1JQPA

Dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
438
structure length
348
Chain Sequence
DTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHETMTGWVHDVLGRNWACFVGKKMLSLPESWDWRNVRGINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHPFNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptidyl peptidase I
publication title Tetrameric dipeptidyl peptidase I directs substrate specificity by use of the residual pro-part domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 100
structure length 348
sequence length 438
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 1jqpA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1jqpA02
3HHAA 1F2BA 1ME4A 4X6JA 3KKUA 4YV8A 1F2AA 1U9XA 7PCKA 3OVZA 2XU1A 5CHVA 4MZOA 1CV8A 5CVMA 1PXVA 2DJGB 3K9MA 1NL6A 4CDEB 5CVNB 1EWMA 4YYRA 4BSQA 1SP4B 2VHFA 3K8UA 1Q6KA 1MDWA 2JQFR 4QH6A 2GFOA 2IPPB 3I3TA 3IHPA 3K24A 2DJFA 3OF9A 3H89A 1HUCB 1PIPA 3C9EA 3HHIA 2CB5A 3D6SA 1PPOA 3E1ZB 5CHTA 1ATKA 1PPNA 2FT2A 3N3KA 3MORA 2AYNA 1ME3A 5FPWA 6PADA 1EF7A 3TNXA 2H7JA 2FYEA 4AXMA 2FQ9A 3RVWA 2DCDA 1VSNA 4ZUXU 1JQPA 1YT7A 3BCNA 1S4VA 3P5UA 1DF0A 4OELA 2NQAA 4BS5A 4YYSA 3BWKA 2G8EA 1AU4A 2E00A 2Y5BA 2DJGA 4K7CA 4CDEA 4YYWA 4FK5A 4W4UA 3IV2A 1Y4HA 4QRGA 4OEMA 3OVXA 1F2CA 2JQGR 5JH3A 2ACTA 1IWDA 2FTDA 3QSDA 3MTNA 1MEGA 3MHSA 2DC7A 1NB5A 3NHEA 2OP3A 3BC3A 2AIMA 1U9WA 1AU3A 5K16A 2DZYA 2VHSA 4DMXA 4P6GA 1KFXL 3O1GA 3KFQA 2XU5A 1QOLA 1ZIVA 4CDCA 1YVBA 1YK8A 1NQCA 2XU3A 1MIRA 2P86A 1TL9A 2BDZA 1TU6A 1XKGA 4QRVA 1KHPA 3PW3A 1CJLA 2AYOA 3CBKA 1U9QX 1NPZA 2NQDB 9PAPA 2Y6EA 2G8JA 2DCCA 1POPA 5A24A 2WBFX 2NQIA 1EWOA 3KX1A 4YVAA 4I05A 1BY8A 1EWLA 2IBIA 2G7YA 5F02A 2P7UA 3BOWA 4X6IA 4PI3A 4W5BA 2P0RA 1K3BA 1YK7A 2YJBA 3DF0A 1M6DA 2AUXA 3H8BA 3CH2X 1STFE 3P5VA 4YYVA 3S3QA 1U9VA 4QRXA 3S3RA 4PP2E 1O0EA 3PDFA 4CDCB 1CPJA 2GHUA 3AI8A 4Q8HA 3HWNA 3N4CA 3B79A 3PBHA 2G6DA 1PCIA 3H7DA 4BS6A 2PBHA 2AUZA 1YALA 3BPFA 2YJ9A 4CDDB 3M99A 2E01A 2CIOA 4RY2A 1CSBB 2OULA 1BP4A 2B1MA 2PNSA 4CDFB 1THEA 3KSEA 3QJ3A 1QDQA 1NB3A 2DCAA 3IOQA 3QT4A 3V6CA 1A6RA 3P5WA 4YYQA 2DC8A 1F29A 5J94A 4MZSA 2HD5A 1K3BB 1KXRA 3H6SA 4PADA 3USVA 4FIPA 2C0YA 4BQVA 1MHWA 1AYUA 4W5CA 5PADA 4FJCA 2R9CA 3F75A 1CVZA 3WXFA 1AU2A 3KWZA 3O0UA 4YYUA 4CDDA 1EWPA 1PE6A 1AYWA 2E02A 1AIMA 1FH0A 4I07A 1MS6A 2F7DA 4CDFA 1PBHA 2R9MA 3ZUAA 4XR7A 1CB5A 1QMYA 1BGOA 8PCHA 1AU0A 1Y08A 1NLJA 1CTEA 2PREA 1ICFA 3GCBA 1PADA 3U8EA 1KHQA 2B1NA 1BQIA 1GLOA 2ATOA 1CQDA 1KFUL 1ZCMA 1TLOA 4G54A 4BPVA 4N8WA 3IUTA 1SNKA 3ERVA 4MSXA 3KWBX 1GMYA 3WXEA 1QXPA 3LFYA 3P5XA 4DMYA 1ITOA 1MEMA 1U5IA 3LXSA 4HWYA 4WA6A 3OISA 3IEJA 2YJCA 3OF8A 3F5VA 3V6EA 5EGWA 1AYVA 4XUIA 2OZ2A 4I04A 2ARYA 3CBJA 4N4ZA 1VJVA 3H8CA 2FRAA 2R9OA 4CZWA 1CS8A 2AS8A 2PADA 4P6EA 3RVXA 2R9FA 1GCBA 1PPPA 4AXLA 2BDLA 2E03A 2R6NA 2AU1A 3HD3A 4QBBA 1PPDA 2DCBA 3MHHA 2FO5A 1GECE 3IMAA 2HXZA 2FUDA 2HH5A 3WXGA 4KLBA 3I06A 1DEUA 2AVWA 3RVVA 3N3GA 3CH3X 2F1GA 3PNRA 2YJ2A 1AECA 2YJ8A 2XU4A 2DJFB 4PP1A 4X6HA 2DC6A 2R9NA 3KW9A 2DZZA 5CVOB 2NQGA 3BPMA 5EF4A 2O6XA 2FRQA 4N79A 2DC9A 1X9YA 2HHNA 4Q8GA 5JA7A
chains in the Genus database with same CATH superfamily
4I3CA 4BOEA 2E4JA 1SXUA 2G79A 3KKUA 4ON1A 2IZDB 1K24A 3TGBA 4RNAA 2YMSA 5B10O 4AW8A 2RTKA 1YWAA 1ZRYA 4GH7A 5CVNB 2FLJA 1SWHA 1CRBA 1FDQA 1EI5A 4CPFA 3EBKA 4BX5A 1KT7A 1SRJA 1X89A 3VG3A 1LFOA 1PIPA 2F09A 4DQ3A 1JBHA 3VHHA 3ELXA 4YBPA 1LCZA 5B3MO 4LKPA 5AJBA 5D48A 5FPWA 1UKFA 2W2AA 5CE4A 2K62A 3PHXA 1ZNEA 3O19A 2FQ9A 1YWCA 3C77X 2DCDA 4HPAA 4AZPA 4ZUXU 2AT6X 1VWBB 4WFUA 1JQPA 3RE5A 4INNA 3P5UA 1DF0A 2ZAIA 1OBPA 3KZAA 3BWKA 4WFVA 1ZNLA 2E00A 1S2PA 2Q2PA 4U8UM 1DV9A 1SY2A 3AUMO 4W4UA 4Y0RA 2QO5A 4ZGFA 3PH6A 5H9AA 2EU7X 2JQGR 3P6DA 2X55A 1CJ5A 3RZYA 2IZFB 2OL7A 1PM1X 3W31A 2WSJA 1X71A 1NB5A 2OP3A 4GU8A 1Y9LA 2AIMA 1U9WA 3NBXX 3PQUA 4DMXA 2G7BA 2LFOA 1Y52X 4Z2VA 1W5RA 4MI7A 2HYSA 1QOLA 4GJSA 3BY4A 1MIRA 2C4IA 2P86A 2NNQA 4I3BA 3CWKA 3ZWEA 1MX8A 4D6AA 3MX7A 2OZQA 2KW1A 4L1NA 4YCEA 2L68A 1DFVA 4JO6A 2C1SA 4NV8A 1U9QX 2NQDB 4IP3A 1SLEB 9PAPA 4WBKA 5HCEC 4P16A 2G8JA 5A24A 5IXGA 5AEOA 2WBFX 1QWDA 1ALBA 3MBTA 5LJDA 3KX1A 5JZEA 2R56A 1LUQA 1SWLA 4I05A 2A2GA 2R74A 3KFHA 2FKJA 2WQ9A 1DC9A 3P24A 3BX8A 5F02A 3BU1A 2KTDA 4X6IA 4A1YA 4PI3A 4W5BA 1RXKA 1U17A 1YP6A 3B2HA 1ADLA 1QFVA 3H8BA 3CH2X 1UZ2X 1STFE 3P5VA 1B0OA 4BOSA 2RTAA 4IB6A 5B5FA 3PRPA 1W6FA 3G7XA 5H9NA 4CDCB 1X8QA 3PRMA 3FEPA 3N4CA 1KT5A 1VWMB 4Y59A 3CQNA 3H7DA 2VFBA 3S5VA 3BPFA 2YJ9A 4CDDB 4AZQA 1RXHA 5D45A 2OVSA 4FBVA 1BSYA 4BX6B 2OULA 5F1EA 4TJZA 3ZI8A 3KSEA 4D8EA 1YIVA 3QJ3A 2OVAA 3EYCA 1GT1A 3IOQA 1D3SA 4NV7A 1E5PA 1S7DA 2DC8A 1F29A 1QFTA 3PEDA 1SMPI 3WJCA 1K3BB 3D95A 3I17A 1HN2A 3RDUA 4CK4A 4PADA 4RKXA 1DZMA 2AT0X 3NPOA 2C0YA 1VWGB 3UEWA 3RDQA 3ZUOA 4FJCA 2PY1A 2R9CA 5LJGA 3F75A 1CVZA 1GT5A 3C78X 3APXA 4CDDA 1PE6A 2OFMX 2Q39A 1EW3A 