1JQPA

Dipeptidyl peptidase i (cathepsin c), a tetrameric cysteine protease of the papain family
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
438
structure length
348
Chain Sequence
b'DTPANCTYPDLLGTWVFQVGPRHPRSHINCSVMEPTEEKVVIHLKKLDTAYDEVGNSGYFTLIYNQGFEIVLNDYKWFAFFKYEVKGSRAISYCHETMTGWVHDVLGRNWACFVGKKMLSLPESWDWRNVRGINFVSPVRNQESCGSCYSFASLGMLEARIRILTNNSQTPILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEENCFPYTATDAPCKPKENCLRYYSSEYYYVGGFYGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHPFNPFELTNHAVLLVGYGKDPVTGLDYWIVKNSWGSQWGESGYFRIRRGTDECAIESIAMAAIPIPKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dipeptidyl peptidase I
publication title Tetrameric dipeptidyl peptidase I directs substrate specificity by use of the residual pro-part domain
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 100
structure length 348
sequence length 438
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00112 Peptidase_C1 Papain family cysteine protease
A PF08773 CathepsinC_exc Cathepsin C exclusion domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.80 Mainly Beta Beta Barrel Lipocalin Cathepsin C, exclusion domain 1jqpA01
3.90.70.10 Alpha Beta Alpha-Beta Complex Cathepsin B; Chain A Cysteine proteinases 1jqpA02
4X6IA 1AYUA 4PI3A 4YVAA 8PCHA 4ZUXU 2R9MA 3KX1A 3IOQA 2BDZA 1QOLA 4CDEB 2AUXA 3TNXA 2FRAA 1DF0A 1PBHA 3NHEA 4N79A 3V6CA 4CDCB 1JQPA 1GMYA 2FYEA 6PADA 1HUCB 3OISA 2AU1A 4OEMA 1PPPA 1AYWA 1KFUL 2YJ2A 4OELA 3LFYA 1PPNA 1U9XA 5FPWA 3K24A 1BP4A 1X9YA 3HHAA 3B79A 1CJLA 2R9FA 1XKGA 3H8BA 2DZYA 1YT7A 3MTNA 1AIMA 1GECE 2AVWA 4CDFA 4YYVA 2NQDB 2CIOA 3CBJA 3S3QA 3N4CA 2XU5A 2PNSA 1CTEA 1EF7A 2R9OA 2FUDA 4BQVA 1ZIVA 2R9NA 2FRQA 2ACTA 1VSNA 2JQGR 5CHVA 1SP4B 4W5BA 1AYVA 2AYOA 1AU0A 3WXGA 4MZOA 1BY8A 1Q6KA 3BCNA 2OZ2A 3KW9A 1CPJA 2B1NA 2FT2A 2OP3A 4BPVA 3KWBX 2NQIA 5JA7A 1AU4A 2DZZA 3N3GA 2HD5A 3IUTA 5CVOB 2BDLA 3CH3X 7PCKA 2G6DA 1F29A 1KHPA 1BGOA 4BS6A 5CVNB 2GHUA 4I07A 5J94A 1KXRA 4CDDB 2R9CA 3D6SA 4DMXA 9PAPA 2JQFR 1AU3A 1CS8A 4QRXA 1CB5A 2E03A 3AI8A 3CH2X 1YK7A 3KFQA 1BQIA 2F7DA 3E1ZB 2VHSA 5EGWA 3H6SA 3K9MA 2YJBA 4CDFB 4YYRA 5A24A 1YVBA 3OVXA 4QH6A 4MZSA 2PADA 4W4UA 5F02A 3H7DA 4X6JA 1ME4A 1STFE 1POPA 2NQAA 3QT4A 1TLOA 2G8EA 4CDDA 2FQ9A 3IHPA 1IWDA 2G7YA 1ME3A 2HH5A 2XU1A 3I3TA 5EF4A 3MORA 2E02A 4RY2A 4MSXA 3PW3A 3HHIA 1EWLA 4CZWA 2GFOA 3WXEA 4QBBA 4I05A 3V6EA 1SNKA 2DCBA 4YYQA 1THEA 3M99A 4P6GA 3I06A 1QMYA 1NL6A 2FO5A 3IV2A 1PADA 1K3BA 2E01A 3KSEA 4G54A 4N4ZA 3BOWA 4XR7A 4YYSA 1MEMA 1ZCMA 4BSQA 2DCAA 2DJFA 2DJGB 3BC3A 1F2CA 5JH3A 3QJ3A 1PPOA 3P5UA 2AIMA 4QRGA 1KHQA 2DC8A 2H7JA 1NLJA 1ICFA 3HWNA 3H8CA 1F2BA 4PADA 2XU4A 1PXVA 2XU3A 4QRVA 5CVMA 1Y4HA 2G8JA 3RVVA 4YYUA 2DCCA 4FJCA 4PP2E 3K8UA 2HHNA 2Y6EA 1VJVA 2P0RA 2ATOA 4I04A 3BWKA 1ATKA 1DEUA 3USVA 3IEJA 3DF0A 2NQGA 1PPDA 2C0YA 1NB5A 3WXFA 4X6HA 1U9WA 2DJGA 1MDWA 1PE6A 1MS6A 4AXLA 3ERVA 1QXPA 2R6NA 4WA6A 5K16A 1GCBA 2P7UA 4YV8A 1M6DA 2ARYA 1K3BB 1S4VA 4W5CA 3P5XA 3ZUAA 3C9EA 2IPPB 4Q8GA 1EWMA 3KWZA 4FK5A 2DJFB 4YYWA 2PREA 3OVZA 3PBHA 2AS8A 1U9VA 2CB5A 3N3KA 1TL9A 1NB3A 3F75A 2YJ9A 3QSDA 4P6EA 2DC7A 2E00A 2AYNA 3O0UA 2B1MA 3KKUA 3GCBA 2F1GA 1CSBB 3H89A 1O0EA 1EWOA 4Q8HA 4KLBA 1MIRA 2O6XA 1CQDA 2Y5BA 4AXMA 2HXZA 4HWYA 2DCDA 2DC6A 3RVXA 3OF8A 3HD3A 2YJ8A 1F2AA 3F5VA 1MHWA 1AU2A 3P5WA 3PDFA 4N8WA 1A6RA 2YJCA 4FIPA 1U5IA 4CDEA 2DC9A 3IMAA 3U8EA 1GLOA 1AECA 5PADA 3MHHA 3MHSA 3BPFA 1QDQA 1YK8A 4CDCA 2FTDA 4DMYA 2P86A 1EWPA 5CHTA 2PBHA 1ITOA 4XUIA 3BPMA 1MEGA 2OULA 4BS5A 1NQCA 3PNRA 1PIPA 1CV8A 1CVZA 1TU6A 1NPZA 2WBFX 1KFXL 2AUZA 3S3RA 1FH0A 3CBKA 4PP1A 3RVWA 1PCIA 3LXSA 4K7CA 1U9QX 1Y08A 2VHFA 3O1GA 2IBIA 1YALA 3OF9A 3P5VA
