1JQPA

Dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
438
structure length
348
Chain Sequence
DTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHETMTGWVHDVLGRNWACFVGKKMLSLPESWDWRNVRGINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHPFNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tetrameric dipeptidyl peptidase I directs substrate specificity by use of the residual pro-part domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
molecule keywords dipeptidyl peptidase I
total genus 100
structure length 348
sequence length 438
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 1jqpA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1jqpA02
2R9OA 4N79A 3H8BA 3U8EA 1F29A 2FO5A 1CVZA 1MEMA 1BGOA 3BWKA 3GCBA 2YJ9A 1HUCB 4Q8HA 2Y6EA 1GECE 1U5IA 2ARYA 3WXGA 4YV8A 1FH0A 1SP4B 1NL6A 3MHSA 3RVXA 4W4UA 3V6CA 4HWYA 1EWLA 2NQGA 2XU4A 1ITOA 2JQGR 1AU4A 2VHSA 4PI3A 1CTEA 2DCAA 4X6HA 1VSNA 3N3KA 3QT4A 4YYQA 3IV2A 1K3BB 3TNXA 3USVA 4YYRA 1X9YA 4BS5A 1CS8A 2FTDA 1BQIA 2G7YA 3H7DA 1KHQA 1PE6A 3HHIA 3KFQA 2B1NA 3S3QA 2Y5BA 1PPOA 4Q8GA 2YJ8A 3P5XA 5EF4A 3KSEA 1YK7A 3RVWA 2R6NA 1PIPA 1GLOA 4XR7A 1PADA 3IUTA 3F75A 5CVOB 1GCBA 1MDWA 2O6XA 2GFOA 2WBFX 2PBHA 2NQIA 3RVVA 3O0UA 3IOQA 1EWPA 4YYWA 3KWBX 1AYVA 2F7DA 4W5CA 3O1GA 1MEGA 1GMYA 1MS6A 2FT2A 1QMYA 3IMAA 1O0EA 1U9XA 2DCCA 6PADA 3CBJA 2HD5A 1F2BA 3I3TA 4YVAA 2DJGA 2AUZA 3K8UA 3KW9A 1PPPA 1AU2A 2DZZA 2CB5A 3IEJA 2R9CA 2G8JA 1ME4A 4DMYA 2R9FA 4FK5A 4CDCB 1Y08A 2DC6A 2NQDB 4CZWA 3OVZA 2AIMA 2E00A 2YJ2A 1XKGA 3PBHA 1PXVA 5JH3A 4YYVA 3K24A 5A24A 2DCDA 4QBBA 2FRQA 1SNKA 3ERVA 2AYOA 2H7JA 4YYSA 3ZUAA 1U9VA 2AYNA 2CIOA 2PADA 1F2AA 1AYUA 2DC9A 4FJCA 2JQFR 1EWOA 3P5VA 1ICFA 2ACTA 2IBIA 2HH5A 3KKUA 2XU5A 1CJLA 4N4ZA 3OVXA 1QXPA 3AI8A 1YK8A 2P7UA 1KFXL 2FRAA 1S4VA 4BQVA 2B1MA 2P0RA 1AECA 3H89A 1DF0A 2AUXA 2P86A 4CDDB 1PCIA 1ZIVA 2AVWA 1U9WA 1VJVA 4FIPA 2HHNA 1ATKA 1CQDA 1CV8A 4QRGA 1TU6A 2IPPB 3KWZA 1AYWA 5F02A 4PP2E 3NHEA 2HXZA 3BPFA 2E03A 4OELA 3P5UA 2AS8A 3C9EA 1Y4HA 1POPA 3PDFA 8PCHA 2DJFA 1AIMA 4RY2A 4CDDA 4X6IA 3H6SA 4N8WA 1PPNA 2E02A 3HWNA 2BDZA 2G6DA 1ME3A 4OEMA 1QDQA 2PREA 4MZOA 3F5VA 2BDLA 3HHAA 2AU1A 4I07A 4YYUA 1THEA 9PAPA 5FPWA 2DJFB 3OF9A 2VHFA 2DC7A 3BCNA 1JQPA 3CH2X 2DZYA 4CDEA 4WA6A 4QH6A 4CDFB 4PADA 1ZCMA 5PADA 4CDCA 3OISA 4QRXA 4W5BA 4QRVA 3K9MA 2OP3A 3I06A 1MIRA 3N3GA 1CSBB 1KXRA 3OF8A 4I05A 3PNRA 1CB5A 1IWDA 3D6SA 1K3BA 5JA7A 2R9NA 4CDEB 3CBKA 1NPZA 1YT7A 2E01A 1Q6KA 1DEUA 1PPDA 1YALA 3MORA 3N4CA 2PNSA 1U9QX 5CHVA 2F1GA 3MTNA 4DMXA 4K7CA 3M99A 2XU1A 3MHHA 1NQCA 4MZSA 3LXSA 3LFYA 5CVNB 2XU3A 1KHPA 2ATOA 7PCKA 4P6GA 1EWMA 2FQ9A 3B79A 3BPMA 4XUIA 4G54A 1CPJA 4X6JA 3KX1A 3PW3A 5CVMA 1NLJA 4KLBA 4ZUXU 1A6RA 3DF0A 4AXLA 3HD3A 3E1ZB 1PBHA 1QOLA 2FYEA 3WXFA 4BS6A 1BP4A 2NQAA 2G8EA 1MHWA 1YVBA 2OZ2A 3QSDA 5J94A 1NB3A 2FUDA 4BSQA 4MSXA 3S3RA 1F2CA 4I04A 4BPVA 3V6EA 4PP1A 2DCBA 1NB5A 4AXMA 1TLOA 3BC3A 1STFE 2DJGB 2OULA 2YJBA 1KFUL 2R9MA 3CH3X 5CHTA 1BY8A 3IHPA 2GHUA 3H8CA 5EGWA 4P6EA 2YJCA 1EF7A 3P5WA 1TL9A 3WXEA 4CDFA 3BOWA 2C0YA 3QJ3A 1M6DA 1AU3A 5K16A 1AU0A 2DC8A
chains in the Genus database with same CATH superfamily
4YFQA 2Y3EA 4QZUA 3K3LA 1FE3A 5KHPA 1SXWA 1TOWA 1X8UA 3RDQA 4RUNA 2RTRB 4GU8A 1MEMA 3BWKA 1DZMA 4CPFA 1B8EA 4ZFXA 1SWLA 4BJ8A 4Q8HA 1GECE 2MF6A 3MP2A 3MVFA 1FJ1E 1OEEA 1HBPA 3QKGA 3MHSA 1QY2A 3F8AA 3NQ3A 3IFBA 2N93A 4CPIA 2XU4A 1ITOA 5JD2A 3PH6A 4FQBB 2E4JA 2X34A 1AB0A 3RWXA 4YFPA 1VSNA 4YYQA 1UZ2X 2KD2A 2C4IA 5EDCA 3USVA 4WHIA 3N91A 1X9YA 1P6PA 5LJHA 4M0WA 2A3FX 3PHWA 5BVTA 4NYQA 3JSQA 1YZBA 3BY4A 2IZKA 1VWJB 2AL0X 1IKJA 3ZW1B 2B1NA 2OFRX 3ELXA 2Y5BA 4ZCBA 1PPOA 4AZPA 4Q8GA 3P5XA 1E2TA 2OY1O 3RE6A 5EF4A 1LCWA 3ZNHA 1SWCA 5B5FA 1SWDA 1GLOA 2Y32A 4XR7A 3F75A 4FGIB 4IMNA 1DZJA 1KFFA 4O4XA 2PBHA 1KL4A 4I3BA 2J7QA 2JU7A 1GT3A 1QABE 1ICMA 5HA0A 1EWPA 1Y9LA 1EQDA 4GDZA 4GK9A 2KT4B 3NR3A 5EZ2A 4I3DA 1YP7A 3O1GA 2RTBB 1O0EA 3STMX 4Z2VA 2HD5A 2CZUA 2AUZA 3K8UA 2GTLO 3O22A 3TMPA 2LBVA 4GJVA 2OY5O 1AU2A 1FEMA 4U8UO 5HA1A 1VWGB 2HYSA 2G8JA 4CV7A 1S7DA 4ZH9A 1PBYA 2GTLM 4OW0A 4A5UA 4KCAA 1X8NA 4CZWA 5HCEC 3PQSA 2E00A 1S2PA 4KH8A 3SZJA 1LNMA 2DCDA 4QBBA 2KTSA 4YCHA 3OJYC 4OKAA 4HPCA 4YYSA 1ADLA 1MOYA 3RDXA 1JV4A 2Q2MA 3VGWA 2LFOA 3JQOA 3MBTA 2UYWA 4ZGUA 5EZQA 1BSOA 3SLTA 2IZFB 3HWGA 2OVEA 1STRB 2JTCA 2ACTA 1GT1A 2MM3A 3P02A 2JW1A 2IBIA 3KKUA 1EIIA 1FTPA 1HXZA 2XU5A 2IZJA 4N4ZA 1JJJA 2WEXA 3PHUA 2NNDA 1S4VA 2BS5A 3WJGA 2AUXA 1G74A 1VWIB 1KZWA 2RTQB 2NNEA 1U9WA 5H9NA 3BX8A 1BRPA 4ORWA 1IFBA 1MX7A 4ARHA 3NHEA 4ZTBA 1GT5A 2E03A 1SREA 4OELA 2ZSCA 3C9EA 2QO4A 1YUPA 1KZXA 1POPA 4NNTA 1ICNA 2IZDB 5BVSA 4O4OA 4UU2A 3KVNA 4X6IA 3RZYA 2A13A 1GKAA 2AT8X 2BDZA 2AGAA 5K06A 4HPDA 1BM5A 3BDRA 2FRSA 4BOSA 3WZOA 1G7NA 3HHAA 4I95A 1AVEA 2FS6A 1NBXA 3BB7A 4YYUA 9PAPA 5HCCC 1OPAA 2VHFA 2DC7A 5KO3A 