1G74A 1MX7A 4OW0A 3OBLA 2R9MA 1ZNDA 4ORXA 5L8NA 1CB5A 1QMYA 1MM9A 3MP2A 1VWKB 4CV7A 5EZSA 4IUMA 2DOSA 1Y08A 1VWOB 2PREA 3WZPA 4ZHFA 1LNMA 3U8EA 4OMWA 5FENA 1G7NA 2W2BA 4XMGA 1GLOA 1JYJA 3MG5A 2OL6O 5EPQA 4BBOA 4IB9A 4N8WA 5BVTA 2HLVA 2O62A 4MSXA 1GMYA 1GX3A 4ZH6A 1QXPA 3LFYA 3P5XA 1P6PA 3CBCA 4HPDA 1ICNA 2FT9A 4MISA 3OF8A 3F5VA 5HCCC 5KIDA 2IZKA 3B2KA 2OZ2A 1LIBA 2ARYA 1A3YA 4AZOA 5F7GA 4N4ZA 3SZIA 4R3DA 4QGWA 4BOUA 4CZWA 3CBSA 5BVQA 5L3YA 2JU7A 2P8GA 1SY1A 4BGFA 1DF8A 2OY7A 2BDLA 3VPJE 1EPBA 2R6NA 4GKCA 3OQCA 2FR3A 2JMBA 1LCVA 1AQBA 5DPQA 1SY0A 5HZ9A 3FR4A 5HBSA 1KQXA 2RCTA 4U8UO 4Z2OA 1D2UA 1MVGA 3BBAA 1AELA 2Z84A 4XZXA 3I06A 3NQ9A 1JMXA 2X4MA 5HZ6A 1QY0A 2F1GA 1AECA 2YJ8A 1DKIA 2X56A 2JU8A 4C5PA 3RE6A 2R9NA 1X8NA 4IRWA 3BPMA 4MEEA 3VG2A 2O6XA 3WYQA 1KL3A 3QKGA 2FRQA 1AVDA 2OL8O 3S26A 5D8JA 4O4XA 2HHNA 1HMRA 3LV4A 1E2TA 4N7DA 3KFFA 4GDAA 4A8ZA 5AJCA 2QOMA 1SLDB 5FQ7E 1AVGI 1FENA 4YV8A 2QO6A 1O1UA 1U9XA 2FHNX 2XU1A 3RY1A 4MZOA 5CHVA 4YCHA 1CV8A 3FEKA 1PXVA 2DJGB 4RUUA 3S60A 3ZW1A 2OYBO 3TZSA 3FR2A 1SP4B 4RF1A 3K8UA 2IPPB 3I3TA 3O65A 3IHPA 3K24A 1HUCB 3WYPA 3F9DA 4XMEA 1IW2A 3FDCA 4BOZA 1GGLA 3RNVA 3NP1A 4YFPA 5EEDA 3BS2A 4O3XB 1LPJA 2FYEA 4AXMA 3PP6A 3VE2A 1RBPA 2ASNX 2KTSA 1OEJA 4I6SA 1SWEA 1VWDB 5KICA 1SWGA 1SRHA 4ZHHA 4BCSA 2NQAA 1AVEA 1I78A 1OSPO 3VU1A 1LIFA 3VE1A 2G8EA 4DQ4A 2DJGA 4ORWA 1N9MA 4YYWA 2A0AA 5IRUA 1EPAA 2FWVA 3IV2A 1Y4HA 4NW4A 1ZNHA 3RDSA 1JIWI 1F2CA 2CBRA 3FELA 3HOLA 4AYHA 4ZCBA 1SWQA 2ACTA 4O4OA 2FTDA 2KD2A 1GT3A 1VPRA 1DF3A 3TGAA 1VYGA 3D4RA 4I9RA 4DCBA 3FYFA 3B2IA 2JN3A 5K16A 2VHSA 3EBWA 1Y55X 4P6GA 3BX7A 2A2UA 3O1GA 4DNEA 3KFQA 2JRIA 4YKMA 1JV4A 1ML7A 1NQCA 1TU6A 3RDOA 3EW1A 4GJVA 1NQMA 5F58A 4U9CA 5CSEA 1YWBA 2AT5X 1MDCA 1X8UA 2FE8A 3T2WA 5E6JA 4BJ8A 1FJ1E 1POPA 3CR6A 1SWKA 2NQIA 3VHIA 2IZJA 1SWJA 4Y5DA 2WPUA 4YVAA 2BT9A 2L5PA 2Q2MA 4JNJA 5F2BA 2AT3X 1SWSA 1HY2A 2PI3O 5EEEA 2CBSA 1VWAB 2J7QA 2RTHB 1TOWA 1VWNB 2G7YA 2CAMA 3ZNHA 3FENA 2P0RA 1YK7A 2CM9A 1SLFB 3DF0A 4GGRA 1KT4A 2AUXA 1KZXA 4YBUA 4XMDA 4KC8A 4YDAA 3FIQA 2RN4A 3BLGA 2MF6A 5HCDC 4PP2E 1BWYA 3APUA 2GHUA 1HBPA 3HWNA 3B79A 3PBHA 3NX1A 2OFRX 1PCIA 3H3IA 3RY2A 4XMHA 3HTYA 1Y0GA 2AUZA 3EC5A 1TW4A 2ALLX 3V8UA 3DTQA 2AGAA 2E01A 3Q34A 3WJFA 1JMZA 1STSB 1SWPA 1HXLA 5BVSA 4QZUA 4GD9A 2RTDB 4U8UN 4K19A 5IRAA 1NB3A 2DCAA 5HWZA 1JZUA 2NNDA 4GETA 2AVIA 5J94A 3FIDA 3C0RA 2HD5A 2GTLO 2CM4A 1KXRA 3H6SA 1W4TA 1NC9A 1E02A 2MJIA 4ZH9A 2RTLA 3CQRA 1BRQA 3WXFA 4IB7A 1NQNA 3O0UA 5HZ5A 2G8CO 4HXDB 4XMFA 5EDCA 1MS6A 2MWHA 1PTSA 2J7QC 5FQ8E 4KCAA 2YG2A 3ZUAA 1N0SA 3HOEA 1SRGA 1GKAB 1ERBA 3BSZE 4M7MA 1AU0A 4M0WA 2CZTA 4IBAA 3TGCA 1CTEA 4IABA 2RTFB 3RBYA 2FKGA 3GCBA 2RCQA 1T8VA 4PSQA 2FS7A 1KFUL 5K67A 1ZCMA 4Z6JA 1KGLA 1LF7A 1TLOA 1Z24A 4G54A 4ALBA 4ZJ0A 1DZKA 3KWBX 2IZBA 4Y0SA 3LXSA 2AKQA 1SWFA 1B4MA 4TLJA 3OISA 3IEJA 5K68A 1SA8A 1LKEA 3WXQA 3V6EA 4REZA 2JU3A 3ZZVA 3IFUA 3P6CA 4MVEA 3CBJA 1FEMA 4I9SA 1HMSA 1A18A 1HQPA 2R9OA 1MK5A 4LQZA 3UEXA 2AS8A 4O3YA 3O2YA 4ORSA 1IJ8A 1MEPA 4WHIA 5B11O 1X8PA 4YGGA 1GKAA 2R9FA 5K06A 4AXLA 5LJCA 2E03A 1IKJA 2RA6A 1VWPB 3LHNA 4NLIA 1QY1A 1PPDA 2DCBA 3MHHA 4TKBA 5EZ2A 3TF6A 2F73A 3FA6A 3IMAA 2HXZA 2HH5A 3WXGA 4BOPA 4KLBA 1SLGB 1SXXA 3MM0A 1E06A 1EUOA 4YFRA 4X6HA 2JTCA 2DC6A 3BDRA 3F6ZB 4YH0A 1KL5A 1QY2A 5EF4A 1MOYA 1U0XA 2I5VO 1OPAA 4D6BA 1LELA 3OD9A 2LBAA 2GC9A 2QCBA 1CBQA 5JA7A 1X8OA 3RDXA 5L8IA 3B2LA 4L3RA 2QM9A 1CBIA 5KO3A 4FBRA 1ME4A 1LICA 4X6JA 2LKKA 3WZNA 4D8IA 3AEHA 4GNYA 2RTGB 5CVMA 2A13A 1EIIA 4MVIA 1WBIA 3K9MA 4OKAA 1I9HA 5L8OA 1QABE 1ZNKA 4BSQA 1Q6KA 1MDWA 2JQFR 4QH6A 2GFOA 1EQDA 1RSUB 1I04A 1JJJA 4EEJA 1H91A 3H89A 3RDMA 3OF9A 1STPA 4HWMA 2HZQA 3WJDA 3CKFA 3HHIA 3D6SA 4CSBA 3PHUA 2A5CA 4EXZA 4QAEA 2HWKA 2WQAE 3B21A 3E1ZB 5CHTA 1ATKA 2OVDA 3VHMA 1HBQA 1PPNA 1JJUA 3MORA 1FTPA 2AYNA 2X45A 3E3CA 6PADA 5DG4A 3TNXA 4OS8A 2IZIA 4ORYA 1O1VA 2UZ2A 1VWQB 1KQWA 3ZQ3A 3P6HA 1VSNA 2OFAA 4NNTA 5HA0A 3ZW0B 4TNNA 1IFCA 3IA8A 4O3ZA 3GAQA 5LKFA 4OMXA 3NADA 2L67A 1KFFA 4MVLA 4D8BA 2NP1A 3OE3A 4K7CA 3PK2A 4ZTBA 4LZUA 4FK5A 5LJEA 3VG6A 5FAZA 4QRGA 4GK9A 3OVXA 1SWDA 3PECA 3ZW1B 3KQ0A 5JH3A 2BC3A 3S5XA 3MTNA 2XKLA 4O4SA 1CBSA 2I5ZO 5JR8A 1BM5A 3BC3A 3BY0A 4PT5A 1CBRA 4ORRA 5FQ6E 1KFXL 3HWDA 4GUZA 3T6LA 3ZW0A 1G5WA 2GTLN 2QO4A 1ZIVA 3TMPA 4ID2A 1T0VA 1TL9A 3KFIA 4QRVA 1XKGA 1OBUA 3NQ3A 1OEEA 1KHPA 1NP4A 3PW3A 4UU2A 3BU9A 4CPIA 3HK1A 2AYOA 3UAQA 2X8TA 5HZ8A 3K3LA 5HTEA 3WBGA 1NPZA 2RTOB 2WUTA 3VG5A 3STKA 2FRSA 2ACOA 2R73A 1AB0A 4AZNA 1GX8A 4CPHB 1TVQA 1TXLA 1N4JA 2IBIA 4QRLA 2IZAA 3FW4A 3WZOA 3SLJA 3BOWA 1VWRB 4ML7B 2JGSA 2IZEB 4B55A 1YP7A 1SWRA 2F01A 3GE2A 4A5UA 2YJBA 5CYBA 2BTWB 3STNA 1M6DA 3Q6LA 3SZJA 4ZFXA 4QGVA 4GUAA 4YYVA 4BX7B 1U9VA 4QRXA 1MUPA 1O0EA 3PDFA 5C0NA 3WZQA 2POAA 4Q8HA 4ODDA 3T1DA 1HQQA 2G6DA 2IZLB 3DSZA 1KOIA 1B56A 1VYFA 2RQ0A 2Y3FA 2AH7X 