chains in the Genus database with same CATH superfamily
3T6LA 3P24A 3PQSA 2RTKA 4XMDA 2R9MA 3MP2A 2Q9SA 1HY2A 2BDZA 4BOPA 1BRPA 1MEPA 1PBHA 3ZUIA 3BBAA 2FE8A 1EIIA 5HA0A 1CBQA 2OY7A 1YZBA 4YMYA 2FKJA 3WZQA 2Q39A 2AU1A 1SLFB 3DTQA 1AYWA 3AKNA 4GDAA 1B0OA 4OELA 4YH0A 5H9KA 3K24A 1A2DA 3B79A 2AMMX 4FBRA 3N91A 3NQ3A 5JD2A 2R9FA 3BY0A 1DF3A 3SAOA 1KOIA 2AVWA 1Z24A 3L4RA 2LA7A 4CDFA 2WUTA 2BC3A 2NQDB 2A2UA 4TKHA 2L5PA 4REZA 3N4CA 5HA1A 2PNSA 1OBPA 3ELZA 2R9NA 2FRQA 3GAQA 1VSNA 2JQGR 1HXZA 4RF0A 1UYOX 4KH8A 1AU0A 4MZOA 1BY8A 4MIRA 2Z4IA 1NQMA 4BPVA 3KWBX 5JA7A 3N3GA 5IXGA 5LJDA 1SRGA 2IZIA 5CVOB 4C5PA 4DQ4A 1F29A 4FBOA 3FW5A 1KFFA 2FRSA 3U03A 2RTFB 4BX7A 2LBVA 2FR2A 1I06A 5BVQA 1SLGB 4A5UA 2JQFR 4CPHB 9PAPA 4BX6A 4LQZA 1CS8A 1SWRA 2HKDA 1EPBA 4B55A 4ORSA 1X71A 2VFBA 2JRIA 1RXJA 3CH2X 2F7DA 3AKMA 3FR2A 3VG7A 2OZQA 2F01A 3K9MA 3RZYA 1I04A 2C4IA 3QQ2A 5HZQA 4ZHGA 4TKJA 4A1HA 3PHWA 2WEWA 1VWPB 3B2HA 2PADA 4MVEA 1ICMA 3H7DA 4HFOA 2NQAA 1POPA 1RAVA 2X45A 4GU8A 4ORYA 5KHPA 4OS8A 5H8TA 3AUMO 1O8VA 2G8EA 5D8JA 3D4RA 5B5GA 1LNMA 3EC5A 4CPHA 2G7YA 3FYFA 1KL5A 4CV7A 4JO6A 4O4OA 2L67A 4I05A 3V6EA 3PP6A 3FEPA 4ZHDA 1SNKA 3MX7A 4YYQA 2WQ9A 4LKPA 1GKAA 2W2BA 2ZAGA 4YGZA 4BQUA 3B2JA 2R74A 4P6GA 5CHKA 1NL6A 1PADA 2L9CA 1KZWA 1O1UA 2RD7C 3ZQ3A 3BOWA 3UEUA 4IB9A 1IKJA 4BSQA 2DCAA 2DJFA 5KICA 3BC3A 1F2CA 2FLJA 1SWEA 1SWJA 4BX5B 3P5UA 2Q2PA 1LCZA 2DC8A 3HWNA 3FENA 1LDOA 2LKKA 1F2BA 4PADA 1VWFB 3BRNA 5F1EA 3TGAA 3SZJA 1GX8A 2HHNA 1VJVA 2P0RA 1ATKA 1SLEB 2JU3A 3C78X 2KTSA 1LUQA 2Z84A 2BSZA 2RCTA 1WBIA 1CBSA 2C0YA 1OEKA 4HXDB 1RBPA 5HTDA 4CPIA 1SWTA 3C77X 4AXLA 3WYPA 1QXPA 1E5PA 2WSJA 2QOMA 4O4UA 5HBSA 2R6NA 1SMPI 2P7UA 1OEJA 3NX2A 2JOZA 2MJIA 1S4VA 4W5CA 4IAXA 5B5FA 2AVIA 4OW0A 3RDSA 3ZUAA 2IPPB 2LBAA 4NYRA 1NP4A 3WJGA 4Q8GA 4YYWA 1AB0A 3Q6LA 2AS8A 1TL9A 1UYNX 2YJ9A 4M7MA 1GXAA 3SLOA 2AYNA 1JZUA 1SWQA 2B1MA 3UEVA 1Y55X 1AQBA 2YMSA 4BOQA 4A8ZA 1MIRA 2Z4HA 4RUUA 2BLGA 4GH7A 1CQDA 3V8UA 1JMZA 4QYPA 5KIDA 2Y5BA 2OF9A 2HXZA 5LJBA 1X8UA 4HWYA 1EUOA 3K3LA 4Z28A 2BTWB 4D8IA 2ASNX 5B11O 3F5VA 3RE5A 4N8WA 1A6RA 2F73A 1N4JA 2YJCA 1OBQA 2RQ0A 1JYDA 1GLOA 1LCVA 5PADA 2O62A 3BPFA 4BJ8A 2P86A 1BLRA 3CKFA 4Y59A 3VG6A 3BPMA 3STKA 1NDJA 3T2WA 3PNRA 2A5BA 1KZXA 4OVZB 1CV8A 1WUBA 2NP1A 4AZRA 1GT4A 1U17A 1NPZA 5FAZA 4MVKA 2C1QA 1VWGB 4DCBA 1ZRYA 1U9QX 3O1GA 4EDEA 2IBIA 2RN4A 2ZSCA 4YFPA 4IMOA 1G5WA 1GT5A 1MX7A 2JTCA 1ZNEA 4NW4A 5K67A 2R73A 5K68A 4M6SA 3BX7A 2RTQB 3ZW0A 1VWDB 4D6BA 4PT5A 2DM5A 4NNTA 3WBGA 1NP1A 1BWYA 4OVZA 3KFHA 3NQ9A 2HYSA 1SY1A 1VWCB 3WOVA 4PJ2A 4YGHA 4NLIA 1A18A 1BSQA 2P8GA 1DF0A 1VYGA 2GH7A 2NNQA 3V6CA 4CDCB 3HWGA 5L8OA 5LJCA 3PQUA 1GMYA 3JS1A 1U18A 2AT6X 3VG5A 3OISA 4IAWA 3HTYA 1ZNHA 4TQ2A 4OEMA 1RXKA 1PPPA 4NP1A 1SWHA 2FWVA 5F7GA 4AZPA 3LFYA 5FPWA 1X8NA 5L8IA 1XKGA 2AT5X 1GECE 2ZAIA 1KQXA 2XKLA 3S3QA 3FW4A 3SOTA 2XU5A 1CTEA 3O19A 3RDQA 5B2AO 4MVIA 1S2PA 1HQQA 4IUMA 4U8UM 4BQVA 4ES7A 3CWKA 1N43A 5F58A 1SRJA 2WR6A 5CHVA 1SP4B 1SWPA 2GTLO 1AYVA 2AYOA 4ARHA 3ZNHA 1QY1A 1Q6KA 2OZ2A 4GD9A 1SWOA 3FMZA 2WWPA 5HCEC 2OY8A 2DZZA 1E2TA 1DZJA 5H9NA 4OS3A 3TZSA 3MBTA 2IZGB 3CH3X 2G6DA 7PCKA 1MDCA 3IFUA 1SWCA 1KHPA 1BGOA 3WJBA 4BS6A 3PECA 2RTOB 4ZGFA 4ORUA 2A3FX 1VWBB 3BDRA 5J94A 1MX8A 2A8GA 2YG2A 2R9CA 2RTGB 3UAQA 1D2UA 5AJCA 3EBWA 1YP7A 1UZ2X 4QRXA 3SZHA 5CYBA 3CQRA 4ZR2A 1EIOA 2BS5A 2RTNB 4O4XA 4AZQA 3KFQA 3HWDA 3KVNA 4A60A 1GM6A 5EEDA 1JBHA 1DF8A 5DG4A 3H6SA 1SA8A 2YJBA 4CDFB 4PSQA 3EMMA 2OYBO 1LELA 3STNA 2UYWA 