2BTWA 1CJ5A 4TJZA 4PADA 3PT2A 2HZRA 5PADA 4CDCA 3CR6A 3VU1A 3VHHA 4GGTA 1O1UA 3FENA 3PSEA 3WZQA 2HMBA 3K9MA 3I06A 1RXJA 1MIRA 1LUQA 1SWQA 1JMXA 1KXRA 3OF8A 3I17A 3STKA 4NYRA 4HXDB 4GDAA 1VWAB 5L8NA 3QQ2A 5CE4A 1NPZA 1YT7A 2FE8A 1LIDA 1KT7A 4GD9A 2AT3X 1W5RA 1BBPA 1KQWA 2JU8A 1N4JA 3M99A 4AZRA 4Y59A 4ZHGA 2A2UA 2FR2A 4MZSA 5EPQA 3LFYA 1NQNA 3CWKA 1O8VA 1CRBA 2F73A 1KHPA 2W2FA 2XU3A 7PCKA 1SWUA 2Z84A 4MEEA 3B2JA 5HZ8A 4U8UM 1TOUA 1UKFA 4JHQA 1KT4A 1RXKA 4JO6A 3D96A 5CVMA 4KLBA 4ZUXU 4YKMA 3F9DA 1LDQA 5FQ7E 4YGZA 4YDBA 4AXLA 2RTJA 1I06A 2IZCB 4D8EA 3E1ZB 1PBHA 2FYEA 4U3QA 5CHKA 1D3SA 5CSEA 4GJSA 1YVBA 5J94A 3PPTA 3KZAA 2RTFB 3B2HA 1SWRA 1EW3A 4PJ2A 2JRIA 2CM4A 3RY1A 1I9HA 4P16A 1T0VA 2DCBA 2BSZA 3VE2A 2K62A 2BS6A 4TKBA 1SXYA 2WR6A 4QGXA 3PRPA 1SLFB 2XKLA 2IZBA 3PECA 1KOIA 2NP1A 3P6CA 3S5XA 1KQXA 5HCDC 4YKOA 2BU3A 3NX2A 2OVSA 4P6EA 2YJCA 3P5WA 1O1VA 3WXEA 4Y0PA 3BOWA 3QJ3A 3VHIA 1H91A 1SWEA 1YWDA 1GKAB 4GKCA 3WJCA 2LBAA 1AU0A 4ZHDA 2RTEB 1SWSA 3FMZA 2FS7A 1NC9A 4OS0A 2OF9A 3P6EA 1VWOB 2R9OA 2FHLA 3U8EA 4KC8A 1F29A 3WJEA 3SAOA 1CVZA 3GCBA 1GX3A 2YJ9A 4YGGA 2RTIB 1VWLB 1U5IA 2ARYA 1SWFA 3HOEA 1NL6A 2A2GA 3PP6A 2BHVA 3APVA 4IUMA 3RBYA 2O62A 2JGSA 1QFVA 1X8QA 1EWLA 2NQGA 3E9SA 2VHSA 2JN3A 5L8IA 1CTEA 2DCAA 1HBQA 4ZGFA 1MM9A 3S60A 3L4RA 3SZIA 3N3KA 3IV2A 2JOZA 5B5GA 1LCVA 3FA6A 1BQIA 4GNWA 1SRJA 5AJBA 3H7DA 4BGFA 2A5CA 3FA9A 5IRAA 4UU3A 1U0XA 3KFQA 1SRHA 2Q4NA 4N7CA 3S3QA 1NP1A 1HMTA 2IZHB 2KW1A 1LIFA 2BT9A 4ORUA 4Z2OA 4A1YA 2O6XA 4XMEA 1Y52X 2FKGA 3F6ZB 2OY7A 3D9WA 1JYDA 3KFIA 1AYVA 2Y3FA 3ELZA 1TXLA 1MEGA 1GMYA 2RTOB 1MS6A 2FT2A 1QMYA 2XSTA 1U9XA 3S5VA 1WBIA 2DM5A 4BX6A 2BC3A 3I3TA 3TGAA 2R74A 3RDMA 3NADA 3KW9A 2X8SA 4EDEA 3BY0A 4I60A 1Z24A 4GRJA 3FLLA 2FR3A 4TLJA 2CB5A 2R9CA 4NP1A 4DMYA 2R9FA 4FK5A 1SA8A 1JYJA 2NQDB 2X45A 2YJ2A 1XKGA 2UZ2A 1PXVA 5JH3A 4YYVA 2G79A 2RTPB 5IXGA 5L3YA 4ORSA 4AZMA 1A57A 1DKIA 3CQNA 4NNSA 2H7JA 1FELA 3ZUAA 2X4MA 1U9VA 2AYNA 2CIOA 2PADA 1SWOA 5K68A 2DC9A 5KICA 2JQFR 1EWOA 1X89A 1G5WA 3FELA 1ICFA 4A8ZA 2OL8O 3O2YA 1RBPA 1GM6A 3STNA 2WWPA 4WURA 3OVXA 3AI8A 1YK8A 2P7UA 5FFHA 1ZNLA 4RNAA 5FQ6E 2AT0X 2QM9A 3FA7A 4O3YA 3BU9A 2X8TA 1BLRA 3RDUA 1MK5A 1FDQA 2LB6A 2AVWA 3KQ0A 4FIPA 2OVAA 2JU3A 1CQDA 4QRGA 5FAZA 3P24A 3KWZA 1AELA 4BX6B 1STSB 5F02A 4PP2E 3BPFA 4TKHA 1YP6A 4I6SA 1OBPA 2FGSA 1SLEB 4AYHA 1Y4HA 5DG4A 4O9SA 4BOQA 3GE2A 1DF8A 4CDDA 1VWHB 3VHMA 2I5VO 3H6SA 4N8WA 2HZQA 1PPNA 2ZAGA 1PBOA 3CBCA 5D48A 3EMMA 3ZQ3A 5KIDA 2QCBA 2ACPX 3F5VA 2BDLA 3LHNA 1THEA 1HY2A 3VG2A 1JIWI 1QY1A 5FPWA 3HWEA 1IKEA 4N7DA 2DJFB 5AJCA 3BCNA 4CDEA 4WA6A 4QH6A 3RSWA 3AKMA 1LICA 2G7BA 1E06A 4QQ1A 2RCTA 4O3XB 3OISA 4QRXA 4EXZA 3HPEA 5FQ8E 5LJCA 3N3GA 1CSBB 4LKTA 5F6BA 1LELA 2OFMX 2RTGB 3PNRA 2OZQA 4MVKA 2L5PA 4HPAA 2HWKA 4BCSA 2CBRA 2R9NA 5LJBA 2E01A 1DEUA 3MORA 1OPBA 5IO7A 3N4CA 3KFFA 1N0SA 2PI3O 4QYNA 2G5LA 3P6FA 3OQCA 2XU1A 4DNEA 3EYCA 3TRKA 4O49A 2X55A 4ORRA 5HZ9A 4YVBA 1LIEA 4FBRA 3BSZE 1UREA 3S26A 1AVDA 2R56A 1AQBA 2FLJA 3D4RA 4G54A 1CPJA 1LDOA 3BBAA 1A6RA 5D4AA 2LKKA 4YBPA 3DF0A 4O4UA 3HD3A 1N7YA 4MVLA 1HN2A 4ID2A 4GUZA 2G8EA 4CPHB 2FUDA 3S3RA 1EALA 4BOPA 4ZHHA 3FIDA 5IO6A 4B55A 1HXLA 2MWHA 1SY0A 3BC3A 5B27A 4EFGA 2DJGB 4BOZA 2CM9A 1KFUL 1XKIA 4O3WA 4IAXA 3IHPA 2RTCB 3H8CA 1ZNHA 5EGWA 3C78X 2WQ9A 1BEBA 4YBUA 4ZJ0A 4OMXA 1VWPB 2IZIA 2C0YA 4TKJA 2AKQA 1BWYA 5EZSA 1SXXA 3MJ5A 4WFUA 1AU3A 3C76X 1LF7A 4OVZB 3MM0A 2J7QC 2RA6A 2DC8A 3FR2A 1UYOX 2DOSA 5HZ6A 2IZLB 4DCBA 3RNVA 1SWHA 3H8BA 3BX7A 1KL5A 1RSTB 1GXAA 4D6BA 1HUCB 3WXGA 1FH0A 1PVJA 2I5ZO 1SP4B 3RVXA 4W4UA 1W6FA 2JQGR 3B2IA 1PEEA 4ES7A 4PI3A 4CPHA 1MDCA 1DZKA 3MG5A 4X6HA 3VE1A 5FENA 3QT4A 5B3MO 3RE5A 4GNYA 4IBAA 3T1DA 2IZEB 1T8VA 1N43A 4YYRA 1BSYA 4BS5A 1CS8A 2FTDA 2F09A 2RTLA 3VG7A 2G7YA 1VWFB 4YFRA 4BOUA 1OBUA 4LZVA 1SRIA 1KHQA 2M4LA 3HHIA 2CAMA 2RCQA 1SWBA 4REZA 2L67A 5HWZA 2OFBA 5L8OA 2YJ8A 1SWAA 2G78A 3KSEA 1WUBA 1YK7A 4C5PA 2RTAA 3RVWA 2R6NA 3IUTA 1W4TA 2R73A 2C1QA 4Z6JA 3BLGA 2GFOA 2FWVA 4CPEA 4WBKA 3RVVA 1VWKB 4O3ZA 1RSUB 3PEDA 1MUPA 4I3CA 3WBGA 3WZPA 1DV9A 2A5BA 3NPOA 3IMAA 4QAEA 2DCCA 3APXA 3CBJA 2HKDA 1SY3A 1RLBE 4O4SA 3WVMA 4EEJA 2F01A 2OFAA 4YVAA 2DJGA 1DZPA 4AW8A 3ZUOA 2LA7A 1PPPA 3NX1A 1EI5A 3UEUA 1CBQA 1U17A 1X8PA 2RN4A 1IIUA 4MISA 1U18A 4DQ4A 4IMOA 3W30A 4D8IA 1EPAA 3WXQA 1Y08A 3OVZA 4ORYA 2AIMA 4BOEA 4GGRA 3PBHA 2X32A 3T2WA 3FDCA 1SLDB 2CBSA 2G8CO 4EQAC 5JR8A 4QRLA 4GUAA 5A24A 5E6JA 1YWBA 4OMWA 4MVIA 1TVQA 4KT5A 3UEXA 3WJBA 1SNKA 3ERVA 2AYOA 5HZ5A 3ZW2A 2AMMX 1ZRYA 2FT9A 3DTQA 4XMGA 4OVZA 1F2AA 1AYUA 1YWAA 3FEKA 2EU7X 1B0OA 2HH5A 1CBIA 1KXOA 3C77X 2IZAA 2OF8A 1QXPA 5HBSA 1B4MA 1AECA 3H89A 2X8FA 3DSZA 3NBXX 1DF0A 1PCIA 1I78A 5IO5A 1ZIVA 2Z4IA 3WJDA 1VJVA 4R0BA 1ATKA 1X71A 4U8UN 1TU6A 5B11O 4GETA 2IPPB 4YH0A 3OBLA 4XZXA 3JS1A 1AYWA 1LCZA 1TW4A 5CYBA 4ZR2A 3P5UA 4L3RA 1E02A 2GC9A 