1SXYA 3P02A 4A1HA 3EW2A 4KT5A 4BS6A 2PBHA 1YALA 2BHVA 4CPHA 1NBXA 3WJGA 4ORUA 3M99A 4QYNA 2RTMA 2X34A 3T6FA 4ZHCA 2B1MA 1LIEA 4JHQA 4CDFB 2Y3EA 4N7CA 3FA8A 2BTWA 4HPBA 3V6CA 1A6RA 4YVBA 3P5WA 4YYQA 3FMZA 3BRNA 3U0DA 2LB6A 4BX7A 3D97A 1UYNX 3WJBA 4ARHA 4MIRA 3USVA 4FIPA 2RTCB 1YWDA 5B2AO 1VWIB 1MHWA 2ANSA 2RD7C 4YDBA 5PADA 1GT4A 1OPBA 3P6EA 4PJ2A 3ZUIA 1AU2A 2FTBA 4YYUA 2G78A 1VWHB 1AYWA 1QQSA 2E02A 4I07A 4AZRA 5HTDA 2F7DA 2XSTA 2AT8X 2X46A 3D96A 2IZGB 4GNWA 4CDFA 1PBHA 4FQBB 3SAOA 1BGOA 2DM5A 5H9LA 1BSQA 5IO7A 4OS3A 1I05A 2JOZA 1NLJA 3NQKA 1PADA 2RTEB 1KHQA 3STMX 3L4RA 1LIDA 2LBVA 3IUTA 5AQ6A 3WJEA 3MVFA 3P6GA 2IFBA 1ITOA 1MEMA 1U5IA 3W30A 3U9PC 2FGSA 4RUNA 5HAEA 1BBPA 2A8GA 1G85A 2RTPB 5EGWA 5IRWA 4XUIA 2BS5A 4O3WA 3CKGA 5B29A 1VJVA 2FRAA 5IO6A 3MJ5A 4IMNA 1CS8A 2CZUA 4GDZA 2PADA 1SRFA 3EM0A 3RVXA 1VWCB 1GCBA 2RTBB 1EIOA 2RTNB 1HMTA 1U18A 2X8FA 1BSOA 4EQAC 2AU1A 3HD3A 1IIUA 1LDOA 1L6MA 1SREA 4GE1A 1A2DA 2FO5A 5B5GA 5KHPA 4KH8A 4UU3A 2FUDA 2BLGA 2QOSC 1SWTA 5EDBA 5LJHA 1N43A 3N3GA 1RAVA 4QYPA 2YJ2A 3IFBA 2DJFB 4EFGA 3KW9A 1KT3A 4FBOA 4CPEA 5CVOB 5BYPA 5HZQA 2NQGA 4QQ1A 4OS0A 2DC9A 1SRIA 1STRB 3ELZA 4A60A 1SY3A 2RTJA 3HHAA 1F2BA 4QNIA 4R0BA 4LZVA 2GTFX 4U3QA 4XMCA 1DZJA 2RTIB 1F2AA 7PCKA 1BEBA 3OVZA 1QG5A 3T2XA 4YKOA 1OEKA 2BS6A 1Y9TA 1NL6A 4CDEB 2MM3A 1EWMA 4YYRA 2OF8A 1ACDA 3C76X 3KVNA 2VHFA 1TOUA 3UEUA 5D47A 1UREA 3SLOA 4GZVA 1SWUA 2DJFA 3C9EA 1LCWA 2Y32A 2CB5A 4YGZA 3RSWA 3BB7A 1PPOA 1BLRA 3HWEA 2FT2A 3N3KA 4NYQA 1ME3A 5F6ZA 1EF7A 4RF0A 2BU3A 2H7JA 1R0UA 3X00A 3RVWA 1ICMA 2N93A 4I60A 5LKEA 1YT7A 3BCNA 1N7YA 1PEEA 1S4VA 4KC7A 1BRPA 4OELA 4BS5A 3PH5A 4GGZA 1I4UA 4YYSA 4YFQA 1AU4A 1RSTB 2Y5BA 1N9YA 4CDEA 2OFBA 2Q9SA 4ZGUA 2OVEA 4YMYA 1IFBA 2LA7A 3LTWA 4OEMA 3VGWA 3AKNA 1E00A 3QQ2A 4QGXA 3FLLA 1FELA 1S44A 4QZTA 1IWDA 3QSDA 4HPCA 1MEGA 3MHSA 1EXSA 2DC7A 4NNSA 4Z27A 1ERXA 3NHEA 2FR2A 1KT6A 1AU3A 2A5BA 2DZYA 4EKVA 4O9SA 4GGTA 4Z28A 2M4LA 2XU5A 2ZAGA 4CDCA 1YVBA 1YK8A 2XU3A 4MM3B 3JSQA 3FW5A 2BDZA 4I95A 2X32A 4ZR2A 1PBYA 4TQ2A 2OF9A 1CJLA 5IO5A 2VFCA 2OY5O 1UYOX 1Y53X 3I0AA 1KL4A 3CBKA 2C1QA 3VG4A 4BX6A 2Y6EA 2DCCA 2GH7A 3NX2A 2OY8A 2MHDA 5EZQA 2X8SA 2AMMX 1EWOA 1EALA 1BY8A 1EWLA 1HXZA 5JD2A 4HFOA 2QMIA 2GJ5A 1RLBE 4NP1A 2P7UA 3O22A 1K3BA 2OY1O 3APVA 4Z2PA 1FE3A 1GM6A 1VWFB 3CMPA 1IKEA 1RXJA 1KZWA 4ALOA 3S3QA 3NR3A 5HA1A 4ES7A 3S3RA 1VYOA 4LKTA 2AL0X 1CPJA 3AI8A 5B27A 1YZBA 2MO5A 5H8TA 2ZSCA 1YUPA 3PSEA 4O4UA 3FA7A 3JQOA 2RTRB 4COTA 1XCAA 2CIOA 4RY2A 1CSBB 1PVJA 1SXWA 1BP4A 2BSZA 2PNSA 2HNXA 1THEA 2HMBA 1QDQA 3SLTA 5LJKA 1DZPA 2GTLM 3D9WA 3QT4A 3RWXA 4M6SA 4MZSA 4TKJA 1PMPA 3B2JA 2Z4IA 1BJ7A 1WUBA 5H9KA 3PQSA 4BQVA 2HZRA 2NNEA 1KXOA 1AYUA 2HKDA 3F8AA 1GXAA 2Z4HA 2RTQB 4W5CA 3HPEA 3SOTA 3KWZA 1EWPA 2IZHB 1LDQA 1I06A 2WEWA 4AZMA 4YGHA 1AIMA 1FH0A 1A57A 3N91A 2JW1A 4XR7A 2A3FX 1PBOA 1NGLA 8PCHA 3SZHA 2W2FA 4OVZB 3PPTA 5CHKA 4IMOA 3E9SA 1ICFA 1VWLB 2B1NA 1BQIA 4I3DA 2ATOA 1CQDA 4BPVA 3FR5A 4O49A 3PT2A 4MVKA 3AKMA 4JGLA 1SNKA 3FA9A 1SWCA 4IB8A 4BQUA 1JJXA 3ERVA 4IAWA 3OJYC 3WXEA 4DMYA 1VWJB 2Q4NA 4HWYA 5LJBA 4WA6A 2WWPA 1OBQA 2YJCA 5D4AA 3U03A 4WURA 2KT4B 1SWOA 1AYVA 4I04A 4EDEA 3H8CA 4Y0QA 4IAXA 3KFGA 4ZHDA 3JS1A 2UZJA 4P6EA 3APWA 5FFHA 4NYRA 1PPPA 1SWBA 5F6BA 1VWEB 4BVMA 4OVZA 3UEVA 4QBBA 2FS6A 1XKIA 3MTVA 2AF5A 4KIIA 3EMMA 2WR6A 2G5LA 4FGIB 1GECE 3HWGA 1SWAA 1NP1A 1T68X 3TRKA 2L9CA 2VDFA 3WVMA 3P6FA 4GRJA 3HWFA 1DEUA 2AVWA 4ZHGA 3RVVA 4NLJA 2IZCB 3ZW2A 3CH3X 4BOQA 3PNRA 3RKGA 2WEXA 4BX5B 1GX9A 2XU4A 4PP1A 2FHLA 2ACPX 2DZZA 4TKHA 2K23A 4U46A 3WOVA 1NDJA 1JYDA 4N79A 1SWNA 1O8VA 1ZNGA 1X9YA 3PHWA 4Y0PA 3VG7A 2UYWA 4Q8GA 1B8EA
chains in the Genus database with same CATH topology
1E2TA 3HHAA 1F2BA 1ME4A 4X6JA 3KKUA 4YV8A 1F2AA 1U9XA 7PCKA 3OVZA 2XU1A 5CHVA 4MZOA 1CV8A 5CVMA 1PXVA 2DJGB 3K9MA 1NL6A 4CDEB 5CVNB 1EWMA 4YYRA 4BSQA 1SP4B 2VHFA 3K8UA 1Q6KA 1MDWA 2JQFR 4QH6A 2GFOA 2IPPB 3I3TA 3IHPA 3K24A 2DJFA 3OF9A 3H89A 1HUCB 1PIPA 3C9EA 3HHIA 2CB5A 3D6SA 1PPOA 3E1ZB 5CHTA 1ATKA 1PPNA 2FT2A 3N3KA 3MORA 2AYNA 1ME3A 5FPWA 6PADA 1EF7A 3TNXA 2H7JA 2FYEA 4AXMA 2FQ9A 3RVWA 2DCDA 1VSNA 4ZUXU 1JQPA 1YT7A 3BCNA 1S4VA 3P5UA 1DF0A 4OELA 2NQAA 4BS5A 4YYSA 3BWKA 2G8EA 1AU4A 2E00A 2Y5BA 2DJGA 4K7CA 4CDEA 4YYWA 4FK5A 4W4UA 3IV2A 1Y4HA 4QRGA 3LTWA 4OEMA 3OVXA 1F2CA 2JQGR 5JH3A 2ACTA 1IWDA 2FTDA 3QSDA 3MTNA 1MEGA 3MHSA 2DC7A 1NB5A 3NHEA 2OP3A 3BC3A 2AIMA 1U9WA 1AU3A 5K16A 2DZYA 2VHSA 4DMXA 4P6GA 1KFXL 4GUZA 3O1GA 3KFQA 1W5RA 2XU5A 1QOLA 1ZIVA 4CDCA 1YVBA 1YK8A 1NQCA 2XU3A 1MIRA 2P86A 1TL9A 2BDZA 1TU6A 1XKGA 4QRVA 1KHPA 3PW3A 1CJLA 2VFCA 2AYOA 4NV8A 3CBKA 1U9QX 1NPZA 2NQDB 9PAPA 2Y6EA 2G8JA 2DCCA 1POPA 5A24A 2WBFX 2NQIA 1EWOA 3KX1A 4YVAA 4I05A 1BY8A 1EWLA 2IBIA 2G7YA 5F02A 2P7UA 3BOWA 4X6IA 4PI3A 4W5BA 4B55A 2P0RA 1K3BA 1YK7A 2YJBA 3DF0A 1M6DA 2AUXA 3H8BA 3CH2X 1STFE 3P5VA 