1JQLB

Mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of e. coli dna polymerase iii: structure of beta-delta (1-140)
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
140
Chain Sequence
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLLHDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of processivity clamp opening by the delta subunit wrench of the clamp loader complex of E. coli DNA polymerase III.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA Polymerase III, BETA CHAIN
total genus 27
structure length 140
sequence length 140
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jqlB00
5KSOA 1DAIA 2PH1A 4GZMA 2JLXA 2ODEA 1OLOA 4NBSA 5DLQC 4CF7A 2A30A 2F3TA 3T1VA 4OHYA 3QVUA 3CX8A 3IPYA 5JJKA 5JS7A 2CLCX 1RC8A 4A8JC 4MITA 2YWHA 4ITRC 4M1MA 1KO8A 4LOAA 1KZ7B 1W47A 1WRBA 2H16A 4BFUA 3PEYA 4N1AA 4A6XA 2VF8A 4C0AC 3ZVMA 1IHUA 4L4UA 3B2EA 1TQ6A 5DHFA 4DXAA 2X2FA 2ZR0A 3RS2A 3QG5A 3W6PA 4IFEA 4GOKA 5KDDA 1FFHA 3SDZA 2QA5A 5EE9A 2FN4A 4IEIA 3T5DA 4P32A 3W8NA 2O8BB 3OE7A 1JQLB 1BIFA 3EW9A 3UMSA 2W2TA 3CWZA 1P2TA 1HEIA 1UDXA 3N5CA 4DUGA 4URVR 3AV0B 2Q6TA 3QXCA 3SQWA 4IJMA 2XEXA 1CR4A 2PJZA 4JL6A 1G4AE 4E09A 3OESA 2FG5A 1E96A 2C98A 1FTNA 2FFHA 3B1XA 3MD0A 4ARZB 2P6NA 2CL6X 1QHSA 1WXQA 2PT7A 3EZ6A 3QNUA 5H8WA 2J7PA 3ZZ0A 3DVLA 3HR8A 4A2PA 4C0LA 3HPRA 2RGXA 2UVQA 2ZU6A 1NBMA 3B9PA 1VG1A 4G5SA 1R0YA 2RGNA 4C0HA 2VP6A 4C0QC 2XSZD 1R4AA 3VKWA 4L15A 4OK3A 1Z29A 5DGXA 2VP2A 2OBMA 5D3MA 1KO5A 2A5GA 1SXJA 4EPVA 2Z83A 5FTMA 4B3XA 1CULC 3P4YA 2ODBA 2XOKD 3TH5A 1E2MA 1XZQA 4GL2A 4US0R 1YRBA 2EU8A 1IXRC 1L4UA 1OXVA 3CKLA 4B3CA 1EK0A 1JNYA 1DG3A 3FFBA 1RKBA 2P5TB 2PZFA 1NVVR 4HAVA 2ZE5A 3FFAA 4NTZA 1NSTA 1ZRHA 2VHTA 3TJZA 1AQUA 5FL7A 2ZJYA 3V4FA 1AA9A 3FVQA 1G4UR 2O5VA 5GADl 1IJFA 1K5GA 5AK0A 3CONA 4U00A 3V9PA 2FDCA 3DKVA 1DEKA 1U90A 2BEJA 3LQRA 4C9BA 2FGKA 3GFTA 1OXUA 1GG2A 2QRZA 1E79D 2AK2A 1G8HA 5JLJA 3GJXC 4BLQA 1ZJ6A 5D3QA 4MGIR 2DWOA 4YC7A 2C8VA 4DDVA 2CHQA 1G3QA 4TMVA 4UNRA 2QT1A 4HYYA 3D7MA 3FKQA 1Q44A 4EIWA 2YWEA 1MABA 1GUAA 3BXZA 2FGJA 4RD6A 1F2TA 3EPLA 2O8CB 5FUVA 1HA3A 2YOGA 2QP4A 1Q0UA 4X8OA 5HE8A 2HT6A 1P73A 3I8SA 4HAUA 4DLXA 4PPGA 2W6ID 1VIAA 2ZRMA 3B82A 2NPIA 1AGRA 1MV5A 2JEOA 4L8GA 3U3MA 3VR6A 1A2BA 2OFWA 4DVGA 2ZQ5A 3RVBA 4A4DA 5FTNA 1Q1BA 1S96A 2BBOA 2ZYVX 3QBVA 4G5OA 1GIAA 3HR7A 3P1JA 3SJZA 4Q21A 2IS2A 4RCYA 4DLUA 4MA4A 4OI1A 3FYHA 2BOVA 2QEQA 3VQTA 1XRJA 1BYUA 1KI7A 1XXHB 2JCSA 4A2WA 1T9HA 3K0FA 2PLFA 4F4JA 1EFHA 5AJYA 1Z5ZA 2X1VA 1X1RA 4US1R 5FBRB 4JBXA 1U81A 2BCJQ 1M1YE 1DAFA 1G21E 1XX6A 4UNPA 5H1YA 3UXMA 4FN5A 4D4KA 1G5PA 4DDUA 2ZRNA 1G3IA 4LJAA 5KSZA 4GRAA 1CR2A 1FX0B 3L0SA 2OILA 1JBKA 2Q3HA 3B9QA 4ASUA 1UAAA 5H70A 3GJ6A 5HPYB 2O8FB 2QBYB 4MYTA 4CZ2A 3HDTA 3KXIA 2F3RA 2WWHA 2FEOA 3GFPA 3MAAC 1S8FA 4QNRA 1W4CA 5GVSA 2ZRIA 1OIXA 4MYCA 2QQ0A 3VX3A 4OK6A 4DZZA 2WHXA 2ZRGA 2BMEA 3IBYA 2QGZA 1LFDB 3K70C 5AJZA 4LBWA 1FUKA 2ANBA 4C0BA 1DO0A 3CF2A 4LBYA 3LAWA 3BFVA 3MFYA 1IBRA 3RS5A 1K5DA 2JLWA 3NBYC 2WSSA 2QNRA 4TLAA 4KFUA 3EIHA 5FOVA 3EWAA 1RVDA 4XVQA 5DSZA 1NJFA 4D4LA 5FI1B 3L82B 2WWYA 3TBKA 3W6NA 3ADBA 1TAGA 2P65A 1JXOA 3R8CA 4NCHA 3CLVA 3X1ZA 2JLYA 2VH5R 1W2GA 2ZROA 2QMUA 1SHKA 4FWIB 2KWIA 3WMGA 4DLYA 1LNZA 1XP8A 5DIFA 4DLVA 2CLSA 3LBNA 1JEEA 1G3RA 4N0EA 3DDCA 1KIMA 1WBBA 3EZ9A 2CCGA 3QKUA 1NVWQ 4RCZA 1SXJB 5IK2A 1J70A 1SKYB 3CM0A 1E99A 2OFXA 4JLDA 4ZO4A 3TW8B 2AD5A 1J7KA 4Q7LA 2IUSA 2BWJA 3JVUA 3L2OB 1J99A 1PVOA 2HLDD 1C4OA 2Z5FA 4BFZA 5EQTA 1E0KA 1Z6XA 2IUUA 4DLRA 2PX3A 2QY9A 4AG5A 4TMZA 2PT5A 3QPUA 1KDOA 1S2MA 2CNWA 4MKGA 5J4VA 1KMHB 5TB5A 1WDTA 5J4YA 1V5WA 5JCPA 1L4YA 2FV8A 2PZEA 1T91A 4EFLA 4JLNA 2IS6A 4FCVA 2J45A 4ZPXA 2YVUA 3VR5A 2RGAA 1T6NA 4LBZA 4LK2A 2KE5A 1RRGA 2IEYA 1AM4D 4BPBA 2IYYA 3FKSA 1W0JA 2NO6A 2V54A 4DT1A 2OCBA 4OI2A 2XNDA 1JR6A 1P62B 1XWIA 4UKDA 1GKIA 4US2R 5FTJA 5L3RA 3RRYA 2B7CA 1FOEB 1N6KA 1D8TA 4JLVA 3I5YA 4AD8A 3E2IA 1L7VC 2VTKA 3SJAA 5FOTA 1P3JA 4DHEA 1P9RA 1OF1A 4M1WA 1OKKA 4AKGA 2DFLA 1Z63A 2Y8EA 4KSCA 3U3OA 1NP6A 3SC3A 2XB4A 4XVRA 3DL0A 3NHAA 2P0EA 2I1VB 5AJXA 4DSTA 2IYSA 4G5RA 1UKVY 1A2KC 2QUZA 2EFHB 4V03A 2GCOA 4D4MA 2YV5A 3KKOA 4AKIA 4TZ0A 1D5CA 1OFHA 2XZPA 3K53A 4W5WA 1KHTA 4E07A 3KJIA 2QAGA 3I5XA 1G5TA 3SYKA 4RZUA 2J3EA 3D8BA 5EP2A 5F98A 3IKJA 3NEJA 3PUVA 1M7GA 5GJBA 4Q4JA 2OHFA 4B76A 4DB2A 2EFGA 4QBFA 3A1VA 4HLCA 4MQBA 1R5NA 2OXRA 2ZJ5A 3OIUA 2J59A 3UG6A 5L3QA 1ZC3A 5E7JA 1WBDA 1MOZA 4PQYA 2P5SA 3LFUA 4PC6A 1O3YA 4PC7A 2BBTA 4DEXA 4PR0A 4IVRA 4ERNA 2A78A 1NLFA 3BB4A 3W8RA 2GEVA 1GRRA 4XIGS 1GTVA 1NSFA 2RGCA 3GEHA 3NDBB 4C2UA 4BFTA 3K9HA 1NLYA 5FI0B 1F3OA 3B5JA 1I4DD 2PEYA 2W2VA 4M53A 2IWRA 4LJ7A 2ONKA 2KSQA 2V9PA 5IDVA 1VYUA 1M8PA 1MT0A 1QHIA 3IEVA 1XJQA 5B2ZA 1E98A 1VG9B 4FCWA 4URWR 4BFXA 3M1IA 1U98A 1CP2A 1XMSA 2C99A 3WYAA 3QKSA 5KOYA 1UJ2A 3ZJYA 3A1TA 1H8ED 1DAEA 1M6NA 1G6HA 1ZNYA 2PCLA 3CX6A 3ND9A 5KPDA 3B1ZA 1XEFA 2FH5B 2ZPTX 1GL7A 2WVJA 1E2EA 4TSFA 2ZUCA 3GP8A 3CZPA 3MUFA 1NF3A 1NKSA 4RFSB 1OJLA 2KBFA 3A58B 1EESA 1LW7A 1WQ1R 2WIBA 3CRRA 3QPWA 4ZDIA 1ZD1A 2IYUA 4K46A 3IO5A 3KZ1E 