4GRJA 2KTDA 4GE1A 2HWKA 1STFE 3VE1A 3S5VA 3RSWA 3E9SA 2FHNX 3QT4A 5CE4A 5AQ6A 5EZSA 1CBRA 1KGLA 1DZMA 2E4JA 2C1SA 4TLJA 2FQ9A 2CZUA 4AYHA 3IHPA 1YWCA 3C0RA 4CK4A 3RWXA 1ME3A 3VPJE 4BBOA 2XU1A 3GE2A 1MVGA 3I3TA 4A1YA 1PBYA 4Z6JA 5EF4A 2E02A 4RY2A 1DKIA 4MSXA 1SXWA 1STSB 3AEHA 3PW3A 3HHIA 5EDBA 2OFBA 4L1NA 2A13A 4U9CA 4IP3A 3WXQA 5FQ7E 1JJXA 2R56A 1UKFA 4LZUA 4BOSA 4BX7B 2POAA 1GT3A 1THEA 1GX3A 3MJ5A 4OMWA 4BX6B 3I06A 3RDMA 1QMYA 1RSTB 1VWQB 1FEMA 2MM3A 4G54A 1SXUA 4GZVA 1X89A 4EXZA 1QFTA 2DJGB 5JH3A 4I95A 2X8FA 5LKEA 4O49A 2M4LA 1KHQA 5IRAA 4TNNA 5D48A 1ICFA 5CVMA 1B8EA 1LIDA 1Y4HA 4DQ3A 4YYUA 2DCCA 4WURA 2J7QC 4PP2E 1SY0A 1SXYA 4HPDA 4IABA 2GTLN 4GNYA 4I60A 3G7XA 4QZUA 2CBRA 4O3WA 3H3IA 1BEBA 4X6HA 3NR3A 2DJGA 4KC8A 1MDWA 3ERVA 1VPRA 1GKAB 3OQCA 3ZI8A 4YFQA 3PH6A 5K16A 5EPQA 2RTAA 3CBCA 2IFBA 1B4MA 1OEEA 3PSEA 3TGBA 4Y5DA 2WPUA 5FQ6E 1YUPA 2DJFB 1PM1X 2CZTA 2PREA 4I9SA 2AT3X 2CB5A 1BSOA 1VYFA 2FGSA 4ZCBA 1W4TA 1X8QA 1EQDA 1NQNA 3RDOA 1X8PA 3KQ0A 3QSDA 1IKEA 2DC7A 3O0UA 2IZCB 2RTHB 3SLJA 4ORWA 5EZ2A 2X46A 4GUAA 3HPEA 1CSBB 3H89A 4O3XB 3P6EA 3SZIA 4QZTA 3ELXA 3F6ZB 1O0EA 2QOSC 4YCEA 4Q8HA 1VWAB 4COTA 1O1VA 4HPAA 2DCDA 5IRWA 3LV4A 3PDFA 5IRUA 4XMEA 1U5IA 4CDEA 2AH7X 5B3MO 3BU9A 3MHHA 3HK1A 2OFAA 2OY1O 1VWNB 3MTVA 4WFUA 1T68X 2BHVA 3P6CA 2PBHA 1BJ7A 1ITOA 2IZJA 2OULA 1NQCA 2QO4A 1TU6A 2JGSA 4IRWA 1S7DA 3S3RA 1FH0A 3CBKA 4PP1A 1L6MA 1PCIA 3LXSA 1Y08A 2IZAA 2VHFA 1QABE 4O3ZA 5LJGA 2FKGA 1N9YA 2RTJA 3OF9A 4AW8A 2QCBA 3NPOA 1AYUA 1EPAA 2QO5A 3OD9A 2IZEB 1GT1A 3P6FA 4YDAA 1SWBA 1BRQA 4O4SA 1E02A 4M0WA 4NYQA 1AVGI 3W30A 2CM4A 2X56A 3VHMA 1QOLA 2AUXA 4KC7A 3TNXA 2PY1A 4XMCA 2OL6O 2RA6A 3QKGA 3NHEA 4N79A 3C76X 5AJBA 5H9LA 1MUPA 3RNVA 4QGXA 1EALA 2FYEA 5L8NA 4YGGA 1HUCB 1PBOA 3D97A 2RTEB 4N7DA 3CR6A 1SRFA 4ALBA 5F2BA 3BY4A 1KFUL 4CSBA 2IZBA 2YJ2A 5DPQA 2HZQA 1X8OA 3RE6A 1U9XA 1BP4A 1X9YA 3HHAA 3MTNA 1VWKB 1AIMA 3CBSA 2RTMA 3FLLA 2CIOA 4GKCA 5K06A 4MI7A 3X00A 1OBUA 1EF7A 1LIEA 2NNDA 1D3SA 4U3QA 2N93A 3EW1A 1NBXA 1EW3A 1FTPA 1ZIVA 1GX9A 1LF7A 4GJVA 3ZW0B 4W5BA 2Y3EA 1A57A 3WXGA 4D8EA 4ZHFA 4RNAA 1FJ1E 3CQNA 3KW9A 1NC9A 1CPJA 3BU1A 2HNXA 2FT2A 2OP3A 4QNIA 2HD5A 2W2AA 3ZZVA 4MEEA 4YCHA 3IUTA 2BDLA 4INNA 4YFRA 4MM3B 1U0XA 4GGRA 1ML7A 5CVNB 2GHUA 4I07A 3KZAA 2GJ5A 3S60A 1CRBA 4CDDB 1ZNGA 1QWDA 4DMXA 3O65A 1AU3A 3HOEA 1YWBA 1KT5A 4UU2A 1SY2A 2AL0X 3FR5A 4YBPA 1CB5A 2E03A 4RKXA 1IFCA 1QQSA 3E1ZB 2FTBA 5HZ8A 2VHSA 1JJUA 4YYRA 2G8CO 3PK2A 3WJCA 3OJYC 3OVXA 3B2IA 2IZKA 3MM0A 4ML7B 4MZSA 3VG3A 2RTBB 4W4UA 4X6JA 1ME4A 4O3YA 1TLOA 2J7QA 3PEDA 4CDDA 2RTDB 1IWDA 4N7CA 3BB7A 5FQ8E 2HH5A 3FIDA 1EXSA 3VG4A 4BOEA 2IZHB 1ERBA 1VWJB 2QO6A 1IJ8A 1EWLA 4CZWA 1HMRA 3WXEA 4QBBA 1KL4A 4Z2PA 1CJ5A 4O9SA 5D47A 2K62A 2VFCA 1G85A 1HBPA 3T6FA 1IIUA 3WJFA 2A0AA 3WZNA 3PPTA 2FO5A 3UEWA 3IV2A 1K3BA 4XMFA 2I5VO 4U46A 4GJSA 2IZDB 3CKGA 3P02A 1ZNKA 4YYSA 3VU1A 3ZW1A 1DZKA 4HPBA 1JIWI 2KW1A 3PHXA 3FA9A 4YKOA 3QJ3A 3HWFA 2AIMA 5BYPA 1NLJA 2G79A 2GTFX 2AT8X 3Q34A 3H8CA 3FA7A 2XU3A 4HWMA 4AZOA 1S44A 4IB8A 2UZJA 3RVVA 5IO7A 4EFGA 1SWFA 4L3RA 3DSZA 3OE3A 3PRMA 3K8UA 1Y53X 1KQWA 3D96A 2Y6EA 2MHDA 1LCWA 3BLGA 1FDQA 1KXOA 3RKGA 3BX8A 4I04A 4ODDA 3WJDA 1DZPA 1DEUA 3USVA 3IEJA 1LIFA 5KO3A 3RY2A 2G78A 3NADA 3OBLA 1KT7A 1Y9LA 1PE6A 2AF5A 1MS6A 4U8UO 2IZFB 3KFIA 2HMBA 2XSTA 5EEEA 2CBSA 3B21A 3STMX 4D6AA 2CM9A 3APVA 1VWEB 4RF1A 1E06A 3EW2A 4KCAA 3KWZA 1UREA 3PBHA 2PI3O 3FR4A 1DC9A 4OKAA 1U9VA 3N3KA 1MOYA 4QGVA 2OVSA 4I3DA 4Y0PA 1JYJA 4P6EA 5AEOA 2E00A 4GETA 2RTRB 2A5CA 3KKUA 3WZPA 1PTSA 1FELA 2JN3A 2MO5A 4QQ1A 2Y3FA 1KL3A 3JQOA 4Y0RA 4KLBA 2HLVA 