4YYVA 3S3QA 1U9VA 4QRXA 3S3RA 4PP2E 1O0EA 3PDFA 1W6FA 4CDCB 1CPJA 2GHUA 3AI8A 4Q8HA 3HWNA 3N4CA 3B79A 3PBHA 2G6DA 1PCIA 3H7DA 4BS6A 2PBHA 2VFBA 2AUZA 1YALA 3BPFA 2YJ9A 4CDDB 3M99A 2E01A 2CIOA 4RY2A 1CSBB 2OULA 1BP4A 2B1MA 2BSZA 2PNSA 4CDFB 1THEA 3KSEA 3QJ3A 1QDQA 1NB3A 2DCAA 3D9WA 3IOQA 3QT4A 4NV7A 3V6CA 1A6RA 3P5WA 4YYQA 2DC8A 1F29A 5J94A 4MZSA 2HD5A 1K3BB 1KXRA 3H6SA 1W4TA 4PADA 3USVA 4FIPA 2C0YA 4BQVA 1MHWA 1AYUA 4W5CA 5PADA 4FJCA 2R9CA 3F75A 1CVZA 3WXFA 1AU2A 3KWZA 3O0UA 4YYUA 4CDDA 1EWPA 1PE6A 1AYWA 2E02A 1AIMA 1FH0A 4I07A 1MS6A 2F7DA 4CDFA 1PBHA 2R9MA 3ZUAA 4XR7A 1CB5A 1QMYA 1BGOA 8PCHA 1AU0A 1Y08A 1NLJA 1CTEA 2PREA 1ICFA 3GCBA 1PADA 3U8EA 1KHQA 2B1NA 1BQIA 1GLOA 2ATOA 1CQDA 1KFUL 1ZCMA 1TLOA 4G54A 4BPVA 4N8WA 3IUTA 1SNKA 3ERVA 4MSXA 3KWBX 1GMYA 1GX3A 3WXEA 1QXPA 3LFYA 3P5XA 4DMYA 1ITOA 1MEMA 1U5IA 3LXSA 4HWYA 4WA6A 3OISA 3IEJA 2YJCA 3OF8A 3F5VA 3V6EA 5EGWA 1AYVA 4XUIA 2OZ2A 4I04A 2ARYA 3CBJA 4N4ZA 1VJVA 3H8CA 2FRAA 2R9OA 4CZWA 1CS8A 2AS8A 2PADA 4P6EA 3RVXA 2R9FA 1GCBA 1PPPA 4AXLA 4BGFA 2BDLA 2E03A 2R6NA 2AU1A 3HD3A 4QBBA 1PPDA 2DCBA 3MHHA 2FO5A 1GECE 3IMAA 2HXZA 2FUDA 2HH5A 3WXGA 4KLBA 3I06A 1DEUA 2AVWA 3RVVA 3N3GA 3CH3X 2F1GA 3PNRA 2YJ2A 1AECA 2YJ8A 2XU4A 2DJFB 4PP1A 4X6HA 4C5PA 2DC6A 2R9NA 3KW9A 2DZZA 5CVOB 2NQGA 3BPMA 5EF4A 2O6XA 2FRQA 4N79A 2DC9A 1X9YA 2HHNA 4Q8GA 5JA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHA A;  1F2B A;  1ME4 A;  4X6J A;  3KKU A;  4YV8 A;  1F2A A;  1U9X A;  7PCK A;  3OVZ A;  2XU1 A;  5CHV A;  4MZO A;  1CV8 A;  5CVM A;  1PXV A;  2DJG B;  3K9M A;  1NL6 A;  4CDE B;  5CVN B;  1EWM A;  4YYR A;  4BSQ A;  1SP4 B;  2VHF A;  3K8U A;  1Q6K A;  1MDW A;  2JQF R;  4QH6 A;  2GFO A;  2IPP B;  3I3T A;  3IHP A;  3K24 A;  2DJF A;  3OF9 A;  3H89 A;  1HUC B;  1PIP A;  3C9E A;  3HHI A;  2CB5 A;  3D6S A;  1PPO A;  3E1Z B;  5CHT A;  1ATK A;  1PPN A;  2FT2 A;  3N3K A;  3MOR A;  2AYN A;  1ME3 A;  5FPW A;  6PAD A;  1EF7 A;  3TNX A;  2H7J A;  2FYE A;  4AXM A;  2FQ9 A;  3RVW A;  2DCD A;  1VSN A;  4ZUX U;  1JQP A;  1YT7 A;  3BCN A;  1S4V A;  3P5U A;  1DF0 A;  4OEL A;  2NQA A;  4BS5 A;  4YYS A;  3BWK A;  2G8E A;  1AU4 A;  2E00 A;  2Y5B A;  2DJG A;  4K7C A;  4CDE A;  4YYW A;  4FK5 A;  4W4U A;  3IV2 A;  1Y4H A;  4QRG A;  4OEM A;  3OVX A;  1F2C A;  2JQG R;  5JH3 A;  2ACT A;  1IWD A;  2FTD A;  3QSD A;  3MTN A;  1MEG A;  3MHS A;  2DC7 A;  1NB5 A;  3NHE A;  2OP3 A;  3BC3 A;  2AIM A;  1U9W A;  1AU3 A;  5K16 A;  2DZY A;  2VHS A;  4DMX A;  4P6G A;  1KFX L;  3O1G A;  3KFQ A;  2XU5 A;  1QOL A;  1ZIV A;  4CDC A;  1YVB A;  1YK8 A;  1NQC A;  2XU3 A;  1MIR A;  2P86 A;  1TL9 A;  2BDZ A;  1TU6 A;  1XKG A;  4QRV A;  1KHP A;  3PW3 A;  1CJL A;  2AYO A;  3CBK A;  1U9Q X;  1NPZ A;  2NQD B;  9PAP A;  2Y6E A;  2G8J A;  2DCC A;  1POP A;  5A24 A;  2WBF X;  2NQI A;  1EWO A;  3KX1 A;  4YVA A;  4I05 A;  1BY8 A;  1EWL A;  2IBI A;  2G7Y A;  5F02 A;  2P7U A;  3BOW A;  4X6I A;  4PI3 A;  4W5B A;  2P0R A;  1K3B A;  1YK7 A;  2YJB A;  3DF0 A;  1M6D A;  2AUX A;  3H8B A;  3CH2 X;  1STF E;  3P5V A;  4YYV A;  3S3Q A;  1U9V A;  4QRX A;  3S3R A;  4PP2 E;  1O0E A;  3PDF A;  4CDC B;  1CPJ A;  2GHU A;  3AI8 A;  4Q8H A;  3HWN A;  3N4C A;  3B79 A;  3PBH A;  2G6D A;  1PCI A;  3H7D A;  4BS6 A;  2PBH A;  2AUZ A;  1YAL A;  3BPF A;  2YJ9 A;  4CDD B;  3M99 A;  2E01 A;  2CIO A;  4RY2 A;  1CSB B;  2OUL A;  1BP4 A;  2B1M A;  2PNS A;  4CDF B;  1THE A;  3KSE A;  3QJ3 A;  1QDQ A;  1NB3 A;  2DCA A;  3IOQ A;  3QT4 A;  3V6C A;  1A6R A;  3P5W A;  4YYQ A;  2DC8 A;  1F29 A;  5J94 A;  4MZS A;  2HD5 A;  1K3B B;  1KXR A;  3H6S A;  4PAD A;  3USV A;  4FIP A;  2C0Y A;  4BQV A;  1MHW A;  1AYU A;  4W5C A;  5PAD A;  4FJC A;  2R9C A;  3F75 A;  1CVZ A;  3WXF A;  1AU2 A;  3KWZ A;  3O0U A;  4YYU A;  4CDD A;  1EWP A;  1PE6 A;  1AYW A;  2E02 A;  1AIM A;  1FH0 A;  4I07 A;  1MS6 A;  2F7D A;  4CDF A;  1PBH A;  2R9M A;  3ZUA A;  4XR7 A;  1CB5 A;  1QMY A;  1BGO A;  8PCH A;  1AU0 A;  1Y08 A;  1NLJ A;  1CTE A;  2PRE A;  1ICF A;  3GCB A;  1PAD A;  3U8E A;  1KHQ A;  2B1N A;  1BQI A;  1GLO A;  2ATO A;  1CQD A;  1KFU L;  1ZCM A;  1TLO A;  4G54 A;  4BPV A;  4N8W A;  3IUT A;  1SNK A;  3ERV A;  4MSX A;  3KWB X;  1GMY A;  3WXE A;  1QXP A;  3LFY A;  3P5X A;  4DMY A;  1ITO A;  1MEM A;  1U5I A;  3LXS A;  4HWY A;  4WA6 A;  3OIS A;  3IEJ A;  2YJC A;  3OF8 A;  3F5V A;  3V6E A;  5EGW A;  1AYV A;  4XUI A;  2OZ2 A;  4I04 A;  2ARY A;  3CBJ A;  4N4Z A;  1VJV A;  3H8C A;  2FRA A;  2R9O A;  4CZW A;  1CS8 A;  2AS8 A;  2PAD A;  4P6E A;  3RVX A;  2R9F A;  1GCB A;  1PPP A;  4AXL A;  2BDL A;  2E03 A;  2R6N A;  2AU1 A;  3HD3 A;  4QBB A;  1PPD A;  2DCB A;  3MHH A;  2FO5 A;  1GEC E;  3IMA A;  2HXZ A;  2FUD A;  2HH5 A;  3WXG A;  4KLB A;  3I06 A;  1DEU A;  2AVW A;  3RVV A;  3N3G A;  3CH3 X;  2F1G A;  3PNR A;  2YJ2 A;  1AEC A;  2YJ8 A;  2XU4 A;  2DJF B;  4PP1 A;  4X6H A;  2DC6 A;  2R9N A;  3KW9 A;  2DZZ A;  5CVO B;  2NQG A;  3BPM A;  5EF4 A;  2O6X A;  2FRQ A;  4N79 A;  2DC9 A;  1X9Y A;  2HHN A;  4Q8G A;  5JA7 A; 