4IB9A 5D45A 3FA8A 3PDFA 8PCHA 1LPJA 1AIMA 4RY2A 5HAEA 4ORXA 4L1NA 4YGHA 3CQRA 4YCEA 1DF3A 3HWNA 4MI7A 3W31A 4WFVA 3ZW0A 1HQQA 1ERXA 1SRFA 1ME3A 1VWCB 1QDQA 2VDFA 1ZNDA 1NQMA 2PREA 4MZOA 2AVIA 1JJUA 1Y0GA 3EBWA 1BSQA 1CBSA 2WUTA 4XMHA 3SLOA 2AU1A 1DFVA 2X46A 1NP4A 2WSJA 1JQPA 3CH2X 2DZYA 2X56A 4Z28A 4CDFB 2JMBA 3IA8A 2GH7A 1I05A 4XMCA 4Y0SA 1VWRB 2RTNB 5DPQA 4QZTA 3FR4A 4W5BA 1DC9A 5IRUA 4FBOA 1KL3A 2IZGB 3I0AA 4I05A 1CB5A 4IB8A 4CSBA 5F1EA 4Y0QA 1ZNEA 4Y5DA 4AZQA 4KC7A 1K3BA 2AF5A 5JA7A 1PTSA 5IRWA 3HWFA 2PY1A 3CBKA 2Q9SA 5D47A 1SWPA 1Q6KA 1YALA 3O65A 2RTKA 4K19A 2MO5A 5CHVA 4ON1A 1SY2A 4A60A 3MHHA 2GJ5A 3B2KA 1SWKA 2FTBA 2K23A 2QO5A 3BRNA 1X8OA 1E5PA 5F7GA 3VG5A 1EWMA 3AKNA 4IP3A 3NQKA 3BPMA 4XUIA 4X6JA 3EC5A 3CKFA 3B2LA 3PH5A 4D8BA 2ZAIA 1NLJA 4QGWA 3Q34A 2RTHB 3WJFA 4OS3A 3U03A 1GX9A 3WXFA 3EW1A 5EDBA 3OE3A 5H8TA 4MVEA 2L68A 4LKPA 4QYPA 4BX7A 1BJ7A 2Q2PA 1MHWA 1ZNKA 1MVGA 5LJGA 3QSDA 1LIBA 4BSQA 1F2CA 1JJXA 2ACOA 1SWNA 1GT4A 3V6EA 3WOVA 1NB5A 2AH7X 5B10O 2OULA 2YJBA 2R9MA 3CH3X 5CHTA 1BY8A 4ZHFA 2W2BA 2UZJA 4YMYA 1EF7A 1TL9A 3PQUA 2VFBA 2IFBA 4AZOA 1ML7A 4Z2PA 3TZSA 3HK1A 1M6DA 1PMPA 3ZI8A 2ALLX 4IRWA 4HPBA 1SY1A 1VPRA 3EW2A 2FHNX 2AT5X 1S44A 3CBSA 4HFOA 1VWEB 3FW5A 5LKEA 4N79A 5H9AA 3SOTA 4TNNA 4NLIA 2FO5A 4IB7A 3RKGA 1BGOA 3ZW1A 2Y6EA 1SRGA 2A8GA 3BU1A 2A0AA 4YV8A 3G7XA 2WEWA 4BX5B 4PSQA 3U0DA 4PT5A 1VWDB 4CK4A 2BLGA 1G85A 3V6CA 3UEWA 5K67A 4RUUA 1UYNX 4HWYA 4INNA 1NGLA 4RF1A 2ANSA 1AU4A 1IJ8A 1I4UA 4M6SA 5EEEA 1JMZA 4IB6A 2FKJA 3PK2A 1K3BB 3TNXA 1KGLA 3TGBA 1CBRA 4Y0RA 4ZH6A 3IFUA 4QNIA 5H9LA 3TGCA 1PE6A 3MTVA 3GAQA 5LJEA 1QWDA 3FYFA 4JNJA 1B56A 4BQUA 4Z27A 2W2AA 1BRQA 3VPJE 1PIPA 5F6ZA 4OS8A 1PADA 1IFCA 5CVOB 1GCBA 1MDWA 4M7MA 2WBFX 1LKEA 2NQIA 3FIQA 5EEDA 3EBKA 3O0UA 1KT5A 3IOQA 4YYWA 4DQ3A 3AUMO 3KWBX 2RTDB 2NNQA 2F7DA 4W5CA 1N9MA 1L6MA 1T68X 3X00A 6PADA 4BX5A 1F2BA 1QG5A 3VG3A 3SZHA 2AT6X 4XMFA 4MM3B 4ALBA 4NLJA 5LKFA 2DZZA 2L9CA 3IEJA 1ME4A 3UAQA 1OEKA 4CDCB 3B21A 2MJIA 2P8GA 2DC6A 3ZZVA 1EUOA 3LTWA 1IW2A 2OL6O 2ASNX 2BTWB 3K24A 1MEPA 3RDOA 1SMPI 3MX7A 2FRQA 4ZHCA 3HTYA 3P6HA 4FJCA 4NV7A 3P5VA 1NDJA 4IAWA 1K24A 3CKGA 3OD9A 1CJLA 1GX8A 3E3CA 1VYFA 4IABA 1KFXL 1EXSA 2FRAA 4BQVA 2B1MA 2P0RA 2QO6A 2OYBO 2QOMA 3C0RA 1VYOA 3EM0A 4MIRA 2P86A 4CDDB 4GH7A 5AQ6A 1VYGA 3UEVA 5B2AO 4AZNA 1A3YA 3D97A 5BVQA 2HHNA 1CV8A 1HMRA 3P6DA 2YG2A 3V8UA 1VWBB 2HXZA 1RAVA 2Z4HA 3P6GA 1QQSA 3NP1A 2AS8A 2RD7C 3HOLA 5D8JA 2DJFA 2VFCA 2QMIA 3D95A 1VWQB 4BBOA 3TF6A 3FEPA 4NW4A 3T2XA 4I9SA 2E02A 1EIOA 4A1HA 2G6DA 4XMDA 1OEJA 1EPBA 1FENA 4OEMA 1YWCA 3AEHA 2POAA 4I07A 4QGVA 4EKVA 3OF9A 2RTMA 1ZCMA 5LJDA 3APWA 4ALOA 3WZNA 1JZUA 4QRVA 1MX8A 4GGZA 2OP3A 3FW4A 1KT6A 1SWJA 2RQ0A 3CMPA 1A18A 1HQPA 1JBHA 2HNXA 1XCAA 1QY0A 1IWDA 3D6SA 2Q39A 1LFOA 3HWDA 2HLVA 4GE1A 4U46A 5AEOA 1ALBA 1YIVA 1R0UA 4CDEB 3Q6LA 1OSPO 1PPDA 1RXHA 3RY2A 2PNSA 1U9QX 1SWTA 2F1GA 1Y53X 3MTNA 4DMXA 4K7CA 2CZTA 4RF0A 1NQCA 2KTDA 3H3IA 3LXSA 1SXUA 3VG4A 5CVNB 1VWNB 3PRMA 1Y9TA 2ATOA 4P6GA 4JGLA 2FQ9A 3B79A 3WYQA 5H9KA 4LZUA 4GZVA 2GTLN 4RKXA 3BS2A 2YMSA 3KX1A 3PW3A 5JZEA 1I04A 1D2UA 4R3DA 3U9PC 4BVMA 1SLGB 3NQ9A 4FBVA 5HTEA 1QOLA 2WPUA 5F2BA 5LJKA 2QOSC 3ZW0B 4BS6A 4HWMA 1BP4A 2NQAA 3FR5A 1QFTA 2OZ2A 4D6AA 1NB3A 2GTFX 4ML7B 1Y55X 4MSXA 1STPA 4I04A 4U9CA 5B29A 4BPVA 3PHXA 4KIIA 2OVDA 1GGLA 2MHDA 3RDSA 1AVGI 4PP1A 1ACDA 1ZNGA 4YDAA 4AXMA 1TLOA 3SLJA 5C0NA 3T6FA 1STFE 1N9YA 3T6LA 5HTDA 4I9RA 1PM1X 4TQ2A 1HMSA 2GHUA 3KFHA 4COTA 3APUA 4ODDA 1A2DA 3KFGA 1VWMB 4CDFA 3ZUIA 5F58A 4LQZA 1KT3A 4NV8A 1E00A 3O19A 3ZWEA 5HZQA 1OBQA 5K16A 2OL7A 2WQAE 1ERBA 3VG6A 3WYPA 2OY8A 2C1SA 4BX7B 1SWGA 3LV4A 5BYPA
chains in the Genus database with same CATH topology
2R9OA 4N79A 3H8BA 3U8EA 1F29A 2FO5A 1CVZA 1MEMA 1BGOA 3BWKA 3GCBA 1GX3A 2YJ9A 1HUCB 4Q8HA 2Y6EA 1GECE 1U5IA 2ARYA 3WXGA 4YV8A 1FH0A 1SP4B 1NL6A 3MHSA 3RVXA 4W4UA 1W6FA 3V6CA 4HWYA 1EWLA 2NQGA 2XU4A 1ITOA 2JQGR 1AU4A 2VHSA 4PI3A 1CTEA 2DCAA 4X6HA 1VSNA 3N3KA 3QT4A 4YYQA 3IV2A 1K3BB 3TNXA 3USVA 4YYRA 1X9YA 4BS5A 1CS8A 2FTDA 1BQIA 2G7YA 3H7DA 4BGFA 1KHQA 1PE6A 3HHIA 3KFQA 2B1NA 3S3QA 2Y5BA 1PPOA 4Q8GA 2YJ8A 3P5XA 1E2TA 5EF4A 3KSEA 1YK7A 4C5PA 3RVWA 2R6NA 1PIPA 1GLOA 4XR7A 1PADA 3IUTA 3F75A 5CVOB 1W4TA 1GCBA 1MDWA 2O6XA 2GFOA 2WBFX 2PBHA 2NQIA 3RVVA 3O0UA 3IOQA 1EWPA 3D9WA 4YYWA 3KWBX 1AYVA 2F7DA 4W5CA 3O1GA 1MEGA 1GMYA 1MS6A 2FT2A 1QMYA 3IMAA 1O0EA 1U9XA 2DCCA 6PADA 3CBJA 2HD5A 1F2BA 3I3TA 4YVAA 2DJGA 2AUZA 3K8UA 3KW9A 1PPPA 1AU2A 2DZZA 2CB5A 3IEJA 2R9CA 2G8JA 1ME4A 4DMYA 2R9FA 4FK5A 4CDCB 1Y08A 2DC6A 2NQDB 4CZWA 3OVZA 3LTWA 2AIMA 2E00A 2YJ2A 1XKGA 3PBHA 1PXVA 5JH3A 4YYVA 3K24A 5A24A 2DCDA 4QBBA 2FRQA 1SNKA 3ERVA 2AYOA 2H7JA 4YYSA 3ZUAA 1U9VA 2AYNA 2CIOA 2PADA 1F2AA 1AYUA 2DC9A 4FJCA 2JQFR 4NV7A 1EWOA 3P5VA 1ICFA 2ACTA 2IBIA 2HH5A 3KKUA 2XU5A 1CJLA 4N4ZA 3OVXA 1QXPA 