4CPFA 2MF6A 2I5ZO 4EQAC 1SWDA 4AXMA 1K24A 3LHNA 2DC6A 3RVXA 3OF8A 3HD3A 1W5RA 2X8SA 2Y32A 2YJ8A 2UZ2A 4NLJA 2OF8A 1I9HA 3P5WA 2ACOA 1SRIA 1YWDA 3MG5A 3VHHA 3NBXX 4P16A 1ERXA 3U8EA 1AECA 3I17A 3MHSA 1BSYA 1QDQA 1YK8A 3SLTA 3F9DA 3IFBA 1YP6A 1YWAA 4ZTBA 1PEEA 4DMYA 1EWPA 4LZVA 1MEGA 4TJZA 3IA8A 4BS5A 1SWNA 4YKMA 4HPCA 4BGFA 4Y0SA 1SWLA 1QY2A 1VWRB 2OL7A 3FELA 3MVFA 5FENA 3RVWA 2G5LA 4FGIB 3VE2A 2OFRX 4K7CA 4ZHHA 4YVBA 2Q2MA 1XKIA 5JZEA 1YALA 4IMNA 3P5VA 2L68A 4X6IA 1KT6A 4ZHCA 1A3YA 1ADLA 5H9AA 1SREA 4PI3A 5F6BA 3FIQA 4YVAA 8PCHA 4ZUXU 2LB6A 3KX1A 3ZWEA 3IOQA 1GGLA 1TW4A 3RDUA 2DOSA 1SY3A 3PH5A 4CDEB 2VDFA 2FRAA 1HQPA 1TVQA 1HMTA 2AGAA 2KT4B 3S5XA 1JQPA 4I9RA 4U8UN 5B29A 6PADA 1I4UA 1Y0GA 3FDCA 3KFGA 3FA8A 3RDXA 4ZFXA 4Z2VA 4I3CA 1OSPO 1NGLA 3TF6A 1HBQA 3BSZE 1HMSA 2RTIB 1PPNA 2Q4NA 1VWLB 1Y9TA 1CJLA 3O22A 3H8BA 2DZYA 1YT7A 3NX1A 4JHQA 1SWKA 1T8VA 4BOZA 4YYVA 1STPA 3CBJA 4KIIA 2QM9A 4ON1A 2RTCB 2NNEA 2FT9A 1ZNDA 3B2LA 2R9OA 2FUDA 3PHUA 5CSEA 4JNJA 5F6ZA 2ACTA 4YBUA 1TOUA 2X8TA 1OPAA 5BVTA 5L3YA 4NNSA 3F8AA 4GK9A 3BCNA 1KT3A 2B1NA 3FEKA 3I0AA 1PMPA 3BS2A 4XMHA 1QG5A 4OS0A 2NQIA 1W6FA 3RBYA 4ZGUA 1AU4A 4ZH9A 4OMXA 1MK5A 1LDQA 5HZ6A 2A2GA 3D95A 3D9WA 4QRLA 3S26A 1KXRA 2OY5O 1IW2A 2OFMX 2FR3A 3D6SA 1STRB 1VWOB 5HAEA 4UU3A 1EI5A 3APXA 4D8BA 2K23A 4TKBA 3AI8A 1TOWA 3ZUOA 1YK7A 2BU3A 1BQIA 1QFVA 3FA6A 2GC9A 3VG2A 4ZJ0A 1JJJA 5EGWA 5LKFA 4BCSA 5A24A 4BX5A 1TXLA 1I05A 5LJHA 1YVBA 3E3CA 3TRKA 4QH6A 1N7YA 5F02A 5IO6A 4K19A 4JGLA 2BT9A 4DNEA 4I3BA 2EU7X 1BBPA 1OPBA 3EYCA 4ORXA 4EEJA 1RXHA 4NV7A 2OVAA 2G7BA 1ZNLA 5D45A 1LPJA 3MORA 5HWZA 1LICA 1N9MA 5B10O 2LFOA 3WZOA 2GFOA 5FFHA 2X55A 3CMPA 1R0UA 1SWAA 4Z27A 3NP1A 3JSQA 2DCBA 1E00A 2JMBA 1DV9A 5JR8A 3VGWA 3HWEA 4GNWA 3M99A 1VYOA 4QYNA 1SWUA 1VWMB 4ALOA 1QY0A 1LIBA 2E01A 3KSEA 4FQBB 4WFVA 3WVMA 1N0SA 4N4ZA 1RSUB 4XR7A 1MEMA 1LKEA 2OVEA 2AT0X 5IO5A 1ZCMA 1T0VA 4I6SA 3O2YA 1JMXA 4ORRA 1PPOA 4QAEA 4IB7A 4AZNA 4QRGA 5HCDC 1KT4A 1SWSA 2H7JA 1G74A 4R3DA 2XU4A 1PXVA 4QRVA 2MWHA 2FS6A 2G8JA 4FJCA 4EKVA 2ACPX 5B27A 1AVDA 3EM0A 1ACDA 3U9PC 4KT5A 1H91A 2ATOA 2FS7A 1JV4A 3KFFA 3U0DA 2X4MA 3BWKA 5HZ5A 3T2XA 5BVSA 3P6HA 2BTWA 3LTWA 4BOUA 4Y0QA 2ALLX 3DF0A 5D4AA 4AZMA 2NQGA 1PPDA 1NB5A 1XCAA 2RTLA 4BVMA 2CAMA 3WXFA 4MVLA 3EBKA 1LFOA 1U9WA 3UEXA 1RLBE 1MM9A 4GDZA 1SXXA 1DFVA 4IBAA 3RY1A 5LJEA 4NV8A 4WA6A 5E6JA 1SLDB 1GCBA 1FENA 5LJKA 4YV8A 1M6DA 2AKQA 2ARYA 1K3BB 3VHIA 2JU7A 3P5XA 3WJEA 2WQAE 3C9EA 3ZW1B 2WEXA 1HXLA 1EWMA 2F09A 1CBIA 4ZH6A 4WBKA 3P6DA 5HCCC 3TGCA 4FK5A 4QGWA 4GUZA 4CPEA 3HOLA 3OVZA 1B56A 4Z2OA 3B2KA 4XMGA 2OVDA 1I78A 1AELA 2GTLM 1NB3A 3F75A 2BS6A 4LKTA 1IFBA 4IB6A 3NQKA 4FBVA 1SRHA 2IZLB 3GCBA 2F1GA 1ALBA 1EWOA 3TMPA 2QMIA 3T1DA 3W31A 3APUA 2RTPB 2FHLA 2O6XA 3ZW2A 4ID2A 1Y52X 1ICNA 4GGTA 2JW1A 1F2AA 1MHWA 1AU2A 5EDCA 4FIPA 2JU8A 1G7NA 1HN2A 2DC9A 3IMAA 2ANSA 2RCQA 1BM5A 3APWA 1SWGA 3PRPA 1P6PA 4RUNA 2X32A 4WHIA 2FTDA 4CDCA 3P6GA 1YIVA 1PVJA 2X34A 1AVEA 5CHTA 1VWIB 4XUIA 1VWHB 5EZQA 1PIPA 5C0NA 1CVZA 4MISA 2WBFX 1KFXL 5HZ9A 2AUZA 5HTEA 3PT2A 3WYQA 2KD2A 1FE3A 4XZXA 2OL8O 4R0BA 4GGZA 4YDBA 2HZRA 2W2FA
chains in the Genus database with same CATH topology