#chains in the Genus database with same CATH topology
 4I3C A;  4BOE A;  2E4J A;  1SXU A;  2G79 A;  3KKU A;  4ON1 A;  2IZD B;  1K24 A;  3TGB A;  4RNA A;  2YMS A;  5B10 O;  4AW8 A;  2RTK A;  1YWA A;  1ZRY A;  4GH7 A;  5CVN B;  2FLJ A;  1SWH A;  1CRB A;  1FDQ A;  1EI5 A;  4CPF A;  3EBK A;  4BX5 A;  1KT7 A;  1SRJ A;  1X89 A;  3VG3 A;  1LFO A;  1PIP A;  2F09 A;  4DQ3 A;  1JBH A;  3VHH A;  3ELX A;  4YBP A;  1LCZ A;  5B3M O;  4LKP A;  5AJB A;  5D48 A;  5FPW A;  1UKF A;  2W2A A;  5CE4 A;  2K62 A;  3PHX A;  1ZNE A;  3O19 A;  2FQ9 A;  1YWC A;  3C77 X;  2DCD A;  4HPA A;  4AZP A;  4ZUX U;  2AT6 X;  1VWB B;  4WFU A;  1JQP A;  3RE5 A;  4INN A;  3P5U A;  1DF0 A;  2ZAI A;  1OBP A;  3KZA A;  3BWK A;  4WFV A;  1ZNL A;  2E00 A;  1S2P A;  2Q2P A;  4U8U M;  1DV9 A;  1SY2 A;  3AUM O;  4W4U A;  4Y0R A;  2QO5 A;  4ZGF A;  3PH6 A;  5H9A A;  2EU7 X;  2JQG R;  3P6D A;  2X55 A;  1CJ5 A;  3RZY A;  2IZF B;  2OL7 A;  1PM1 X;  3W31 A;  2WSJ A;  1X71 A;  1NB5 A;  2OP3 A;  4GU8 A;  1Y9L A;  2AIM A;  1U9W A;  3NBX X;  3PQU A;  4DMX A;  2G7B A;  2LFO A;  1Y52 X;  4Z2V A;  1W5R A;  4MI7 A;  2HYS A;  1QOL A;  4GJS A;  3BY4 A;  1MIR A;  2C4I A;  2P86 A;  2NNQ A;  4I3B A;  3CWK A;  3ZWE A;  1MX8 A;  4D6A A;  3MX7 A;  2OZQ A;  2KW1 A;  4L1N A;  4YCE A;  2L68 A;  1DFV A;  4JO6 A;  2C1S A;  4NV8 A;  1U9Q X;  2NQD B;  4IP3 A;  1SLE B;  9PAP A;  4WBK A;  5HCE C;  4P16 A;  2G8J A;  5A24 A;  5IXG A;  5AEO A;  2WBF X;  1QWD A;  1ALB A;  3MBT A;  5LJD A;  3KX1 A;  5JZE A;  2R56 A;  1LUQ A;  1SWL A;  4I05 A;  2A2G A;  2R74 A;  3KFH A;  2FKJ A;  2WQ9 A;  1DC9 A;  3P24 A;  3BX8 A;  5F02 A;  3BU1 A;  2KTD A;  4X6I A;  4A1Y A;  4PI3 A;  4W5B A;  1RXK A;  1U17 A;  1YP6 A;  3B2H A;  1ADL A;  1QFV A;  3H8B A;  3CH2 X;  1UZ2 X;  1STF E;  3P5V A;  1B0O A;  4BOS A;  2RTA A;  4IB6 A;  5B5F A;  3PRP A;  1W6F A;  3G7X A;  5H9N A;  4CDC B;  1X8Q A;  3PRM A;  3FEP A;  3N4C A;  1KT5 A;  1VWM B;  4Y59 A;  3CQN A;  3H7D A;  2VFB A;  3S5V A;  3BPF A;  2YJ9 A;  4CDD B;  4AZQ A;  1RXH A;  5D45 A;  2OVS A;  4FBV A;  1BSY A;  4BX6 B;  2OUL A;  5F1E A;  4TJZ A;  3ZI8 A;  3KSE A;  4D8E A;  1YIV A;  3QJ3 A;  2OVA A;  3EYC A;  1GT1 A;  3IOQ A;  1D3S A;  4NV7 A;  1E5P A;  1S7D A;  2DC8 A;  1F29 A;  1QFT A;  3PED A;  1SMP I;  3WJC A;  1K3B B;  3D95 A;  3I17 A;  1HN2 A;  3RDU A;  4CK4 A;  4PAD A;  4RKX A;  1DZM A;  2AT0 X;  3NPO A;  2C0Y A;  1VWG B;  3UEW A;  3RDQ A;  3ZUO A;  4FJC A;  2PY1 A;  2R9C A;  5LJG A;  3F75 A;  1CVZ A;  1GT5 A;  3C78 X;  3APX A;  4CDD A;  1PE6 A;  2OFM X;  2Q39 A;  1EW3 A;  1G74 A;  1MX7 A;  4OW0 A;  3OBL A;  2R9M A;  1ZND A;  4ORX A;  5L8N A;  1CB5 A;  1QMY A;  1MM9 A;  3MP2 A;  1VWK B;  4CV7 A;  5EZS A;  4IUM A;  2DOS A;  1Y08 A;  1VWO B;  2PRE A;  3WZP A;  4ZHF A;  1LNM A;  3U8E A;  4OMW A;  5FEN A;  1G7N A;  2W2B A;  4XMG A;  1GLO A;  1JYJ A;  3MG5 A;  2OL6 O;  5EPQ A;  4BBO A;  4IB9 A;  4N8W A;  5BVT A;  2HLV A;  2O62 A;  4MSX A;  1GMY A;  1GX3 A;  4ZH6 A;  1QXP A;  3LFY A;  3P5X A;  1P6P A;  3CBC A;  4HPD A;  1ICN A;  2FT9 A;  4MIS A;  3OF8 A;  3F5V A;  5HCC C;  5KID A;  2IZK A;  3B2K A;  2OZ2 A;  1LIB A;  2ARY A;  1A3Y A;  4AZO A;  5F7G A;  4N4Z A;  3SZI A;  4R3D A;  4QGW A;  4BOU A;  4CZW A;  3CBS A;  5BVQ A;  5L3Y A;  2JU7 A;  2P8G A;  1SY1 A;  4BGF A;  1DF8 A;  2OY7 A;  2BDL A;  3VPJ E;  1EPB A;  2R6N A;  4GKC A;  3OQC A;  2FR3 A;  2JMB A;  1LCV A;  1AQB A;  5DPQ A;  1SY0 A;  5HZ9 A;  3FR4 A;  5HBS A;  1KQX A;  2RCT A;  4U8U O;  4Z2O A;  1D2U A;  1MVG A;  3BBA A;  1AEL A;  2Z84 A;  4XZX A;  3I06 A;  3NQ9 A;  1JMX A;  2X4M A;  5HZ6 A;  1QY0 A;  2F1G A;  1AEC A;  2YJ8 A;  1DKI A;  2X56 A;  2JU8 A;  4C5P A;  3RE6 A;  2R9N A;  1X8N A;  4IRW A;  3BPM A;  4MEE A;  3VG2 A;  2O6X A;  3WYQ A;  1KL3 A;  3QKG A;  2FRQ A;  1AVD A;  2OL8 O;  3S26 A;  5D8J A;  4O4X A;  2HHN A;  1HMR A;  3LV4 A;  1E2T A;  4N7D A;  3KFF A;  4GDA A;  4A8Z A;  5AJC A;  2QOM A;  1SLD B;  5FQ7 E;  1AVG I;  1FEN A;  4YV8 A;  2QO6 A;  1O1U A;  1U9X A;  2FHN X;  2XU1 A;  3RY1 A;  4MZO A;  5CHV A;  4YCH A;  1CV8 A;  3FEK A;  1PXV A;  2DJG B;  4RUU A;  3S60 A;  3ZW1 A;  2OYB O;  3TZS A;  3FR2 A;  1SP4 B;  4RF1 A;  3K8U A;  2IPP B;  3I3T A;  3O65 A;  3IHP A;  3K24 A;  1HUC B;  3WYP A;  3F9D A;  4XME A;  1IW2 A;  3FDC A;  4BOZ A;  1GGL A;  3RNV A;  3NP1 A;  4YFP A;  5EED A;  3BS2 A;  4O3X B;  1LPJ A;  2FYE A;  4AXM A;  3PP6 A;  3VE2 A;  1RBP A;  2ASN X;  2KTS A;  1OEJ A;  4I6S A;  1SWE A;  1VWD B;  5KIC A;  1SWG A;  1SRH A;  4ZHH A;  4BCS A;  2NQA A;  1AVE A;  1I78 A;  1OSP O;  3VU1 A;  1LIF A;  3VE1 A;  2G8E A;  4DQ4 A;  2DJG A;  4ORW A;  1N9M A;  