3AI8A 1YK8A 2P7UA 1KFXL 2FRAA 1S4VA 4BQVA 2B1MA 2P0RA 1AECA 3H89A 1DF0A 2AUXA 2P86A 4CDDB 1PCIA 1ZIVA 2AVWA 1U9WA 1VJVA 4FIPA 2HHNA 1ATKA 1CQDA 1CV8A 4QRGA 1TU6A 2IPPB 3KWZA 1AYWA 5F02A 4PP2E 3NHEA 2HXZA 3BPFA 2E03A 4OELA 3P5UA 2AS8A 3C9EA 1Y4HA 1POPA 3PDFA 8PCHA 2DJFA 2VFCA 1AIMA 4RY2A 4CDDA 4X6IA 3H6SA 4N8WA 1PPNA 2E02A 3HWNA 2BDZA 2G6DA 1ME3A 4OEMA 1QDQA 2PREA 4MZOA 3F5VA 2BDLA 3HHAA 2AU1A 4I07A 4YYUA 1THEA 9PAPA 5FPWA 2DJFB 3OF9A 2VHFA 2DC7A 3BCNA 1JQPA 3CH2X 2DZYA 4CDEA 4WA6A 4QH6A 4CDFB 4PADA 1ZCMA 5PADA 4CDCA 3OISA 4QRXA 4W5BA 4QRVA 3K9MA 2OP3A 3I06A 1MIRA 3N3GA 1CSBB 1KXRA 3OF8A 4I05A 3PNRA 1CB5A 1IWDA 3D6SA 1K3BA 5JA7A 2R9NA 4CDEB 3CBKA 1NPZA 1YT7A 2E01A 1Q6KA 1DEUA 1PPDA 1YALA 3MORA 1W5RA 3N4CA 2PNSA 1U9QX 5CHVA 2F1GA 3MTNA 4DMXA 4K7CA 3M99A 2XU1A 3MHHA 1NQCA 4MZSA 3LXSA 3LFYA 5CVNB 2XU3A 1KHPA 2ATOA 7PCKA 4P6GA 1EWMA 2FQ9A 3B79A 3BPMA 4XUIA 4G54A 1CPJA 4X6JA 3KX1A 3PW3A 5CVMA 1NLJA 4KLBA 4ZUXU 1A6RA 3DF0A 4AXLA 3HD3A 3E1ZB 1PBHA 1QOLA 2FYEA 3WXFA 4BS6A 1BP4A 2NQAA 4GUZA 2G8EA 1MHWA 1YVBA 2OZ2A 3QSDA 5J94A 1NB3A 2FUDA 4BSQA 4MSXA 3S3RA 1F2CA 4I04A 4BPVA 3V6EA 4B55A 4PP1A 2DCBA 1NB5A 2BSZA 4AXMA 1TLOA 3BC3A 1STFE 2DJGB 2OULA 2YJBA 1KFUL 2R9MA 3CH3X 5CHTA 1BY8A 3IHPA 2GHUA 3H8CA 5EGWA 4P6EA 2YJCA 1EF7A 3P5WA 1TL9A 2VFBA 3WXEA 4CDFA 3BOWA 2C0YA 4NV8A 3QJ3A 1M6DA 1AU3A 5K16A 1AU0A 2DC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9O A;  4N79 A;  3H8B A;  3U8E A;  1F29 A;  2FO5 A;  1CVZ A;  1MEM A;  1BGO A;  3BWK A;  3GCB A;  2YJ9 A;  1HUC B;  4Q8H A;  2Y6E A;  1GEC E;  1U5I A;  2ARY A;  3WXG A;  4YV8 A;  1FH0 A;  1SP4 B;  1NL6 A;  3MHS A;  3RVX A;  4W4U A;  3V6C A;  4HWY A;  1EWL A;  2NQG A;  2XU4 A;  1ITO A;  2JQG R;  1AU4 A;  2VHS A;  4PI3 A;  1CTE A;  2DCA A;  4X6H A;  1VSN A;  3N3K A;  3QT4 A;  4YYQ A;  3IV2 A;  1K3B B;  3TNX A;  3USV A;  4YYR A;  1X9Y A;  4BS5 A;  1CS8 A;  2FTD A;  1BQI A;  2G7Y A;  3H7D A;  1KHQ A;  1PE6 A;  3HHI A;  3KFQ A;  2B1N A;  3S3Q A;  2Y5B A;  1PPO A;  4Q8G A;  2YJ8 A;  3P5X A;  5EF4 A;  3KSE A;  1YK7 A;  3RVW A;  2R6N A;  1PIP A;  1GLO A;  4XR7 A;  1PAD A;  3IUT A;  3F75 A;  5CVO B;  1GCB A;  1MDW A;  2O6X A;  2GFO A;  2WBF X;  2PBH A;  2NQI A;  3RVV A;  3O0U A;  3IOQ A;  1EWP A;  4YYW A;  3KWB X;  1AYV A;  2F7D A;  4W5C A;  3O1G A;  1MEG A;  1GMY A;  1MS6 A;  2FT2 A;  1QMY A;  3IMA A;  1O0E A;  1U9X A;  2DCC A;  6PAD A;  3CBJ A;  2HD5 A;  1F2B A;  3I3T A;  4YVA A;  2DJG A;  2AUZ A;  3K8U A;  3KW9 A;  1PPP A;  1AU2 A;  2DZZ A;  2CB5 A;  3IEJ A;  2R9C A;  2G8J A;  1ME4 A;  4DMY A;  2R9F A;  4FK5 A;  4CDC B;  1Y08 A;  2DC6 A;  2NQD B;  4CZW A;  3OVZ A;  2AIM A;  2E00 A;  2YJ2 A;  1XKG A;  3PBH A;  1PXV A;  5JH3 A;  4YYV A;  3K24 A;  5A24 A;  2DCD A;  4QBB A;  2FRQ A;  1SNK A;  3ERV A;  2AYO A;  2H7J A;  4YYS A;  3ZUA A;  1U9V A;  2AYN A;  2CIO A;  2PAD A;  1F2A A;  1AYU A;  2DC9 A;  4FJC A;  2JQF R;  1EWO A;  3P5V A;  1ICF A;  2ACT A;  2IBI A;  2HH5 A;  3KKU A;  2XU5 A;  1CJL A;  4N4Z A;  3OVX A;  1QXP A;  3AI8 A;  1YK8 A;  2P7U A;  1KFX L;  2FRA A;  1S4V A;  4BQV A;  2B1M A;  2P0R A;  1AEC A;  3H89 A;  1DF0 A;  2AUX A;  2P86 A;  4CDD B;  1PCI A;  1ZIV A;  2AVW A;  1U9W A;  1VJV A;  4FIP A;  2HHN A;  1ATK A;  1CQD A;  1CV8 A;  4QRG A;  1TU6 A;  2IPP B;  3KWZ A;  1AYW A;  5F02 A;  4PP2 E;  3NHE A;  2HXZ A;  3BPF A;  2E03 A;  4OEL A;  3P5U A;  2AS8 A;  3C9E A;  1Y4H A;  1POP A;  3PDF A;  8PCH A;  2DJF A;  1AIM A;  4RY2 A;  4CDD A;  4X6I A;  3H6S A;  4N8W A;  1PPN A;  2E02 A;  3HWN A;  2BDZ A;  2G6D A;  1ME3 A;  4OEM A;  1QDQ A;  2PRE A;  4MZO A;  3F5V A;  2BDL A;  3HHA A;  2AU1 A;  4I07 A;  4YYU A;  1THE A;  9PAP A;  5FPW A;  2DJF B;  3OF9 A;  2VHF A;  2DC7 A;  3BCN A;  1JQP A;  3CH2 X;  2DZY A;  4CDE A;  4WA6 A;  4QH6 A;  4CDF B;  4PAD A;  1ZCM A;  5PAD A;  4CDC A;  3OIS A;  4QRX A;  4W5B A;  4QRV A;  3K9M A;  2OP3 A;  3I06 A;  1MIR A;  3N3G A;  1CSB B;  1KXR A;  3OF8 A;  4I05 A;  3PNR A;  1CB5 A;  1IWD A;  3D6S A;  1K3B A;  5JA7 A;  2R9N A;  4CDE B;  3CBK A;  1NPZ A;  1YT7 A;  2E01 A;  1Q6K A;  1DEU A;  1PPD A;  1YAL A;  3MOR A;  3N4C A;  2PNS A;  1U9Q X;  5CHV A;  2F1G A;  3MTN A;  4DMX A;  4K7C A;  3M99 A;  2XU1 A;  3MHH A;  1NQC A;  4MZS A;  3LXS A;  3LFY A;  5CVN B;  2XU3 A;  1KHP A;  2ATO A;  7PCK A;  4P6G A;  1EWM A;  2FQ9 A;  3B79 A;  3BPM A;  4XUI A;  4G54 A;  1CPJ A;  4X6J A;  3KX1 A;  3PW3 A;  5CVM A;  1NLJ A;  4KLB A;  4ZUX U;  1A6R A;  3DF0 A;  4AXL A;  3HD3 A;  3E1Z B;  1PBH A;  1QOL A;  2FYE A;  3WXF A;  4BS6 A;  1BP4 A;  2NQA A;  2G8E A;  1MHW A;  1YVB A;  2OZ2 A;  3QSD A;  5J94 A;  1NB3 A;  2FUD A;  4BSQ A;  4MSX A;  3S3R A;  1F2C A;  4I04 A;  4BPV A;  3V6E A;  4PP1 A;  2DCB A;  1NB5 A;  4AXM A;  1TLO A;  3BC3 A;  1STF E;  2DJG B;  2OUL A;  2YJB A;  1KFU L;  2R9M A;  3CH3 X;  5CHT A;  1BY8 A;  3IHP A;  2GHU A;  3H8C A;  5EGW A;  4P6E A;  2YJC A;  1EF7 A;  3P5W A;  1TL9 A;  3WXE A;  4CDF A;  3BOW A;  2C0Y A;  3QJ3 A;  1M6D A;  1AU3 A;  5K16 A;  1AU0 A;  2DC8 A; 