2D2EA 3L0IB 4LCBA 2BJVA 3CPHA 4PQRA 3AGQA 4B48A 3FTQA 3GLHB 2ZJOA 1HV8A 3LLUA 1D2NA 5CDFA 4C30A 5KYKA 4PPNA 1R0ZA 3T34A 5SZIA 2H5EA 2I1QA 4X8HA 3H2YA 5FUWA 4M2LA 3RWMB 5JWOA 2WIAA 1Q3HA 2IX3A 3B1YA 3DOFA 4OYHA 2GJKA 1JR3A 2P3SA 3HU1A 4LV8B 3RS7A 1KY2A 1DADA 4HI0E 4D6PA 4PO8A 2W6IA 4EPWA 3R7WB 1U9IC 1VG0B 1ZINA 4OQLA 5EE5B 5LD2C 4QNMA 5B57C 2GXQA 1RYHA 1Z6YA 2BVNA 2XNSA 4MKFA 4GMXA 5H68A 2ZETA 4NKRA 4D26A 1W0KD 2IXFA 3OF5A 1XB2A 3AEZA 2OBNA 3LXRA 2V8OA 1E32A 1QHHA 2O8EA 4DKXA 4IXMA 4RD4A 3SNHA 4MUBA 1VDZA 1DOAA 4F7WA 1UBEA 3QF7A 4FCTA 2AL7A 4B75A 1R6BX 1RJ9B 4DDWA 3OFNA 1SXJD 3CO5A 3VAAA 4OI4A 1FUUA 4TQAA 3FWYA 5G53C 2PMDA 4MRSA 1E9FA 3O8BA 4MGZR 2LKCA 1G3UA 3ZYCA 2XAUA 1FP7A 1D2MA 4OHXA 4BE7B 2P2LA 2ZRAA 1TQ4A 3LDAA 1R10A 4H1UA 4UJ5A 1IAQA 3AP1A 1J8YF 5EZ5A 4ACBA 2EYQA 5HCNA 3I8XA 2PJRA 1S1MA 1HQCA 2AWOA 4YDHB 5DH9A 5TY0A 1GL6A 1P75A 3A1UA 4C0JA 1OH5A 3B85A 1QG2A 3BIFA 1F6BA 1HTWA 1EXMA 2VBCA 4TSFD 3ZLJA 2ZI4A 3G0HA 2J41A 1VCIA 4HUQB 1SVIA 3R9WA 3RC3A 2QAGC 2JIZA 3WHLA 5DYGA 5FBQB 3CF0A 5JECA 4IXNA 1P2VA 4Q1FA 3REFA 4R2IA 1Z6AA 3NDPA 4Q7MB 2FPLA 3SBDA 5CIWA 2Q3FA 4PC2A 5BXQC 2FU5C 4I99A 2JJ2A 4A36A 3VR1A 1S3SA 2GCOB 3I4LA 3PEUA 2CXXA 4K81B 4JBWA 3ZVLA 3J81k 2RGNC 5CIQA 4C2TA 4HAYA 4IHQA 1CRQA 1E0JA 1XXHA 2IYZA 2MMGA 3LH5A 4KI0A 4ON9A 4M9ZA 4MDEA 2FSGA 2ZJAA 4JS0A 4ABYA 4QRHA 3DM5A 1KAOA 3TAUA 1JR3E 4R71A 2OUKA 2C77A 2GBLC 1M74A 1ZM7A 3PFIA 4JSTA 2GJSA 5KUTA 2ZR9A 3AF2A 3I62A 1KDTA 4I1OA 3GJ3A 2IF2A 2EFDB 1J2JA 1LS1A 3EASA 2DFKB 4EJSC 5JRJA 2WPDD 4EPRA 4PHGA 3CW2A 2BBWA 5K8TA 1K6MA 3KUCA 4LDJA 2O0JA 3CR8A 2WJJA 3FB4A 1N5JA 3FHOA 3FMIA 3M0EA 5EE1A 3C4JA 3SN6A 4DDTA 3K70D 2WTUA 2QM8A 3MWJA 4QGFA 2GTPA 4BLTA 3P32A 3A8TA 4CEJA 4HDQB 3LY5A 4V0KA 3RC8A 2IL1A 4GNKA 1UM8A 4KODA 2ZXUA 3BGWA 3AM1A 1NY6A 1XCPA 1IN4A 1AIPA 4JSYA 4TL6A 1B23P 4C0KA 4X8LA 1TUIA 1XCMA 2OSBA 1TX4B 1XTQA 2V4ZA 421PA 4QM6A 1T3HA 5TVKA 1RIFA 3CX7A 1GWNA 1W46A 3D6TB 4A0GA 4D0LB 3BBPA 4IOMA 3ZS8A 1MO6A 2ZSAA 4R2HA 4JBYA 3WHKA 5EP3A 1IJEA 1E2HA 1Z08A 2W2XA 4JVLA 4ZV4A 3X2SA 1W36B 4I1SA 4M1YA 4B44A 1W4BA 4KO8A 1KO1A 4NYMQ 2D74A 2CDNA 3QKTA 4KVAA 5FL7D 3EG5A 3EIEA 1XTRA 4UNSA 3CNLA 3KKMA 1JQJC 3P4XA 3KX2A 3UMRA 4IEEA 1N5LA 3GJ4A 3HYRA 1HH4A 5JEEA 4QJ3A 1EGAA 1COWD 3F3YA 3AVYA 2W83A 4P4TA 1S1CA 4JZKA 2OXCA 1GFIA 2ZS7A 1KK3A 1ZIOA 3HU2A 1VECA 2JIZD 1UEJA 3KL4A 4A0RA 1UKYA 2G6BA 4B71A 2ZYUX 4GPTA 4HSEA 1UKZA 4IDQA 4MRRA 1OYYA 5FPTA 821PA 1JEDA 2PZGA 1LVGA 4C4PA 4CT5A 1HURA 2BKEA 4QGHA 1R8QA 2UZIR 1SVWA 1J90A 5HE9A 3TE6A 5JMTA 4LHZA 1CXZA 2JJ2D 3BH7A 3IIMA 2HCBA 5HZHA 3UATA 3U7FB 2REXB 3AUXA 4CIDA 2OLKA 1EFUA 4EJSA 4WZ6A 3VU9A 1FZQA 4CEJB 2Q9BA 1OB5A 2YJTD 4QGAA 2WJHA 721PA 4LPKA 3DMNA 1X8JA 2R62A 2MMCA 2YWFA 3MRSA 4GSYA 2KI5A 2A7QA 1GILA 1XEWY 3AUYA 3QXXA 1G5RA 4EDHA 3GLIE 3X1YA 1W5SA 1KO7A 3Q5EA 1MABB 3JZMA 2YYZA 4LZZA 1NN5A 2GAOA 4JVSB 3I3SR 1XD9A 1E2FA 2J0UA 4IOLA 3R9IA 4NONA 5TXGA 2ZYTX 2QG6A 3NBFA 3QIAA 2OCYC 2ZVQX 4XSHA 1HY3A 5EXTA 1GVNB 3LQQA 3ZZUA 2J0QA 3PV0A 5GJWC 4IVQA 4TYNA 5JJIA 1WCV1 4F92B 4PZZA 3AVWA 1XNJA 2VSOA 5E7MA 5CITA 3P20A 1UPTA 2CBZA 4LHWA 5UKDA 5FPHA 1H8HD 2HDNB 2KJQA 1KMHA 3NH9A 1IY1A 3FHTA 5HCIA 2CHGA 4P4UA 4HZUB 2VHJA 2RMKA 1Q1QA 1ZUNB 2JLQA 4AKHA 2ATXA 3A4LA 4RD3A 2GILA 4TWZA 1QRAA 1UADA 2E9SA 4AWXA 1E2LA 3AF3A 3KDSE 4UNNA 1QVRA 4EQ6B 4LX0A 2JDIA 5JWRA 3KB2A 5DYIA 4A92A 3ICEA 1ZAKA 2OAP1 5BW8A 4TMXA 1OB2A 4MDFA 3RRMA 3C8UA 3GJ0A 1RW4A 4OHWA 4PHTA 1RPZA 5GVRA 3G5UA 5JHGB 4W5JA 3QQ5A 4PSAA 2WJIA 3DZ8A 3IILA 2R6CA 3LWNA 4Q9LA 2JLSA 1VMAA 1Y63A 3THXB 4V0ME 1C1YA 1D9ZA 3U44B 1II8B 4K8OA 4TZ6A 4JLOA 3AKCA 3RLFA 3TUJC 2VO1A 4OQXA 3CF6R 4TN1A 2W00A 3REGA 2GWHA 4Z54A 1WB9A 1G8GA 3VHXA 5JSZA 5L8VA 3B6EA 2GJ8A 1UDWA 2WJVA 1SQ5A 2C5LA 2IYVA 3PENA 2Z0MA 3PCRB 2IYLD 1CJKC 3HWSA 2ZSEA 3CNNA 2GETA 3AH8A 2VP4A 3UK6A 2PMKA 4W5HA 2K5UA 3TVTA 2QQEA 2JLZA 2GEDA 3U6KA 2ZI7A 1NMYA 4BWYA 3UMFA 4Z1MA 1NN1A 3NBZC 4XD7D 3VFDA 3PUZA 1A4RA 1AS3A 3BOSA 3VR2A 4CVNA 4DSNA 2GKSA 1GRQA 4TTQA 5D3MB 1Q1EA 5CB8A 4BLSA 4ESHA 5J4HA 2BCGY 1XTSA 2GZDA 1I2DA 3SR0A 4PSVA 3GLHA 4DCNA 2F9MA 1M2OB 1N6LA 5J4KA 4V0MA 4X8MA 4XOIA 5EZ6B 3BRWD 5JI3E 3OHMA 1CRPA 1C9KA 2O8CA 3CPJB 3U7HB 2ZYWX 4TLCA 3L0PA 2QSYA 3W3AA 1ZD8A 1NMZA 4HLUA 2A9KA 1EFRA 1CLUA 3KFXA 4CEHB 4C7OA 1E94E 3QF4A 3CR7A 4MGYR 1KNXA 3RS3A 1IN7A 1UEIA 4GI7A 3GEIA 2Z4RA 4QOSA 3K0AB 3MG9A 1DBSA 3BD9A 4FMCF 3EWSA 4YMSA 4DCSA 1U8ZA 4I81A 2JDID 2R8RA 3MMPA 4ZDJA 5DN6D 3KJHA 5JFGA 5C2JB 1XF9A 2SHKA 5HKKD 4QBGB 3VMFA 1P60A 1CIPA 1GOTA 2WZQA 3CNOA 3UWOA 2ZJBA 2IXEA 3OIVA 5FBVB 3Q8XB 2ZIAA 2ZRLA 4Q4HB 1I4LD 1E9BA 1JB1A 1JR3D 3PITA 2WM9B 1HE8B 4OJQA 1U0LA 4KFSA 5DE3A 3PUXA 3WRXC 4HLDA 2C04A 5SZKB 5SZJA 4IFBA 5BWMA 3BK7A 2FSHA 2J0UB 4FXPA 4OJKA 2QU8A 1LV7A 1NMXA 5KSYA 1XTKA 3DO6A 4AK9A 4DBLC 1IM2A 4NZYA 4GT1A 1DPFA 3M4YA 1VYTA 3A4NA 4V0LA 1KYIA 4L16A 1W0KA 1FL9A 3MLEA 4MYUA 4RSGA 4DLZA 3T06B 1G20E 4KBGA 5FL3A 1OSNA 3KKPA 4GP7A 4JKYA 1KNQA 1LB1B 2GK7A 4XSGA 1DAMA 4P4SB 4QHSA 4XH9B 1DAGA 4WAUA 1P9NA 3TQFA 4BFVA 1KJYA 2QENA 5FPSA 2V6JA 3SI7A 3GLIB 4QXAA 3W6OA 