4YYW A;  2A0A A;  5IRU A;  1EPA A;  2FWV A;  3IV2 A;  1Y4H A;  4NW4 A;  1ZNH A;  3RDS A;  1JIW I;  1F2C A;  2CBR A;  3FEL A;  3HOL A;  4AYH A;  4ZCB A;  1SWQ A;  2ACT A;  4O4O A;  2FTD A;  2KD2 A;  1GT3 A;  1VPR A;  1DF3 A;  3TGA A;  1VYG A;  3D4R A;  4I9R A;  4DCB A;  3FYF A;  3B2I A;  2JN3 A;  5K16 A;  2VHS A;  3EBW A;  1Y55 X;  4P6G A;  3BX7 A;  2A2U A;  3O1G A;  4DNE A;  3KFQ A;  2JRI A;  4YKM A;  1JV4 A;  1ML7 A;  1NQC A;  1TU6 A;  3RDO A;  3EW1 A;  4GJV A;  1NQM A;  5F58 A;  4U9C A;  5CSE A;  1YWB A;  2AT5 X;  1MDC A;  1X8U A;  2FE8 A;  3T2W A;  5E6J A;  4BJ8 A;  1FJ1 E;  1POP A;  3CR6 A;  1SWK A;  2NQI A;  3VHI A;  2IZJ A;  1SWJ A;  4Y5D A;  2WPU A;  4YVA A;  2BT9 A;  2L5P A;  2Q2M A;  4JNJ A;  5F2B A;  2AT3 X;  1SWS A;  1HY2 A;  2PI3 O;  5EEE A;  2CBS A;  1VWA B;  2J7Q A;  2RTH B;  1TOW A;  1VWN B;  2G7Y A;  2CAM A;  3ZNH A;  3FEN A;  2P0R A;  1YK7 A;  2CM9 A;  1SLF B;  3DF0 A;  4GGR A;  1KT4 A;  2AUX A;  1KZX A;  4YBU A;  4XMD A;  4KC8 A;  4YDA A;  3FIQ A;  2RN4 A;  3BLG A;  2MF6 A;  5HCD C;  4PP2 E;  1BWY A;  3APU A;  2GHU A;  1HBP A;  3HWN A;  3B79 A;  3PBH A;  3NX1 A;  2OFR X;  1PCI A;  3H3I A;  3RY2 A;  4XMH A;  3HTY A;  1Y0G A;  2AUZ A;  3EC5 A;  1TW4 A;  2ALL X;  3V8U A;  3DTQ A;  2AGA A;  2E01 A;  3Q34 A;  3WJF A;  1JMZ A;  1STS B;  1SWP A;  1HXL A;  5BVS A;  4QZU A;  4GD9 A;  2RTD B;  4U8U N;  4K19 A;  5IRA A;  1NB3 A;  2DCA A;  5HWZ A;  1JZU A;  2NND A;  4GET A;  2AVI A;  5J94 A;  3FID A;  3C0R A;  2HD5 A;  2GTL O;  2CM4 A;  1KXR A;  3H6S A;  1W4T A;  1NC9 A;  1E02 A;  2MJI A;  4ZH9 A;  2RTL A;  3CQR A;  1BRQ A;  3WXF A;  4IB7 A;  1NQN A;  3O0U A;  5HZ5 A;  2G8C O;  4HXD B;  4XMF A;  5EDC A;  1MS6 A;  2MWH A;  1PTS A;  2J7Q C;  5FQ8 E;  4KCA A;  2YG2 A;  3ZUA A;  1N0S A;  3HOE A;  1SRG A;  1GKA B;  1ERB A;  3BSZ E;  4M7M A;  1AU0 A;  4M0W A;  2CZT A;  4IBA A;  3TGC A;  1CTE A;  4IAB A;  2RTF B;  3RBY A;  2FKG A;  3GCB A;  2RCQ A;  1T8V A;  4PSQ A;  2FS7 A;  1KFU L;  5K67 A;  1ZCM A;  4Z6J A;  1KGL A;  1LF7 A;  1TLO A;  1Z24 A;  4G54 A;  4ALB A;  4ZJ0 A;  1DZK A;  3KWB X;  2IZB A;  4Y0S A;  3LXS A;  2AKQ A;  1SWF A;  1B4M A;  4TLJ A;  3OIS A;  3IEJ A;  5K68 A;  1SA8 A;  1LKE A;  3WXQ A;  3V6E A;  4REZ A;  2JU3 A;  3ZZV A;  3IFU A;  3P6C A;  4MVE A;  3CBJ A;  1FEM A;  4I9S A;  1HMS A;  1A18 A;  1HQP A;  2R9O A;  1MK5 A;  4LQZ A;  3UEX A;  2AS8 A;  4O3Y A;  3O2Y A;  4ORS A;  1IJ8 A;  1MEP A;  4WHI A;  5B11 O;  1X8P A;  4YGG A;  1GKA A;  2R9F A;  5K06 A;  4AXL A;  5LJC A;  2E03 A;  1IKJ A;  2RA6 A;  1VWP B;  3LHN A;  4NLI A;  1QY1 A;  1PPD A;  2DCB A;  3MHH A;  4TKB A;  5EZ2 A;  3TF6 A;  2F73 A;  3FA6 A;  3IMA A;  2HXZ A;  2HH5 A;  3WXG A;  4BOP A;  4KLB A;  1SLG B;  1SXX A;  3MM0 A;  1E06 A;  1EUO A;  4YFR A;  4X6H A;  2JTC A;  2DC6 A;  3BDR A;  3F6Z B;  4YH0 A;  1KL5 A;  1QY2 A;  5EF4 A;  1MOY A;  1U0X A;  2I5V O;  1OPA A;  4D6B A;  1LEL A;  3OD9 A;  2LBA A;  2GC9 A;  2QCB A;  1CBQ A;  5JA7 A;  1X8O A;  3RDX A;  5L8I A;  3B2L A;  4L3R A;  2QM9 A;  1CBI A;  5KO3 A;  4FBR A;  1ME4 A;  1LIC A;  4X6J A;  2LKK A;  3WZN A;  4D8I A;  3AEH A;  4GNY A;  2RTG B;  5CVM A;  2A13 A;  1EII A;  4MVI A;  1WBI A;  3K9M A;  4OKA A;  1I9H A;  5L8O A;  1QAB E;  1ZNK A;  4BSQ A;  1Q6K A;  1MDW A;  2JQF R;  4QH6 A;  2GFO A;  1EQD A;  1RSU B;  1I04 A;  1JJJ A;  4EEJ A;  1H91 A;  3H89 A;  3RDM A;  3OF9 A;  1STP A;  4HWM A;  2HZQ A;  3WJD A;  3CKF A;  3HHI A;  3D6S A;  4CSB A;  3PHU A;  2A5C A;  4EXZ A;  4QAE A;  2HWK A;  2WQA E;  3B21 A;  3E1Z B;  5CHT A;  1ATK A;  2OVD A;  3VHM A;  1HBQ A;  1PPN A;  1JJU A;  3MOR A;  1FTP A;  2AYN A;  2X45 A;  3E3C A;  6PAD A;  5DG4 A;  3TNX A;  4OS8 A;  2IZI A;  4ORY A;  1O1V A;  2UZ2 A;  1VWQ B;  1KQW A;  3ZQ3 A;  3P6H A;  1VSN A;  2OFA A;  4NNT A;  5HA0 A;  3ZW0 B;  4TNN A;  1IFC A;  3IA8 A;  4O3Z A;  3GAQ A;  5LKF A;  4OMX A;  3NAD A;  2L67 A;  1KFF A;  4MVL A;  4D8B A;  2NP1 A;  3OE3 A;  4K7C A;  3PK2 A;  4ZTB A;  4LZU A;  4FK5 A;  5LJE A;  3VG6 A;  5FAZ A;  4QRG A;  4GK9 A;  3OVX A;  1SWD A;  3PEC A;  3ZW1 B;  3KQ0 A;  5JH3 A;  2BC3 A;  3S5X A;  3MTN A;  2XKL A;  4O4S A;  1CBS A;  2I5Z O;  5JR8 A;  1BM5 A;  3BC3 A;  3BY0 A;  4PT5 A;  1CBR A;  4ORR A;  5FQ6 E;  1KFX L;  3HWD A;  4GUZ A;  3T6L A;  3ZW0 A;  1G5W A;  2GTL N;  2QO4 A;  1ZIV A;  3TMP A;  4ID2 A;  1T0V A;  1TL9 A;  3KFI A;  4QRV A;  1XKG A;  1OBU A;  3NQ3 A;  1OEE A;  1KHP A;  1NP4 A;  3PW3 A;  4UU2 A;  3BU9 A;  4CPI A;  3HK1 A;  2AYO A;  3UAQ A;  2X8T A;  5HZ8 A;  3K3L A;  5HTE A;  3WBG A;  1NPZ A;  2RTO B;  2WUT A;  3VG5 A;  3STK A;  2FRS A;  2ACO A;  2R73 A;  1AB0 A;  4AZN A;  1GX8 A;  4CPH B;  1TVQ A;  1TXL A;  1N4J A;  2IBI A;  4QRL A;  2IZA A;  3FW4 A;  3WZO A;  3SLJ A;  3BOW A;  1VWR B;  4ML7 B;  2JGS A;  2IZE B;  4B55 A;  1YP7 A;  1SWR