4X6IA 1AYUA 4PI3A 4YVAA 8PCHA 4ZUXU 2R9MA 3KX1A 3IOQA 2BDZA 1QOLA 4CDEB 2AUXA 3TNXA 2FRAA 1DF0A 1PBHA 3NHEA 4N79A 3V6CA 4CDCB 1JQPA 1GMYA 2FYEA 6PADA 1HUCB 3OISA 2AU1A 4OEMA 1PPPA 1AYWA 1KFUL 2YJ2A 4OELA 3LFYA 1PPNA 1U9XA 5FPWA 3K24A 1BP4A 1X9YA 3HHAA 3B79A 1CJLA 2R9FA 1XKGA 3H8BA 2DZYA 1YT7A 3MTNA 1AIMA 1GECE 2AVWA 4CDFA 4YYVA 2NQDB 2CIOA 3CBJA 3S3QA 3N4CA 2XU5A 2PNSA 1CTEA 1EF7A 2R9OA 2FUDA 4BQVA 1ZIVA 2R9NA 2FRQA 2ACTA 1VSNA 2JQGR 5CHVA 1SP4B 4W5BA 1AYVA 2AYOA 1AU0A 3WXGA 4MZOA 1BY8A 1Q6KA 3BCNA 2OZ2A 3KW9A 1CPJA 2B1NA 2FT2A 2OP3A 4BPVA 3KWBX 2NQIA 1W6FA 1AU4A 2DZZA 5JA7A 3N3GA 2HD5A 1E2TA 3IUTA 5CVOB 4C5PA 2BDLA 3CH3X 7PCKA 2G6DA 1F29A 1KHPA 1BGOA 4BS6A 5CVNB 2GHUA 4I07A 3D9WA 5J94A 1KXRA 4CDDB 2R9CA 3D6SA 4DMXA 9PAPA 2JQFR 1AU3A 1CS8A 4B55A 4QRXA 2VFBA 1CB5A 2E03A 3AI8A 3CH2X 1YK7A 3KFQA 1BQIA 2F7DA 3E1ZB 2VHSA 5EGWA 3H6SA 3K9MA 2YJBA 4CDFB 4YYRA 5A24A 1YVBA 3OVXA 4QH6A 4MZSA 2PADA 4W4UA 5F02A 3H7DA 4X6JA 1ME4A 1STFE 1POPA 2NQAA 3QT4A 1TLOA 2G8EA 4CDDA 2FQ9A 3IHPA 1IWDA 4NV7A 2G7YA 1ME3A 2HH5A 2XU1A 3I3TA 5EF4A 3MORA 2E02A 4RY2A 4MSXA 3PW3A 3HHIA 1EWLA 4CZWA 2GFOA 3WXEA 4QBBA 4I05A 3V6EA 1SNKA 2DCBA 4YYQA 2VFCA 1THEA 1GX3A 3M99A 4P6GA 3I06A 1QMYA 1NL6A 2FO5A 3IV2A 1PADA 1K3BA 2E01A 3KSEA 4G54A 4N4ZA 3BOWA 4XR7A 4YYSA 1MEMA 1ZCMA 4BSQA 2DCAA 2DJFA 2DJGB 3BC3A 1F2CA 5JH3A 3QJ3A 1PPOA 3P5UA 2AIMA 4QRGA 1KHQA 2DC8A 2H7JA 1NLJA 1ICFA 3HWNA 3H8CA 1F2BA 4PADA 2XU4A 1PXVA 2XU3A 4QRVA 5CVMA 1Y4HA 2G8JA 3RVVA 4YYUA 2DCCA 4FJCA 4PP2E 3K8UA 2HHNA 2Y6EA 1VJVA 2P0RA 2ATOA 4I04A 3BWKA 1ATKA 1DEUA 3USVA 2BSZA 3LTWA 3IEJA 3DF0A 2NQGA 1PPDA 2C0YA 1NB5A 3WXFA 4X6HA 1U9WA 2DJGA 1MDWA 1PE6A 1MS6A 4AXLA 3ERVA 1QXPA 2R6NA 4NV8A 4WA6A 5K16A 1GCBA 2P7UA 4YV8A 1M6DA 2ARYA 1K3BB 1S4VA 4W5CA 3P5XA 3ZUAA 3C9EA 2IPPB 4Q8GA 1EWMA 3KWZA 4FK5A 2DJFB 4GUZA 4YYWA 2PREA 3OVZA 3PBHA 2AS8A 1U9VA 2CB5A 3N3KA 1TL9A 1NB3A 3F75A 2YJ9A 1W4TA 3QSDA 4P6EA 2DC7A 2E00A 2AYNA 3O0UA 2B1MA 3KKUA 3GCBA 2F1GA 1CSBB 3H89A 1O0EA 1EWOA 4Q8HA 4KLBA 1MIRA 2O6XA 1CQDA 2Y5BA 4AXMA 2HXZA 4HWYA 2DCDA 2DC6A 3RVXA 3OF8A 3HD3A 1W5RA 2YJ8A 1F2AA 3F5VA 1MHWA 1AU2A 3P5WA 3PDFA 4N8WA 1A6RA 2YJCA 4FIPA 1U5IA 4CDEA 2DC9A 3IMAA 3U8EA 1GLOA 1AECA 5PADA 3MHHA 3MHSA 3BPFA 1QDQA 1YK8A 4CDCA 2FTDA 4DMYA 2P86A 1EWPA 5CHTA 2PBHA 1ITOA 4XUIA 3BPMA 1MEGA 2OULA 4BS5A 1NQCA 3PNRA 1PIPA 1CV8A 1CVZA 1TU6A 1NPZA 4BGFA 2WBFX 1KFXL 2AUZA 3S3RA 1FH0A 3CBKA 4PP1A 3RVWA 1PCIA 3LXSA 4K7CA 1U9QX 1Y08A 2VHFA 3O1GA 2IBIA 1YALA 3OF9A 3P5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6I A;  1AYU A;  4PI3 A;  4YVA A;  8PCH A;  4ZUX U;  2R9M A;  3KX1 A;  3IOQ A;  2BDZ A;  1QOL A;  4CDE B;  2AUX A;  3TNX A;  2FRA A;  1DF0 A;  1PBH A;  3NHE A;  4N79 A;  3V6C A;  4CDC B;  1JQP A;  1GMY A;  2FYE A;  6PAD A;  1HUC B;  3OIS A;  2AU1 A;  4OEM A;  1PPP A;  1AYW A;  1KFU L;  2YJ2 A;  4OEL A;  3LFY A;  1PPN A;  1U9X A;  5FPW A;  3K24 A;  1BP4 A;  1X9Y A;  3HHA A;  3B79 A;  1CJL A;  2R9F A;  1XKG A;  3H8B A;  2DZY A;  1YT7 A;  3MTN A;  1AIM A;  1GEC E;  2AVW A;  4CDF A;  4YYV A;  2NQD B;  2CIO A;  3CBJ A;  3S3Q A;  3N4C A;  2XU5 A;  2PNS A;  1CTE A;  1EF7 A;  2R9O A;  2FUD A;  4BQV A;  1ZIV A;  2R9N A;  2FRQ A;  2ACT A;  1VSN A;  2JQG R;  5CHV A;  1SP4 B;  4W5B A;  1AYV A;  2AYO A;  1AU0 A;  3WXG A;  4MZO A;  1BY8 A;  1Q6K A;  3BCN A;  2OZ2 A;  3KW9 A;  1CPJ A;  2B1N A;  2FT2 A;  2OP3 A;  4BPV A;  3KWB X;  2NQI A;  5JA7 A;  1AU4 A;  2DZZ A;  3N3G A;  2HD5 A;  3IUT A;  5CVO B;  2BDL A;  3CH3 X;  7PCK A;  2G6D A;  1F29 A;  1KHP A;  1BGO A;  4BS6 A;  5CVN B;  2GHU A;  4I07 A;  5J94 A;  1KXR A;  4CDD B;  2R9C A;  3D6S A;  4DMX A;  9PAP A;  2JQF R;  1AU3 A;  1CS8 A;  4QRX A;  1CB5 A;  2E03 A;  3AI8 A;  3CH2 X;  1YK7 A;  3KFQ A;  1BQI A;  2F7D A;  3E1Z B;  2VHS A;  5EGW A;  3H6S A;  3K9M A;  2YJB A;  4CDF B;  4YYR A;  5A24 A;  1YVB A;  3OVX A;  4QH6 A;  4MZS A;  2PAD A;  4W4U A;  5F02 A;  3H7D A;  4X6J A;  1ME4 A;  1STF E;  1POP A;  2NQA A;  3QT4 A;  1TLO A;  2G8E A;  