1IN5A 4XD7A 2G0TA 2REOA 5J47A 2ASEA 3OEED 3I73A 2A5FA 4IDHA 4DEYA 1XPOA 3EA0A 2BBSA 4WA7A 3EPHA 5G3YA 1GDDA 2OZEA 4NMMA 1G3MA 3Q72A 1X86B 1Q1ZA 1OXTA 2YINC 4KU4A 4RD2A 4DRZA 1SHZA 1AZTA 3R20A 3S1AB 2D2FA 2GJ9A 1YR6A 5CYPA 3SS8A 1Z0DA 3WMEA 2N42A 1NLZA 4FD2A 4B74A 1GZSA 2GDJA 3GCGA 3ONWA 4GOJA 4ZIRA 2DCUA 1XDBA 1ZUIA 4RY2A 1COWA 1ZBDA 1T5LA 4JJKA 4TT3D 2C78A 4HAWA 4R7ZA 2WWIA 3AVPA 3K09C 3TRFA 4AYXA 2G0NA 2QN6A 2R6FA 1AKEA 2WSMA 1DVRA 4H9GA 1EWQA 2RH5A 3PUYA 3QXJA 3IIJA 5J5CA 2CHVA 4Q4AA 1N6RA 4WXRA 1F48A 1G7CA 3H4MA 1IOZA 1GNRA 4DLTA 1N6IA 1D9XA 3GLFA 2D06A 3GFOA 4RFVA 4QHYA 4UXHA 4URUR 3T1TA 3BERA 1O87A 2NTYC 1P61B 1E9AA 4M8NE 5A4JA 1NVUQ 1IONA 5GJCA 4DLWA 5L3SA 4YLGA 3LNCA 3H0KA 4TLBA 1RYFA 1WE2A 2UZ3A 4P3YA 4BLRA 2Z6VA 5IF9A 2HJVA 3K1JA 5FOXA 3PUWA 2ZE7A 2PCJA 1HQYE 2IYRA 3L8YA 4RJLA 2FEMA 5AUQA 5CK4A 2ZR7A 2RGBA 3NHBA 2B8TA 4M9SA 2FMXA 5DNYB 3BS4A 4RZ2A 3SU8A 3BH0A 3S1AA 2W0MA 4MKHA 3DOEA 2IT1A 4DUGD 4PZLA 1K8RA 3D3QA 2BM0A 5FPKA 3R8FA 1YVDA 1VYVA 4LYHA 5ELXA 4IKEA 4V0NA 5BN3A 4D25A 2NGRA 3O8CA 5JEDA 3N70A 1P5ZB 1WP9A 3GLGA 3ICQB 2AHOA 2OO7A 3DMDA 4CDGA 2J7PD 1T8UA 4JIMA 1JJ7A 2DYKA 2XJ9A 4HLQB 5FPYA 1VG8A 2HXYA 4TTRA 3UPUA 3NIBA 4Z8YA 2BEKA 4KVGA 2QZ4A 4FMDB 4O3MA 2AX4A 1KSHA 2V7QA 1ZIPA 1V43A 2XTZA 3LBHA 1VHTA 2WICA 1IN6A 5AJWA 1W7AA 4BGDA 3I1FA 3CWQA 1IY2A 2XXAB 1R5BA 2Z4SA 4Q9JA 1AGPA 3QI2A 1KSFX 2QAGB 4L5BA 3SHWA 1U9IA 2ZTSA 3CH5A 2O8EB 4WOPA 4BZPA 3W90A 2WWFA 3OZXA 3AF1A 1U0JA 5FOSA 4Q66C 4ZCMA 4KAXA 1HT1E 1Z0IA 1X1SA 5BYKA 2O0HA 2NMVA 3ZIAD 1GNQA 5FTLA 3CBQA 3Q9LA 3NC0C 2JJ1D 4KYUA 1E6CA 1FPMA 3TLXA 1Z83A 2O0KA 3W34A 3M6AA 4G3XA 4PSKA 4UXJA 3TK1A 3VR4A 1HUQA 2D62A 1PLKA 4CGZA 2O8BA 3KUDA 1SVLA 2CVHA 5EXXA 1AKYA 4YMWA 4TYWA 1D2EA 3SBEA 3IQXA 4NYJQ 3V00A 2BDTA 5KNBA 4A6PA 4HUTA 1SXJC 1HT2E 1VTKA 1CKEA 1AK2A 5L3SB 2BMDA 2QPOA 2F43A 1XCGB 1Q57A 3QOFA 3MGCA 4PXAA 5IT5A 1JAHA 4Q7KA 4A0FA 4DT1B 1ZNWA 5BN4A 3U3KA 4BFSA 3KQUA 1Z3IX 2BIFA 3U60B 2L0XA 1KJZA 1LF0A 2WAXA 1UKEA 1SVMA 1F2TB 3CRVA 1PLJA 3L8ZA 4N0DA 5EP4A 2FF7A 2G9NA 4CYMA 3O8RA 3KJGA 3ZD7A 2BHRA 1BS1A 4RKFA 3U3RA 2J0SA 3BFXA 2XX3A 4O2LA 3I32A 4AC9A 3SJBA 4TL7A 1W2HA 2GBLA 4ASUD 4BUJA 2HJGA 2VQSA 4RFSA 2XOKA 3C5HA 3GJ8A 2ORVA 1KDRA 5CJ2A 3N2IA 4B43A 4QHTA 4LJYA 3SFVA 1ZCBA 1BMFA 3C15C 2YC4C 4HDOB 4WZAE 2FFBA 4PAOA 5JS8A 1N3BA 4Q5IA 2D4HA 1G18A 4HLUC 2G88A 4O2RA 3G82C 3K0CC 3U4QA 2WKRA 3AVQA 3QKSB 1SVOA 2RHDA 2WOOA 2FPMA 2WJGA 4POAA 3X1DA 4ILEA 4RVCA 2MSEB 1EX7A 2G77B 4JT2A 1Z0KA 2QL6A 1G19A 2ZSBA 3IEUA 1ZP6A 3L43A 5DI3B 5LDDC 4LC0A 2ANCA 4FMDF 2PEZA 3VNVA 4AKEA 1ZU5A 4I1VA 1NL3A 2CE7A 2W58A 4D4JA 3VR3A 1TL7C 2XB2A 4YXWD 1ODFA 4JT4A 1XTIA 1KDPA 5EXSA 4KV9A 4KITB 5K8UA 1E9SA 4NCIA 1OIVA 3BE4A 1OIWA 3QY0A 4HB3A 5DISB 4XWOA 5JSZB 1E2DA 1PUIA 2JJ1A 1QHHB 3NKVA 1EG7A 2VIIA 4MRVA 4UXIA 1W36C 5JHHB 4A8JA 4EKDA 3PEWA 1DS6A 1Z07A 2QE7D 4B34A 5IK2D 4KXFB 4JLMA 2G3YA 5JRZA 1YQTA 1G8YA 4Z1MD 2IYWA 3AVOA 3AKYA 5FBLB 1J8MF 4D0GA 2O8DA 2R65A 2I3BA 4B73A 3LV8A 2J0VA 1ESNA 3AKEA 4PAQA 3WRYC 4KSBA 2YC2C 3WNDA 4YMUA 5CK5A 2H18A 3B13B 5DI3A 3ZQ6A 2JAQA 2EFEB 2V1UA 1R0XA 1CJMA 3GJ5A 1DTSA 4QGGA 5AJVB 3O8DA 3WMFA 1Z28A 4QBHA 3A37A 1SVSA 5F9FA 1TEVA 2B6HA 4TTPA 5JWHA 2NO9A 2EQBA 3N2EA 3THOA 3OEHD 4S2EA 1E4VA 1KSGA 4LV6A 2FOLA 3Q85A 2XNDD 2GEUA 4EFMA 2IA5A 1UBCA 4TL9A 1MO5A 1A7JA 2C95A 2CMKA 2FX3A 3ZQJA 1G7RA 2VA8A 4JVMA 1CJVC 1G6OA 2ZRHA 1LTQA 3EC2A 1CR1A 4JJZA 3RNLA 2F1JA 2X2EA 2VP9A 4TQ9A 4KLNA 3QSYA 2NO7A 3KXKA 2A5DA 4R9UC 3T5GA 1FMJA 4PHFA 2NPFA 2H17A 4ZKEA 2QRNA 1QBKC 4HB4A 1YZTA 2EFCB 1E2PA 2QP3A 4ZI3A 3PXGA 2RGDA 4FWTA 3K9GA 521PA 4HATA 4IDPA 4H1VA 1FQJA 2JA1A 3T15A 5FFMA 3E1SA 1UFQA 1YZGA 3AF0A 4Y0VA 1N0VC 2EWVA 1CS4C 1ZYUA 3IBGA 1UBGA 3EXAA 4FMBB 1N2CE 2AK3A 3D31A 4DB4A 1SZPA 2A2ZA 5IRCD 2HXSA 3QENA 1XEXB 5B58C 3B1WA 1TU3A 3VTKA 1R5OA 2A3RA 3IGFA 2ORWA 2IYQA 1Q22A 3C14C 3LW8A 2PX0A 3NXSA 1TQDA 4D0NA 4ZKDA 1GL9B 3GD7A 4M1TA 2D3WA 2D7DA 3THYB 3CIOA 4QKQA 2CVFA 3IUYA 3TAHA 4JVNA 1DARA 4V02A 4LI0A 4Z8XA 3EZ7A 1E9CA 4MGKR 1OH7A 2HEIA 2I4IA 4LJ8A 2VPPA 1EWRA 1KI2A 3DHWC 4P0TA 4A9AA 2GHIA 1II0A 3B8HA 4HB2A 3RS0A 1YKSA 1KKLA 2PL3A 4Q19A 3NVAA 1Z22A 3PG5A 2HLDA 1VIYA 2PLRA 4ZIRB 3WBKA 2DHRA 3HJNA 4XTRA 1A5TA 3WXMA 3GLIA 1Z6GA 5JI2E 4S35A 4Q9KA 5K8LA 4NL4H 5P21A 5CM8B 4BEBA 5FTKA 4YONB 4AYTA 1E2GA 1L2TA 3UANA 2F1RA 2EWWA 1FQKA 1ZCAA 2YZ2A 2FSFA 3GPLA 2DFNA 4DCTA 1OV4A 3SE0A 3SYLA 2ZSDA 5G3ZA 2O8FA 2BMJA 2FSIA 4Q4LA 2DR3A 2HUPA 2GRJA 2ZE6A 1E79A 2HF8A 3O47A 5A0FA 1TQ2A 1XMIA 3ND8A 4Q02A 5F3WB 4BZQA 2CEAA 1VCOA 1DELA 1G16A 2JLUA 2WOJA 3FHCB 4DJTA 1LY1A 2REBA 3NBXX 3HP1A 3U4QB 5KDLA 4PANA 3KFVA 4Q4HA 2WV9A 3A4MA 5F2EA 4IOKA 4Q1BA 3TW4A 2IS4A 2IS1A 5AUNB 4KLZA 3A1WA 4ZDKA 1YZQA 3IIKA 5FR2A 2ZEJA 5JZVA 4WIAA 5CLQA 4BRWA 3GLGB 2ZRPA 1BO6A 3RAPR 4FMCB 2FZ4A 2G1JA 4DIEA 1NNEA 3Q5DA 1VKJA 3LXXA 4QM7A 5K8IA 1XPRA 3C7KA 1IQPA 4BEJA 4NCNA 2B7BA 2ZUBA 1KI6B 2NZJA 3IHLA 4OQMA 3ASZA 2EW1A 3LLMA 1T0HB 4Q9HA 3ZIAA 1DO2A 1JXMA 2CCJA 1GAJA 2ZREA 1JI0A 3Q7PA 3BB1A 5KNCA 3BFKA 1DAKA 2QGNA 5LBIA 2QMHA 1M34E 2OEPA 2ZI9A 2W0SA 