A;  2F01 A;  3GE2 A;  4A5U A;  2YJB A;  5CYB A;  2BTW B;  3STN A;  1M6D A;  3Q6L A;  3SZJ A;  4ZFX A;  4QGV A;  4GUA A;  4YYV A;  4BX7 B;  1U9V A;  4QRX A;  1MUP A;  1O0E A;  3PDF A;  5C0N A;  3WZQ A;  2POA A;  4Q8H A;  4ODD A;  3T1D A;  1HQQ A;  2G6D A;  2IZL B;  3DSZ A;  1KOI A;  1B56 A;  1VYF A;  2RQ0 A;  2Y3F A;  2AH7 X;  1SXY A;  3P02 A;  4A1H A;  3EW2 A;  4KT5 A;  4BS6 A;  2PBH A;  1YAL A;  2BHV A;  4CPH A;  1NBX A;  3WJG A;  4ORU A;  3M99 A;  4QYN A;  2RTM A;  2X34 A;  3T6F A;  4ZHC A;  2B1M A;  1LIE A;  4JHQ A;  4CDF B;  2Y3E A;  4N7C A;  3FA8 A;  2BTW A;  4HPB A;  3V6C A;  1A6R A;  4YVB A;  3P5W A;  4YYQ A;  3FMZ A;  3BRN A;  3U0D A;  2LB6 A;  4BX7 A;  3D97 A;  1UYN X;  3WJB A;  4ARH A;  4MIR A;  3USV A;  4FIP A;  2RTC B;  1YWD A;  5B2A O;  1VWI B;  1MHW A;  2ANS A;  2RD7 C;  4YDB A;  5PAD A;  1GT4 A;  1OPB A;  3P6E A;  4PJ2 A;  3ZUI A;  1AU2 A;  2FTB A;  4YYU A;  2G78 A;  1VWH B;  1AYW A;  1QQS A;  2E02 A;  4I07 A;  4AZR A;  5HTD A;  2F7D A;  2XST A;  2AT8 X;  2X46 A;  3D96 A;  2IZG B;  4GNW A;  4CDF A;  1PBH A;  4FQB B;  3SAO A;  1BGO A;  2DM5 A;  5H9L A;  1BSQ A;  5IO7 A;  4OS3 A;  1I05 A;  2JOZ A;  1NLJ A;  3NQK A;  1PAD A;  2RTE B;  1KHQ A;  3STM X;  3L4R A;  1LID A;  2LBV A;  3IUT A;  5AQ6 A;  3WJE A;  3MVF A;  3P6G A;  2IFB A;  1ITO A;  1MEM A;  1U5I A;  3W30 A;  3U9P C;  2FGS A;  4RUN A;  5HAE A;  1BBP A;  2A8G A;  1G85 A;  2RTP B;  5EGW A;  5IRW A;  4XUI A;  2BS5 A;  4O3W A;  3CKG A;  5B29 A;  1VJV A;  2FRA A;  5IO6 A;  3MJ5 A;  4IMN A;  1CS8 A;  2CZU A;  4GDZ A;  2PAD A;  1SRF A;  3EM0 A;  3RVX A;  1VWC B;  1GCB A;  2RTB B;  1EIO A;  2RTN B;  1HMT A;  1U18 A;  2X8F A;  1BSO A;  4EQA C;  2AU1 A;  3HD3 A;  1IIU A;  1LDO A;  1L6M A;  1SRE A;  4GE1 A;  1A2D A;  2FO5 A;  5B5G A;  5KHP A;  4KH8 A;  4UU3 A;  2FUD A;  2BLG A;  2QOS C;  1SWT A;  5EDB A;  5LJH A;  1N43 A;  3N3G A;  1RAV A;  4QYP A;  2YJ2 A;  3IFB A;  2DJF B;  4EFG A;  3KW9 A;  1KT3 A;  4FBO A;  4CPE A;  5CVO B;  5BYP A;  5HZQ A;  2NQG A;  4QQ1 A;  4OS0 A;  2DC9 A;  1SRI A;  1STR B;  3ELZ A;  4A60 A;  1SY3 A;  2RTJ A;  3HHA A;  1F2B A;  4QNI A;  4R0B A;  4LZV A;  2GTF X;  4U3Q A;  4XMC A;  1DZJ A;  2RTI B;  1F2A A;  7PCK A;  1BEB A;  3OVZ A;  1QG5 A;  3T2X A;  4YKO A;  1OEK A;  2BS6 A;  1Y9T A;  1NL6 A;  4CDE B;  2MM3 A;  1EWM A;  4YYR A;  2OF8 A;  1ACD A;  3C76 X;  3KVN A;  2VHF A;  1TOU A;  3UEU A;  5D47 A;  1URE A;  3SLO A;  4GZV A;  1SWU A;  2DJF A;  3C9E A;  1LCW A;  2Y32 A;  2CB5 A;  4YGZ A;  3RSW A;  3BB7 A;  1PPO A;  1BLR A;  3HWE A;  2FT2 A;  3N3K A;  4NYQ A;  1ME3 A;  5F6Z A;  1EF7 A;  4RF0 A;  2BU3 A;  2H7J A;  1R0U A;  3X00 A;  3RVW A;  1ICM A;  2N93 A;  4I60 A;  5LKE A;  1YT7 A;  3BCN A;  1N7Y A;  1PEE A;  1S4V A;  4KC7 A;  1BRP A;  4OEL A;  4BS5 A;  3PH5 A;  4GGZ A;  1I4U A;  4YYS A;  4YFQ A;  1AU4 A;  1RST B;  2Y5B A;  1N9Y A;  4CDE A;  2OFB A;  2Q9S A;  4ZGU A;  2OVE A;  4YMY A;  1IFB A;  2LA7 A;  3LTW A;  4OEM A;  3VGW A;  3AKN A;  1E00 A;  3QQ2 A;  4QGX A;  3FLL A;  1FEL A;  1S44 A;  4QZT A;  1IWD A;  3QSD A;  4HPC A;  1MEG A;  3MHS A;  1EXS A;  2DC7 A;  4NNS A;  4Z27 A;  1ERX A;  3NHE A;  2FR2 A;  1KT6 A;  1AU3 A;  2A5B A;  2DZY A;  4EKV A;  4O9S A;  4GGT A;  4Z28 A;  2M4L A;  2XU5 A;  2ZAG A;  4CDC A;  1YVB A;  1YK8 A;  2XU3 A;  4MM3 B;  3JSQ A;  3FW5 A;  2BDZ A;  4I95 A;  2X32 A;  4ZR2 A;  1PBY A;  4TQ2 A;  2OF9 A;  1CJL A;  5IO5 A;  2VFC A;  2OY5 O;  1UYO X;  1Y53 X;  3I0A A;  1KL4 A;  3CBK A;  2C1Q A;  3VG4 A;  4BX6 A;  2Y6E A;  2DCC A;  2GH7 A;  3NX2 A;  2OY8 A;  2MHD A;  5EZQ A;  2X8S A;  2AMM X;  1EWO A;  1EAL A;  1BY8 A;  1EWL A;  1HXZ A;  5JD2 A;  4HFO A;  2QMI A;  2GJ5 A;  1RLB E;  4NP1 A;  2P7U A;  3O22 A;  1K3B A;  2OY1 O;  3APV A;  4Z2P A;  1FE3 A;  1GM6 A;  1VWF B;  3CMP A;  1IKE A;  1RXJ A;  1KZW A;  4ALO A;  3S3Q A;  3NR3 A;  5HA1 A;  4ES7 A;  3S3R A;  1VYO A;  4LKT A;  2AL0 X;  1CPJ A;  3AI8 A;  5B27 A;  1YZB A;  2MO5 A;  5H8T A;  2ZSC A;  1YUP A;  3PSE A;  4O4U A;  3FA7 A;  3JQO A;  2RTR B;  4COT A;  1XCA A;  2CIO A;  4RY2 A;  1CSB B;  1PVJ A;  1SXW A;  1BP4 A;  2BSZ A;  2PNS A;  2HNX A;  1THE A;  2HMB A;  1QDQ A;  3SLT A;  5LJK A;  1DZP A;  2GTL M;  3D9W A;  3QT4 A;  3RWX A;  4M6S A;  4MZS A;  4TKJ A;  1PMP A;  3B2J A;  2Z4I A;  1BJ7 A;  1WUB A;  5H9K A;  3PQS A;  4BQV A;  2HZR A;  2NNE A;  1KXO A;  1AYU A;  2HKD A;  3F8A A;  1GXA A;  2Z4H A;  2RTQ B;  4W5C A;  3HPE A;  3SOT A;  3KWZ A;  1EWP A;  2IZH B;  1LDQ A;  1I06 A;  2WEW A;  4AZM A;  4YGH A;  1AIM A;  1FH0 A;  1A57 A;  3N91 A;  2JW1 A;  4XR7 A;  2A3F X;  1PBO A;  1NGL A;  8PCH A;  3SZH A;  2W2F A;  4OVZ B;  3PPT A;  5CHK A;  4IMO A;  3E9S A;  1ICF A;  1VWL B;  2B1N A;  1BQI A;  4I3D A;  2ATO A;  1CQD A;  4BPV A;  3FR5 A;  4O49 A;  3PT2 A;  4MVK A;  3AKM A;  4JGL A;  