1JQPA

Dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
438
structure length
348
Chain Sequence
DTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHETMTGWVHDVLGRNWACFVGKKMLSLPESWDWRNVRGINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHPFNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrameric dipeptidyl peptidase I directs substrate specificity by use of the residual pro-part domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords dipeptidyl peptidase I
total genus 100
structure length 348
sequence length 438
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 1jqpA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1jqpA02
2GFOA 2R9MA 1NB5A 1STFE 1YALA 1TU6A 3DF0A 2AUZA 4AXLA 3QJ3A 1EWLA 1S4VA 1BY8A 2R6NA 3OF9A 2FTDA 3B79A 2R9FA 3F5VA 3KW9A 2DJGB 1PCIA 2HH5A 2AYNA 2FQ9A 1PBHA 2Y6EA 1AECA 3S3QA 5CVNB 1CPJA 1BQIA 1PPDA 4N4ZA 5FPWA 4WA6A 3BCNA 3RVXA 3V6CA 2E00A 2PREA 4CZWA 3IUTA 2CIOA 3BWKA 1QMYA 4BS5A 4CDDA 1EWMA 2NQGA 1CTEA 3OVXA 4P6GA 3RVWA 5J94A 2DC9A 4G54A 3CBJA 4HWYA 4N79A 2AUXA 1GLOA 4QBBA 3H6SA 1DF0A 4W5CA 3CH3X 1BGOA 3D6SA 2AU1A 3ERVA 2OZ2A 2XU3A 4PADA 3P5WA 4Q8GA 4FIPA 1SP4B 1CV8A 4X6HA 4W4UA 2ARYA 1GMYA 3P5UA 3N3GA 4AXMA 1EF7A 1KHPA 3PDFA 4I05A 1YVBA 2R9OA 2R9CA 4OEMA 1KHQA 2G8EA 1PXVA 2DC6A 3WXFA 4K7CA 1PIPA 3M99A 2YJBA 2DJFB 2PNSA 5CHVA 1MS6A 1ITOA 3IMAA 3LXSA 3K8UA 1CVZA 3BPMA 3U8EA 1AU2A 2B1MA 2P7UA 1AU3A 4KLBA 2DZZA 2ATOA 1MEGA 2NQDB 4CDFA 2PBHA 2DC7A 3KKUA 4BPVA 1TLOA 4YVAA 1HUCB 1F29A 2XU4A 4PP1A 3KWBX 3I3TA 4MZSA 2HD5A 3IV2A 2H7JA 4P6EA 3NHEA 1XKGA 1ZCMA 1IWDA 1YT7A 1PADA 2G7YA 2JQFR 2DCBA 1Q6KA 4QRGA 5K16A 3BPFA 2G8JA 2C0YA 6PADA 3C9EA 4I04A 4YV8A 2FUDA 2PADA 2WBFX 2XU5A 1ATKA 1MDWA 1X9YA 1MIRA 3BOWA 5CHTA 3IOQA 1U9WA 1Y08A 1A6RA 1DEUA 2AS8A 2YJ2A 1VJVA 3KFQA 5PADA 4YYVA 3BC3A 3HWNA 1CSBB 3KWZA 1F2AA 4DMXA 1AYWA 1O0EA 2YJ9A 4CDEA 1NPZA 1POPA 3ZUAA 4XR7A 4ZUXU 7PCKA 3CH2X 2AIMA 3H89A 3RVVA 4YYQA 2E01A 1TL9A 1AYVA 4BSQA 2BDZA 3WXGA 1NL6A 2YJCA 2HHNA 1YK7A 1VSNA 1AU0A 3KX1A 2VHSA 2O6XA 1JQPA 4CDCB 4W5BA 4YYSA 4PP2E 5A24A 1ME3A 2HXZA 3MTNA 5F02A 2BDLA 2XU1A 3P5VA 3WXEA 3N3KA 1ME4A 2R9NA 3HHAA 3H7DA 3TNXA 3USVA 1AU4A 1QDQA 4FJCA 4RY2A 3K9MA 4YYUA 4X6IA 3PW3A 3GCBA 2JQGR 4XUIA 5EGWA 1U9XA 4CDEB 1EWPA 1ICFA 1AIMA 3H8BA 3P5XA 2B1NA 1AYUA 4YYRA 5JA7A 3HD3A 1BP4A 3KSEA 2AYOA 2DJGA 9PAPA 4FK5A 2FYEA 1F2CA 3E1ZB 4CDFB 1GECE 2Y5BA 1GCBA 3OISA 1PPNA 1U5IA 3O0UA 2FRAA 1MHWA 3QT4A 3MHSA 1CS8A 1QOLA 1NQCA 2E03A 4Q8HA 4YYWA 2DCAA 2F1GA 1ZIVA 1YK8A 1CJLA 3AI8A 3K24A 3S3RA 3LFYA 1CB5A 2IBIA 3IHPA 5CVMA 2OULA 3CBKA 4OELA 2DJFA 3O1GA 4BS6A 1K3BA 1KFUL 1KXRA 3F75A 2G6DA 1K3BB 2CB5A 2IPPB 3IEJA 3N4CA 5CVOB 4PI3A 4DMYA 2DCDA 2P0RA 2YJ8A 1U9VA 4QH6A 3OF8A 3H8CA 1PPPA 5EF4A 2OP3A 2AVWA 2NQIA 5JH3A 2E02A 3HHIA 4QRXA 4X6JA 3MHHA 2DC8A 1MEMA 4MZOA 4BQVA 1PE6A 3MORA 2DCCA 3OVZA 4CDDB 2NQAA 2FRQA 1NB3A 8PCHA 4MSXA 2GHUA 1THEA 4QRVA 3V6EA 1M6DA 1F2BA 2VHFA 1PPOA 3PBHA 1EWOA 1NLJA 1KFXL 3PNRA 1CQDA 3I06A 4I07A 2DZYA 1FH0A 1SNKA 2F7DA 2P86A 3QSDA 1Y4HA 4CDCA 4N8WA 1QXPA 2FT2A 1U9QX 2FO5A 2ACTA
chains in the Genus database with same CATH superfamily
2BT9A 2OZQA 4D8EA 1QY2A 2FKJA 4N7CA 4O3WA 3D95A 1LCWA 2FTDA 3FA8A 4GJSA 4ZJ0A 2RTFB 4WFVA 1CBIA 3KW9A 1MX8A 1PCIA 2NNEA 1BWYA 2AYNA 4O3ZA 3S3QA 5F2BA 3WYQA 2X56A 3BS2A 3HTYA 3VPJE 1ZNLA 3C0RA 4AYHA 1U18A 1VYGA 3ZNHA 3RVXA 4GKCA 1SWLA 5HZ6A 2X46A 3T2XA 2NQGA 1CTEA 1KT4A 1BRQA 3OVXA 3NX2A 5H8TA 4HPDA 1DC9A 2HZQA 3MVFA 5J94A 5K06A 5B11O 1I06A 4HWYA 4RF1A 2AUXA 1GLOA 2R56A 2X4MA 3CMPA 3CH3X 1BJ7A 1VWBB 4YVBA 2OZ2A 5LJCA 1ZNGA 4Y0RA 3P5WA 4Q8GA 4UU2A 1D3SA 5E6JA 2C1QA 1EXSA 5L8NA 4ORXA 3FMZA 4AXMA 1VWMB 1LDOA 3VHMA 5IO6A 2Q39A 3VE1A 1YVBA 1ZRYA 4I3DA 1KFFA 1HXZA 2DC6A 1GM6A 4K7CA 3CQNA 1PIPA 1SY0A 2GH7A 4OVZB 1VWRB 3SLOA 1IJ8A 2WR6A 1NC9A 2PNSA 2AF5A 1MS6A 4IAXA 4QAEA 3E9SA 5IXGA 1JJXA 3LXSA 4Z6JA 1CBRA 3OJYC 4ORYA 1CVZA 3BX8A 4GUAA 3WOVA 1HMTA 3VG2A 3NQ9A 2OL7A 4O4UA 3PQUA 1ACDA 3RDQA 3UEVA 3FR2A 4D8IA 2L67A 3O2YA 3VGWA 3PK2A 1YUPA 5CE4A 3EC5A 3KWBX 1HMRA 4DQ4A 4U8UO 4P6EA 1OEEA 3CBCA 1SRIA 1I78A 3FW5A 1XKGA 3BU1A 3KZAA 1ZCMA 1PADA 5F7GA 2G7YA 2JQFR 3UEXA 2G8JA 3WJGA 5HA0A 4I04A 3AEHA 3IFBA 1ATKA 1GGLA 1MDWA 1X9YA 3GE2A 3P6GA 1MIRA 4YH0A 3BOWA 5CHTA 4EEJA 1U9WA 4COTA 4IMNA 2AS8A 2YJ2A 4ORSA 2HMBA 3ZW0A 2FT9A 4IMOA 1SWDA 3WVMA 3ZUIA 5D8JA 2DM5A 3KFQA 1JJUA 2JU7A 3BC3A 3L4RA 1LIEA 1AYWA 1VPRA 4CDEA 4UU3A 2CM4A 4O49A 2OY7A 1VWNB 1KT6A 3NQ3A 2AIMA 2QOSC 4YGZA 3GAQA 3P02A 4BSQA 4IP3A 1VWOB 2ASNX 2IZFB 4NV8A 1AVDA 1SWCA 2HHNA 1ZNHA 5LJGA 3AKNA 1IW2A 1AU0A 1YK7A 3SZJA 2KT4B 2OFMX 2AT5X 2O6XA 2JOZA 3TGAA 1LDQA 1SLGB 4BOZA 1KOIA 5B5GA 4YYSA 5HA1A 1ME3A 5FAZA 3MTNA 2XU1A 4JGLA 4OKAA 5HCCC 3N3KA 4I3CA 3HHAA 2OFAA 1SWSA 1S44A 4IB7A 1MEPA 4RNAA 4FJCA 4RY2A 4QYNA 2JN3A 1IFBA 4OS0A 4ORUA 3BY4A 3BRNA 