4CDD A;  2FQ9 A;  3IHP A;  1IWD A;  2G7Y A;  1ME3 A;  2HH5 A;  2XU1 A;  3I3T A;  5EF4 A;  3MOR A;  2E02 A;  4RY2 A;  4MSX A;  3PW3 A;  3HHI A;  1EWL A;  4CZW A;  2GFO A;  3WXE A;  4QBB A;  4I05 A;  3V6E A;  1SNK A;  2DCB A;  4YYQ A;  1THE A;  3M99 A;  4P6G A;  3I06 A;  1QMY A;  1NL6 A;  2FO5 A;  3IV2 A;  1PAD A;  1K3B A;  2E01 A;  3KSE A;  4G54 A;  4N4Z A;  3BOW A;  4XR7 A;  4YYS A;  1MEM A;  1ZCM A;  4BSQ A;  2DCA A;  2DJF A;  2DJG B;  3BC3 A;  1F2C A;  5JH3 A;  3QJ3 A;  1PPO A;  3P5U A;  2AIM A;  4QRG A;  1KHQ A;  2DC8 A;  2H7J A;  1NLJ A;  1ICF A;  3HWN A;  3H8C A;  1F2B A;  4PAD A;  2XU4 A;  1PXV A;  2XU3 A;  4QRV A;  5CVM A;  1Y4H A;  2G8J A;  3RVV A;  4YYU A;  2DCC A;  4FJC A;  4PP2 E;  3K8U A;  2HHN A;  2Y6E A;  1VJV A;  2P0R A;  2ATO A;  4I04 A;  3BWK A;  1ATK A;  1DEU A;  3USV A;  3IEJ A;  3DF0 A;  2NQG A;  1PPD A;  2C0Y A;  1NB5 A;  3WXF A;  4X6H A;  1U9W A;  2DJG A;  1MDW A;  1PE6 A;  1MS6 A;  4AXL A;  3ERV A;  1QXP A;  2R6N A;  4WA6 A;  5K16 A;  1GCB A;  2P7U A;  4YV8 A;  1M6D A;  2ARY A;  1K3B B;  1S4V A;  4W5C A;  3P5X A;  3ZUA A;  3C9E A;  2IPP B;  4Q8G A;  1EWM A;  3KWZ A;  4FK5 A;  2DJF B;  4YYW A;  2PRE A;  3OVZ A;  3PBH A;  2AS8 A;  1U9V A;  2CB5 A;  3N3K A;  1TL9 A;  1NB3 A;  3F75 A;  2YJ9 A;  3QSD A;  4P6E A;  2DC7 A;  2E00 A;  2AYN A;  3O0U A;  2B1M A;  3KKU A;  3GCB A;  2F1G A;  1CSB B;  3H89 A;  1O0E A;  1EWO A;  4Q8H A;  4KLB A;  1MIR A;  2O6X A;  1CQD A;  2Y5B A;  4AXM A;  2HXZ A;  4HWY A;  2DCD A;  2DC6 A;  3RVX A;  3OF8 A;  3HD3 A;  2YJ8 A;  1F2A A;  3F5V A;  1MHW A;  1AU2 A;  3P5W A;  3PDF A;  4N8W A;  1A6R A;  2YJC A;  4FIP A;  1U5I A;  4CDE A;  2DC9 A;  3IMA A;  3U8E A;  1GLO A;  1AEC A;  5PAD A;  3MHH A;  3MHS A;  3BPF A;  1QDQ A;  1YK8 A;  4CDC A;  2FTD A;  4DMY A;  2P86 A;  1EWP A;  5CHT A;  2PBH A;  1ITO A;  4XUI A;  3BPM A;  1MEG A;  2OUL A;  4BS5 A;  1NQC A;  3PNR A;  1PIP A;  1CV8 A;  1CVZ A;  1TU6 A;  1NPZ A;  2WBF X;  1KFX L;  2AUZ A;  3S3R A;  1FH0 A;  3CBK A;  4PP1 A;  3RVW A;  1PCI A;  3LXS A;  4K7C A;  1U9Q X;  1Y08 A;  2VHF A;  3O1G A;  2IBI A;  1YAL A;  3OF9 A;  3P5V A; 
#chains in the Genus database with same CATH topology
 3T6L A;  3P24 A;  3PQS A;  2RTK A;  4XMD A;  2R9M A;  3MP2 A;  2Q9S A;  1HY2 A;  2BDZ A;  4BOP A;  1BRP A;  1MEP A;  1PBH A;  3ZUI A;  3BBA A;  2FE8 A;  1EII A;  5HA0 A;  1CBQ A;  2OY7 A;  1YZB A;  4YMY A;  2FKJ A;  3WZQ A;  2Q39 A;  2AU1 A;  1SLF B;  3DTQ A;  1AYW A;  3AKN A;  4GDA A;  1B0O A;  4OEL A;  4YH0 A;  5H9K A;  3K24 A;  1A2D A;  3B79 A;  2AMM X;  4FBR A;  3N91 A;  3NQ3 A;  5JD2 A;  2R9F A;  3BY0 A;  1DF3 A;  3SAO A;  1KOI A;  2AVW A;  1Z24 A;  3L4R A;  2LA7 A;  4CDF A;  2WUT A;  2BC3 A;  2NQD B;  2A2U A;  4TKH A;  2L5P A;  4REZ A;  3N4C A;  5HA1 A;  2PNS A;  1OBP A;  3ELZ A;  2R9N A;  2FRQ A;  3GAQ A;  1VSN A;  2JQG R;  1HXZ A;  4RF0 A;  1UYO X;  4KH8 A;  1AU0 A;  4MZO A;  1BY8 A;  4MIR A;  2Z4I A;  1NQM A;  4BPV A;  3KWB X;  5JA7 A;  3N3G A;  5IXG A;  5LJD A;  1SRG A;  2IZI A;  5CVO B;  4C5P A;  4DQ4 A;  1F29 A;  4FBO A;  3FW5 A;  1KFF A;  2FRS A;  3U03 A;  2RTF B;  4BX7 A;  2LBV A;  2FR2 A;  1I06 A;  5BVQ A;  1SLG B;  4A5U A;  2JQF R;  4CPH B;  9PAP A;  4BX6 A;  4LQZ A;  1CS8 A;  1SWR A;  2HKD A;  1EPB A;  4B55 A;  4ORS A;  1X71 A;  2VFB A;  2JRI A;  1RXJ A;  3CH2 X;  2F7D A;  3AKM A;  3FR2 A;  3VG7 A;  2OZQ A;  2F01 A;  3K9M A;  3RZY A;  1I04 A;  2C4I A;  3QQ2 A;  5HZQ A;  4ZHG A;  4TKJ A;  4A1H A;  3PHW A;  2WEW A;  1VWP B;  3B2H A;  2PAD A;  4MVE A;  1ICM A;  3H7D A;  4HFO A;  2NQA A;  1POP A;  