1SNK A;  3FA9 A;  1SWC A;  4IB8 A;  4BQU A;  1JJX A;  3ERV A;  4IAW A;  3OJY C;  3WXE A;  4DMY A;  1VWJ B;  2Q4N A;  4HWY A;  5LJB A;  4WA6 A;  2WWP A;  1OBQ A;  2YJC A;  5D4A A;  3U03 A;  4WUR A;  2KT4 B;  1SWO A;  1AYV A;  4I04 A;  4EDE A;  3H8C A;  4Y0Q A;  4IAX A;  3KFG A;  4ZHD A;  3JS1 A;  2UZJ A;  4P6E A;  3APW A;  5FFH A;  4NYR A;  1PPP A;  1SWB A;  5F6B A;  1VWE B;  4BVM A;  4OVZ A;  3UEV A;  4QBB A;  2FS6 A;  1XKI A;  3MTV A;  2AF5 A;  4KII A;  3EMM A;  2WR6 A;  2G5L A;  4FGI B;  1GEC E;  3HWG A;  1SWA A;  1NP1 A;  1T68 X;  3TRK A;  2L9C A;  2VDF A;  3WVM A;  3P6F A;  4GRJ A;  3HWF A;  1DEU A;  2AVW A;  4ZHG A;  3RVV A;  4NLJ A;  2IZC B;  3ZW2 A;  3CH3 X;  4BOQ A;  3PNR A;  3RKG A;  2WEX A;  4BX5 B;  1GX9 A;  2XU4 A;  4PP1 A;  2FHL A;  2ACP X;  2DZZ A;  4TKH A;  2K23 A;  4U46 A;  3WOV A;  1NDJ A;  1JYD A;  4N79 A;  1SWN A;  1O8V A;  1ZNG A;  1X9Y A;  3PHW A;  4Y0P A;  3VG7 A;  2UYW A;  4Q8G A;  1B8E A; 
#chains in the Genus database with same CATH homology
 1E2T A;  3HHA A;  1F2B A;  1ME4 A;  4X6J A;  3KKU A;  4YV8 A;  1F2A A;  1U9X A;  7PCK A;  3OVZ A;  2XU1 A;  5CHV A;  4MZO A;  1CV8 A;  5CVM A;  1PXV A;  2DJG B;  3K9M A;  1NL6 A;  4CDE B;  5CVN B;  1EWM A;  4YYR A;  4BSQ A;  1SP4 B;  2VHF A;  3K8U A;  1Q6K A;  1MDW A;  2JQF R;  4QH6 A;  2GFO A;  2IPP B;  3I3T A;  3IHP A;  3K24 A;  2DJF A;  3OF9 A;  3H89 A;  1HUC B;  1PIP A;  3C9E A;  3HHI A;  2CB5 A;  3D6S A;  1PPO A;  3E1Z B;  5CHT A;  1ATK A;  1PPN A;  2FT2 A;  3N3K A;  3MOR A;  2AYN A;  1ME3 A;  5FPW A;  6PAD A;  1EF7 A;  3TNX A;  2H7J A;  2FYE A;  4AXM A;  2FQ9 A;  3RVW A;  2DCD A;  1VSN A;  4ZUX U;  1JQP A;  1YT7 A;  3BCN A;  1S4V A;  3P5U A;  1DF0 A;  4OEL A;  2NQA A;  4BS5 A;  4YYS A;  3BWK A;  2G8E A;  1AU4 A;  2E00 A;  2Y5B A;  2DJG A;  4K7C A;  4CDE A;  4YYW A;  4FK5 A;  4W4U A;  3IV2 A;  1Y4H A;  4QRG A;  3LTW A;  4OEM A;  3OVX A;  1F2C A;  2JQG R;  5JH3 A;  2ACT A;  1IWD A;  2FTD A;  3QSD A;  3MTN A;  1MEG A;  3MHS A;  2DC7 A;  1NB5 A;  3NHE A;  2OP3 A;  3BC3 A;  2AIM A;  1U9W A;  1AU3 A;  5K16 A;  2DZY A;  2VHS A;  4DMX A;  4P6G A;  1KFX L;  4GUZ A;  3O1G A;  3KFQ A;  1W5R A;  2XU5 A;  1QOL A;  1ZIV A;  4CDC A;  1YVB A;  1YK8 A;  1NQC A;  2XU3 A;  1MIR A;  2P86 A;  1TL9 A;  2BDZ A;  1TU6 A;  1XKG A;  4QRV A;  1KHP A;  3PW3 A;  1CJL A;  2VFC A;  2AYO A;  4NV8 A;  3CBK A;  1U9Q X;  1NPZ A;  2NQD B;  9PAP A;  2Y6E A;  2G8J A;  2DCC A;  1POP A;  5A24 A;  2WBF X;  2NQI A;  1EWO A;  3KX1 A;  4YVA A;  4I05 A;  1BY8 A;  1EWL A;  2IBI A;  2G7Y A;  5F02 A;  2P7U A;  3BOW A;  4X6I A;  4PI3 A;  4W5B A;  4B55 A;  2P0R A;  1K3B A;  1YK7 A;  2YJB A;  3DF0 A;  1M6D A;  2AUX A;  3H8B A;  3CH2 X;  1STF E;  3P5V A;  4YYV A;  3S3Q A;  1U9V A;  4QRX A;  3S3R A;  4PP2 E;  1O0E A;  3PDF A;  1W6F A;  4CDC B;  1CPJ A;  2GHU A;  3AI8 A;  4Q8H A;  3HWN A;  3N4C A;  3B79 A;  3PBH A;  2G6D A;  1PCI A;  3H7D A;  4BS6 A;  2PBH A;  2VFB A;  2AUZ A;  1YAL A;  3BPF A;  2YJ9 A;  4CDD B;  3M99 A;  2E01 A;  2CIO A;  4RY2 A;  1CSB B;  2OUL A;  1BP4 A;  2B1M A;  2BSZ A;  2PNS A;  4CDF B;  1THE A;  3KSE A;  3QJ3 A;  1QDQ A;  1NB3 A;  2DCA A;  3D9W A;  3IOQ A;  3QT4 A;  4NV7 A;  3V6C A;  1A6R A;  3P5W A;  4YYQ A;  2DC8 A;  1F29 A;  5J94 A;  4MZS A;  2HD5 A;  1K3B B;  1KXR A;  3H6S A;  1W4T A;  4PAD A;  3USV A;  4FIP A;  2C0Y A;  4BQV A;  1MHW A;  1AYU A;  4W5C A;  5PAD A;  4FJC A;  2R9C A;  3F75 A;  1CVZ A;  3WXF A;  1AU2 A;  3KWZ A;  3O0U A;  4YYU A;  4CDD A;  1EWP A;  1PE6 A;  1AYW A;  2E02 A;  1AIM A;  1FH0 A;  4I07 A;  1MS6 A;  2F7D A;  4CDF A;  1PBH A;  2R9M A;  3ZUA A;  4XR7 A;  1CB5 A;  1QMY A;  1BGO A;  8PCH A;  1AU0 A;  1Y08 A;  1NLJ A;  1CTE A;  2PRE A;  1ICF A;  3GCB A;  1PAD A;  3U8E A;  1KHQ A;  2B1N A;  1BQI A;  1GLO A;  2ATO A;  1CQD A;  1KFU L;  1ZCM A;  1TLO A;  4G54 A;  4BPV A;  4N8W A;  3IUT A;  1SNK A;  3ERV A;  4MSX A;  3KWB X;  1GMY A;  1GX3 A;  3WXE A;  1QXP A;  3LFY A;  3P5X A;  4DMY A;  1ITO A;  1MEM A;  1U5I A;  3LXS A;  4HWY A;  4WA6 A;  3OIS A;  3IEJ A;  2YJC A;  3OF8 A;  3F5V A;  3V6E A;  5EGW A;  1AYV A;  4XUI A;  2OZ2 A;  4I04 A;  2ARY A;  3CBJ A;  4N4Z A;  1VJV A;  3H8C A;  2FRA A;  2R9O A;  4CZW A;  1CS8 A;  2AS8 A;  2PAD A;  4P6E A;  3RVX A;  2R9F A;  1GCB A;  1PPP A;  4AXL A;  4BGF A;  2BDL A;  2E03 A;  2R6N A;  2AU1 A;  3HD3 A;  4QBB A;  1PPD A;  2DCB A;  3MHH A;  2FO5 A;  1GEC E;  3IMA A;  2HXZ A;  2FUD A;  2HH5 A;  3WXG A;  4KLB A;  3I06 A;  1DEU A;  2AVW A;  3RVV A;  3N3G A;  3CH3 X;  2F1G A;  3PNR A;  2YJ2 A;  1AEC A;  2YJ8 A;  2XU4 A;  2DJF B;  4PP1 A;  4X6H A;  4C5P A;  2DC6 A;  2R9N A;  3KW9 A;  2DZZ A;  5CVO B;  2NQG A;  3BPM A;  5EF4 A;  2O6X A;  2FRQ A;  4N79 A;  2DC9 A;  1X9Y A;  2HHN A;  4Q8G A;  5JA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...