3HD3A 4EKVA 1QFTA 3K3LA 1QY1A 4AZPA 2DJGA 9PAPA 1DZPA 1OPBA 3FEKA 2FYEA 3VG5A 4CDFB 3BDRA 2R73A 4GZVA 2Q9SA 1DF8A 4AZNA 4O3XB 2FRAA 3BSZE 1UKFA 5KICA 5LJBA 5LJKA 1QOLA 5HTEA 1BSQA 1N0SA 4L3RA 1CBQA 2J7QA 2AT0X 4GDZA 1CJLA 3S3RA 3HWFA 3ZW1A 3WJFA 1CB5A 5CVMA 4QZTA 1OBQA 1Y9TA 5HZ9A 4OELA 2F73A 3O1GA 3PQSA 1HQPA 1KFUL 4BVMA 2G6DA 3S5VA 2IPPB 4GNWA 1RSTB 1STSB 1QWDA 2O62A 2YJ8A 1SWAA 2MWHA 4PSQA 4I60A 5HZ5A 3D4RA 5CHKA 3H8CA 2OP3A 2FE8A 4NV7A 3RBYA 3SOTA 4U8UN 4MM3B 3HHIA 2A8GA 4QRXA 4OS8A 4A8ZA 3MHHA 1KT5A 4MZOA 4BQVA 1PE6A 2DCCA 3RDXA 2CZTA 3HWEA 3OVZA 4ZHDA 4NYQA 3DTQA 4U9CA 1NB3A 2GHUA 3V6EA 4QRVA 3W30A 1M6DA 1FJ1E 2MM3A 4I9RA 1PPOA 3P6HA 1KQXA 5HAEA 2DZYA 1DF3A 3TMPA 2F7DA 2M4LA 4OS3A 2CAMA 1MUPA 5EZQA 2X8FA 2X34A 2CZUA 4LQZA 4MISA 1GT5A 1FTPA 4Y59A 4ALOA 2ACOA 1YALA 5L8IA 1A57A 5FFHA 5LJDA 2ZAIA 2AUZA 5BYPA 1X8UA 4EQAC 3APXA 2OY5O 4XMFA 1N4JA 4A5UA 4XMHA 5HZ8A 3FR5A 1UYOX 3OBLA 3F5VA 2A5BA 1MOYA 3KFHA 3MBTA 2FQ9A 1GKAA 1AECA 3RZYA 4TKBA 2W2AA 5IRAA 4O4XA 1VWEB 1SY3A 1PPDA 5KHPA 4DCBA 5FPWA 4WA6A 3IA8A 3FR4A 4NYRA 2PREA 1FE3A 3O22A 1LIFA 1EIOA 1KT3A 2JGSA 1B8EA 4BS5A 2AT8X 3EYCA 1CBSA 3T6LA 3FYFA 3NQKA 3RVWA 1GT4A 1RXHA 1PTSA 5B5FA 2IZLB 1SXWA 5F58A 2DC9A 1HQQA 4N79A 1YIVA 3H6SA 1SY2A 5EEDA 1DF0A 3JS1A 4LKTA 2RCQA 3D6SA 4EDEA 4BOUA 5EZ2A 4L1NA 4FIPA 3T2WA 4R3DA 5FQ8E 5B29A 2NNQA 2W2BA 2Q4NA 3VG6A 4W4UA 2ARYA 5EDBA 1LCZA 2AT3X 5AJBA 4ZR2A 1FENA 3APUA 4QRLA 3S60A 5FENA 4KH8A 4U46A 1LNMA 4I95A 4OEMA 1KHQA 4NNTA 2G79A 2UZ2A 3DSZA 3WJDA 3LV4A 1XKIA 2X8TA 1IKJA 3NBXX 1A3YA 2GTFX 2L9CA 5D4AA 2DJFB 2RTQB 5FQ6E 5CHVA 4JNJA 2P8GA 2LA7A 5HCDC 3CWKA 3BPMA 2Y3FA 2AL0X 4LZUA 1PMPA 1AU2A 4YFQA 2P7UA 1T68X 5KIDA 4TNNA 3O65A 2ATOA 3VG7A 4CDFA 3CKFA 1TLOA 2G8CO 3G7XA 1U17A 1F29A 2FS6A 1Y0GA 3VG3A 4PP1A 4EXZA 4BJ8A 4CPFA 2OVAA 3I3TA 5H9KA 1LIBA 3LHNA 5K68A 1VWLB 1IWDA 1YT7A 4ORWA 1WUBA 3RNVA 3B2LA 2RTDB 3BY0A 3BPFA 2C0YA 4QQ1A 1RBPA 2IZJA 2IZDB 5IRUA 2PADA 2WBFX 3PHXA 3ZW1B 1STRB 2RTNB 2YMSA 4IUMA 5DG4A 1Y08A 1OSPO 1RLBE 5AJCA 4INNA 3T1DA 5BVQA 2DOSA 2A3FX 4BX6A 1OPAA 1LIDA 4O3YA 1O1VA 4ARHA 5F6BA 3HWNA 2IZGB 4DMXA 2LKKA 3RE6A 4A1HA 3RDUA 2PY1A 3ZUAA 1YWBA 1DV9A 7PCKA 4AW8A 1KL3A 3TGCA 1JZUA 2QCBA 2BDZA 4MEEA 3MM0A 1NL6A 2QMIA 3NX1A 2HYSA 3ZQ3A 3KFFA 1VSNA 3KX1A 5H9AA 2I5ZO 1SY1A 1LF7A 1SRHA 4KIIA 1X89A 3EMMA 4YGHA 2WEXA 3ZWEA 4CV7A 4U3QA 4PP2E 4YKOA 3C77X 2A5CA 2LB6A 5A24A 2RTOB 2HXZA 3U9PC 2BDLA 1I9HA 2BTWB 2CBRA 3WXEA 1B56A 2Z4HA 3OQCA 3TNXA 1Z24A 2QO6A 1AU4A 1QDQA 1TXLA 5EEEA 3TRKA 3K9MA 4YYUA 3PW3A 3GCBA 5DPQA 5EGWA 1EWPA 2IFBA 5D48A 2JTCA 2A13A 2B1NA 1MVGA 1BP4A 3KSEA 2QO4A 3P24A 1X8NA 1AVGI 1SXXA 3VG4A 2Q2MA 4M7MA 1KXOA 3E1ZB 2E4JA 2RTMA 2Y5BA 1E06A 1GCBA 3QKGA 1PPNA 2I5VO 4GGTA 4BGFA 2WUTA 2OY8A 2CM9A 3NPOA 3I17A 4BBOA 4M0WA 2E03A 4BX5B 2BC3A 3RDMA 4Q8HA 4GETA 4BX6B 1X8OA 4Y0SA 3EBWA 2DCAA 1VWPB 1JBHA 1ZIVA 1YK8A 1BSYA 1AQBA 4YCHA 3AI8A 3K24A 3IHPA 4O9SA 3WZQA 2DJFA 1X8QA 3CKGA 2HNXA 3RDSA 1KXRA 1VWQB 3ELXA 3FA6A 3N4CA 3V8UA 2N93A 4ZHHA 4ODDA 4QYPA 1EI5A 1U9VA 4YKMA 1PPPA 1VWIB 4CPEA 1BLRA 2E02A 4QNIA 4C5PA 2DC8A 1MEMA 3TF6A 1LFOA 1SWNA 4RKXA 3VE2A 3ZW2A 1KZWA 8PCHA 1SRFA 3FIDA 2RTHB 1O8VA 2RTEB 1THEA 2RTKA 1EALA 1UZ2X 3FEPA 1NP1A 4RUUA 3IFUA 2IZCB 1MDCA 1CQDA 4I07A 1FH0A 1SNKA 2HWKA 4RUNA 4CDCA 2AT6X 2FLJA 5JD2A 2AGAA 5L8OA 3HWDA 1RAVA 2A2GA 2ACTA 3AUMO 3OE3A 4ALBA 2GFOA 2JU8A 4JHQA 1ML7A 1TVQA 5CSEA 3FENA 1G85A 1STFE 4TQ2A 1E02A 2Z4IA 1TU6A 3DF0A 4AXLA 1PM1X 5EDCA 3STKA 4HPBA 4CPIA 2IZIA 1BY8A 2R6NA 3OF9A 1ZNKA 1ZNEA 4GGRA 2WWPA 1Y53X 2FHNX 5LJHA 4HWMA 4ZTBA 2FTBA 1N43A 5IO5A 1TOWA 1BQIA 3P6FA 4Y0QA 4N4ZA 4R0BA 4Z27A 4FBRA 4MVKA 1SWJA 3B2JA 1HBPA 1E5PA 4YMYA 4OMWA 1RXJA 4BX7A 4Z28A 2ZSCA 4ZHCA 3IUTA 1G7NA 4ORRA 2CIOA 3BWKA 1ZNDA 1QMYA 4AZMA 4CDDA 3WJCA 2K23A 1EWMA 2F01A 1SXYA 4P6GA 3W31A 2L68A 4A1YA 1VWCB 4QGWA 4MIRA 2KTSA 1SWBA 1EQDA 2MO5A 2R74A 4HFOA 2XKLA 1FELA 2C1SA 5CYBA 4W5CA 1ERXA 1BGOA 3D96A 2AU1A 3ERVA 2XU3A 5F1EA 4ZGUA 1CV8A 4X6HA 1TW4A 4OVZA 5HTDA 2RTCB 4I05A 4GDAA 2R9OA 2R9CA 1YWAA 3STNA 1PXVA 2ANSA 3SZIA 4GH7A 3WXFA 4ZCBA 1VWAB 2Q2PA 4U8UM 3JQOA 3M99A 2BLGA 1HBQA 3RWXA 1MK5A 3F8AA 2YJBA 1ERBA 1MX7A 3BBAA 1SWUA 3K8UA 4ZFXA 2BSZA 1JIWI 3U8EA 3CR6A 4KC7A 5D47A 1AU3A 1LICA 2NQDB 2DC7A 4WFUA 4BPVA 4IBAA 4NLJA 1HUCB 2LBAA 3D97A 4O4SA 2OF8A 4ZHGA 1GT1A 3UEWA 4MZSA 3IV2A 2H7JA 3NHEA 4ZH9A 4GJVA 3RSWA 3TGBA 4NNSA 1DZJA 3WZPA 4KCAA 4I6SA 4D6BA 5K16A 2X8SA 3C9EA 5B3MO 4TLJA 3SZHA 3ZZVA 4YV8A 1NGLA 2FUDA 1LELA 2AVIA 2LBVA 2XU5A 5K67A 4IRWA 5D45A 5IRWA 3H3IA 4IABA 3IOQA 1VYFA 1A6RA 1DEUA 2OFBA 3KQ0A 5EPQA 2NP1A 2RN4A 3T6FA 4ML7B 3HWGA 5BVSA 4WURA 1VJVA 3ZW0B 1NP4A 2WPUA 1JV4A 5PADA 4ES7A 4YYVA 3EW2A 1CSBB 2YJ9A 1POPA 1YWCA 1PEEA 4XR7A 4ZUXU 2GJ5A 1G5WA 3RVVA 2F09A 4YYQA 3FIQA 2E01A 4JO6A 3WXGA 1BSOA 3B21A 2PI3O 1G74A 1AELA 2BS6A 1YZBA 5KO3A 