1RAV A;  2X45 A;  4GU8 A;  4ORY A;  5KHP A;  4OS8 A;  5H8T A;  3AUM O;  1O8V A;  2G8E A;  5D8J A;  3D4R A;  5B5G A;  1LNM A;  3EC5 A;  4CPH A;  2G7Y A;  3FYF A;  1KL5 A;  4CV7 A;  4JO6 A;  4O4O A;  2L67 A;  4I05 A;  3V6E A;  3PP6 A;  3FEP A;  4ZHD A;  1SNK A;  3MX7 A;  4YYQ A;  2WQ9 A;  4LKP A;  1GKA A;  2W2B A;  2ZAG A;  4YGZ A;  4BQU A;  3B2J A;  2R74 A;  4P6G A;  5CHK A;  1NL6 A;  1PAD A;  2L9C A;  1KZW A;  1O1U A;  2RD7 C;  3ZQ3 A;  3BOW A;  3UEU A;  4IB9 A;  1IKJ A;  4BSQ A;  2DCA A;  2DJF A;  5KIC A;  3BC3 A;  1F2C A;  2FLJ A;  1SWE A;  1SWJ A;  4BX5 B;  3P5U A;  2Q2P A;  1LCZ A;  2DC8 A;  3HWN A;  3FEN A;  1LDO A;  2LKK A;  1F2B A;  4PAD A;  1VWF B;  3BRN A;  5F1E A;  3TGA A;  3SZJ A;  1GX8 A;  2HHN A;  1VJV A;  2P0R A;  1ATK A;  1SLE B;  2JU3 A;  3C78 X;  2KTS A;  1LUQ A;  2Z84 A;  2BSZ A;  2RCT A;  1WBI A;  1CBS A;  2C0Y A;  1OEK A;  4HXD B;  1RBP A;  5HTD A;  4CPI A;  1SWT A;  3C77 X;  4AXL A;  3WYP A;  1QXP A;  1E5P A;  2WSJ A;  2QOM A;  4O4U A;  5HBS A;  2R6N A;  1SMP I;  2P7U A;  1OEJ A;  3NX2 A;  2JOZ A;  2MJI A;  1S4V A;  4W5C A;  4IAX A;  5B5F A;  2AVI A;  4OW0 A;  3RDS A;  3ZUA A;  2IPP B;  2LBA A;  4NYR A;  1NP4 A;  3WJG A;  4Q8G A;  4YYW A;  1AB0 A;  3Q6L A;  2AS8 A;  1TL9 A;  1UYN X;  2YJ9 A;  4M7M A;  1GXA A;  3SLO A;  2AYN A;  1JZU A;  1SWQ A;  2B1M A;  3UEV A;  1Y55 X;  1AQB A;  2YMS A;  4BOQ A;  4A8Z A;  1MIR A;  2Z4H A;  4RUU A;  2BLG A;  4GH7 A;  1CQD A;  3V8U A;  1JMZ A;  4QYP A;  5KID A;  2Y5B A;  2OF9 A;  2HXZ A;  5LJB A;  1X8U A;  4HWY A;  1EUO A;  3K3L A;  4Z28 A;  2BTW B;  4D8I A;  2ASN X;  5B11 O;  3F5V A;  3RE5 A;  4N8W A;  1A6R A;  2F73 A;  1N4J A;  2YJC A;  1OBQ A;  2RQ0 A;  1JYD A;  1GLO A;  1LCV A;  5PAD A;  2O62 A;  3BPF A;  4BJ8 A;  2P86 A;  1BLR A;  3CKF A;  4Y59 A;  3VG6 A;  3BPM A;  3STK A;  1NDJ A;  3T2W A;  3PNR A;  2A5B A;  1KZX A;  4OVZ B;  1CV8 A;  1WUB A;  2NP1 A;  4AZR A;  1GT4 A;  1U17 A;  1NPZ A;  5FAZ A;  4MVK A;  2C1Q A;  1VWG B;  4DCB A;  1ZRY A;  1U9Q X;  3O1G A;  4EDE A;  2IBI A;  2RN4 A;  2ZSC A;  4YFP A;  4IMO A;  1G5W A;  1GT5 A;  1MX7 A;  2JTC A;  1ZNE A;  4NW4 A;  5K67 A;  2R73 A;  5K68 A;  4M6S A;  3BX7 A;  2RTQ B;  3ZW0 A;  1VWD B;  4D6B A;  4PT5 A;  2DM5 A;  4NNT A;  3WBG A;  1NP1 A;  1BWY A;  4OVZ A;  3KFH A;  3NQ9 A;  2HYS A;  1SY1 A;  1VWC B;  3WOV A;  4PJ2 A;  4YGH A;  4NLI A;  1A18 A;  1BSQ A;  2P8G A;  1DF0 A;  1VYG A;  2GH7 A;  2NNQ A;  3V6C A;  4CDC B;  3HWG A;  5L8O A;  5LJC A;  3PQU A;  1GMY A;  3JS1 A;  1U18 A;  2AT6 X;  3VG5 A;  3OIS A;  4IAW A;  3HTY A;  1ZNH A;  4TQ2 A;  4OEM A;  1RXK A;  1PPP A;  4NP1 A;  1SWH A;  2FWV A;  5F7G A;  4AZP A;  3LFY A;  5FPW A;  1X8N A;  5L8I A;  1XKG A;  2AT5 X;  1GEC E;  2ZAI A;  1KQX A;  2XKL A;  3S3Q A;  3FW4 A;  3SOT A;  2XU5 A;  1CTE A;  3O19 A;  3RDQ A;  5B2A O;  4MVI A;  1S2P A;  1HQQ A;  4IUM A;  4U8U M;  4BQV A;  4ES7 A;  3CWK A;  1N43 A;  5F58 A;  1SRJ A;  2WR6 A;  5CHV A;  1SP4 B;  1SWP A;  2GTL O;  1AYV A;  2AYO A;  4ARH A;  3ZNH A;  1QY1 A;  1Q6K A;  2OZ2 A;  4GD9 A;  1SWO A;  3FMZ A;  2WWP A;  5HCE C;  2OY8 A;  2DZZ A;  1E2T A;  1DZJ A;  5H9N A;  4OS3 A;  3TZS A;  3MBT A;  2IZG B;  3CH3 X;  2G6D A;  7PCK A;  1MDC A;  3IFU A;  1SWC A;  1KHP A;  1BGO A;  3WJB A;  4BS6 A;  3PEC A;  2RTO B;  4ZGF A;  4ORU A;  2A3F X;  1VWB B;  3BDR A;  5J94 A;  1MX8 A;  2A8G A;  2YG2 A;  2R9C A;  2RTG B;  3UAQ A;  1D2U A;  5AJC A;  3EBW A;  1YP7 A;  1UZ2 X;  4QRX A;  3SZH A;  5CYB A;  3CQR A;  4ZR2 A;  1EIO A;  2BS5 A;  2RTN B;  4O4X A;  4AZQ A;  3KFQ A;  3HWD A;  3KVN A;  