 3DMTC 3RFUA 1EVZA 3V4LA 3VJKA 1QTRA 2DUUA 4M7PA 1PS8A 2JJ2D 4OGLA 4QXPA 2OXIA 4FMDF 1C0PA 2AEJA 4RHFA 3VR4D 1R15A 4LK2A 1PNVA 1AGNA 1Y81A 1KYIA 4NZYA 4MS3A 4DCSA 4EVIA 2RGGA 4TL6A 5HGXA 2FP3A 5JXHA 1KTIA 2JH3A 1PZGA 1YJXA 1PD0A 2X15A 1DNPA 4ARIA 5JI3E 3T9FA 4II2A 4U2BA 1Z0JA 5A4FS 2VTBA 1FPQA 2Q2NA 3SJ7A 1ODJA 1R0BA 3OPXA 5E6UA 2AMFA 1E5XA 2D1TA 2DF8A 4YJFB 4QVGA 1M8FA 4O08A 1PZXA 1Q74A 5HF5A 4E14A 4UNPA 2WVAA 2DHEA 2G0NA 1EIZA 4I8IA 4J1NA 2DR2A 2ATIA 3NWPA 4N82A 1AK2A 2MT9A 2FMHA 3QU7A 3D4BA 3PC7A 5HKOA 2ZK7A 1UP6A 3AYXB 4YRCA 3DLTA 5CXUA 3T1TA 3B20A 3E9YA 3IQEA 3QWFA 1ZMBA 3JQFA 5JAZA 4Z86A 4FIZA 1SVIA 1JHMA 1Z75A 2WT9A 4PVDA 4QUGA 4ZEWA 5BOVA 3K70B 2XQFA 5ALHA 3B3QA 3BH6A 1O4VA 1ORIA 1U9IA 2GTPA 3DZKA 5BRNA 1AKYA 2FK8A 2RHTA 1SBHA 4B6QA 1PKXA 3RSSA 8OHMA 3K8QA 1DC8A 2R1TB 3MCWA 4MX8A 1NQXA 1W0KD 2QE7D 3BWYA 3L6OO 4RZUA 4TSKA 5FTLA 1R4NA 3Q3GE 1NI3A 2BF4A 3H8SA 3O8BA 3JQAD 3PK0A 1G21A 4UUNA 5BNIA 3WAGA 4Y98A 3LPMA 3GGGA 1V1MB 3QPCA 2AZXA 1PGNA 3S2ZA 3AOEA 1HRKA 2X5JO 3HN6A 1XWWA 1DWPA 4C7OB 1ULUA 2CLCX 2BGLA 3LKVA 3EB9A 7REQA 3FCAA 2RAPA 1ID1A 3PYMA 4YRLA 4OXXA 4Z4HA 4NECA 5HCIA 2KQUA 3DFMA 3JD2A 1S3IA 3K9QO 3ZCTA 5JAIA 4GR4A 1OZGA 3WQHA 3NEYA 3L84A 5JIBA 1NXOA 4UCWA 1PI3A 4XM0A 3H75A 2ZJOA 5FPHA 1T3TA 4P34A 4XOIA 3UZUA 2BMWA 4QNMA 1TGVA 1TF2A 5IU6A 3C1UA 1Q1QA 4ND8A 1IUKA 1PJTA 2KS6A 1D1PA 2L2QA 3GRKA 4XH9B 4D3DA 4CKEB 4D5GA 4HDOB 3GNLA 1KFCB 4ZZ3A 3PUVA 3WZMA 1TK2A 2LPMA 2X4LA 3JASB 4KNVA 4LYHA 3V97A 3AY7A 3WLOA 1QV6A 3SJCA 1QLWA 3IV6A 3T7TA 2F9MA 1BMQA 4MR8A 3SKYA 3INTA 3VXKA 1PJCA 5K2OA 2WWYA 4WLVA 3O8NA 2PSEA 1BXRA 1RQNA 2QA5A 1U1DA 2AWNA 1JKJA 3FZYA 1G0NA 4KSCA 3R20A 5AXBA 5I7VA 1CJKC 4FC7A 1E94E 4PRZA 4G5QA 5F78A 2F3PA 3I0NA 2FJPA 2DHQA 5A06A 5HP4A 3OKAA 4P3YA 4P38A 2JHPA 1HLFA 1N9KA 1PVDA 2B8WA 2HK7A 4PVCA 4QUEA 4WLUA 5CCDA 2HU5A 3EAFA 5I47A 3OX1A 1PNRA 3L82B 1DXQA 1XLUA 1CQJA 1TUIA 3LUDA 1XTSA 2A78A 4R83A 2Y9PB 3AI1A 3L7AA 4XCVA 3G0BA 3TGLA 3W2GA 4OUDA 2QG6A 3TCKA 2E18A 3FSEA 3PCTA 2BYTA 3ZZMA 4PZCA 4F0JA 3T41A 5EIEA 3R8FA 3M9LA 3OJWA 5CBPA 1RE0A 3G6KA 3IQDB 2FSVA 4IHJA 4UQPA 2VL7A 5DM1A 3F2VA 5FUWA 3RS9A 4AJ1A 4COOA 5CFOA 1V4NA 5B1SA 1GV1A 2PCLA 4HYEA 4FNMA 4O2RA 4ARUA 3U5TA 1JFVA 2GHQA 3RYCB 5ICGA 1CUFA 