1JYDA 2RTPB 1JQPA 1HN2A 1Y55X 1W5RA 3HOLA 1T8VA 1WBIA 1A2DA 2LFOA 1EW3A 5F02A 3P5VA 1SXUA 2HKDA 1ME4A 3USVA 5F6ZA 2YG2A 4IB6A 3EW1A 3C78X 5LKEA 4GRJA 3PP6A 4X6IA 1N9MA 1JMZA 3UEUA 4NLIA 1NBXA 3NR3A 4ON1A 1B0OA 1ICFA 4I3BA 5IO7A 2K62A 4CSBA 1O1UA 1ICMA 3H8BA 1AB0A 5B10O 4ZHFA 1AYUA 4YYRA 5JA7A 2UZJA 2BHVA 2ZAGA 2WEWA 3B2IA 3ZUOA 3P6CA 1QQSA 1GT3A 1SWOA 1F2CA 3PSEA 1GXAA 1KL5A 1N7YA 3PH6A 1SLFB 2BS5A 2Y32A 3OISA 3APWA 4N7DA 3WJEA 4D8BA 1YWDA 3QT4A 2XSTA 1KQWA 3AKMA 1SLEB 4Z2OA 1NQCA 4YYWA 1SWFA 1VWFB 2RQ0A 1FEMA 2F1GA 3BLGA 2Y3EA 5BVTA 2IBIA 2IZEB 5AQ6A 1HXLA 1IIUA 4KC8A 3E3CA 2G5LA 4XZXA 1SWHA 3WZNA 1K3BA 3MX7A 1EPBA 2CB5A 3IEJA 1K24A 1BM5A 5EZSA 4PI3A 1R0UA 4DMYA 2DCDA 3VU1A 1STPA 2OFRX 1FDQA 5HZQA 4I9SA 3OF8A 3HK1A 2NQIA 1T0VA 4O4OA 3SLTA 4YGGA 3D9WA 1KT7A 4BOQA 3FDCA 3STMX 4TKHA 3ELZA 2FKGA 3NP1A 3MORA 5JZEA 2NQAA 1W6FA 2FR2A 3KFGA 1H91A 2FRQA 4BOEA 1VWGB 4MSXA 1NQMA 3FW4A 2G7BA 2MF6A 4DNEA 4BOPA 1F2BA 3WBGA 1NLJA 1KFXL 3PNRA 4BX7B 3CBSA 3QSDA 2IZKA 5B27A 4ID2A 1QXPA 4PT5A 3P6DA 3FA7A 1YP6A 2R9MA 1NB5A 4Z2VA 4KT5A 1JMXA 1BRPA 2WSJA 4YFRA 4B55A 5FQ7E 3QJ3A 3B2HA 4YDBA 1EWLA 4OMXA 1LPJA 5HCEC 1S4VA 3FA9A 2GTLM 4XMGA 1KL4A 2RCTA 3B79A 2A2UA 3MG5A 4CPHA 4GE1A 2R9FA 4D6AA 4RF0A 2DJGB 2HH5A 4K19A 1PBHA 2Y6EA 1OBPA 1TOUA 1QABE 1I04A 5CVNB 1CPJA 2IZBA 1DZMA 4TJZA 1LKEA 3SLJA 1NDJA 3FELA 1LCVA 1S7DA 1EUOA 3BCNA 3V6CA 2E00A 1VWHB 3PRPA 1RXKA 4ZH6A 5AEOA 1XCAA 4CZWA 3CQRA 2GTLN 3OD9A 5HBSA 1UREA 3BU9A 3MP2A 4WHIA 2AKQA 4PJ2A 3KVNA 4G54A 3CBJA 3WZOA 4QBBA 4ZGFA 3UAQA 4BX5A 3Q6LA 3S26A 2WQAE 4WBKA 4PADA 1DKIA 2JW1A 1SP4B 4NP1A 1GMYA 4GK9A 1CRBA 3I0AA 3P5UA 1X71A 3N3GA 1I4UA 1EF7A 2MJIA 3PDFA 2GC9A 1KHPA 4AZRA 3F9DA 2OY1O 2FGSA 2G8EA 2EU7X 4Y5DA 1IKEA 1HY2A 3BX7A 4GGZA 4YFPA 1PVJA 3KFIA 5C0NA 3BB7A 2W2FA 3PPTA 4HPAA 4P16A 2G78A 4XMCA 3RY2A 5JR8A 2ALLX 1ITOA 3IMAA 3FLLA 1UYNX 4A60A 4BCSA 2BU3A 4GU8A 1VWKB 3LTWA 1SRJA 4FBVA 2B1MA 4KLBA 1SWKA 2DZZA 1MEGA 2PBHA 3KKUA 2RTGB 2X55A 4YVAA 2RTLA 3O19A 1VYOA 2XU4A 1ICNA 3RY1A 1VWDB 2HD5A 1GX8A 1MM9A 2FS7A 3RKGA 2NNDA 4FBOA 2DCBA 4QZUA 1Q6KA 2HLVA 2OVDA 4QGXA 4QRGA 3WJBA 6PADA 1HMSA 1SWTA 4M6SA 3VHIA 1E2TA 4QGVA 1IFCA 3HPEA 2OVSA 4IB8A 1QG5A 2IZHB 3EM0A 3SAOA 1OEKA 2RTJA 1RSUB 2RTIB 4XMEA 1CJ5A 3RDOA 1GKAB 2VDFA 2HZRA 1KZXA 2FRSA 4YBUA 1I05A 4AZQA 4FGIB 2WQ9A 4GUZA 3P6EA 4YCEA 3KWZA 1F2AA 2OL6O 1O0EA 1NPZA 2QM9A 1EPAA 1JJJA 1S2PA 3HOEA 3MJ5A 2OYBO 3CH2X 3H89A 4DQ3A 3U0DA 1TL9A 1B4MA 1U0XA 5H9LA 1AYVA 3PH5A 3U03A 1EIIA 1W4TA 2YJCA 1SLDB 4IAWA 2Z84A 1KGLA 2KD2A 1ALBA 2JRIA 4YDAA 1SWEA 2VHSA 1GX3A 2JMBA 1SMPI 4CDCB 4W5BA 2RD7C 1GX9A 1YP7A 1SA8A 1E00A 3F6ZB 2JU3A 2CBSA 2VFCA 1OEJA 3NADA 2RTBB 3VHHA 3PRMA 2BTWA 2R9NA 1ADLA 3H7DA 4MVLA 1Y52X 4LKPA 3MTVA 1SWGA 2OF9A 1OBUA 4FQBB 4EFGA 2JQGR 1LUQA 4XUIA 3B2KA 1U9XA 4CDEB 3ZI8A 1AIMA 1QFVA 3P5XA 2KTDA 3QQ2A 1A18A 3PT2A 4NW4A 2AYOA 3S5XA 4FK5A 2RA6A 2IZAA 1BEBA 4MI7A 3WXQA 1GECE 3PHUA 1BBPA 1SWRA 2FWVA 1P6PA 2RTAA 4MVIA 1U5IA 4IB9A 3APVA 3O0UA 1MHWA 3MHSA 2J7QC 1JYJA 3PEDA 1CS8A 3JSQA 2X45A 4BQUA 1PBOA 2GTLO 2L5PA 2AMMX 5HWZA 3PHWA 3X00A 3LFYA 4XMDA 2QOMA 2OULA 4BOSA 4TKJA 3PECA 3CBKA 4OW0A 4Y0PA 1SWQA 4BS6A 5B2AO 1N9YA 2ACPX 2AH7X 3F75A 3RE5A 1PBYA 1K3BB 1X8PA 2MHDA 5CVOB 2X32A 2P0RA 3N91A 5LKFA 2KW1A 2OL8O 2OVEA 2VFBA 4QH6A 1D2UA 1Y9LA 2POAA 5EF4A 4GNYA 2FR3A 2AVWA 4Z2PA 4YBPA 5L3YA 1AVEA 5JH3A 4LZVA 4CPHB 1DZKA 4X6JA 1SRGA 5H9NA 1NQNA 3Q34A 1DFVA 3WYPA 2FHLA 4MVEA 1QY0A 3TZSA 1VWJB 4CDDB 4REZA 1SWPA 2A0AA 4CK4A 3C76X 4GD9A 2UYWA 2RTRB 2VHFA 4HXDB 3EBKA 2QO5A 3PBHA 1EWOA 3I06A 5LJEA 2C4IA 1L6MA 2P86A 4HPCA 1SREA 1Y4HA 4N8WA 2FT2A 4AZOA 1U9QX 2FO5A
chains in the Genus database with same CATH topology
2GFOA 2R9MA 1NB5A 1STFE 1YALA 1TU6A 3DF0A 2AUZA 4B55A 4AXLA 3QJ3A 1EWLA 1S4VA 1BY8A 2R6NA 3OF9A 2FTDA 3B79A 2R9FA 3F5VA 3KW9A 2DJGB 1PCIA 2HH5A 2AYNA 2FQ9A 1PBHA 2Y6EA 1AECA 3S3QA 5CVNB 1CPJA 1BQIA 1PPDA 4N4ZA 5FPWA 4WA6A 3BCNA 3RVXA 3V6CA 2E00A 2PREA 4CZWA 3IUTA 2CIOA 3BWKA 1QMYA 4BS5A 4CDDA 1EWMA 2NQGA 1CTEA 3OVXA 4P6GA 3RVWA 5J94A 2DC9A 4G54A 3CBJA 4HWYA 4N79A 2AUXA 1GLOA 4QBBA 3H6SA 1DF0A 4W5CA 3CH3X 1BGOA 3D6SA 2AU1A 3ERVA 2OZ2A 2XU3A 4PADA 3P5WA 4Q8GA 4FIPA 1SP4B 1CV8A 4X6HA 4W4UA 2ARYA 1GMYA 3P5UA 3N3GA 4AXMA 1EF7A 1KHPA 3PDFA 4I05A 1YVBA 2R9OA 2R9CA 4OEMA 1KHQA 2G8EA 1PXVA 2DC6A 3WXFA 4K7CA 1PIPA 3M99A 2YJBA 2DJFB 2PNSA 5CHVA 1MS6A 1ITOA 3IMAA 3LXSA 3K8UA 1CVZA 2BSZA 3BPMA 3U8EA 3LTWA 1AU2A 2B1MA 2P7UA 1AU3A 4KLBA 2DZZA 2ATOA 1MEGA 2NQDB 4CDFA 2PBHA 2DC7A 3KKUA 4BPVA 1TLOA 4YVAA 1HUCB 1F29A 2XU4A 4PP1A 3KWBX 3I3TA 4MZSA 2HD5A 3IV2A 2H7JA 4P6EA 3NHEA 1XKGA 1ZCMA 1IWDA 1YT7A 1PADA 2G7YA 2JQFR 2DCBA 1Q6KA 4QRGA 5K16A 3BPFA 2G8JA 2C0YA 6PADA 3C9EA 4I04A 4YV8A 2FUDA 1E2TA 2PADA 2WBFX 2XU5A 1ATKA 1MDWA 1X9YA 1MIRA 3BOWA 5CHTA 3IOQA 1U9WA 1Y08A 1A6RA 1DEUA 2AS8A 2YJ2A 1VJVA 