3ZVRA 2LCFA 2ZRBA 3PQCA 4EJSB 3KQKA 3K0AA 4JKIA 1QHXA 2CL7X 5C18A 3BB3A 2YOHA 2FNAA 4P33A 5CM9C 2ONJA 3A1SA 3OEEA 1GP2A 4LJ6A 1Z8FA 3FMOB 2MSDB 3KXLA 3QEJA 5J4LA 2GAAA 4GDFA 2JLVA 1W1WA 2GXSA 2Q21A 1E4YA 1XJCA 2CNWD 2WKPA 3JVVA 4MH0R 3TUZC 2ZJ2A 2VLIA 4XWAA 2DBYA 2IUTA 2VEDA 4CEIB 3GMTA 1Z2CA 2AFIE 3VKGA 4O25A 2VHCA 2FFAA 3LW7A 4P4SA 2GJAA 2VP0A 1XXHE 1GKUB 3W9YA 1JECA 3FKSD 4DIDA 3ZZTA 3FDIA 1QZXA 4LYJA 2LWIA 2WMOB 4B33A 5TV2A 4LYFA 4Q9IA 1U0HC 2VHQA 2ZAOA 1E2KA 3QEOA 4YQFA 2ZRKA 2GCPA 4ZI2A 1QG4A 2F9LA 2ZAMA 4LSGA 1OH6A 1XTJA 2ZANA 3SEAA 1II8A 4RKEA 4OQFA 4PX9A 4FIDA 1IN8A 2YWGA 1E2QA 3ECCA 2ZI6A 4B3GA 1DE0A 2R6GA 3WNCA 4M1SA 2DWPA 1NKTA 4NPHA 4G0NA 2NG1A 4F93B 2C96A 2VSXA 3KJEA 2FWRA 3A36A 1G7SA 2CE2X 5EJEA 3V4RA 1QHYA 1YE8A 4LBVA 1YR9A 3PIRA 3GJ7A 2QTHA 2GVZC 3IQWA 1CJTC 3EC1A 1XEXA 3GQBA 1KO4A 4PPQA 1T3LA 4MUAA 1E1QD 1N5IA 5AR1A 3KQNA 4KBFA 3THYA 4UNQA 4IDNA 4I1UA 2ZRDA 4HEJA 2XZOA 1OT3A 4IDOA 3QPVA 1GRNA 1YU9A 4AIIA 3KQLA 3FOZA 2WPDA 2ZRCA 2GF9A 4BFYA 5DHAA 2HCJB 2QMEA 2HYDA 1KI4A 2QAJA 1E2IA 1KTVA 2GESA 2QE7A 3AKDA 4PO9A 1Z06A 5LB2A 2FA9A 1G291 3T61A 1MO4A 1DG1G 1UF9A 3B60A 1OHHA 4PTLA 4V0OA 4B6FA 1NI3A 4DCUA 4Q1CA 1OFUX 4CEHA 4KHZA 1YHNA 2DY1A 1Q21A 4II7A 4HUQA 4TLEA 5AWFC 3AVTA 2ZE8A 4PPFA 1N6HA 4JYBA 4MRPA 1F2UA 2HF9A 1EFCA 1S3GA 3FMFA 2ECKA 2O8DB 3AGPA 3VKHA 2JATA 3C5CA 3NEYA 3Q7QA 3VU9B 5JCZA 3BAFA 221PA 1BH2A 2P6RA 4GFDA 2BM1A 5TMPA 4Q1DA 1CEEA 1PJRA 4M9XA 4OHVA 4BZXA 1TU4A 3P26A 4BECA 2BV3A 1X8KA 1ZW6A 2ERXA 2J9RA 1T3SA 4RD0A 1TEXA 5FUXA 4YMTA 3GLGE 2ZJZA 3QVVA 4A15A 4TYQA 4LV5B 3X1XA 1BKDR 1JAIA 4C0SA 4XJXA 4XVUA 5J40A 2X19A 3RABA 1ZD9A 1ZNZA 3IDQA 3NG1A 2C03A 1KSJA 1GM5A 1XFAA 1ZM2A 5AUPB 4ESVA 1SULA 4TL8A 3AP3A 3K09A 3OIWA 1JJVA 1D6JA 4TMWA 1E9DA 3TNFA 3AVXA 1WMSA 1F5NA 4WVFA 3U3JA 5FOWA 2DFTA 3GLFE 2QPTA 1U8YA 1GNPA 2DWQA 2GZAA 5CYOA 4YXWA 1QVAA 2ZUDA 1R2QA 1RE0A 4JLPA 5FBWB 6Q21A 3EZ2A 2CLDX 2IYXA 3ZDQA 1MRNA 4QJ5A 3NTUA 1N0UA 4LUCA 4OBEA 1B0UA 4ACAA 2OBLA 2P6UA 4W9MC 1G8FA 4LC1A 4D80A 4NH0A 1P2UA 4DLSA 4F91B 2IW3A 1CU1A 1KK2A 3FPAA 3DZDA 1RFLA 3FMPB 4PQFA 4BRUA 1OH8A 4U5XA 5KNDA 3RHFA 2BMFA 4C3ZA 1W44A 1XD2A 2R9VA 3JZAA 5HTKA 4D82A 1XMVA 1NN3A 2IF0A 1E1RA 1MH1A 2X8AA 1Z6TA 4F4CA 1E3MA 1NVVQ 1TF5A 4BLOA 4Z51A 1YJ5A 1U99A 3RDPA 4PC3A 4NYJR 1NY5A 4M1OA 3SOPA 1GKYA 4P31A 3U44A 2CCKA 2QBYA 1A82A 4B2IA 1H8HA 2FFQA 4O0MA 4A1FA 5A5GA 3THWA 4WZBE 3T1OA 1OHHD 1HYQA 2QTFA 4DSOA 1FW6A 5BN5A 1OYWA 4EFNA 2V1XA 4QFMA 2Q9CA 5TDHA 1YZKA 4FI3C 3L0OA 2XTMA 2GA8A 3K9NA 2OCAA 3T12A 2D7CA 1KY3A 2JGNA 3AP2A 1KOFA 3LBIA 3MJHA 4JLKA 4TQUS 1LF5A 1NG1A 3TSWA 2HYIC 2WAYA 2XITA 2OE2A 3AF4A 1Z0FA 2J46A 3QXSA 3Q3JB 3VHLB 3QXHA 3MCAA 1U94A 2FPKA 1OPXA 2GF0A 4F38A 4JYCA 4FINA 4EUNA 3BORA 5CJPA 4OHZA 3ADDA 3ETLA 3E70C 5F9HA 3PR1A 1YZLA 2X77A 4AYWA 4KFTA 1FMLA 3AB3A 1NRJB 4LWZA 1JPNA 4NDZA 4DC9A 4U02A 2AFHE 2H8KA 1AJEA 1T0JB 3KTAB 3DEFA 3ADCA 1TF2A 2C9YA 1H65A 3QG1A 1M7HA 4CT4B 3SHFA 4PO1A 3A6PC 4PFSA 1R0WA 2RGEA 3LO5A 3WNBA 1MR3F 2F6RA 2IK8A 3UWKA 3U6BA 4IW3B 4TLDA 2VRWA 5L3QB 3TR5A 2ZSFA 2F55A 2OFOA 3TR0A 1AZSC 1L8QA 2G1KA 5KDOA 3OE7D 1US8B 2DPXA 4M1KA 2B21A 4Q18A 1VPLA 3WYFA 5AUOB 2WJYA 3W5IA 2QORA 2AKYA 1AS0A 1G64A 2ATVA 3MWKA 1NBME 3RANA 3T35A 3CZQA 1NJGA 5FUYA 1E0AA 4RD1A 4TYPA 2B8WA 3TGPA 4CW7A 3EA5A 2YKGA 3KKNA 4B3DA 3RYTC 2E87A 4BQSA 2RHMA 1E1RD 5LB4A 5M04A 1Y3AA 3AVVA 4Q1EA 1VCNA 3HYTA 1ZM4A 3QE0A 3RSLA 3K0EA 1G41A 3NH6A 2ZITA 5G40A 3EARA 4TMTA 1SVKA 2RCNA 5CB6A 2A5YB 5C4MA 3KTAA 5L3VA 2VP5A 3OFND 3W5JA 1EFTA 2Z43A 2NO0A 4M4SA 4KJZA 4MRNA 3AQ4A 2V3CC 1TNDA 1U8AA 3MWLA 3R7WA 3KQHA 2Q3MA 3LRPA 1ZNXA 4Q7JB 3I92A 4NU0A 4E03A 2ORIA 2YHSA 4NYIQ 1W49A 1IY0A 3B1VA 3MWYW 2O52A 1XU4A 1XBTA 2YOFA 3LA6A 1OFTA 2ZJ8A 2VYFA 4B3BA 1YR8A 4URYR 4Q00A 2C2HA 2GCNA 1XEWX 4NYIR 2NO1A 4AY2A 1N6NA 2PBRA 1W5TA 2OM2A 4URZR 1X8LA 4DWJA 2TMKA 2XTNA 3SZRA 4LGMA 2GXAA 3TKLA 2QI9C 3IPXA 3RWOA 1P6XA 4MYHA 5BQ5A 3E5HA 1GSIA 2WBLC 4NP6A 2J7KA 1FNNA 3WY9A 4F4IA 4G5GA 4WXPA 3TMKA 4EPXA 3WYGA 3U7EB 3GLFB 5EXPA 1E69A 2FE4A 4JL8A 1E2JA 1ZUHA 4Q47A 2OT3B 1S0UA 1T5IA 1P4SA 4HAZA 2R6AA 1I4TD 3NWJA 2CJWB 4YMVA 4AI6A 2ODNA 1X3SA 1KI8A 2H92A 4UJ3A 2XGJA 1WF3A 4B2PA 2GK6A 5FOUA 2JASA 2ZS9A 3QKRB 3RRZA 2QSZA 3R9XA 1ZM9A 1XD2B 2BKUA 1G8PA 2QM7A 2H1LA 1E1QA 3LD9A 4LYAA 1P7CA 3QF4B 3LVQE 1KGDA 2ZRFA 1T8TA 3MSXA 3BJIC 5CLLA 2CK3D 4LRWA 1BYIA 3F0TA 1ESMA 1OE0A 1W4RA 3DM9B 2W6JD 1CF4A 1OXXK 2OV2A 1KI1A 4Q03A 3TIFA 4IRUB 3SQXA 1N6OA 4G5QA 4AG6A 5EUQB 1KI3A 4B6EA 4QBIA 4ZDWA 4URXR 4NHOA 4RZXA 3OIYA 3OAAD 1Z0AA 1QF9A 4BLPA 4A2QA 1ELOA 4A8JB 1N25A 5IHPA 1G17A 1PUJA 5JJLA 3EPKA 3EZFA 2BC9A 1Q3TA 2AD1A 1RJ9A 4MKIA 4KYIB 3UG7A 1N0WA 2AWNA 2J5XA 4GZLA 3C16C 1FNMA 3ADKA 5EUMA 1NIPA 2G83A 1RRPA 4TYYA 3TVDA 1MO3A 5E95A 3ASYA 4HZUA 3TQCA 2OESA 2R6DA 3KKQA 4JLBA 2QMOA 2XXAA 1VCMA 2CJWA 4LHYA 1IXZA 5ANRB 4N3NA 3H84A 2AR7A 1TF7A 4PZYA 4EQ6A 4M22A 5SZHB 4GOXA 3ZGXA 5KO2A 1TTTA 1MRSA 4LHXA 4D2IA 3F8TA 1RRCA 5G41A 2F43B 4M9QA 3ZD6A 2IEZA 1R7RA 2HT1A 2BJWA 1P72A 1ZMXA 5DO9A 4PHHA 1F2UB 1FP6A 3CB4A 4I4LA 1P9WA 3U2QA 1YRAA 