3P0RA 1WB6A 4MWBA 5I7EA 2VHZA 3GZNA 2QT9A 3U3XA 3BSYA 4LRYA 1E6KA 5EHGA 3HTXA 4KMMA 3K5IA 4PS0A 3SY8A 4FFPA 3ZI7A 4Q00A 1TL7C 4RSRA 5B3JC 3PLAE 1GQQA 4A8JC 2YZKA 4UHHA 3QVXA 4C0KA 2XCOA 3TB6A 4DV1B 4X1KA 4FQ5A 3BBPA 5JG7A 2IVFA 2FYTA 4MJ7A 4A5OA 3WGZA 1IEQA 5EIBC 3A05A 3PQ7A 2VNKA 1E3SA 2H4HA 2H5EA 4YI5A 2NO6A 3VZRA 2Y1FA 3JD1A 1BS2A 1J5XA 3DEAA 1REQA 1QJCA 4I08A 1GYRA 2Q28A 1FSSA 4FLMA 1KDOA 4MROA 5A5FA 1FFAA 4TOIA 3SWWA 4F6RB 4D6XA 5ISMA 4DHWA 3QELB 4BVGA 1ANKA 4CKCB 1E2MA 3RVKA 3S8MA 1KP9A 3C4QA 1YRBA 3TLKA 1B8PA 1H8EA 2OY0A 4LJ6A 3F98A 1PJ3A 1JVBA 3EXFB 2VP9A 2LDXA 3ETNA 2OZLB 4PX9A 5K0ZA 1TTQB 3O8QA 2D7JA 3KDAA 5EPEA 2DTDA 4RZXA 4LC0A 4L8FA 4NMLA 4BCBA 1VPEA 4G41A 4NE7A 3TD6A 3MCTA 5E3HA 1H6BA 3GNSA 3M5WA 3P0JA 1RJ9A 1F8XA 4MEBA 3PR2B 2C7PA 5EHIA 4QJ5A 3COYA 4TKZA 4TSFD 3W5IA 1NXTA 2J87A 4UDXX 3M6IA 1GQ2A 4M0PA 5AW6A 3AWDA 2YZ2A 1WXEA 4C14A 4EJSB 4K3VA 1R0KA 2EX0A 4DEYA 1BEEA 2CVHA 4CPDA 3LBNA 4AKSA 4DLVA 3PL1A 4N0PA 2EW2A 4QU8A 4YXFA 1XTUA 5CEEA 2XNDA 3NTLA 4N41A 4BX8A 1HF3A 1LJ8A 4O3FA 4F5YA 5FJJA 1YTUA 3GP8A 2A88A 2E7ZA 4ALNA 2XNCA 2FG5A 3L7LA 2Q3HA 5K8UA 1Y1SA 5HEKA 1W1IA 4IMRA 1NJ6A 1CUVA 1Z5NA 1WXHA 2C2MA 3L8GA 3PHJA 2YNMA 3CLTC 1XNJA 1HDYA 4HL6A 5ECGC 1RM5A 2OBNA 1CDEA 3KK0A 3LDGA 3MUFA 1K6MA 3OOJA 1MNQA 4C6TA 4QPPA 1JEQB 3ZY3A 2E0IA 2F90A 5DI3A 3WWDA 1MVOA 1B3BA 1RABA 4UVEA 1W36B 1RW4A 5LQCA 4Q9DA 3QVKA 2H2GA 5DSXA 4UTVA 3AVTA 3SZGA 3V7WA 3GPBA 5IARA 1BYUA 3M34A 4BC1A 3L0OA 3C70A 3X1JA 1H85A 4IIJB 3GZTB 4GRAA 4J0IA 1Y1TA 2EATA 4NBTA 4EVSA 4UDYX 4P3OA 3AETB 2I8AA 1E7YA 2FN3A 3OQIB 1C2TA 4FDMA 4K87A 1QYIA 1JNYA 1T43A 3FWPA 4YCAA 2Q3MA 4MPJA 4OLJA 4P7FA 5JQGB 3BMXA 4R51A 3U4MA 1T9GS 3O3CA 4N3NA 3UWPA 3DFZA 3NTOA 4QDJA 3AONB 2ZJ0A 1IVYA 3KEGA 4FGUA 2QRVB 3G89A 4O4LA 5JV5A 4DC0A 1KI8A 4KVFA 4RF4A 3VC2A 1THMA 1WSWA 2FPLA 3OCWA 1GNSA 2L69A 3FYSA 2J0UA 3GDWA 2JCXA 1E7RA 1SM4A 2Y1XA 3P27A 2E21A 3MRTA 3I1YA 4Y2RA 3ITEA 4MWOA 2JASA 4TV8A 3QQPA 3BMQB 3FLBA 2N47A 1UK7A 1N5LA 3KKZA 1JWLA 3KJQA 1M6HA 2IEBA 2P35A 2O3JA 1PHPA 3HHEA 1L1QA 3MWEA 2FAXA 4WDRA 3KOXA 4WBNF 4C4PA 1P81A 3ADBA 3VR6D 3QG5A 1ZJYA 2XKJE 3EZLA 3LP8A 1W93A 3NETA 1UKVY 1QP7A 4CKZA 3STXA 1GNLA 1KXJA 7GPBA 3TWOA 2JHCA 1ZN2A 3CVXA 4JJ8A 2F9FA 2WJGA 1ULZA 1W87A