3KFQA 5PADA 4GUZA 4YYVA 3BC3A 3HWNA 1CSBB 3KWZA 1F2AA 4DMXA 1AYWA 1O0EA 2YJ9A 4CDEA 1NPZA 1POPA 3ZUAA 4XR7A 4ZUXU 7PCKA 3CH2X 2AIMA 3H89A 3RVVA 4YYQA 2E01A 1TL9A 1AYVA 4BSQA 2BDZA 4NV8A 3WXGA 1NL6A 1W4TA 2YJCA 2HHNA 1YK7A 1VSNA 1AU0A 3KX1A 2VHSA 1GX3A 2O6XA 1JQPA 4CDCB 4W5BA 1W5RA 4YYSA 4PP2E 5A24A 1ME3A 2HXZA 2VFCA 3MTNA 5F02A 2BDLA 2XU1A 3P5VA 3WXEA 3N3KA 1ME4A 2R9NA 3HHAA 3H7DA 3TNXA 3USVA 1AU4A 1QDQA 4FJCA 4RY2A 3K9MA 4YYUA 4X6IA 3PW3A 3GCBA 2JQGR 4XUIA 5EGWA 1U9XA 4CDEB 1EWPA 1ICFA 1AIMA 3H8BA 3P5XA 2B1NA 1AYUA 4YYRA 5JA7A 3HD3A 1BP4A 3KSEA 2AYOA 2DJGA 9PAPA 4FK5A 2FYEA 1F2CA 3E1ZB 4CDFB 1GECE 2Y5BA 1GCBA 3OISA 1PPNA 1U5IA 4BGFA 3O0UA 2FRAA 1MHWA 3QT4A 3MHSA 1CS8A 1QOLA 1NQCA 2E03A 4Q8HA 4YYWA 2DCAA 2F1GA 1ZIVA 1YK8A 1CJLA 3AI8A 3K24A 3S3RA 3LFYA 1CB5A 2IBIA 3IHPA 5CVMA 2OULA 3CBKA 4OELA 2DJFA 3O1GA 4BS6A 1K3BA 1KFUL 1KXRA 3F75A 2G6DA 1K3BB 2CB5A 2IPPB 3IEJA 3N4CA 5CVOB 4PI3A 4DMYA 2DCDA 2P0RA 2YJ8A 2VFBA 1U9VA 4QH6A 3OF8A 3H8CA 1PPPA 5EF4A 2OP3A 4NV7A 2AVWA 2NQIA 5JH3A 2E02A 3HHIA 4QRXA 4X6JA 3D9WA 4C5PA 3MHHA 2DC8A 1MEMA 4MZOA 4BQVA 1PE6A 3MORA 2DCCA 3OVZA 4CDDB 1W6FA 2NQAA 2FRQA 1NB3A 8PCHA 4MSXA 2GHUA 1THEA 4QRVA 3V6EA 1M6DA 1F2BA 2VHFA 1PPOA 3PBHA 1EWOA 1NLJA 1KFXL 3PNRA 1CQDA 3I06A 4I07A 2DZYA 1FH0A 1SNKA 2F7DA 2P86A 3QSDA 1Y4HA 4CDCA 4N8WA 1QXPA 2FT2A 1U9QX 2FO5A 2ACTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFO A;  2R9M A;  1NB5 A;  1STF E;  1YAL A;  1TU6 A;  3DF0 A;  2AUZ A;  4AXL A;  3QJ3 A;  1EWL A;  1S4V A;  1BY8 A;  2R6N A;  3OF9 A;  2FTD A;  3B79 A;  2R9F A;  3F5V A;  3KW9 A;  2DJG B;  1PCI A;  2HH5 A;  2AYN A;  2FQ9 A;  1PBH A;  2Y6E A;  1AEC A;  3S3Q A;  5CVN B;  1CPJ A;  1BQI A;  1PPD A;  4N4Z A;  5FPW A;  4WA6 A;  3BCN A;  3RVX A;  3V6C A;  2E00 A;  2PRE A;  4CZW A;  3IUT A;  2CIO A;  3BWK A;  1QMY A;  4BS5 A;  4CDD A;  1EWM A;  2NQG A;  1CTE A;  3OVX A;  4P6G A;  3RVW A;  5J94 A;  2DC9 A;  4G54 A;  3CBJ A;  4HWY A;  4N79 A;  2AUX A;  1GLO A;  4QBB A;  3H6S A;  1DF0 A;  4W5C A;  3CH3 X;  1BGO A;  3D6S A;  2AU1 A;  3ERV A;  2OZ2 A;  2XU3 A;  4PAD A;  3P5W A;  4Q8G A;  4FIP A;  1SP4 B;  1CV8 A;  4X6H A;  4W4U A;  2ARY A;  1GMY A;  3P5U A;  3N3G A;  4AXM A;  1EF7 A;  1KHP A;  3PDF A;  4I05 A;  1YVB A;  2R9O A;  2R9C A;  4OEM A;  1KHQ A;  2G8E A;  1PXV A;  2DC6 A;  3WXF A;  4K7C A;  1PIP A;  3M99 A;  2YJB A;  2DJF B;  2PNS A;  5CHV A;  1MS6 A;  1ITO A;  3IMA A;  3LXS A;  3K8U A;  1CVZ A;  3BPM A;  3U8E A;  1AU2 A;  2B1M A;  2P7U A;  1AU3 A;  4KLB A;  2DZZ A;  2ATO A;  1MEG A;  2NQD B;  4CDF A;  2PBH A;  2DC7 A;  3KKU A;  4BPV A;  1TLO A;  4YVA A;  1HUC B;  1F29 A;  2XU4 A;  4PP1 A;  3KWB X;  3I3T A;  4MZS A;  2HD5 A;  3IV2 A;  2H7J A;  4P6E A;  3NHE A;  1XKG A;  1ZCM A;  1IWD A;  1YT7 A;  1PAD A;  2G7Y A;  2JQF R;  2DCB A;  1Q6K A;  4QRG A;  5K16 A;  3BPF A;  2G8J A;  2C0Y A;  6PAD A;  3C9E A;  4I04 A;  4YV8 A;  2FUD A;  2PAD A;  2WBF X;  2XU5 A;  1ATK A;  1MDW A;  1X9Y A;  1MIR A;  3BOW A;  5CHT A;  3IOQ A;  1U9W A;  1Y08 A;  1A6R A;  1DEU A;  2AS8 A;  2YJ2 A;  1VJV A;  3KFQ A;  5PAD A;  4YYV A;  3BC3 A;  3HWN A;  1CSB B;  3KWZ A;  1F2A A;  4DMX A;  1AYW A;  1O0E A;  2YJ9 A;  4CDE A;  1NPZ A;  1POP A;  3ZUA A;  4XR7 A;  4ZUX U;  7PCK A;  3CH2 X;  2AIM A;  3H89 A;  3RVV A;  4YYQ A;  2E01 A;  1TL9 A;  1AYV A;  4BSQ A;  2BDZ A;  3WXG A;  1NL6 A;  2YJC A;  2HHN A;  1YK7 A;  1VSN A;  1AU0 A;  3KX1 A;  2VHS A;  2O6X A;  1JQP A;  4CDC B;  4W5B A;  4YYS A;  4PP2 E;  5A24 A;  1ME3 A;  2HXZ A;  3MTN A;  5F02 A;  2BDL A;  2XU1 A;  3P5V A;  3WXE A;  3N3K A;  1ME4 A;  2R9N A;  3HHA A;  3H7D A;  3TNX A;  3USV A;  1AU4 A;  1QDQ A;  4FJC A;  4RY2 A;  3K9M A;  4YYU A;  4X6I A;  3PW3 A;  3GCB A;  2JQG R;  4XUI A;  5EGW A;  1U9X A;  4CDE B;  1EWP A;  1ICF A;  1AIM A;  3H8B A;  3P5X A;  2B1N A;  1AYU A;  4YYR A;  5JA7 A;  3HD3 A;  1BP4 A;  3KSE A;  2AYO A;  2DJG A;  9PAP A;  4FK5 A;  2FYE A;  1F2C A;  3E1Z B;  4CDF B;  1GEC E;  2Y5B A;  1GCB A;  3OIS A;  1PPN A;  1U5I A;  3O0U A;  2FRA A;  1MHW A;  3QT4 A;  3MHS A;  1CS8 A;  1QOL A;  1NQC A;  2E03 A;  4Q8H A;  4YYW A;  2DCA A;  2F1G A;  1ZIV A;  1YK8 A;  1CJL A;  3AI8 A;  3K24 A;  3S3R A;  3LFY A;  1CB5 A;  2IBI A;  3IHP A;  5CVM A;  2OUL A;  3CBK A;  4OEL A;  2DJF A;  3O1G A;  4BS6 A;  1K3B A;  1KFU L;  1KXR A;  3F75 A;  2G6D A;  1K3B B;  2CB5 A;  2IPP B;  3IEJ A;  3N4C A;  5CVO B;  4PI3 A;  4DMY A;  2DCD A;  2P0R A;  2YJ8 A;  1U9V A;  4QH6 A;  3OF8 A;  3H8C A;  1PPP A;  5EF4 A;  2OP3 A;  2AVW A;  2NQI A;  5JH3 A;  2E02 A;  3HHI A;  4QRX A;  4X6J A;  3MHH A;  2DC8 A;  1MEM A;  4MZO A;  4BQV A;  1PE6 A;  3MOR A;  2DCC A;  3OVZ A;  4CDD B;  2NQA A;  2FRQ A;  1NB3 A;  8PCH A;  4MSX A;  2GHU A;  1THE A;  4QRV A;  3V6E A;  1M6D A;  1F2B A;  2VHF A;  1PPO A;  3PBH A;  1EWO A;  1NLJ A;  1KFX L;  3PNR A;  1CQD A;  3I06 A;  4I07 A;  2DZY A;  1FH0 A;  1SNK A;  2F7D A;  2P86 A;  3QSD A;  1Y4H A;  4CDC A;  4N8W A;  1QXP A;  2FT2 A;  1U9Q X;  2FO5 A;  2ACT A; 