#chains in the Genus database with same CATH topology
 4YFQ A;  2Y3E A;  4QZU A;  3K3L A;  1FE3 A;  5KHP A;  1SXW A;  1TOW A;  1X8U A;  3RDQ A;  4RUN A;  2RTR B;  4GU8 A;  1MEM A;  3BWK A;  1DZM A;  4CPF A;  1B8E A;  4ZFX A;  1SWL A;  4BJ8 A;  4Q8H A;  1GEC E;  2MF6 A;  3MP2 A;  3MVF A;  1FJ1 E;  1OEE A;  1HBP A;  3QKG A;  3MHS A;  1QY2 A;  3F8A A;  3NQ3 A;  3IFB A;  2N93 A;  4CPI A;  2XU4 A;  1ITO A;  5JD2 A;  3PH6 A;  4FQB B;  2E4J A;  2X34 A;  1AB0 A;  3RWX A;  4YFP A;  1VSN A;  4YYQ A;  1UZ2 X;  2KD2 A;  2C4I A;  5EDC A;  3USV A;  4WHI A;  3N91 A;  1X9Y A;  1P6P A;  5LJH A;  4M0W A;  2A3F X;  3PHW A;  5BVT A;  4NYQ A;  3JSQ A;  1YZB A;  3BY4 A;  2IZK A;  1VWJ B;  2AL0 X;  1IKJ A;  3ZW1 B;  2B1N A;  2OFR X;  3ELX A;  2Y5B A;  4ZCB A;  1PPO A;  4AZP A;  4Q8G A;  3P5X A;  1E2T A;  2OY1 O;  3RE6 A;  5EF4 A;  1LCW A;  3ZNH A;  1SWC A;  5B5F A;  1SWD A;  1GLO A;  2Y32 A;  4XR7 A;  3F75 A;  4FGI B;  4IMN A;  1DZJ A;  1KFF A;  4O4X A;  2PBH A;  1KL4 A;  4I3B A;  2J7Q A;  2JU7 A;  1GT3 A;  1QAB E;  1ICM A;  5HA0 A;  1EWP A;  1Y9L A;  1EQD A;  4GDZ A;  4GK9 A;  2KT4 B;  3NR3 A;  5EZ2 A;  4I3D A;  1YP7 A;  3O1G A;  2RTB B;  1O0E A;  3STM X;  4Z2V A;  2HD5 A;  2CZU A;  2AUZ A;  3K8U A;  2GTL O;  3O22 A;  3TMP A;  2LBV A;  4GJV A;  2OY5 O;  1AU2 A;  1FEM A;  4U8U O;  5HA1 A;  1VWG B;  2HYS A;  2G8J A;  4CV7 A;  1S7D A;  4ZH9 A;  1PBY A;  2GTL M;  4OW0 A;  4A5U A;  4KCA A;  1X8N A;  4CZW A;  5HCE C;  3PQS A;  2E00 A;  1S2P A;  4KH8 A;  3SZJ A;  1LNM A;  2DCD A;  4QBB A;  2KTS A;  4YCH A;  3OJY C;  4OKA A;  4HPC A;  4YYS A;  1ADL A;  1MOY A;  3RDX A;  1JV4 A;  2Q2M A;  3VGW A;  2LFO A;  3JQO A;  3MBT A;  2UYW A;  4ZGU A;  5EZQ A;  1BSO A;  3SLT A;  2IZF B;  3HWG A;  2OVE A;  1STR B;  2JTC A;  2ACT A;  1GT1 A;  2MM3 A;  3P02 A;  2JW1 A;  2IBI A;  3KKU A;  1EII A;  1FTP A;  1HXZ A;  2XU5 A;  2IZJ A;  4N4Z A;  1JJJ A;  2WEX A;  3PHU A;  2NND A;  1S4V A;  2BS5 A;  3WJG A;  2AUX A;  1G74 A;  1VWI B;  1KZW A;  2RTQ B;  2NNE A;  1U9W A;  5H9N A;  3BX8 A;  1BRP A;  4ORW A;  1IFB A;  1MX7 A;  4ARH A;  3NHE A;  4ZTB A;  1GT5 A;  2E03 A;  1SRE A;  4OEL A;  2ZSC A;  3C9E A;  2QO4 A;  1YUP A;  1KZX A;  1POP A;  4NNT A;  1ICN A;  2IZD B;  5BVS A;  4O4O A;  4UU2 A;  3KVN A;  4X6I A;  3RZY A;  2A13 A;  1GKA A;  2AT8 X;  2BDZ A;  2AGA A;  5K06 A;  4HPD A;  1BM5 A;  3BDR A;  2FRS A;  4BOS A;  3WZO A;  1G7N A;  3HHA A;  4I95 A;  1AVE A;  2FS6 A;  1NBX A;  3BB7 A;  4YYU A;  9PAP A;  5HCC C;  1OPA A;  2VHF A;  2DC7 A;  5KO3 A;  2BTW A;  1CJ5 A;  4TJZ A;  4PAD A;  3PT2 A;  2HZR A;  5PAD A;  4CDC A;  3CR6 A;  3VU1 A;  3VHH A;  4GGT A;  1O1U A;  3FEN A;  3PSE A;  3WZQ A;  2HMB A;  3K9M A;  3I06 A;  1RXJ A;  1MIR A;  1LUQ A;  1SWQ A;  1JMX A;  1KXR A;  3OF8 A;  3I17 A;  3STK A;  4NYR A;  4HXD B;  4GDA A;  1VWA B;  5L8N A;  3QQ2 A;  5CE4 A;  1NPZ A;  1YT7 A;  2FE8 A;  1LID A;  1KT7 A;  4GD9 A;  2AT3 X;  1W5R A;  1BBP A;  1KQW A;  2JU8 A;  1N4J A;  3M99 A;  4AZR A;  4Y59 A;  4ZHG A;  2A2U A;  2FR2 A;  4MZS A;  5EPQ A;  3LFY A;  1NQN A;  3CWK A;  1O8V A;  1CRB A;  2F73 A;  1KHP A;  2W2F A;  2XU3 A;  7PCK A;  1SWU A;  2Z84 A;  4MEE A;  3B2J A;  5HZ8 A;  4U8U M;  1TOU A;  1UKF A;  4JHQ A;  1KT4 A;  1RXK A;  4JO6 A;  3D96 A;  5CVM A;  4KLB A;  4ZUX U;  4YKM A;  3F9D A;  1LDQ A;  5FQ7 E;  4YGZ A;  4YDB A;  4AXL A;  2RTJ A;  1I06 A;  2IZC B;  4D8E A;  3E1Z B;  1PBH A;  2FYE A;  4U3Q A;  5CHK A;  1D3S A;  5CSE A;  4GJS A;  1YVB A;  5J94 A;  3PPT A;  3KZA A;  2RTF B;  3B2H A;  1SWR A;  1EW3 A;  4PJ2 A;  2JRI A;  2CM4 A;  3RY1 A;  1I9H A;  4P16 A;  1T0V A;  2DCB A;  2BSZ A;  3VE2 A;  2K62 A;  2BS6 A;  4TKB A;  1SXY A;  2WR6 A;  4QGX A;  3PRP A;  1SLF B;  2XKL A;  2IZB A;  3PEC A;  1KOI A;  2NP1 A;  3P6C A;  3S5X A;  1KQX A;  5HCD C;  4YKO A;  2BU3 A;  3NX2 A;  2OVS A;  4P6E A;  2YJC A;  3P5W A;  1O1V A;  3WXE A;  4Y0P A;  3BOW A;  3QJ3 A;  3VHI A;  1H91 A;  1SWE A;  1YWD A;  1GKA B;  4GKC A;  3WJC A;  2LBA A;  1AU0 A;  4ZHD A;  2RTE B;  1SWS A;  3FMZ A;  2FS7 A;  1NC9 A;  4OS0 A;  2OF9 A;  3P6E A;  1VWO B;  2R9O A;  2FHL A;  3U8E A;  4KC8 A;  1F29 A;  3WJE A;  3SAO A;  1CVZ A;  3GCB A;  1GX3 A;  2YJ9 A;  4YGG A;  2RTI B;  1VWL B;  1U5I A;  2ARY A;  1SWF A;  3HOE A;  1NL6 A;  2A2G A;  3PP6 A;  2BHV A;  3APV A;  4IUM A;  3RBY A;  2O62 A;  2JGS A;  1QFV A;  1X8Q A;  1EWL A;  2NQG A;  3E9S A;  2VHS A;  2JN3 A;  5L8I A;  1CTE A;  2DCA A;  1HBQ A;  4ZGF A;  1MM9 A;  3S60 A;  3L4R A;  3SZI A;  3N3K A;  3IV2 A;  2JOZ A;  5B5G A;  1LCV A;  3FA6 A;  1BQI A;  4GNW A;  1SRJ A;  5AJB A;  3H7D A;  4BGF A;  2A5C A;  