5FH9A 3TSOA 4BASA 2A5JA 2NOAA 4QG7A 1TUEA 2OG2A 3K8YA 2OCPA 621PA 1NBMD 4YDSA 2GZHA 3WP1B 1CJUC 4QL3A 2AXNA 3K9LA 5FR1A 5KU1A 5GJVC 4M0LA 4JLAA 1YR7A 5JBQA 1M7BA 2P67A 1RRFA 1OFIA 1ANKA 2NZ8A 4OI0A 3TSZA 1E9EA 3DPUA 2IWHA 3X1WA 2WWXA 2FZLA 2OAQ1 1NIJA 2NIPA 2WMNB 4PAMA 3DKPA 1OW3B 2W6JA 1N5KA 2LKDA 2EYUA 1IXSB 1RZ3A 2ERYA 2GVDC 3HPQA 3CRMA 2IC5A 4Q4AB 1X6VA 1Q20A 1CR0A 2VHUA 4HDCA 2R44A 4XTCS 3U7GA 1PV4A 3I72A 5E4FA 4IOJA 2C9CA 3OAAA 1G9XA 3EIQA 4LPSA 4A0HA 1QHGA 2C9OA 1NG9A 2V7QD 3TUIC 3EX7C 4JLJA 4Q48A 4LJ9A 3GEEA 4CEIA 4TT3A 2VF7A 1E0SA 2RGGA 2MSCB 2ZVPX 1OKKD 5EE0A 1YZNA 1ETUA 2IBMA 2IHYA 1UBFA 5EP1A 3T1QA 2ZI3A 1VHLA 1SKYE 4ZCIA 1KI9A 2J87A 4LY6A 4EAQA 2ZM5A 1S9DA 5B64A 2J1LA 1R8SA 4W7SA 4DCVA 2B92A 2QROA 2WSSD 1U2RA 4D81A 2OLJA 8OHMA 4Y0AA 2Q0HA 1BOFA 1HE1C 3CPEA 1TADA 1KJWA 2WKQA 3IHWA 3PVSA 2F1HA 4PC1A 3RS4A 3THXA 5KPJA 4JL5A 4LHVA 1AN0A 4A82A 3CUEF 3BC1A 2QP9X 2XJ4A 3WP0A 2ZI5A 2YNMA 1S4QA 1ONBA 3BWDD 4B32A 2EVWX 4G1UC 1KMQA 2NQ2C 4JMPA 3UKDA 4ZCLA 2RB4A 3F5FA 1ZC4A 2H7VA 4M21A 4OKSA 5KHOC 1OXSC 3I61A 3W3ZB 2F7SA 1XZPA 2F1IA 3MJRA 1SGWA 2AN9A 4KCGA 4IVPA 1JPJA 3PJRA 1EFRD 2IHBA 4U7DA 1SXJE 2GNOA 2QPAA 1W36D 1CBUA 1TPZA 4FW9A 4L9SA 3AVUA 3K0SA 1ZM3A 3EPJA 4OQNA 3H1TA 3THWB 3HU3A 2E1RA 2GXUA 4AURA 2N46A 4R98A 3H86A 5C4GB 5DN6A 1FTSA 5C1BA 5HKKA 1BMFD 4TMKA 1KI6A 1DAHA 3PEVA 2N1BA 2AXPA 5DI9A 2UKDA 1EX6A 3SFZA 5HR5A 2HV8A 3QKRA 4KFRA 4B47A 5TARA 5B30A 4HAXA 4NCJA 4DSUA 1E9RA 4BFWA 4GBMA 1A1VA 2JJ8A 4EPTA 1KAGA 1LS6A 1PLLA 5E7IA 1KZGB 4UQOA 1ZU4A 1MKYA 1Z2AA 3BH6A 3U5ZB 1SKQA 4L9WA 4C7OB 1XD8A 1P2SA 2KBEA 4QJ4A 1GITA 4LJ4A 1N6PA 4G01B 3KB1A 4LJ5A 2QTVB 1I2MA 3FE2A 5KSPA 1AS2A 1Q12A 1KK0A 1AQYA 1KKMA 4OL0A 2DB3A 4GP6A 1WA5A 2IYTA 3QBTA 4EPYA 2V55B 4HZIA 3U61B 4E5UA 1ZVQA 2KB0A 5LPNA 5CDFE 2ODWA 4Q4JB 1YZUA 2ZS8A 1E2NA 4CRWB 1CTQA 4GMDA 4NCKA 1F60A 3B7GA 1KK1A 3CRW1 3SYNA 121PA 4Q01A 1XPUA 2AKAB 3QJYA 1QDEA 4OK5A 3NC1C 4RZ3A 3SJCA 1G7TA 1US8A 1S9HA 1TMKA 3RRNA 2WWGA 2XZLA 1XJ0A 4WW0A 1W48A 3LVRE 3ZH9B 2ZU0C 4NYMR 2H57A 3UIEA 1JALA 4XWKA 2FJUA 2V6IA 2XSZA 3LX5A 3VNUA 3QUSA 1Z47A 1T4GA 4HB0A 1XMJA 4NE2A 2VL7A 1G1MA 3IO3A 3C41J 3K0CA 4QC2A 3ZS9A 1PZNA 3P27A 4ARZA 1Z0JA 4B35A 5LD2B 2JLRA 2CK3A 1FX0A 3CH4B 3RSOA 5E3HA 1II9A 4E22A 2R2AA 4Q1AA 2VSFA 3WBJA 5HZKA 2IXGA 2QT0A 4B2LA 5EE3A 2RKOA 1QHNA 2ZRJA 5BYJA 3VX4A 4B3FX 1W4AA 1H8EA 5KTYA 1NN0A 4J0QA 1W0JD 4WBSA 2CL0X 3LX8A 3B78A 2RAPA 3K0FB 2Q9AA 2WWWA 3K70B 3CRQA 3GLHE 3ZVNA 3OEHA 3EAQA 1NVXQ 5C46F 3FGNA
chains in the Genus database with same CATH superfamily
3A06A 1DAIA 2HA6A 1C8BA 1JJAA 2EX0A 2ODEA 4CF7A 2F3TA 2B2CA 1OA0A 2X8LA 3DSRA 3PXUA 1XT6A 2PGOA 3RJ9A 4G36A 2DFPA 3EBOA 3GG2A 2CZGA 2RBGA 4BFUA 1JRLA 4GC9A 2C57A 4L75A 3VZDA 2OCDA 4D44A 4RJKA 2ERCA 3VPDA 4D3YA 5FD8A 1K6EA 3TNDA 2Z6UA 3LBYA 1QR2A 4J0DA 4NFHA 1RLJA 3RS2A 1VE5A 1SBTA 4G5FA 1O0BA 2HLHA 1VRVA 3QG5A 4ZZ0A 2VTVA 5EERA 3BCUA 4RF5A 4U2FA 1H1LB 4Y98A 2QA5A 4OGWA 2FN4A 2NT3A 1NV8A 4L4YA 4DLKA 5CFLA 2YRFA 3FZYA 3O7MA 4JI5B 2O8BB 4CIWA 1BIFA 5AOCA 2ZIVB 3AEQA 4N03A 1MLDA 1P2TA 3MERA 1A8UA 4MVJF 3QXGA 4C06A 2Z5GA 3EEYA 4MCAA 3GDHA 5E8RA 3RVLA 2XEXA 3K1TA 3TO5A 4JL6A 4CKZA 4PN3A 1P2DA 3I58A 1JA1A 2FG5A 1E96A 3TFWA 1F8FA 1P33A 2R1VA 1SOMA 1YRQA 2P6NA 2ZWIA 4KXXA 2IE8A 4OG2A 3PQ2A 4WBNB 3V2GA 2G67A 3QNUA 4MEBA 2F3UA 3FWZA 2BLNA 1USVA 2B2XA 2V9CA 2XCUA 4K6FA 3QLVA 1FNDA 2Z2IA 4GD3Q 2LW7A 2UVQA 2YFHA 3HPRA 1NBMA 2NU6A 5FNVF 5A03A 2OZVA 2XQFA 5ALOA 1Q7EA 2P6OA 1T9KA 4FGUA 1TZJA 4AN0A 5LWQA 4G0WA 2WF9A 4G0XA 1BMTA 4YECA 2Q4DA 3U3XA 1V16A 4HUJA 3W8EA 4E5MA 4EHKA 2PKXA 3NVDA 1XRQA 2A5GA 2VZ9A 1SXJA 1UOOA 4HQ0A 5BSVA 2DOKA 5JCXA 2VJBA 1E7QA 1WVIA 1CULC 4B3XA 2A84A 3B5EA 2YJGA 3P2KA 1ENOA 2ZR8A 1S8NA 1X80B 2NM0A 2XOKD 5BORA 3TH5A 4US0R 1YRBA 1P0PA 3STVA 2J0EA 4AG3A 1OXVA 1JNYA 1QGYA 3MGBA 1FPQA 2PZFA 5ARCA 1PSDA 2ZE5A 3A7EA 4W5NA 2L2QA 2JRLA 4M86A 5FL7A 4N65A 3FVQA 2WT8A 3UB2A 1G4UR 2O5VA 1ITZA 1GU0A 1NXWA 3MINA 4RK4A 5HDBB 4HDKB 1KH1A 2GS9A 2K2WA 3V9PA 4IV5A 2QV0A 4BHTA 1ESDA 3JQBC 2BEJA 4YJ3B 1GUBA 3GFSA 1UWKA 2FGKA 4YAUA 1IZ9A 2IHJA 1GG2A 2PVSA 4WK2B 1E79D 1MNQA 3T4EA 5DOVA 2HRZA 4FFMA 4AWBA 4HX5A 1MIOB 4QJBA 5KQPA 4CDRA 4MGIR 1N2XA 5JSQA 4RWZA 1CCWA 4YC7A 1V1RA 1K0UA 4DDVA 1G98A 1U04A 4Q24A 1AUQA 2ZJ6A 1VLZA 2G40A 2YMMA 4FNAA 2QWXA 2W4QA 4HYYA 3FKQA 2OQVA 2YWEA 2VK4A 3H2GA 5KNBD 2VNHA 3BXZA 4TPKA 4MR8B 1HM5A 2DXIA 4CV2A 3EPLA 2J5KA 1QX3A 1WABA 2C59A 5FUVA 1C30A 1HA3A 1OLXA 1FDRA 2Q7XA 2QP4A 1Z62A 5HE8A 2OBBA 5IT4A 3WOVA 4NARA 4PPGA 4JU8A 2ZRMA 1VIAA 4ZAXA 3ZG6A 1V8ZA 2BFMA 2BEUB 3M6LA 5BY2A 5ECWA 2CDCA 2NPIA 1AGRA 1MV5A 2II6A 2W2NA 4HH1A 5CDUA 3WAGA 3EG9A 2ZVDA 3RSCA 3V1MA 1VM6A 4C6TA 1NM5C 4A4DA 1T8YA 3JQBA 4H2DA 2PR2A 2BBOA 1D07A 4L3OA 1D0VA 2VNAA 1CG6A 2F3SA 3HR7A 3KQPA 4GLOA 2MINB 3GJZA 4GXTA 4PYLA 5A71A 4F2PA 3L79A 3GEGA 4RCYA 3A6JA 4OI1A 4UC0A 3INNA 3LX6A 2BOVA 5JTUA 2QRGA 3VQTA 4XM1A 2G8LA 5C8XA 4J6FA 4A2WA 2HA7A 4I19A 3OI7A 5FLYA 1CJCA 1C1XB 3WQQA 1EGMB 3G6KA 5FBRB 3WLEA 3HCOA 4JBXA 2RH8A 1Z45A 3CJRA 1RTTA 1B8OA 4LTMA 3GAMA 4IIJF 4IR7A 