#chains in the Genus database with same CATH topology
 2BT9 A;  2OZQ A;  4D8E A;  1QY2 A;  2FKJ A;  4N7C A;  4O3W A;  3D95 A;  1LCW A;  2FTD A;  3FA8 A;  4GJS A;  4ZJ0 A;  2RTF B;  4WFV A;  1CBI A;  3KW9 A;  1MX8 A;  1PCI A;  2NNE A;  1BWY A;  2AYN A;  4O3Z A;  3S3Q A;  5F2B A;  3WYQ A;  2X56 A;  3BS2 A;  3HTY A;  3VPJ E;  1ZNL A;  3C0R A;  4AYH A;  1U18 A;  1VYG A;  3ZNH A;  3RVX A;  4GKC A;  1SWL A;  5HZ6 A;  2X46 A;  3T2X A;  2NQG A;  1CTE A;  1KT4 A;  1BRQ A;  3OVX A;  3NX2 A;  5H8T A;  4HPD A;  1DC9 A;  2HZQ A;  3MVF A;  5J94 A;  5K06 A;  5B11 O;  1I06 A;  4HWY A;  4RF1 A;  2AUX A;  1GLO A;  2R56 A;  2X4M A;  3CMP A;  3CH3 X;  1BJ7 A;  1VWB B;  4YVB A;  2OZ2 A;  5LJC A;  1ZNG A;  4Y0R A;  3P5W A;  4Q8G A;  4UU2 A;  1D3S A;  5E6J A;  2C1Q A;  1EXS A;  5L8N A;  4ORX A;  3FMZ A;  4AXM A;  1VWM B;  1LDO A;  3VHM A;  5IO6 A;  2Q39 A;  3VE1 A;  1YVB A;  1ZRY A;  4I3D A;  1KFF A;  1HXZ A;  2DC6 A;  1GM6 A;  4K7C A;  3CQN A;  1PIP A;  1SY0 A;  2GH7 A;  4OVZ B;  1VWR B;  3SLO A;  1IJ8 A;  2WR6 A;  1NC9 A;  2PNS A;  2AF5 A;  1MS6 A;  4IAX A;  4QAE A;  3E9S A;  5IXG A;  1JJX A;  3LXS A;  4Z6J A;  1CBR A;  3OJY C;  4ORY A;  1CVZ A;  3BX8 A;  4GUA A;  3WOV A;  1HMT A;  3VG2 A;  3NQ9 A;  2OL7 A;  4O4U A;  3PQU A;  1ACD A;  3RDQ A;  3UEV A;  3FR2 A;  4D8I A;  2L67 A;  3O2Y A;  3VGW A;  3PK2 A;  1YUP A;  5CE4 A;  3EC5 A;  3KWB X;  1HMR A;  4DQ4 A;  4U8U O;  4P6E A;  1OEE A;  3CBC A;  1SRI A;  1I78 A;  3FW5 A;  1XKG A;  3BU1 A;  3KZA A;  1ZCM A;  1PAD A;  5F7G A;  2G7Y A;  2JQF R;  3UEX A;  2G8J A;  3WJG A;  5HA0 A;  4I04 A;  3AEH A;  3IFB A;  1ATK A;  1GGL A;  1MDW A;  1X9Y A;  3GE2 A;  3P6G A;  1MIR A;  4YH0 A;  3BOW A;  5CHT A;  4EEJ A;  1U9W A;  4COT A;  4IMN A;  2AS8 A;  2YJ2 A;  4ORS A;  2HMB A;  3ZW0 A;  2FT9 A;  4IMO A;  1SWD A;  3WVM A;  3ZUI A;  5D8J A;  2DM5 A;  3KFQ A;  1JJU A;  2JU7 A;  3BC3 A;  3L4R A;  1LIE A;  1AYW A;  1VPR A;  4CDE A;  4UU3 A;  2CM4 A;  4O49 A;  2OY7 A;  1VWN B;  1KT6 A;  3NQ3 A;  2AIM A;  2QOS C;  4YGZ A;  3GAQ A;  3P02 A;  4BSQ A;  4IP3 A;  1VWO B;  2ASN X;  2IZF B;  4NV8 A;  1AVD A;  1SWC A;  2HHN A;  1ZNH A;  5LJG A;  3AKN A;  1IW2 A;  1AU0 A;  1YK7 A;  3SZJ A;  2KT4 B;  2OFM X;  2AT5 X;  2O6X A;  2JOZ A;  3TGA A;  1LDQ A;  1SLG B;  4BOZ A;  1KOI A;  5B5G A;  4YYS A;  5HA1 A;  1ME3 A;  5FAZ A;  3MTN A;  2XU1 A;  4JGL A;  4OKA A;  5HCC C;  3N3K A;  4I3C A;  3HHA A;  2OFA A;  1SWS A;  1S44 A;  4IB7 A;  1MEP A;  4RNA A;  4FJC A;  4RY2 A;  4QYN A;  2JN3 A;  1IFB A;  4OS0 A;  4ORU A;  3BY4 A;  3BRN A;  3HD3 A;  4EKV A;  1QFT A;  3K3L A;  1QY1 A;  4AZP A;  2DJG A;  9PAP A;  1DZP A;  1OPB A;  3FEK A;  2FYE A;  3VG5 A;  4CDF B;  3BDR A;  2R73 A;  4GZV A;  2Q9S A;  1DF8 A;  4AZN A;  4O3X B;  2FRA A;  3BSZ E;  1UKF A;  5KIC A;  5LJB A;  5LJK A;  1QOL A;  5HTE A;  1BSQ A;  1N0S A;  4L3R A;  1CBQ A;  2J7Q A;  2AT0 X;  4GDZ A;  1CJL A;  3S3R A;  3HWF A;  3ZW1 A;  3WJF A;  1CB5 A;  5CVM A;  4QZT A;  1OBQ A;  1Y9T A;  5HZ9 A;  4OEL A;  2F73 A;  3O1G A;  3PQS A;  1HQP A;  1KFU L;  4BVM A;  2G6D A;  3S5V A;  2IPP B;  4GNW A;  1RST B;  1STS B;  1QWD A;  2O62 A;  2YJ8 A;  1SWA A;  2MWH A;  4PSQ A;  4I60 A;  5HZ5 A;  3D4R A;  5CHK A;  3H8C A;  2OP3 A;  2FE8 A;  4NV7 A;  3RBY A;  3SOT A;  4U8U N;  4MM3 B;  3HHI A;  2A8G A;  4QRX A;  4OS8 A;  4A8Z A;  3MHH A;  1KT5 A;  4MZO A;  4BQV A;  1PE6 A;  2DCC A;  3RDX A;  2CZT A;  3HWE A;  3OVZ A;  4ZHD A;  4NYQ A;  3DTQ A;  4U9C A;  1NB3 A;  2GHU A;  3V6E A;  4QRV A;  3W30 A;  1M6D A;  1FJ1 E;  2MM3 A;  4I9R A;  1PPO A;  3P6H A;  1KQX A;  5HAE A;  2DZY A;  1DF3 A;  3TMP A;  2F7D A;  2M4L A;  4OS3 A;  2CAM A;  1MUP A;  5EZQ A;  2X8F A;  2X34 A;  2CZU A;  4LQZ A;  4MIS A;  1GT5 A;  1FTP A;  4Y59 A;  4ALO A;  2ACO A;  1YAL A;  5L8I A;  1A57 A;  5FFH A;  5LJD A;  2ZAI A;  2AUZ A;  5BYP A;  1X8U A;  4EQA C;  3APX A;  2OY5 O;  4XMF A;  1N4J A;  4A5U A;  4XMH A;  5HZ8 A;  3FR5 A;  1UYO X;  3OBL A;  3F5V A;  2A5B A;  1MOY A;  3KFH A;  3MBT A;  2FQ9 A;  1GKA A;  1AEC A;  3RZY A;  4TKB A;  2W2A A;  5IRA A;  4O4X A;  1VWE B;  1SY3 A;  1PPD A;  5KHP A;  4DCB A;  5FPW A;  4WA6 A;  3IA8 A;  3FR4 A;  4NYR A;  2PRE A;  1FE3 A;  3O22 A;  1LIF A;  1EIO A;  1KT3 A;  2JGS A;  1B8E A;  4BS5 A;  2AT8 X;  3EYC A;  1CBS A;  3T6L A;  3FYF A;  3NQK A;  3RVW A;  1GT4 A;  1RXH A;  1PTS A;  5B5F A;  2IZL B;  1SXW A;  5F58 A;  2DC9 A;  1HQQ A;  4N79 A;  1YIV A;  3H6S A;  1SY2 A;  5EED A;  1DF0 A;  3JS1 A;  4LKT A;  2RCQ A;  3D6S A;  4EDE A;  4BOU A;  5EZ2 A;  4L1N A;  4FIP A;  3T2W A;  4R3D A;  5FQ8 E;  5B29 A;  2NNQ A;  2W2B A;  2Q4N A;  3VG6 A;  