3FA9 A;  5IRA A;  4UU3 A;  1U0X A;  3KFQ A;  1SRH A;  2Q4N A;  4N7C A;  3S3Q A;  1NP1 A;  1HMT A;  2IZH B;  2KW1 A;  1LIF A;  2BT9 A;  4ORU A;  4Z2O A;  4A1Y A;  2O6X A;  4XME A;  1Y52 X;  2FKG A;  3F6Z B;  2OY7 A;  3D9W A;  1JYD A;  3KFI A;  1AYV A;  2Y3F A;  3ELZ A;  1TXL A;  1MEG A;  1GMY A;  2RTO B;  1MS6 A;  2FT2 A;  1QMY A;  2XST A;  1U9X A;  3S5V A;  1WBI A;  2DM5 A;  4BX6 A;  2BC3 A;  3I3T A;  3TGA A;  2R74 A;  3RDM A;  3NAD A;  3KW9 A;  2X8S A;  4EDE A;  3BY0 A;  4I60 A;  1Z24 A;  4GRJ A;  3FLL A;  2FR3 A;  4TLJ A;  2CB5 A;  2R9C A;  4NP1 A;  4DMY A;  2R9F A;  4FK5 A;  1SA8 A;  1JYJ A;  2NQD B;  2X45 A;  2YJ2 A;  1XKG A;  2UZ2 A;  1PXV A;  5JH3 A;  4YYV A;  2G79 A;  2RTP B;  5IXG A;  5L3Y A;  4ORS A;  4AZM A;  1A57 A;  1DKI A;  3CQN A;  4NNS A;  2H7J A;  1FEL A;  3ZUA A;  2X4M A;  1U9V A;  2AYN A;  2CIO A;  2PAD A;  1SWO A;  5K68 A;  2DC9 A;  5KIC A;  2JQF R;  1EWO A;  1X89 A;  1G5W A;  3FEL A;  1ICF A;  4A8Z A;  2OL8 O;  3O2Y A;  1RBP A;  1GM6 A;  3STN A;  2WWP A;  4WUR A;  3OVX A;  3AI8 A;  1YK8 A;  2P7U A;  5FFH A;  1ZNL A;  4RNA A;  5FQ6 E;  2AT0 X;  2QM9 A;  3FA7 A;  4O3Y A;  3BU9 A;  2X8T A;  1BLR A;  3RDU A;  1MK5 A;  1FDQ A;  2LB6 A;  2AVW A;  3KQ0 A;  4FIP A;  2OVA A;  2JU3 A;  1CQD A;  4QRG A;  5FAZ A;  3P24 A;  3KWZ A;  1AEL A;  4BX6 B;  1STS B;  5F02 A;  4PP2 E;  3BPF A;  4TKH A;  1YP6 A;  4I6S A;  1OBP A;  2FGS A;  1SLE B;  4AYH A;  1Y4H A;  5DG4 A;  4O9S A;  4BOQ A;  3GE2 A;  1DF8 A;  4CDD A;  1VWH B;  3VHM A;  2I5V O;  3H6S A;  4N8W A;  2HZQ A;  1PPN A;  2ZAG A;  1PBO A;  3CBC A;  5D48 A;  3EMM A;  3ZQ3 A;  5KID A;  2QCB A;  2ACP X;  3F5V A;  2BDL A;  3LHN A;  1THE A;  1HY2 A;  3VG2 A;  1JIW I;  1QY1 A;  5FPW A;  3HWE A;  1IKE A;  4N7D A;  2DJF B;  5AJC A;  3BCN A;  4CDE A;  4WA6 A;  4QH6 A;  3RSW A;  3AKM A;  1LIC A;  2G7B A;  1E06 A;  4QQ1 A;  2RCT A;  4O3X B;  3OIS A;  4QRX A;  4EXZ A;  3HPE A;  5FQ8 E;  5LJC A;  3N3G A;  1CSB B;  4LKT A;  5F6B A;  1LEL A;  2OFM X;  2RTG B;  3PNR A;  2OZQ A;  4MVK A;  2L5P A;  4HPA A;  2HWK A;  4BCS A;  2CBR A;  2R9N A;  5LJB A;  2E01 A;  1DEU A;  3MOR A;  1OPB A;  5IO7 A;  3N4C A;  3KFF A;  1N0S A;  2PI3 O;  4QYN A;  2G5L A;  3P6F A;  3OQC A;  2XU1 A;  4DNE A;  3EYC A;  3TRK A;  4O49 A;  2X55 A;  4ORR A;  5HZ9 A;  4YVB A;  1LIE A;  4FBR A;  3BSZ E;  1URE A;  3S26 A;  1AVD A;  2R56 A;  1AQB A;  2FLJ A;  3D4R A;  4G54 A;  1CPJ A;  1LDO A;  3BBA A;  1A6R A;  5D4A A;  2LKK A;  4YBP A;  3DF0 A;  4O4U A;  3HD3 A;  1N7Y A;  4MVL A;  1HN2 A;  4ID2 A;  4GUZ A;  2G8E A;  4CPH B;  2FUD A;  3S3R A;  1EAL A;  4BOP A;  4ZHH A;  3FID A;  5IO6 A;  4B55 A;  1HXL A;  2MWH A;  1SY0 A;  3BC3 A;  5B27 A;  4EFG A;  2DJG B;  4BOZ A;  2CM9 A;  1KFU L;  1XKI A;  4O3W A;  4IAX A;  3IHP A;  2RTC B;  3H8C A;  1ZNH A;  5EGW A;  3C78 X;  2WQ9 A;  1BEB A;  4YBU A;  4ZJ0 A;  4OMX A;  1VWP B;  2IZI A;  2C0Y A;  4TKJ A;  2AKQ A;  1BWY A;  5EZS A;  1SXX A;  3MJ5 A;  4WFU A;  1AU3 A;  3C76 X;  1LF7 A;  4OVZ B;  3MM0 A;  2J7Q C;  2RA6 A;  2DC8 A;  3FR2 A;  1UYO X;  2DOS A;  5HZ6 A;  2IZL B;  4DCB A;  3RNV A;  1SWH A;  3H8B A;  3BX7 A;  1KL5 A;  1RST B;  1GXA A;  4D6B A;  1HUC B;  3WXG A;  1FH0 A;  1PVJ A;  2I5Z O;  1SP4 B;  3RVX A;  4W4U A;  1W6F A;  2JQG R;  3B2I A;  1PEE A;  4ES7 A;  4PI3 A;  4CPH A;  1MDC A;  1DZK A;  3MG5 A;  4X6H A;  3VE1 A;  5FEN A;  3QT4 A;  5B3M O;  3RE5 A;  4GNY A;  4IBA A;  3T1D A;  2IZE B;  1T8V A;  1N43 A;  4YYR A;  1BSY A;  4BS5 A;  1CS8 A;  2FTD A;  2F09 A;  2RTL A;  3VG7 A;  2G7Y A;  1VWF B;  4YFR A;  4BOU A;  1OBU A;  4LZV A;  1SRI A;  1KHQ A;  2M4L A;  3HHI A;  2CAM A;  2RCQ A;  1SWB A;  4REZ A;  2L67 A;  5HWZ A;  2OFB A;  5L8O A;  2YJ8 A;  1SWA A;  2G78 A;  3KSE A;  1WUB A;  1YK7 A;  4C5P A;  2RTA A;  3RVW A;  2R6N A;  3IUT A;  1W4T A;  2R73 A;  2C1Q A;  4Z6J A;  3BLG A;  2GFO A;  2FWV A;  4CPE A;  4WBK A;  3RVV A;  1VWK B;  4O3Z A;  1RSU B;  3PED A;  1MUP A;  4I3C A;  3WBG A;  3WZP A;  1DV9 A;  2A5B A;  3NPO A;  3IMA A;  4QAE A;  2DCC A;  3APX A;  3CBJ A;  2HKD A;  1SY3 A;  1RLB E;  4O4S A;  3WVM A;  4EEJ A;  2F01 A;  2OFA A;  4YVA A;  2DJG A;  1DZP A;  4AW8 A;  3ZUO A;  2LA7 A;  1PPP A;  3NX1 A;  1EI5 A;  3UEU A;  1CBQ A;  1U17 A;  1X8P A;  2RN4 A;  1IIU A;  4MIS A;  1U18 A;  4DQ4 A;  4IMO A;  3W30 A;  4D8I A;  1EPA A;  3WXQ A;  1Y08 A;  3OVZ A;  4ORY A;  2AIM A;  4BOE A;  4GGR A;  3PBH A;  2X32 A;  3T2W A;  3FDC A;  1SLD B;  2CBS A;  2G8C O;  4EQA C;  5JR8 A;  4QRL A;  4GUA A;  5A24 A;  5E6J A;  1YWB A;  4OMW A;  4MVI A;  1TVQ A;  4KT5 A;  3UEX A;  3WJB A;  1SNK A;  3ERV A;  2AYO A;  5HZ5 A;  3ZW2 A;  2AMM X;  1ZRY A;  2FT9 A;  3DTQ A;  4XMG A;  4OVZ A;  1F2A A;  1AYU A;  1YWA A;  3FEK A;  2EU7 X;  1B0O A;  2HH5 A;  1CBI A;  1KXO A;  3C77 X;  2IZA A;  2OF8 A;  1QXP A;  5HBS A;  