4UBIA 2NTEA 4UNPA 3HCNA 2WM8A 4D4KA 4DDUA 1MFPA 4LJAA 1OGIA 1J2TA 3V7FA 5IWCA 1FX0B 3A3KA 3DEYX 1TMOA 3GQVA 1JBKA 2Q3HA 3FFTA 1GNVA 1RZRD 2Y6VA 4LZOA 1GGMA 3PIIA 1DLJA 3NBKA 5H70A 2CMDA 1URPA 5HPYB 2O8FB 1PT7A 3B9RA 5FB3A 3ZLTA 2WTAA 2H4JA 3WLHA 4RGYA 3FZNA 2H9AA 4J4BA 4X00A 5EOVA 3ZZNA 2PUBA 3GXOA 1A8PA 1BC5A 4NMWA 3SS7X 2ID4A 4QNRA 3AM4A 3TDMA 4R2XA 1LK7A 2NTVA 2QRUA 2QQ0A 3PQ4A 1V8PA 4UHDA 4BP3A 3P9KA 1PG2A 4Y7CA 5AW1A 1AZLA 1G42A 3O2NA 5AJZA 4YPVA 4FN4A 4LBWA 1GPH1 2ANBA 3E22B 4RORA 5JROA 1EFVB 2FX5A 3WJ1A 2JCGA 5C7YA 1ODKA 4NEQA 5JPCA 2NUPB 1ULZA 3NBYC 1RWBA 1NW6A 3E5NA 2LVBA 3ZWOA 4F7DA 4K9RA 3TR6A 4CV3A 2IHKA 2EF0A 1RVDA 4YJFB 5FO0A 1BHQ1 1D2RA 1E60A 4D4LA 3L82B 1WD7A 5JAQA 4EJFA 1Y7TA 3QYPA 3W6NA 3Q7TA 1ISJA 2XF8A 4GOMD 4V2UA 1R5JA 2PKYX 4HRYA 5JAMA 4RFLA 1B42A 2CY0A 2JLYA 4OFZA 2J9GA 1NTOA 2KWIA 3VO1A 2H1HA 4RVUA 5DIFA 3GI1A 3WR5A 4XIFA 1JEEA 1YDEA 1G3RA 1QP0A 5BNFA 2WE7A 3DDCA 4C05A 4GKJB 3EZ9A 3AK4A 1XAJA 4MOWA 4JA2A 1UODA 2CCGA 3B3JA 3QKUA 2DPGA 4PF1A 3ROQA 3QU7A 4C1NA 5JD6A 2G4LA 1BVUA 2XT9A 1PR5A 2OZLB 3B6JA 5KYGA 4K86A 4Q7LA 4NWIA 3BCSA 4OQ4A 3WIBA 4DSAA 1N7JA 2PKQP 3E7DA 3HHPA 3INGA 3G2NA 4XDYA 1J99A 4AMVA 4RBNA 1A8IA 3OCZA 2OBXA 2IZ1A 2XW6A 3KKLA 3PNKA 4BFZA 1Y80A 2H0RA 4RSHA 2YHIA 3T5BA 3S8EA 1N9KA 3KLBA 4AG5A 4K0KB 4U2CA 2HBZA 3RGWS 4OSEA 4TMZA 3H1PA 2JI9A 2CNWA 3DR3A 2IU0A 1WM1A 3HBLA 3PXXA 3TLJA 1NWHA 3TNJA 3O82A 5MN6A 3KK0A 2FV8A 2AI2A 4EGAA 5LWHA 5K0NA 2PHZA 3Q9UA 3OTHA 5A3QA 4LBZA 1RKUA 1HNWB 3R6WA 3ER8A 2O7SA 3UJDA 5KINB 1RRGA 3ZCVA 3M6MD 3ANXA 2P79A 2NO6A 3RHTA 2JJQA 2V54A 4OI2A 4R1QA 2XNDA 2A14A 1P62B 4FT4A 3ELUA 1XI2A 4REMA 4RV9A 1LWNA 3BULA 2RGUA 3KOMA 4ZYTA 5FADA 3VSBA 1LVHA 4INZA 3RRYA 1EUYA 2B7CA 1D8TA 2OV6A 1QB7A 3KIPA 4Z4FA 1L7VC 2Y3IA 3PGJA 4ZREA 3TIXB 3ZV4A 2L17A 3UAVA 2OZLA 3HLTA 1DI0A 1JDPA 5K4AA 3T7EA 3QELB 5KTOA 1H2RS 4EFDA 1OKKA 1J09A 5KVVA 2DFLA 2QRQA 2Y8EA 3F5MA 1NP6A 3SC3A 1D4AA 3B3FA 4RADA 2P0EA 1ACLA 1CUYA 1ZJZA 2GM5A 2IYSA 2M98A 5DNDA 2QUZA 4QDTA 4WK6A 1YVPA 4B9EA 4OJNA 4V03A 4YRLA 2YV5A 2XYQA 3KHTA 4MTLA 2R6ZA 4YV7A 2JFPA 5BQPA 2AQHA 5H16A 3DR5A 3KJIA 1FVOA 2QAGA 4ENQA 4YX9A 4RZUA 2J3EA 1J1ZA 7MDHA 6LDHA 1EZZA 1A9RA 2DQSA 4F86A 3NEJA 2HKIA 4N3CA 5B4VA 2HK7A 2XGOA 1M7GA 1A5BB 4LRUA 4ZC8A 2XCQA 3LIIA 5GJBA 5K3OA 3SZLA 3SZUA 1RP7A 2DLCX 1GXSA 3RFCA 4DB2A 1OPRA 5KC9A 1W8DA 2P75A 2C4UA 4MQBA 1R5NA 3I9JA 1ZC3A 5E7JA 4MKXA 2W8ZA 2ZBGA 3ZW9A 2D0OB 3ABQB 1UM9A 2ZIGA 4PC7A 5HF9A 3GMSA 2WJ4A 2WDPA 4PR0A 1A0OA 1XZLA 2W2OA 5JSKA 3ZD8A 4BNYA 1X87A 1YD7A 2JCVA 2FAXA 2WTBA 3W8RA 1ZR4A 2GEVA 3DBHB 1GRRA 1SA0A 1X42A 3V4LA 4E08A 3GEHA 4NC9A 3NTOA 3R3VA 1XCJA 1GFSA 1P9OA 4HFMA 4L0MA 5FI0B 2M32A 4I5EA 2QYSA 3GJQA 3C7AA 4B2YA 5EZYB 4ED9A 3WYDA 1I0ZA 4WNAA 5IDVA 1BHJA 1VYUA 2RIPA 1M8PA 3EZYA 1A3CA 4XWKA 3FNIA 1XJQA 4FCWA 1AKTA 5M34A 3K6SB 1O6BA 3M1IA 4CLHA 1CP2A 2BFEB 1DC6A 4YDQA 3MPUA 3Q88A 1UJ2A 4BL5A 1ZNYA 2WNHA 4S1NA 1GQOA 1GL7A 1Z4IA 2WVJA 4DC1A 5TLSA 4TSFA 3GP8A 4H3HB 3MUFA 1GAQA 4UMFA 1DJMA 4FHGA 1RMYA 4RFSB 1OJLA 3SMVA 1DQRA 3F9IA 4RJ2A 1LW7A 3WK7A 2F90A 1ZD1A 3HCRA 2ZYRA 5HQ3A 3BXGA 3IO5A 1HLDA 3KZ1E 1L4KA 5IMSA 4ARCA 1XDSA 1WLSA 1KFJB 3H4TA 4HNQA 2OV8A 1W34A 4RHCA 2PUVA 4W82A 5KAMA 1DC3A 3CPHA 2XE4A 2W37A 3FTQA 2BGJA 5ED4A 4GGMX 3FTEA 1YGYA 3MT7A 4F60A 3AOEA 2EL7A 1D2NA 3EVEA 1E1KA 4WDRA 5KYKA 3EOZA 3JAKB 1CZKA 1V95A 5JV5A 4TSRA 1SD2A 1Z33A 3DD1A 5FUWA 4X7MA 1Y8AA 1TW3A 5DWQA 2WIAA 3F98A 1EGHA 1KZ6A 3C7DB 3B1YA 3DW3X 1N2BA 3QLUC 1BNCA 2QTRA 4ITVA 2P3SA 4FC6A 4TZKA 1QR6A 2QD4A 4RABA 2D1YA 1LLCA 4F4UA 2YHIB 3WVNA 1GTZA 5IVKA 3R7WB 4OQLA 5LD2C 4I9HA 5B57C 1Z5WA 3EBPA 1QYXA 1FLNA 2QUHA 1RYHA 1ND5A 1XNQB 2GHQA 2VUTA 3P9SA 2ZETA 4RDCA 4BIIA 2CZCA 4BXOA 3TPCA 1QGOA 3CLRD 4RK5A 4LGYA 5E6UA 2HF2A 1OU4A 1W0KD 1O5OA 1UJBA 1VHQA 1W5EA 1CUGA 2IXFA 3AHIA 4GWGA 4X1YB 1K5HA 3PPVA 4OHFA 1E32A 4UMEA 1QHHA 4BX3A 1EXDA 4WOCA 2OXEA 1YHYA 5GONF 3NC4A 4RD4A 2XMBA 2ZRQA 1NV9A 1Y1LA 3H8WA 3FH0A 3GLKA 4W6QA 5D86A 1DQSA 4FCTA 1D7AA 2AL7A 3PXDA 4NOKA 4CKEB 2E1PA 2F8LA 4JQZA 7MHTA 3CO5A 2PN1A 2RI0A 2FW8A 4OI4A 3FWYA 4JH0A 4TQAA 3CRZA 1UZNA 1VL2A 2H2GA 4N5NA 1EKXA 1OQAA 2JVKA 3N53A 4HL6A 4V2IA 3ZYCA 3IOBA 2XAUA 2QJWA 5C31A 1M2HA 2VA9A 4RX1A 5LXTB 4UCFA 4UJ5A 1IAQA 1SVUA 1B6RA 2F3PA 4ZANA 3GMIA 3DQZA 3IRVA 5TQ2A 3G0IA 3I8XA 3K20A 4MUHA 3BD6A 1IIBA 1EFDN 3UHFA 5JDIA 1GL6A 4NX2A 4A5OA 3GGJA 3BIFA 1LRLA 1XDWA 3TWOA 3GNTA 1HTWA 1N57A 1H4VB 2VBCA 1RWKA 3ES9A 3NORA 4FNGA 2J41A 3LHIA 4G86A 1VCIA 1MN6A 5JQWA 1KOLA 1SVIA 5HK8A 5EJ6A 3I01A 3LSTA 2CJYA 3CF0A 5THQA 3KEOA 2WJZB 5EKSA 5JECA 1P2VA 2OY0A 3ZHZA 4R2IA 1Z6AA 3NDPA 4JUBA 2VWGA 3A6ZA 3W5SA 2FPLA 1HMPA 4G0OA 3AW8A 5CIWA 4ZVOA 4EJ2A 2YUTA 3ORYA 4NZOA 3EUAA 1KQGA 3OKAA 1JSRA 4AB1A 4ZO9A 3NHWA 1L1QA 1J06A 1AHNA 1DQNA 4I99A 5AOVA 3PXEA 3D7NA 3C0KA 2OOSA 3DUFA 3GP3A 3I4LA 1GQSA 3PEUA 3V4OA 3NFRA 3ZBQA 3S5UA 3ZWYA 2RGNC 1KVUA 4QYTA 1F6WA 1P3DA 1DMRA 3PWKA 1KWKA 3E9ZA 5J23A 2FPPA 1P29A 2PWPA 3CHYA 3DE0X 3TAXA 3VZSA 6REQA 4JS0A 2DWCA 2MYUA 1JH8A 3V34A 1NVMB 4F11A 2AZ4A 4R71A 1RJDA 1F20A 2JCXA 1TM2A 