4W4U A;  2ARY A;  5EDB A;  1LCZ A;  2AT3 X;  5AJB A;  4ZR2 A;  1FEN A;  3APU A;  4QRL A;  3S60 A;  5FEN A;  4KH8 A;  4U46 A;  1LNM A;  4I95 A;  4OEM A;  1KHQ A;  4NNT A;  2G79 A;  2UZ2 A;  3DSZ A;  3WJD A;  3LV4 A;  1XKI A;  2X8T A;  1IKJ A;  3NBX X;  1A3Y A;  2GTF X;  2L9C A;  5D4A A;  2DJF B;  2RTQ B;  5FQ6 E;  5CHV A;  4JNJ A;  2P8G A;  2LA7 A;  5HCD C;  3CWK A;  3BPM A;  2Y3F A;  2AL0 X;  4LZU A;  1PMP A;  1AU2 A;  4YFQ A;  2P7U A;  1T68 X;  5KID A;  4TNN A;  3O65 A;  2ATO A;  3VG7 A;  4CDF A;  3CKF A;  1TLO A;  2G8C O;  3G7X A;  1U17 A;  1F29 A;  2FS6 A;  1Y0G A;  3VG3 A;  4PP1 A;  4EXZ A;  4BJ8 A;  4CPF A;  2OVA A;  3I3T A;  5H9K A;  1LIB A;  3LHN A;  5K68 A;  1VWL B;  1IWD A;  1YT7 A;  4ORW A;  1WUB A;  3RNV A;  3B2L A;  2RTD B;  3BY0 A;  3BPF A;  2C0Y A;  4QQ1 A;  1RBP A;  2IZJ A;  2IZD B;  5IRU A;  2PAD A;  2WBF X;  3PHX A;  3ZW1 B;  1STR B;  2RTN B;  2YMS A;  4IUM A;  5DG4 A;  1Y08 A;  1OSP O;  1RLB E;  5AJC A;  4INN A;  3T1D A;  5BVQ A;  2DOS A;  2A3F X;  4BX6 A;  1OPA A;  1LID A;  4O3Y A;  1O1V A;  4ARH A;  5F6B A;  3HWN A;  2IZG B;  4DMX A;  2LKK A;  3RE6 A;  4A1H A;  3RDU A;  2PY1 A;  3ZUA A;  1YWB A;  1DV9 A;  7PCK A;  4AW8 A;  1KL3 A;  3TGC A;  1JZU A;  2QCB A;  2BDZ A;  4MEE A;  3MM0 A;  1NL6 A;  2QMI A;  3NX1 A;  2HYS A;  3ZQ3 A;  3KFF A;  1VSN A;  3KX1 A;  5H9A A;  2I5Z O;  1SY1 A;  1LF7 A;  1SRH A;  4KII A;  1X89 A;  3EMM A;  4YGH A;  2WEX A;  3ZWE A;  4CV7 A;  4U3Q A;  4PP2 E;  4YKO A;  3C77 X;  2A5C A;  2LB6 A;  5A24 A;  2RTO B;  2HXZ A;  3U9P C;  2BDL A;  1I9H A;  2BTW B;  2CBR A;  3WXE A;  1B56 A;  2Z4H A;  3OQC A;  3TNX A;  1Z24 A;  2QO6 A;  1AU4 A;  1QDQ A;  1TXL A;  5EEE A;  3TRK A;  3K9M A;  4YYU A;  3PW3 A;  3GCB A;  5DPQ A;  5EGW A;  1EWP A;  2IFB A;  5D48 A;  2JTC A;  2A13 A;  2B1N A;  1MVG A;  1BP4 A;  3KSE A;  2QO4 A;  3P24 A;  1X8N A;  1AVG I;  1SXX A;  3VG4 A;  2Q2M A;  4M7M A;  1KXO A;  3E1Z B;  2E4J A;  2RTM A;  2Y5B A;  1E06 A;  1GCB A;  3QKG A;  1PPN A;  2I5V O;  4GGT A;  4BGF A;  2WUT A;  2OY8 A;  2CM9 A;  3NPO A;  3I17 A;  4BBO A;  4M0W A;  2E03 A;  4BX5 B;  2BC3 A;  3RDM A;  4Q8H A;  4GET A;  4BX6 B;  1X8O A;  4Y0S A;  3EBW A;  2DCA A;  1VWP B;  1JBH A;  1ZIV A;  1YK8 A;  1BSY A;  1AQB A;  4YCH A;  3AI8 A;  3K24 A;  3IHP A;  4O9S A;  3WZQ A;  2DJF A;  1X8Q A;  3CKG A;  2HNX A;  3RDS A;  1KXR A;  1VWQ B;  3ELX A;  3FA6 A;  3N4C A;  3V8U A;  2N93 A;  4ZHH A;  4ODD A;  4QYP A;  1EI5 A;  1U9V A;  4YKM A;  1PPP A;  1VWI B;  4CPE A;  1BLR A;  2E02 A;  4QNI A;  4C5P A;  2DC8 A;  1MEM A;  3TF6 A;  1LFO A;  1SWN A;  4RKX A;  3VE2 A;  3ZW2 A;  1KZW A;  8PCH A;  1SRF A;  3FID A;  2RTH B;  1O8V A;  2RTE B;  1THE A;  2RTK A;  1EAL A;  1UZ2 X;  3FEP A;  1NP1 A;  4RUU A;  3IFU A;  2IZC B;  1MDC A;  1CQD A;  4I07 A;  1FH0 A;  1SNK A;  2HWK A;  4RUN A;  4CDC A;  2AT6 X;  2FLJ A;  5JD2 A;  2AGA A;  5L8O A;  3HWD A;  1RAV A;  2A2G A;  2ACT A;  3AUM O;  3OE3 A;  4ALB A;  2GFO A;  2JU8 A;  4JHQ A;  1ML7 A;  1TVQ A;  5CSE A;  3FEN A;  1G85 A;  1STF E;  4TQ2 A;  1E02 A;  2Z4I A;  1TU6 A;  3DF0 A;  4AXL A;  1PM1 X;  5EDC A;  3STK A;  4HPB A;  4CPI A;  2IZI A;  1BY8 A;  2R6N A;  3OF9 A;  1ZNK A;  1ZNE A;  4GGR A;  2WWP A;  1Y53 X;  2FHN X;  5LJH A;  4HWM A;  4ZTB A;  2FTB A;  1N43 A;  5IO5 A;  1TOW A;  1BQI A;  3P6F A;  4Y0Q A;  4N4Z A;  4R0B A;  4Z27 A;  4FBR A;  4MVK A;  1SWJ A;  3B2J A;  1HBP A;  1E5P A;  4YMY A;  4OMW A;  1RXJ A;  4BX7 A;  4Z28 A;  2ZSC A;  4ZHC A;  3IUT A;  1G7N A;  4ORR A;  2CIO A;  3BWK A;  1ZND A;  1QMY A;  4AZM A;  4CDD A;  3WJC A;  2K23 A;  1EWM A;  2F01 A;  1SXY A;  4P6G A;  3W31 A;  2L68 A;  4A1Y A;  1VWC B;  4QGW A;  4MIR A;  2KTS A;  1SWB A;  1EQD A;  2MO5 A;  2R74 A;  4HFO A;  2XKL A;  1FEL A;  2C1S A;  5CYB A;  4W5C A;  1ERX A;  1BGO A;  3D96 A;  2AU1 A;  3ERV A;  2XU3 A;  5F1E A;  4ZGU A;  1CV8 A;  4X6H A;  1TW4 A;  4OVZ A;  5HTD A;  2RTC B;  4I05 A;  4GDA A;  2R9O A;  2R9C A;  1YWA A;  3STN A;  1PXV A;  2ANS A;  3SZI A;  4GH7 A;  3WXF A;  4ZCB A;  1VWA B;  2Q2P A;  4U8U M;  3JQO A;  3M99 A;  2BLG A;  1HBQ A;  3RWX A;  1MK5 A;  3F8A A;  2YJB A;  1ERB A;  1MX7 A;  3BBA A;  1SWU A;  3K8U A;  4ZFX A;  2BSZ A;  1JIW I;  3U8E A;  3CR6 A;  4KC7 A;  5D47 A;  1AU3 A;  1LIC A;  2NQD B;  2DC7 A;  4WFU A;  4BPV A;  4IBA A;  4NLJ A;  1HUC B;  2LBA A;  3D97 A;  4O4S A;  2OF8 A;  4ZHG A;  1GT1 A;  3UEW A;  4MZS A;  3IV2 A;  2H7J A;  3NHE A;  4ZH9 A;  4GJV A;  3RSW A;  3TGB A;  4NNS A;  1DZJ A;  3WZP A;  4KCA A;  4I6S A;  4D6B A;  5K16 A;  2X8S A;  3C9E A;  5B3M O;  4TLJ A;  3SZH A;  3ZZV A;  4YV8 A;  1NGL A;  2FUD A;  1LEL A;  2AVI A;  2LBV A;  2XU5 A;  5K67 A;  4IRW A;  5D45 A;  5IRW A;  3H3I A;  4IAB A;  3IOQ A;  1VYF A;  1A6R A;  1DEU A;  2OFB A;  3KQ0 A;  5EPQ A;  2NP1 A;  2RN4 A;  3T6F A;  4ML7 