1B4M A;  1AEC A;  3H89 A;  2X8F A;  3DSZ A;  3NBX X;  1DF0 A;  1PCI A;  1I78 A;  5IO5 A;  1ZIV A;  2Z4I A;  3WJD A;  1VJV A;  4R0B A;  1ATK A;  1X71 A;  4U8U N;  1TU6 A;  5B11 O;  4GET A;  2IPP B;  4YH0 A;  3OBL A;  4XZX A;  3JS1 A;  1AYW A;  1LCZ A;  1TW4 A;  5CYB A;  4ZR2 A;  3P5U A;  4L3R A;  1E02 A;  2GC9 A;  4IB9 A;  5D45 A;  3FA8 A;  3PDF A;  8PCH A;  1LPJ A;  1AIM A;  4RY2 A;  5HAE A;  4ORX A;  4L1N A;  4YGH A;  3CQR A;  4YCE A;  1DF3 A;  3HWN A;  4MI7 A;  3W31 A;  4WFV A;  3ZW0 A;  1HQQ A;  1ERX A;  1SRF A;  1ME3 A;  1VWC B;  1QDQ A;  2VDF A;  1ZND A;  1NQM A;  2PRE A;  4MZO A;  2AVI A;  1JJU A;  1Y0G A;  3EBW A;  1BSQ A;  1CBS A;  2WUT A;  4XMH A;  3SLO A;  2AU1 A;  1DFV A;  2X46 A;  1NP4 A;  2WSJ A;  1JQP A;  3CH2 X;  2DZY A;  2X56 A;  4Z28 A;  4CDF B;  2JMB A;  3IA8 A;  2GH7 A;  1I05 A;  4XMC A;  4Y0S A;  1VWR B;  2RTN B;  5DPQ A;  4QZT A;  3FR4 A;  4W5B A;  1DC9 A;  5IRU A;  4FBO A;  1KL3 A;  2IZG B;  3I0A A;  4I05 A;  1CB5 A;  4IB8 A;  4CSB A;  5F1E A;  4Y0Q A;  1ZNE A;  4Y5D A;  4AZQ A;  4KC7 A;  1K3B A;  2AF5 A;  5JA7 A;  1PTS A;  5IRW A;  3HWF A;  2PY1 A;  3CBK A;  2Q9S A;  5D47 A;  1SWP A;  1Q6K A;  1YAL A;  3O65 A;  2RTK A;  4K19 A;  2MO5 A;  5CHV A;  4ON1 A;  1SY2 A;  4A60 A;  3MHH A;  2GJ5 A;  3B2K A;  1SWK A;  2FTB A;  2K23 A;  2QO5 A;  3BRN A;  1X8O A;  1E5P A;  5F7G A;  3VG5 A;  1EWM A;  3AKN A;  4IP3 A;  3NQK A;  3BPM A;  4XUI A;  4X6J A;  3EC5 A;  3CKF A;  3B2L A;  3PH5 A;  4D8B A;  2ZAI A;  1NLJ A;  4QGW A;  3Q34 A;  2RTH B;  3WJF A;  4OS3 A;  3U03 A;  1GX9 A;  3WXF A;  3EW1 A;  5EDB A;  3OE3 A;  5H8T A;  4MVE A;  2L68 A;  4LKP A;  4QYP A;  4BX7 A;  1BJ7 A;  2Q2P A;  1MHW A;  1ZNK A;  1MVG A;  5LJG A;  3QSD A;  1LIB A;  4BSQ A;  1F2C A;  1JJX A;  2ACO A;  1SWN A;  1GT4 A;  3V6E A;  3WOV A;  1NB5 A;  2AH7 X;  5B10 O;  2OUL A;  2YJB A;  2R9M A;  3CH3 X;  5CHT A;  1BY8 A;  4ZHF A;  2W2B A;  2UZJ A;  4YMY A;  1EF7 A;  1TL9 A;  3PQU A;  2VFB A;  2IFB A;  4AZO A;  1ML7 A;  4Z2P A;  3TZS A;  3HK1 A;  1M6D A;  1PMP A;  3ZI8 A;  2ALL X;  4IRW A;  4HPB A;  1SY1 A;  1VPR A;  3EW2 A;  2FHN X;  2AT5 X;  1S44 A;  3CBS A;  4HFO A;  1VWE B;  3FW5 A;  5LKE A;  4N79 A;  5H9A A;  3SOT A;  4TNN A;  4NLI A;  2FO5 A;  4IB7 A;  3RKG A;  1BGO A;  3ZW1 A;  2Y6E A;  1SRG A;  2A8G A;  3BU1 A;  2A0A A;  4YV8 A;  3G7X A;  2WEW A;  4BX5 B;  4PSQ A;  3U0D A;  4PT5 A;  1VWD B;  4CK4 A;  2BLG A;  1G85 A;  3V6C A;  3UEW A;  5K67 A;  4RUU A;  1UYN X;  4HWY A;  4INN A;  1NGL A;  4RF1 A;  2ANS A;  1AU4 A;  1IJ8 A;  1I4U A;  4M6S A;  5EEE A;  1JMZ A;  4IB6 A;  2FKJ A;  3PK2 A;  1K3B B;  3TNX A;  1KGL A;  3TGB A;  1CBR A;  4Y0R A;  4ZH6 A;  3IFU A;  4QNI A;  5H9L A;  3TGC A;  1PE6 A;  3MTV A;  3GAQ A;  5LJE A;  1QWD A;  3FYF A;  4JNJ A;  1B56 A;  4BQU A;  4Z27 A;  2W2A A;  1BRQ A;  3VPJ E;  1PIP A;  5F6Z A;  4OS8 A;  1PAD A;  1IFC A;  5CVO B;  1GCB A;  1MDW A;  4M7M A;  2WBF X;  1LKE A;  2NQI A;  3FIQ A;  5EED A;  3EBK A;  3O0U A;  1KT5 A;  3IOQ A;  4YYW A;  4DQ3 A;  3AUM O;  3KWB X;  2RTD B;  2NNQ A;  2F7D A;  4W5C A;  1N9M A;  1L6M A;  1T68 X;  3X00 A;  6PAD A;  4BX5 A;  1F2B A;  1QG5 A;  3VG3 A;  3SZH A;  2AT6 X;  4XMF A;  4MM3 B;  4ALB A;  4NLJ A;  5LKF A;  2DZZ A;  2L9C A;  3IEJ A;  1ME4 A;  3UAQ A;  1OEK A;  4CDC B;  3B21 A;  2MJI A;  2P8G A;  2DC6 A;  3ZZV A;  1EUO A;  3LTW A;  1IW2 A;  2OL6 O;  2ASN X;  2BTW B;  3K24 A;  1MEP A;  3RDO A;  1SMP I;  3MX7 A;  2FRQ A;  4ZHC A;  3HTY A;  3P6H A;  4FJC A;  4NV7 A;  3P5V A;  1NDJ A;  4IAW A;  1K24 A;  3CKG A;  3OD9 A;  1CJL A;  1GX8 A;  3E3C A;  1VYF A;  4IAB A;  1KFX L;  1EXS A;  2FRA A;  4BQV A;  2B1M A;  2P0R A;  2QO6 A;  2OYB O;  2QOM A;  3C0R A;  1VYO A;  3EM0 A;  4MIR A;  2P86 A;  4CDD B;  4GH7 A;  5AQ6 A;  1VYG A;  3UEV A;  5B2A O;  4AZN A;  1A3Y A;  3D97 A;  5BVQ A;  2HHN A;  1CV8 A;  1HMR A;  3P6D A;  2YG2 A;  3V8U A;  1VWB B;  2HXZ A;  1RAV A;  2Z4H A;  3P6G A;  1QQS A;  3NP1 A;  2AS8 A;  2RD7 C;  3HOL A;  5D8J A;  2DJF A;  2VFC A;  2QMI A;  3D95 A;  1VWQ B;  4BBO A;  3TF6 A;  3FEP A;  4NW4 A;  3T2X A;  4I9S A;  2E02 A;  1EIO A;  4A1H A;  2G6D A;  4XMD A;  1OEJ A;  1EPB A;  1FEN A;  4OEM A;  1YWC A;  3AEH A;  2POA A;  4I07 A;  4QGV A;  4EKV A;  3OF9 A;  2RTM A;  1ZCM A;  5LJD A;  3APW A;  4ALO A;  3WZN A;  1JZU A;  4QRV A;  1MX8 A;  4GGZ A;  2OP3 A;  3FW4 A;  1KT6 A;  1SWJ A;  2RQ0 A;  3CMP A;  1A18 A;  1HQP A;  1JBH A;  2HNX A;  1XCA A;  1QY0 A;  1IWD A;  3D6S A;  2Q39 A;  1LFO A;  3HWD A;  2HLV A;  4GE1 A;  4U46 A;  5AEO A;  1ALB A;  1YIV A;  1R0U A;  4CDE B;  3Q6L A;  1OSP O;  1PPD A;  1RXH A;  3RY2 A;  2PNS A;  1U9Q X;  1SWT A;  2F1G A;  1Y53 X;  3MTN A;  4DMX A;  4K7C A;  2CZT A;  4RF0 A;  1NQC A;  2KTD A;  3H3I A;  3LXS A;  1SXU A;  3VG4 A;  5CVN B;  1VWN B;  3PRM A;  1Y9T A;  2ATO A;  