1ZM7A 1Q7RA 3JQFA 3PFIA 2VF4X 3RASA 2NZVG 1K4MA 2QVYX 5TPWA 2QDXA 1OX4A 2AOXA 4Y1RA 4RPHA 1W19A 1IYZA 4Y6OA 1XA3A 5ARBA 2IF2A 5CHEA 3EASA 2I7DA 4DG5A 2XE7A 2YMPA 3HVUA 4WEOA 4UPDA 5DEIA 5EWJA 1UMDA 4D97A 1T6ZA 3BHNA 1WSDA 4S24A 4G9BA 4EX6A 3K70D 1PZFA 2WTUA 4B87A 1J2UA 1AHIA 1JKFA 2VK2A 1N5DA 3P32A 1PW7A 3LY5A 4GKKB 3DW1X 4XPIA 3O21A 3SC2A 2PSEA 2YIMA 1UM8A 2VJDA 5A3SA 4F12A 4XIYA 1NY6A 1AIPA 2OCLA 2R47A 4GKVA 4TL6A 4BQOA 4TGLA 3ZU4A 1B23P 4X8LA 1TUIA 1XCMA 1XUOA 1TX4B 2CFTA 3HWWA 4HWKA 4KNVA 1QAMA 3GLSA 1T3HA 2D0PB 4MRAA 3D6TB 1GWNA 3G9ZA 3R23A 5HCUA 4TVSA 1GCUA 3BBPA 4IOMA 4QU5A 3UMCA 3LUJA 1QYCA 3MPOA 4JBYA 4JX9A 1EK1A 2WD9A 4N0PA 3WHKA 4JVLA 1F4VA 2FX2A 1HDYA 4UE6A 3OMLA 1OZFA 1PJCA 3ZGLA 4DADA 4DL9A 4M1YA 3KWFA 1XZHA 2EBUA 2PYDA 3L0ZA 5IAEA 2Q4OA 4ISBA 1WOYA 4JLSA 5CX1A 1J23A 3HBNA 5FBVB 1YNOA 3P4XA 2ES4A 3DDOA 4ZRNA 1N5LA 3IDAA 1R3DA 3U4HA 2A0FA 5KJEA 1HH4A 4E12A 3OJEA 1A8SA 1GQ2A 3CKYA 1P77A 3WDSA 1E64A 3F3YA 1ORDA 1R6UA 1U1FA 4M6WB 1QIFA 5EINA 5M5BA 1OR8A 2VPWA 1S1CA 3FROA 4LMPA 1GFIA 2OGWA 2ZS7A 5ILOA 4XPIB 3HU2A 2Q8PA 3SC2B 1R4NB 2JAWA 4MA5A 2G07A 4GPTA 3N2KA 4F4FA 1OYYA 4B80A 1WHSA 2EAUA 2KLBA 1RLMA 1CUCA 2PQ0A 1DV2A 3ILXA 2PNFA 4GR4A 4KUHA 3I12A 4PRKA 4A16A 4I9FA 4Z9BA 4QGHA 4YPOA 4D02A 1P0FA 3TE6A 1EVYA 4LHZA 1CXZA 1GAEO 3OEYA 1R8YA 5KU7A 3BH7A 1XZ8A 4KX5A 1Z8HA 4UBOA 3UATA 1DBPA 3TTTA 2DCMA 1L5MA 4CIDA 5DB4A 4J1SA 2X41A 3OO1A 2SBTA 4R8KA 1OWNA 2Q3CA 1XU9A 1SAYA 3R40A 3WV5A 2JZCA 4IHJB 2Q9BA 1GAXA 2YJTD 4QGAA 4TWJA 5CA1F 721PA 1X8JA 1M0TA 4ZO8A 3TB6A 1NJ6A 4OGFA 3ECAA 3FNGA 3MRSA 3EGDA 4KH0A 2KI5A 2DT5A 1GILA 3AUYA 3H4IA 3VC7A 4X7PA 4JEIA 3X1YA 3IERA 4ZGBA 1RWWA 4N4AA 2IVZA 3Q5EA 5A7GA 1MGOA 3DHEA 1A9ZA 1NN5A 3O8OB 1GPBA 1XD9A 4G8DA 1E2FA 4O63O 4IOLA 3WDLA 4BNIA 4NONA 3OWXA 1A7KA 4KWIA 2ZYTX 4XLLA 1U65A 3HZHA 2OCYC 2Q3JA 5AP9A 3UM9A 4V1CA 1D09A 5EXTA 5AKKA 2ZSIA 4BB6A 3O3OB 4LI3X 1DKMA 1T1RA 1BDHA 3DNFA 1LX7A 3OJWA 1V11A 3PPYA 2P4EA 5GJWC 2B82A 5JJIA 3L01A 3C70A 4LOIA 4M49A 4F92B 4L4XA 3I2KA 2BGNA 3AVWA 1XNJA 2LBPA 3NYQA 5E7MA 4YRPA 5CITA 1SPBS 3P20A 5SV2A 5FPHA 4J43A 4UCQA 4UTXA 4TMYA 5JBNA 1XO1A 3FTFA 4GPEA 3NTRA 3HXOA 3OLYA 3GRFA 3KEMA 3FHTA 2VHJA 1S7CA 3OZVA 1QO0D 1ZUNB 5HQJA 2R7KA 3DFIA 3HC7A 4LTNA 4AKHA 1Y7LA 2APJA 3F1KA 3IVXA 4U3JB 3V1LA 1ABBA 3I04M 4L74A 5CBPB 1QRAA 2EJTA 3WL5A 4KR6A 1IZ7A 1XTBA 2VG8A 3ZPXA 2JDIA 5DYIA 4A92A 2X7XA 4I7EA 1GUZA 3ICEA 3B7PA 2AN4A 3AESA 2MSKA 3PFNA 3HDGA 1Z26A 3L6EA 3K5WA 4WADA 1GRVA 5K09A 4LYGA 4OHWA 1GA6A 2G1AA 4QPPA 1RPZA 2V5AA 1XZMA 3MGKA 3QQ5A 4W5JA 4YI5A 3ROEA 3VUFA 1NHGA 3GB9A 3LYUA 5EWMA 1U2TA 4FSXA 1JHVA 1OA1A 5E1MA 4HEQA 4CV0A 2JLSA 4MVJM 3R6GA 3AKZA 3H2JA 2Z3WA 1NNLA 5IM4F 2DLNA 4EG4A 3IQGX 3U44B 2AXEA 1J2YA 1TCAA 3I64A 4K8OA 4TZ6A 3GP5A 3IE1A 2V74B 3E9YA 3TLGB 2VO1A 2FN9A 4TN1A 1QKJA 4UOEA 2Z2YA 5LDGA 5T5QA 4G0VA 1A9YA 2W00A 2FTKE 4JUIA 2W2PA 4QDXA 4AJPA 2GWHA 1R6XA 3EIXA 1CY1A 3WAKA 4LA4A 4BO5A 4OU5A 1G8GA 3W1VA 3E1KA 1IOVA 1H2EA 1PQWA 2FSUA 2OKCA 2XB9A 3I8OA 1JFRA 1UDWA 2H4WA 1FUIA 2PS0A 1MVOA 2C5LA 2I9PA 2IYVA 2FEKA 4KMRA 3EMVA 3LF1A 1TUBB 2JW5A 2NV0A 2B6NA 2Z0MA 4PZAA 4O4IF 1CJKC 1QFZA 2WDZA 4F8YA 3G0GA 5KX5A 4PW0A 1SIOA 2VP4A 4F2HA 2GKOA 3DF7A 3E7FA 5I7EA 3QYFA 2K5UA 2PJDA 5KYUB 4K6GA 3DGEC 3VKFA 3AJ8A 4TKLA 1NMYA 4BWYA 3DE5X 3UMFA 4DMGA 5BUQA 1NN1A 4X60A 2BKAA 5KYWA 1BDMA 4KREA 3KZMA 3AQIA 1A4RA 3VR2A 3BOSA 2LR0A 2VQ6A 2GKSA 1ORWA 1FC0A 4AQ7A 1BAPA 5AVWA 2REQA 1SB9A 2X5JO 3WC4A 5BOVA 4MI6A 4BLSA 4ESHA 5J4HA 1KZHA 4XRRA 2GZDA 4NU6A 3SR0A 1OFVA 1BE0A 2GEKA 5BMVB 5HJ2A 3SSAA 2C31A 1J6UA 2X4IA 3CZRA 4J7AA 1KWGA 3PUHA 3WDKA 1SCUB 2JBAB 3BRWD 3KBBA 3B3QA 4R9NA 3S55A 4ATNA 5JI3E 1CRPA 1PHRA 1POXA 3BEOA 1QOZA 3LT2A 1ZY2A 2ZYWX 3EH2A 3L0PA 3W3AA 5KYYA 1NMZA 1ZIDA 5AW4A 1TFUA 1EFRA 3VO2A 2AEEA 1SUPA 1R16A 1HNXB 4MGYR 3T9DA 3TI7A 3PFCA 2DUJA 2EEZA 3MBIA 3IC5A 3OLZA 5LUBA 5AESA 4FDTA 5TE9A 3EYWA 1L1RA 3LPCA 3WL4A 2PTHA 3BD9A 5CG2A 1QE0A 4JXZA 3C3DA 1Q95A 1XKQA 2OVFA 2VPQA 1BKYA 4I81A 1M1NB 4YMSA 1XPJA 2JDID 3MMPA 4K9KA 4QDUA 4ZDJA 1J4AA 2PVCA 1XF9A 3OJCA 3PDWA 2XQJA 4BNHA 4PU0A 1CY2A 4JVOA 1GOTA 2WZQA 1DSSG 2V8BA 2IXEA 2XNKA 4QFDA 4U7FA 5DV9A 3DWFA 3TLCA 1ISRA 1EK6A 2MU1A 2OK8A 2PMBA 1VJDA 4RUKA 1KR2A 1ETHA 4YEDA 2BFCA 4PBSA 1XK6A 1R6DA 1FDSA 3ISTA 1RXYA 3ESXA 1QGUA 3MOGA 4KO3S 2WM9B 1HE8B 4JD5A 2VHVA 1U0LA 4QTXA 4R2KA 2AYXA 4RNDB 4EL5A 4XUDA 2C4TA 2XMZA 1GYQA 2FSHA 1G2QA 3ANYB 1HRDA 1LV7A 2J3HA 1YDWA 1NMXA 2QU8A 3E8MA 4JEHA 1XTKA 4QVKA 4IJWA 5E1DA 4AK9A 3REQA 1JHYA 1L9KA 2ID9A 4D8VA 4EVQA 3KYDB 1GU7A 3QEBZ 4GT1A 1IBSA 3VPCA 2IYFA 1DPFA 2ZW9A 5HZGA 1DIRA 3QEMB 2P40A 2UAGA 4D4HA 1W0KA 3LUGA 3GGGA 3RU3A 2H54A 3FUWA 3MLEA 3WGZA 2D0DA 3KKZA 3PYLA 4MNTA 1XP5A 3F47A 3KQVA 5FL3A 5J3JA 4CKWB 1TJPB 2GHRA 4GP7A 3WGMA 2IY9A 2GZRA 1KNQA 4D9HA 1LB1B 2FRXA 1ZMRA 3AEYA 5CVUA 1E89A 2ZSKA 4XH9B 1J0EA 1YRLA 1MC1A 3ONFA 3TQFA 1WXDA 4QPNA 5KIAA 4RELA 2HHLA 1WKBA 2LGJA 2V6JA 4YRZA 4I3GA 4BJ3A 3RUCA 5FUQA 3W6OA 3BK2A 5H3LA 4D42A 2ASEA 5JBIA 1ZJWA 3BD7A 4DEYA 2P62A 3L0YA 2HMSA 4B3HA 3DMRA 4CKEA 2PBLA 3G9QA 