B;  3HWG A;  5BVS A;  4WUR A;  1VJV A;  3ZW0 B;  1NP4 A;  2WPU A;  1JV4 A;  5PAD A;  4ES7 A;  4YYV A;  3EW2 A;  1CSB B;  2YJ9 A;  1POP A;  1YWC A;  1PEE A;  4XR7 A;  4ZUX U;  2GJ5 A;  1G5W A;  3RVV A;  2F09 A;  4YYQ A;  3FIQ A;  2E01 A;  4JO6 A;  3WXG A;  1BSO A;  3B21 A;  2PI3 O;  1G74 A;  1AEL A;  2BS6 A;  1YZB A;  5KO3 A;  1JYD A;  2RTP B;  1JQP A;  1HN2 A;  1Y55 X;  1W5R A;  3HOL A;  1T8V A;  1WBI A;  1A2D A;  2LFO A;  1EW3 A;  5F02 A;  3P5V A;  1SXU A;  2HKD A;  1ME4 A;  3USV A;  5F6Z A;  2YG2 A;  4IB6 A;  3EW1 A;  3C78 X;  5LKE A;  4GRJ A;  3PP6 A;  4X6I A;  1N9M A;  1JMZ A;  3UEU A;  4NLI A;  1NBX A;  3NR3 A;  4ON1 A;  1B0O A;  1ICF A;  4I3B A;  5IO7 A;  2K62 A;  4CSB A;  1O1U A;  1ICM A;  3H8B A;  1AB0 A;  5B10 O;  4ZHF A;  1AYU A;  4YYR A;  5JA7 A;  2UZJ A;  2BHV A;  2ZAG A;  2WEW A;  3B2I A;  3ZUO A;  3P6C A;  1QQS A;  1GT3 A;  1SWO A;  1F2C A;  3PSE A;  1GXA A;  1KL5 A;  1N7Y A;  3PH6 A;  1SLF B;  2BS5 A;  2Y32 A;  3OIS A;  3APW A;  4N7D A;  3WJE A;  4D8B A;  1YWD A;  3QT4 A;  2XST A;  1KQW A;  3AKM A;  1SLE B;  4Z2O A;  1NQC A;  4YYW A;  1SWF A;  1VWF B;  2RQ0 A;  1FEM A;  2F1G A;  3BLG A;  2Y3E A;  5BVT A;  2IBI A;  2IZE B;  5AQ6 A;  1HXL A;  1IIU A;  4KC8 A;  3E3C A;  2G5L A;  4XZX A;  1SWH A;  3WZN A;  1K3B A;  3MX7 A;  1EPB A;  2CB5 A;  3IEJ A;  1K24 A;  1BM5 A;  5EZS A;  4PI3 A;  1R0U A;  4DMY A;  2DCD A;  3VU1 A;  1STP A;  2OFR X;  1FDQ A;  5HZQ A;  4I9S A;  3OF8 A;  3HK1 A;  2NQI A;  1T0V A;  4O4O A;  3SLT A;  4YGG A;  3D9W A;  1KT7 A;  4BOQ A;  3FDC A;  3STM X;  4TKH A;  3ELZ A;  2FKG A;  3NP1 A;  3MOR A;  5JZE A;  2NQA A;  1W6F A;  2FR2 A;  3KFG A;  1H91 A;  2FRQ A;  4BOE A;  1VWG B;  4MSX A;  1NQM A;  3FW4 A;  2G7B A;  2MF6 A;  4DNE A;  4BOP A;  1F2B A;  3WBG A;  1NLJ A;  1KFX L;  3PNR A;  4BX7 B;  3CBS A;  3QSD A;  2IZK A;  5B27 A;  4ID2 A;  1QXP A;  4PT5 A;  3P6D A;  3FA7 A;  1YP6 A;  2R9M A;  1NB5 A;  4Z2V A;  4KT5 A;  1JMX A;  1BRP A;  2WSJ A;  4YFR A;  4B55 A;  5FQ7 E;  3QJ3 A;  3B2H A;  4YDB A;  1EWL A;  4OMX A;  1LPJ A;  5HCE C;  1S4V A;  3FA9 A;  2GTL M;  4XMG A;  1KL4 A;  2RCT A;  3B79 A;  2A2U A;  3MG5 A;  4CPH A;  4GE1 A;  2R9F A;  4D6A A;  4RF0 A;  2DJG B;  2HH5 A;  4K19 A;  1PBH A;  2Y6E A;  1OBP A;  1TOU A;  1QAB E;  1I04 A;  5CVN B;  1CPJ A;  2IZB A;  1DZM A;  4TJZ A;  1LKE A;  3SLJ A;  1NDJ A;  3FEL A;  1LCV A;  1S7D A;  1EUO A;  3BCN A;  3V6C A;  2E00 A;  1VWH B;  3PRP A;  1RXK A;  4ZH6 A;  5AEO A;  1XCA A;  4CZW A;  3CQR A;  2GTL N;  3OD9 A;  5HBS A;  1URE A;  3BU9 A;  3MP2 A;  4WHI A;  2AKQ A;  4PJ2 A;  3KVN A;  4G54 A;  3CBJ A;  3WZO A;  4QBB A;  4ZGF A;  3UAQ A;  4BX5 A;  3Q6L A;  3S26 A;  2WQA E;  4WBK A;  4PAD A;  1DKI A;  2JW1 A;  1SP4 B;  4NP1 A;  1GMY A;  4GK9 A;  1CRB A;  3I0A A;  3P5U A;  1X71 A;  3N3G A;  1I4U A;  1EF7 A;  2MJI A;  3PDF A;  2GC9 A;  1KHP A;  4AZR A;  3F9D A;  2OY1 O;  2FGS A;  2G8E A;  2EU7 X;  4Y5D A;  1IKE A;  1HY2 A;  3BX7 A;  4GGZ A;  4YFP A;  1PVJ A;  3KFI A;  5C0N A;  3BB7 A;  2W2F A;  3PPT A;  4HPA A;  4P16 A;  2G78 A;  4XMC A;  3RY2 A;  5JR8 A;  2ALL X;  1ITO A;  3IMA A;  3FLL A;  1UYN X;  4A60 A;  4BCS A;  2BU3 A;  4GU8 A;  1VWK B;  3LTW A;  1SRJ A;  4FBV A;  2B1M A;  4KLB A;  1SWK A;  2DZZ A;  1MEG A;  2PBH A;  3KKU A;  2RTG B;  2X55 A;  4YVA A;  2RTL A;  3O19 A;  1VYO A;  2XU4 A;  1ICN A;  3RY1 A;  1VWD B;  2HD5 A;  1GX8 A;  1MM9 A;  2FS7 A;  3RKG A;  2NND A;  4FBO A;  2DCB A;  4QZU A;  1Q6K A;  2HLV A;  2OVD A;  4QGX A;  4QRG A;  3WJB A;  6PAD A;  1HMS A;  1SWT A;  4M6S A;  3VHI A;  1E2T A;  4QGV A;  1IFC A;  3HPE A;  2OVS A;  4IB8 A;  1QG5 A;  2IZH B;  3EM0 A;  3SAO A;  1OEK A;  2RTJ A;  1RSU B;  2RTI B;  4XME A;  1CJ5 A;  3RDO A;  1GKA B;  2VDF A;  2HZR A;  1KZX A;  2FRS A;  4YBU A;  1I05 A;  4AZQ A;  4FGI B;  2WQ9 A;  4GUZ A;  3P6E A;  4YCE A;  3KWZ A;  1F2A A;  2OL6 O;  1O0E A;  1NPZ A;  2QM9 A;  1EPA A;  1JJJ A;  1S2P A;  3HOE A;  3MJ5 A;  2OYB O;  3CH2 X;  3H89 A;  4DQ3 A;  3U0D A;  1TL9 A;  1B4M A;  1U0X A;  5H9L A;  1AYV A;  3PH5 A;  3U03 A;  1EII A;  1W4T A;  2YJC A;  1SLD B;  4IAW A;  2Z84 A;  1KGL A;  2KD2 A;  1ALB A;  2JRI A;  4YDA A;  1SWE A;  2VHS A;  1GX3 A;  2JMB A;  1SMP I;  4CDC B;  4W5B A;  2RD7 C;  1GX9 A;  1YP7 A;  1SA8 A;  1E00 A;  3F6Z B;  2JU3 A;  2CBS A;  2VFC A;  1OEJ A;  3NAD A;  2RTB B;  3VHH A;  3PRM A;  2BTW A;  2R9N A;  1ADL A;  3H7D A;  4MVL A;  1Y52 X;  4LKP A;  3MTV A;  1SWG A;  2OF9 A;  1OBU A;  4FQB B;  4EFG A;  2JQG R;  1LUQ A;  4XUI A;  3B2K A;  1U9X A;  4CDE B;  3ZI8 A;  1AIM A;  1QFV A;  3P5X A;  2KTD A;  3QQ2 A;  1A18 A;  3PT2 A;  4NW4 A;  2AYO A;  3S5X A;  4FK5 A;  2RA6 A;  2IZA A;  1BEB A;  4MI7 A;  3WXQ A;  1GEC E;  3PHU A;  1BBP A;  1SWR A;  2FWV A;  1P6P A;  2RTA A;  4MVI A;  1U5I A;  4IB9 A;  3APV A;  3O0U A;  