4P6G A;  4JGL A;  2FQ9 A;  3B79 A;  3WYQ A;  5H9K A;  4LZU A;  4GZV A;  2GTL N;  4RKX A;  3BS2 A;  2YMS A;  3KX1 A;  3PW3 A;  5JZE A;  1I04 A;  1D2U A;  4R3D A;  3U9P C;  4BVM A;  1SLG B;  3NQ9 A;  4FBV A;  5HTE A;  1QOL A;  2WPU A;  5F2B A;  5LJK A;  2QOS C;  3ZW0 B;  4BS6 A;  4HWM A;  1BP4 A;  2NQA A;  3FR5 A;  1QFT A;  2OZ2 A;  4D6A A;  1NB3 A;  2GTF X;  4ML7 B;  1Y55 X;  4MSX A;  1STP A;  4I04 A;  4U9C A;  5B29 A;  4BPV A;  3PHX A;  4KII A;  2OVD A;  1GGL A;  2MHD A;  3RDS A;  1AVG I;  4PP1 A;  1ACD A;  1ZNG A;  4YDA A;  4AXM A;  1TLO A;  3SLJ A;  5C0N A;  3T6F A;  1STF E;  1N9Y A;  3T6L A;  5HTD A;  4I9R A;  1PM1 X;  4TQ2 A;  1HMS A;  2GHU A;  3KFH A;  4COT A;  3APU A;  4ODD A;  1A2D A;  3KFG A;  1VWM B;  4CDF A;  3ZUI A;  5F58 A;  4LQZ A;  1KT3 A;  4NV8 A;  1E00 A;  3O19 A;  3ZWE A;  5HZQ A;  1OBQ A;  5K16 A;  2OL7 A;  2WQA E;  1ERB A;  3VG6 A;  3WYP A;  2OY8 A;  2C1S A;  4BX7 B;  1SWG A;  3LV4 A;  5BYP A; 
#chains in the Genus database with same CATH homology
 2R9O A;  4N79 A;  3H8B A;  3U8E A;  1F29 A;  2FO5 A;  1CVZ A;  1MEM A;  1BGO A;  3BWK A;  3GCB A;  1GX3 A;  2YJ9 A;  1HUC B;  4Q8H A;  2Y6E A;  1GEC E;  1U5I A;  2ARY A;  3WXG A;  4YV8 A;  1FH0 A;  1SP4 B;  1NL6 A;  3MHS A;  3RVX A;  4W4U A;  1W6F A;  3V6C A;  4HWY A;  1EWL A;  2NQG A;  2XU4 A;  1ITO A;  2JQG R;  1AU4 A;  2VHS A;  4PI3 A;  1CTE A;  2DCA A;  4X6H A;  1VSN A;  3N3K A;  3QT4 A;  4YYQ A;  3IV2 A;  1K3B B;  3TNX A;  3USV A;  4YYR A;  1X9Y A;  4BS5 A;  1CS8 A;  2FTD A;  1BQI A;  2G7Y A;  3H7D A;  4BGF A;  1KHQ A;  1PE6 A;  3HHI A;  3KFQ A;  2B1N A;  3S3Q A;  2Y5B A;  1PPO A;  4Q8G A;  2YJ8 A;  3P5X A;  1E2T A;  5EF4 A;  3KSE A;  1YK7 A;  4C5P A;  3RVW A;  2R6N A;  1PIP A;  1GLO A;  4XR7 A;  1PAD A;  3IUT A;  3F75 A;  5CVO B;  1W4T A;  1GCB A;  1MDW A;  2O6X A;  2GFO A;  2WBF X;  2PBH A;  2NQI A;  3RVV A;  3O0U A;  3IOQ A;  1EWP A;  3D9W A;  4YYW A;  3KWB X;  1AYV A;  2F7D A;  4W5C A;  3O1G A;  1MEG A;  1GMY A;  1MS6 A;  2FT2 A;  1QMY A;  3IMA A;  1O0E A;  1U9X A;  2DCC A;  6PAD A;  3CBJ A;  2HD5 A;  1F2B A;  3I3T A;  4YVA A;  2DJG A;  2AUZ A;  3K8U A;  3KW9 A;  1PPP A;  1AU2 A;  2DZZ A;  2CB5 A;  3IEJ A;  2R9C A;  2G8J A;  1ME4 A;  4DMY A;  2R9F A;  4FK5 A;  4CDC B;  1Y08 A;  2DC6 A;  2NQD B;  4CZW A;  3OVZ A;  3LTW A;  2AIM A;  2E00 A;  2YJ2 A;  1XKG A;  3PBH A;  1PXV A;  5JH3 A;  4YYV A;  3K24 A;  5A24 A;  2DCD A;  4QBB A;  2FRQ A;  1SNK A;  3ERV A;  2AYO A;  2H7J A;  4YYS A;  3ZUA A;  1U9V A;  2AYN A;  2CIO A;  2PAD A;  1F2A A;  1AYU A;  2DC9 A;  4FJC A;  2JQF R;  4NV7 A;  1EWO A;  3P5V A;  1ICF A;  2ACT A;  2IBI A;  2HH5 A;  3KKU A;  2XU5 A;  1CJL A;  4N4Z A;  3OVX A;  1QXP A;  3AI8 A;  1YK8 A;  2P7U A;  1KFX L;  2FRA A;  1S4V A;  4BQV A;  2B1M A;  2P0R A;  1AEC A;  3H89 A;  1DF0 A;  2AUX A;  2P86 A;  4CDD B;  1PCI A;  1ZIV A;  2AVW A;  1U9W A;  1VJV A;  4FIP A;  2HHN A;  1ATK A;  1CQD A;  1CV8 A;  4QRG A;  1TU6 A;  2IPP B;  3KWZ A;  1AYW A;  5F02 A;  4PP2 E;  3NHE A;  2HXZ A;  3BPF A;  2E03 A;  4OEL A;  3P5U A;  2AS8 A;  3C9E A;  1Y4H A;  1POP A;  3PDF A;  8PCH A;  2DJF A;  2VFC A;  1AIM A;  4RY2 A;  4CDD A;  4X6I A;  3H6S A;  4N8W A;  1PPN A;  2E02 A;  3HWN A;  2BDZ A;  2G6D A;  1ME3 A;  4OEM A;  1QDQ A;  2PRE A;  4MZO A;  3F5V A;  2BDL A;  3HHA A;  2AU1 A;  4I07 A;  4YYU A;  1THE A;  9PAP A;  5FPW A;  2DJF B;  3OF9 A;  2VHF A;  2DC7 A;  3BCN A;  1JQP A;  3CH2 X;  2DZY A;  4CDE A;  4WA6 A;  4QH6 A;  4CDF B;  4PAD A;  1ZCM A;  5PAD A;  4CDC A;  3OIS A;  4QRX A;  4W5B A;  4QRV A;  3K9M A;  2OP3 A;  3I06 A;  1MIR A;  3N3G A;  1CSB B;  1KXR A;  3OF8 A;  4I05 A;  3PNR A;  1CB5 A;  1IWD A;  3D6S A;  1K3B A;  5JA7 A;  2R9N A;  4CDE B;  3CBK A;  1NPZ A;  1YT7 A;  2E01 A;  1Q6K A;  1DEU A;  1PPD A;  1YAL A;  3MOR A;  1W5R A;  3N4C A;  2PNS A;  1U9Q X;  5CHV A;  2F1G A;  3MTN A;  4DMX A;  4K7C A;  3M99 A;  2XU1 A;  3MHH A;  1NQC A;  4MZS A;  3LXS A;  3LFY A;  5CVN B;  2XU3 A;  1KHP A;  2ATO A;  7PCK A;  4P6G A;  1EWM A;  2FQ9 A;  3B79 A;  3BPM A;  4XUI A;  4G54 A;  1CPJ A;  4X6J A;  3KX1 A;  3PW3 A;  5CVM A;  1NLJ A;  4KLB A;  4ZUX U;  1A6R A;  3DF0 A;  4AXL A;  3HD3 A;  3E1Z B;  1PBH A;  1QOL A;  2FYE A;  3WXF A;  4BS6 A;  1BP4 A;  2NQA A;  4GUZ A;  2G8E A;  1MHW A;  1YVB A;  2OZ2 A;  3QSD A;  5J94 A;  1NB3 A;  2FUD A;  4BSQ A;  4MSX A;  3S3R A;  1F2C A;  4I04 A;  4BPV A;  3V6E A;  4B55 A;  4PP1 A;  2DCB A;  1NB5 A;  2BSZ A;  4AXM A;  1TLO A;  3BC3 A;  1STF E;  2DJG B;  2OUL A;  2YJB A;  1KFU L;  2R9M A;  3CH3 X;  5CHT A;  1BY8 A;  3IHP A;  2GHU A;  3H8C A;  5EGW A;  4P6E A;  2YJC A;  1EF7 A;  3P5W A;  1TL9 A;  2VFB A;  3WXE A;  4CDF A;  3BOW A;  2C0Y A;  4NV8 A;  3QJ3 A;  1M6D A;  1AU3 A;  5K16 A;  1AU0 A;  2DC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...