4EHJA 3AF6A 4G8JA 1NFFA 4W5QA 2VCEA 3GY0A 3ZY3A 1A50B 4EA9A 3M2PA 3MBOA 4XGQA 4RD2A 4DRZA 4EJ0A 3J81A 3VYRB 2AZDA 4UUBA 3R20A 3UC5A 2D2FA 2GJ9A 1YR6A 2HAEA 3KAQA 2ZJ1A 3INRA 4LYYA 4ID3A 4UMDA 2N42A 2WYOA 1LFAA 1NLZA 3OTIA 4RACA 4QEDA 1TT5A 4HRVA 3V8PA 4B74A 4B3IA 2GDJA 4Y9UA 3V7NA 2R4UA 3GCGA 2B9EA 4ZIRA 1AV6A 3DV0B 2QW1A 2DCUA 3BL6A 1M2FA 1XDBA 1ZUIA 2O3SA 3CE6A 2R8BA 3LDFA 3SYMA 3V3TA 4PZ0A 3Q3HA 2BF7A 3ABZA 4X65B 1KBOA 1U80A 3IVCA 4HWTA 2E5WA 5CXSA 9MHTA 1VPTA 4OKNA 2WSYB 2WWIA 2P68A 1PFYA 3K09C 3OQVA 1ZMBA 1DX6A 4AYXA 4BRSA 2VAVA 1QQTA 3LKVA 3P2EA 1JWBB 4H9GA 3LPNA 4ND5A 1T2VA 1E9VA 1U2GA 1GRCA 3QXJA 1EWQA 3FX2A 1QF6A 2GPTA 4LE1A 4O4JB 1F48A 1OTYA 3SZ3A 2LIPA 4QYIB 1D6NA 5BMOA 1GNRA 5IJWA 3PJEA 4AZSA 1N6IA 3HI6A 1JSCA 1R1DA 2D06A 3EF1A 3OTWA 3VHQA 2ZPAA 1YA6A 1WEHA 1XZBA 4JGBA 2WHRA 3HL0A 1QSGA 3CSDA 3GVIA 4K7JA 1RADA 1P61B 4PZ9A 1PIWA 1QZTA 1FNSA 4S2UA 2JGJA 5A3VA 1NVUQ 1QFXA 1IONA 2ATIA 1SCKA 2UZAA 2JAXA 1KVQA 4I5GA 5GJCA 3RSQA 2ZCJA 4D1YA 1C50A 4NLLA 1W85B 2R96A 3WFJA 1A88A 1XDUA 1PS0A 1QH8B 5IF9A 1N5MA 2I6FA 5ALGA 5E3IA 3K1JA 1Q11A 2Q0XA 3ESBA 4WERA 1XQXA 3L8YA 1G38A 1JZSA 3VI4B 3O03A 4D5GA 3O6VA 2ZR7A 5AFSA 3OJ0A 4BNVA 2RGBA 3U26A 1QFJA 1ZVJA 4JDPA 1G5HA 5I4BA 2B8TA 1Y9EA 1QAQA 3D4IA 3FNFA 3LUCA 5DXFA 5FHRA 2FN7A 3UWDA 4Z2YA 4BVJA 4YAKA 4HRXA 1J5PA 1Q83A 2CXOA 2OSVA 4GEKA 3SU8A 3S1AA 4E21A 3AL0C 1L7XA 1GGNA 2REQB 4AXBA 4ENPA 3PRHA 1CJBA 1XZDA 4I4TA 5E3JA 3ZWBA 2IT1A 3K15A 3PLAE 3IUPA 3N7UA 4W1SA 1NW5A 1WXXA 3R8FA 5IM5A 3K9WA 2Z5VA 2IEIA 1K86A 3JQAD 4RZIA 4P98A 2DLDA 1SBNE 3LJKA 3FSGA 3ZU2A 1SC3A 1E3WA 2OO7A 3C39A 4HY3A 4CDGA 5ESRA 1U5BB 4MXDA 3W04A 1I14A 1REQB 2EDAA 2J6BA 4L6CA 3ZV5A 5FPYA 2WV7A 3SQDA 1H93A 1I7LA 3IAUA 1FFDA 2YJ3A 4TTRA 2Z98A 4Z8YA 4EHAA 5AO9A 5B3KA 2PRSA 1G55A 8MHTA 1T9BA 1FDUA 3R5KA 1JIJA 2PDAA 4N6GA 4DREA 4H7KA 1PE0A 4NOMA 4BNMA 1KIFA 4PEVA 4E1VA 4IHAA 1Y3DE 4BQPA 5JW6A 1VHTA 2WICA 1G60A 1E1NA 2EHJA 2Y77A 2X0EA 2JRCA 4YUYA 4BGDA 5GIPE 1AN9A 3MMNA 1YS4A 3N76A 1I7SB 1R5BA 2XXAB 3MOSA 4UULA 1COZA 1Q19A 3G2IA 7ABPA 5CFPA 3FDZB 2AJTA 2B1JA 3A1EA 2XB6A 1CDEA 2W93A 3CH5A 1SUWA 4WOPA 4BZPA 3DMGA 3HXLA 4RJIA 2I4NA 1E20A 3MT8A 1KFBB 5GV8A 3W90A 5B4UA 3Q7EA 1QGED 3WL7A 1PGNA 4TRNA 3HMKA 3ICOA 3PC3A 2GB4A 1PJSA 3PCTA 5FTLA 5L40A 4OL9A 4ND6A 4GE0A 2IPXA 3GAZA 3NC0C 4IIFA 4IDGA 1FPMA 4MIOA 3TLXA 2O0KA 1M2VB 1VL1A 4KAAA 2G4CA 4OHPA 1HG1A 4G3XA 4PSKA 3PFBA 1KTIA 1ZK0A 3IP1A 1CQIA 1GGEA 4YP5A 3JAWB 3UCXA 3VR4A 2C3MA 5AVUA 5JISA 3NFYA 2QJTA 3AMVA 2NUTA 2H3HA 3BXEA 5EXXA 4GUDA 4NYJQ 1TJNA 3N3BC 5AKYA 3V00A 1TCBA 3F74A 4A6PA 3SQLA 2BFNA 4HUTA 5KNBA 1ZEJA 5E2IA 1D4FA 4RENA 4X61A 5EIBD 1Q57A 4DUPA 3QOFA 1UMCB 1SN7A 5JDCA 3HZRA 1UK9A 4A0FA 4DT1B 5BN4A 3U3KA 1SUAA 1DEXA 3SVLA 3KQUA 1MOQA 4GYJA 4ZAVA 4P3OA 5KTSA 3GL9A 1KJZA 1LF0A 3GFGA 3MRXA 1ULHA 3L8ZA 1C8LA 4N0DA 2CLFB 3CRVA 3O8RA 4CYMA 5KBYA 2G9NA 2QN1A 2XRZA 1KEPA 3KJGA 2Z8ZA 5CH5A 1NLMA 2VAMA 4KIWA 1WAMA 3AY3A 3U3RA 5CDSA 1RKVA 2J0SA 4DSZA 1R9GA 2JIBA 2GM4A 1HEYA 4MW2A 3WKEA 2QS9A 3SJBA 2Y9PB 4KWEA 4TL7A 1EINA 1W2HA 4BUJA 4OUDA 1MO2A 2VQSA 4RFSA 2XOKA 1GTG1 3FHJA 1M8FA 5JPIA 2HGZA 5LMUB 2BRUA 2IPAB 5HQ3B 1QGDA 2BH9A 4B43A 1H2ZA 4QHTA 4WL0A 1ZWKA 2XUHA 1BMFA 3C15C 4P4NA 3DTVD 4HDOB 4WZAE 3RS9A 4DRXA 4WKPA 1Z16A 4WKCA 2XKJE 1N3BA 5ICFA 4Q5IA 3RB8A 4C29A 4RTKA 1EFAA 4HLUC 1P1FA 3N6RA 3NKLA 4GMKA 2AN5A 5E2AA 1R15A 3G82C 2DJIA 4AULA 4G23A 3E9DA 2A0KA 3PQ7A 1BDIA 3UQYS 2XDAA 2FPMA 3TW6A 3Q5GA 4DBVO 1EM8A 2YVQA 4ILEA 1M2WA 4J07A 3V46A 4MB6A 5PGMA 4M9CA 1Z0KA 4G8BA 2QL6A 3H3JA 5CVCA 5IXSA 1Z7BA 1ZP6A 3TDNA 4UD6A 2XE8A 1YONA 3UOWA 2QZPA 1CP3A 3U16A 2AVDA 5JAPA 1W59A 1WNFA 3NIGB 4JBLA 4JC8A 5U9CA 4LNHA 1HG0A 2W58A 4D4JA 5HQTA 4ZT6A 3K8OE 5HIMA 1ZH4A 4YXWD 2C9BA 1USUA 2XBUA 3LDUA 2IW1A 1U8FO 1N7HA 2OHVA 1ZGZA 4H1HA 2V7XA 1E9SA 1Z2NX 5ER9A 2H0AA 4FB4A 5K8UA 4RTSA 1XJ5A 4GI1A 2Q7OE 2DT8A 3LLSA 3QY0A 5DISB 1Q2XA 1E2DA 1TO1E 2NADA 3AUAA 3NKVA 4X6LA 2BFPA 2CKDA 3LVFO 4UXIA 1WMDA 2JJYA 4A8JA 5JHHB 3PEWA 1Z07A 2QE7D 4IJKA 2VNJA 1SIBE 4MQ4A 1B8VA 2OA0A 1NF9A 1PT9A 2G3YA 3WIUA 5DBGA 1ST2A 5CG1A 4P5PA 1I1QB 3AKYA 5CA0A 4Z53A 3OX3A 1P0MA 4J03A 2NUAA 2FI1A 2R65A 3DVAB 5FBLB 1MMFB 3UMGA 3TOSA 2I3BA 2PD6A 3VYTB 3A14A 1EM8B 3AKEA 3AERA 2HHJA 2V7UA 1KDZA 1FA9A 4L72A 1VZ2A 2AQ8A 2YC2C 2YXLA 2CUZA 4KVFA 5T8KC 4L5CA 3WNDA 4YMUA 5CK5A 5BV2P 3CX4A 2H18A 3PR2B 3ZTYA 1M1ZA 4UUQA 1H2FA 1F06A 1XZIA 1ZQ9A 2JAQA 3VJKA 3BRWA 3LK7A 3U31A 4HNSA 4IMPA 3ROZA 2FY8A 3O8DA 4PG8A 4RIHA 1N1GA 4X1KA 1TA0A 3C85A 1JZQA 4S2EA 3N75A 4LV6A 4Z7NB 2FOLA 1GG8A 1OV6A 4HOYA 4MMZB 5A2GA 4JJ8A 4EFMA 3R7AA 2A9OA 4F04A 1W6UA 3OZSA 5H7XA 3ZQJA 4FB5A 3Q3IA 1YQEA 1G7RA 4B9AA 3TJMA 5HZMA 1B6TA 1ZRNA 4YLEA 1G6OA 1VPVA 1M72A 1LTQA 4B6GA 4JI3B 3RNLA 4OAQA 2XCSB 2ZTHA 4P3XA 4IMIB 3KXKA 5ITZB 3HO6A 4O1MA 3AXTA 4R9UC 3IEPA 1EJBA 3GZNB 3IVMA 3PWZA 1FMJA 4PHFA 2AV6A 3T5GA 4ZKEA 2QRNA 1QBKC 1SBZA 4F72A 4S1WA 5DNAA 4IUYA 3RO7A 4LF4B 3CEJA 4JROA 3PXGA 1CUUA 4Q12A 3S99A 1IBLB 3VR4H 1YBVA 3T15A 2ECPA 4GF5A 4IDDA 4X24A 3AF0A 4H6PA 1N0VC 3EZGA 3TSAA 1CS4C 4P3KA 1GSA