1MHW A;  3MHS A;  2J7Q C;  1JYJ A;  3PED A;  1CS8 A;  3JSQ A;  2X45 A;  4BQU A;  1PBO A;  2GTL O;  2L5P A;  2AMM X;  5HWZ A;  3PHW A;  3X00 A;  3LFY A;  4XMD A;  2QOM A;  2OUL A;  4BOS A;  4TKJ A;  3PEC A;  3CBK A;  4OW0 A;  4Y0P A;  1SWQ A;  4BS6 A;  5B2A O;  1N9Y A;  2ACP X;  2AH7 X;  3F75 A;  3RE5 A;  1PBY A;  1K3B B;  1X8P A;  2MHD A;  5CVO B;  2X32 A;  2P0R A;  3N91 A;  5LKF A;  2KW1 A;  2OL8 O;  2OVE A;  2VFB A;  4QH6 A;  1D2U A;  1Y9L A;  2POA A;  5EF4 A;  4GNY A;  2FR3 A;  2AVW A;  4Z2P A;  4YBP A;  5L3Y A;  1AVE A;  5JH3 A;  4LZV A;  4CPH B;  1DZK A;  4X6J A;  1SRG A;  5H9N A;  1NQN A;  3Q34 A;  1DFV A;  3WYP A;  2FHL A;  4MVE A;  1QY0 A;  3TZS A;  1VWJ B;  4CDD B;  4REZ A;  1SWP A;  2A0A A;  4CK4 A;  3C76 X;  4GD9 A;  2UYW A;  2RTR B;  2VHF A;  4HXD B;  3EBK A;  2QO5 A;  3PBH A;  1EWO A;  3I06 A;  5LJE A;  2C4I A;  1L6M A;  2P86 A;  4HPC A;  1SRE A;  1Y4H A;  4N8W A;  2FT2 A;  4AZO A;  1U9Q X;  2FO5 A; 
#chains in the Genus database with same CATH homology
 2GFO A;  2R9M A;  1NB5 A;  1STF E;  1YAL A;  1TU6 A;  3DF0 A;  2AUZ A;  4B55 A;  4AXL A;  3QJ3 A;  1EWL A;  1S4V A;  1BY8 A;  2R6N A;  3OF9 A;  2FTD A;  3B79 A;  2R9F A;  3F5V A;  3KW9 A;  2DJG B;  1PCI A;  2HH5 A;  2AYN A;  2FQ9 A;  1PBH A;  2Y6E A;  1AEC A;  3S3Q A;  5CVN B;  1CPJ A;  1BQI A;  1PPD A;  4N4Z A;  5FPW A;  4WA6 A;  3BCN A;  3RVX A;  3V6C A;  2E00 A;  2PRE A;  4CZW A;  3IUT A;  2CIO A;  3BWK A;  1QMY A;  4BS5 A;  4CDD A;  1EWM A;  2NQG A;  1CTE A;  3OVX A;  4P6G A;  3RVW A;  5J94 A;  2DC9 A;  4G54 A;  3CBJ A;  4HWY A;  4N79 A;  2AUX A;  1GLO A;  4QBB A;  3H6S A;  1DF0 A;  4W5C A;  3CH3 X;  1BGO A;  3D6S A;  2AU1 A;  3ERV A;  2OZ2 A;  2XU3 A;  4PAD A;  3P5W A;  4Q8G A;  4FIP A;  1SP4 B;  1CV8 A;  4X6H A;  4W4U A;  2ARY A;  1GMY A;  3P5U A;  3N3G A;  4AXM A;  1EF7 A;  1KHP A;  3PDF A;  4I05 A;  1YVB A;  2R9O A;  2R9C A;  4OEM A;  1KHQ A;  2G8E A;  1PXV A;  2DC6 A;  3WXF A;  4K7C A;  1PIP A;  3M99 A;  2YJB A;  2DJF B;  2PNS A;  5CHV A;  1MS6 A;  1ITO A;  3IMA A;  3LXS A;  3K8U A;  1CVZ A;  2BSZ A;  3BPM A;  3U8E A;  3LTW A;  1AU2 A;  2B1M A;  2P7U A;  1AU3 A;  4KLB A;  2DZZ A;  2ATO A;  1MEG A;  2NQD B;  4CDF A;  2PBH A;  2DC7 A;  3KKU A;  4BPV A;  1TLO A;  4YVA A;  1HUC B;  1F29 A;  2XU4 A;  4PP1 A;  3KWB X;  3I3T A;  4MZS A;  2HD5 A;  3IV2 A;  2H7J A;  4P6E A;  3NHE A;  1XKG A;  1ZCM A;  1IWD A;  1YT7 A;  1PAD A;  2G7Y A;  2JQF R;  2DCB A;  1Q6K A;  4QRG A;  5K16 A;  3BPF A;  2G8J A;  2C0Y A;  6PAD A;  3C9E A;  4I04 A;  4YV8 A;  2FUD A;  1E2T A;  2PAD A;  2WBF X;  2XU5 A;  1ATK A;  1MDW A;  1X9Y A;  1MIR A;  3BOW A;  5CHT A;  3IOQ A;  1U9W A;  1Y08 A;  1A6R A;  1DEU A;  2AS8 A;  2YJ2 A;  1VJV A;  3KFQ A;  5PAD A;  4GUZ A;  4YYV A;  3BC3 A;  3HWN A;  1CSB B;  3KWZ A;  1F2A A;  4DMX A;  1AYW A;  1O0E A;  2YJ9 A;  4CDE A;  1NPZ A;  1POP A;  3ZUA A;  4XR7 A;  4ZUX U;  7PCK A;  3CH2 X;  2AIM A;  3H89 A;  3RVV A;  4YYQ A;  2E01 A;  1TL9 A;  1AYV A;  4BSQ A;  2BDZ A;  4NV8 A;  3WXG A;  1NL6 A;  1W4T A;  2YJC A;  2HHN A;  1YK7 A;  1VSN A;  1AU0 A;  3KX1 A;  2VHS A;  1GX3 A;  2O6X A;  1JQP A;  4CDC B;  4W5B A;  1W5R A;  4YYS A;  4PP2 E;  5A24 A;  1ME3 A;  2HXZ A;  2VFC A;  3MTN A;  5F02 A;  2BDL A;  2XU1 A;  3P5V A;  3WXE A;  3N3K A;  1ME4 A;  2R9N A;  3HHA A;  3H7D A;  3TNX A;  3USV A;  1AU4 A;  1QDQ A;  4FJC A;  4RY2 A;  3K9M A;  4YYU A;  4X6I A;  3PW3 A;  3GCB A;  2JQG R;  4XUI A;  5EGW A;  1U9X A;  4CDE B;  1EWP A;  1ICF A;  1AIM A;  3H8B A;  3P5X A;  2B1N A;  1AYU A;  4YYR A;  5JA7 A;  3HD3 A;  1BP4 A;  3KSE A;  2AYO A;  2DJG A;  9PAP A;  4FK5 A;  2FYE A;  1F2C A;  3E1Z B;  4CDF B;  1GEC E;  2Y5B A;  1GCB A;  3OIS A;  1PPN A;  1U5I A;  4BGF A;  3O0U A;  2FRA A;  1MHW A;  3QT4 A;  3MHS A;  1CS8 A;  1QOL A;  1NQC A;  2E03 A;  4Q8H A;  4YYW A;  2DCA A;  2F1G A;  1ZIV A;  1YK8 A;  1CJL A;  3AI8 A;  3K24 A;  3S3R A;  3LFY A;  1CB5 A;  2IBI A;  3IHP A;  5CVM A;  2OUL A;  3CBK A;  4OEL A;  2DJF A;  3O1G A;  4BS6 A;  1K3B A;  1KFU L;  1KXR A;  3F75 A;  2G6D A;  1K3B B;  2CB5 A;  2IPP B;  3IEJ A;  3N4C A;  5CVO B;  4PI3 A;  4DMY A;  2DCD A;  2P0R A;  2YJ8 A;  2VFB A;  1U9V A;  4QH6 A;  3OF8 A;  3H8C A;  1PPP A;  5EF4 A;  2OP3 A;  4NV7 A;  2AVW A;  2NQI A;  5JH3 A;  2E02 A;  3HHI A;  4QRX A;  4X6J A;  3D9W A;  4C5P A;  3MHH A;  2DC8 A;  1MEM A;  4MZO A;  4BQV A;  1PE6 A;  3MOR A;  2DCC A;  3OVZ A;  4CDD B;  1W6F A;  2NQA A;  2FRQ A;  1NB3 A;  8PCH A;  4MSX A;  2GHU A;  1THE A;  4QRV A;  3V6E A;  1M6D A;  1F2B A;  2VHF A;  1PPO A;  3PBH A;  1EWO A;  1NLJ A;  1KFX L;  3PNR A;  1CQD A;  3I06 A;  4I07 A;  2DZY A;  1FH0 A;  1SNK A;  2F7D A;  2P86 A;  3QSD A;  1Y4H A;  4CDC A;  4N8W A;  1QXP A;  2FT2 A;  1U9Q X;  2FO5 A;  2ACT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...