4A60 A;  1GM6 A;  5EED A;  1JBH A;  1DF8 A;  5DG4 A;  3H6S A;  1SA8 A;  2YJB A;  4CDF B;  4PSQ A;  3EMM A;  2OYB O;  1LEL A;  3STN A;  2UYW A;  4GRJ A;  2KTD A;  4GE1 A;  2HWK A;  1STF E;  3VE1 A;  3S5V A;  3RSW A;  3E9S A;  2FHN X;  3QT4 A;  5CE4 A;  5AQ6 A;  5EZS A;  1CBR A;  1KGL A;  1DZM A;  2E4J A;  2C1S A;  4TLJ A;  2FQ9 A;  2CZU A;  4AYH A;  3IHP A;  1YWC A;  3C0R A;  4CK4 A;  3RWX A;  1ME3 A;  3VPJ E;  4BBO A;  2XU1 A;  3GE2 A;  1MVG A;  3I3T A;  4A1Y A;  1PBY A;  4Z6J A;  5EF4 A;  2E02 A;  4RY2 A;  1DKI A;  4MSX A;  1SXW A;  1STS B;  3AEH A;  3PW3 A;  3HHI A;  5EDB A;  2OFB A;  4L1N A;  2A13 A;  4U9C A;  4IP3 A;  3WXQ A;  5FQ7 E;  1JJX A;  2R56 A;  1UKF A;  4LZU A;  4BOS A;  4BX7 B;  2POA A;  1GT3 A;  1THE A;  1GX3 A;  3MJ5 A;  4OMW A;  4BX6 B;  3I06 A;  3RDM A;  1QMY A;  1RST B;  1VWQ B;  1FEM A;  2MM3 A;  4G54 A;  1SXU A;  4GZV A;  1X89 A;  4EXZ A;  1QFT A;  2DJG B;  5JH3 A;  4I95 A;  2X8F A;  5LKE A;  4O49 A;  2M4L A;  1KHQ A;  5IRA A;  4TNN A;  5D48 A;  1ICF A;  5CVM A;  1B8E A;  1LID A;  1Y4H A;  4DQ3 A;  4YYU A;  2DCC A;  4WUR A;  2J7Q C;  4PP2 E;  1SY0 A;  1SXY A;  4HPD A;  4IAB A;  2GTL N;  4GNY A;  4I60 A;  3G7X A;  4QZU A;  2CBR A;  4O3W A;  3H3I A;  1BEB A;  4X6H A;  3NR3 A;  2DJG A;  4KC8 A;  1MDW A;  3ERV A;  1VPR A;  1GKA B;  3OQC A;  3ZI8 A;  4YFQ A;  3PH6 A;  5K16 A;  5EPQ A;  2RTA A;  3CBC A;  2IFB A;  1B4M A;  1OEE A;  3PSE A;  3TGB A;  4Y5D A;  2WPU A;  5FQ6 E;  1YUP A;  2DJF B;  1PM1 X;  2CZT A;  2PRE A;  4I9S A;  2AT3 X;  2CB5 A;  1BSO A;  1VYF A;  2FGS A;  4ZCB A;  1W4T A;  1X8Q A;  1EQD A;  1NQN A;  3RDO A;  1X8P A;  3KQ0 A;  3QSD A;  1IKE A;  2DC7 A;  3O0U A;  2IZC B;  2RTH B;  3SLJ A;  4ORW A;  5EZ2 A;  2X46 A;  4GUA A;  3HPE A;  1CSB B;  3H89 A;  4O3X B;  3P6E A;  3SZI A;  4QZT A;  3ELX A;  3F6Z B;  1O0E A;  2QOS C;  4YCE A;  4Q8H A;  1VWA B;  4COT A;  1O1V A;  4HPA A;  2DCD A;  5IRW A;  3LV4 A;  3PDF A;  5IRU A;  4XME A;  1U5I A;  4CDE A;  2AH7 X;  5B3M O;  3BU9 A;  3MHH A;  3HK1 A;  2OFA A;  2OY1 O;  1VWN B;  3MTV A;  4WFU A;  1T68 X;  2BHV A;  3P6C A;  2PBH A;  1BJ7 A;  1ITO A;  2IZJ A;  2OUL A;  1NQC A;  2QO4 A;  1TU6 A;  2JGS A;  4IRW A;  1S7D A;  3S3R A;  1FH0 A;  3CBK A;  4PP1 A;  1L6M A;  1PCI A;  3LXS A;  1Y08 A;  2IZA A;  2VHF A;  1QAB E;  4O3Z A;  5LJG A;  2FKG A;  1N9Y A;  2RTJ A;  3OF9 A;  4AW8 A;  2QCB A;  3NPO A;  1AYU A;  1EPA A;  2QO5 A;  3OD9 A;  2IZE B;  1GT1 A;  3P6F A;  4YDA A;  1SWB A;  1BRQ A;  4O4S A;  1E02 A;  4M0W A;  4NYQ A;  1AVG I;  3W30 A;  2CM4 A;  2X56 A;  3VHM A;  1QOL A;  2AUX A;  4KC7 A;  3TNX A;  2PY1 A;  4XMC A;  2OL6 O;  2RA6 A;  3QKG A;  3NHE A;  4N79 A;  3C76 X;  5AJB A;  5H9L A;  1MUP A;  3RNV A;  4QGX A;  1EAL A;  2FYE A;  5L8N A;  4YGG A;  1HUC B;  1PBO A;  3D97 A;  2RTE B;  4N7D A;  3CR6 A;  1SRF A;  4ALB A;  5F2B A;  3BY4 A;  1KFU L;  4CSB A;  2IZB A;  2YJ2 A;  5DPQ A;  2HZQ A;  1X8O A;  3RE6 A;  1U9X A;  1BP4 A;  1X9Y A;  3HHA A;  3MTN A;  1VWK B;  1AIM A;  3CBS A;  2RTM A;  3FLL A;  2CIO A;  4GKC A;  5K06 A;  4MI7 A;  3X00 A;  1OBU A;  1EF7 A;  1LIE A;  2NND A;  1D3S A;  4U3Q A;  2N93 A;  3EW1 A;  1NBX A;  1EW3 A;  1FTP A;  1ZIV A;  1GX9 A;  1LF7 A;  4GJV A;  3ZW0 B;  4W5B A;  2Y3E A;  1A57 A;  3WXG A;  4D8E A;  4ZHF A;  4RNA A;  1FJ1 E;  3CQN A;  3KW9 A;  1NC9 A;  1CPJ A;  3BU1 A;  2HNX A;  2FT2 A;  2OP3 A;  4QNI A;  2HD5 A;  2W2A A;  3ZZV A;  4MEE A;  4YCH A;  3IUT A;  2BDL A;  4INN A;  4YFR A;  4MM3 B;  1U0X A;  4GGR A;  1ML7 A;  5CVN B;  2GHU A;  4I07 A;  3KZA A;  2GJ5 A;  3S60 A;  1CRB A;  4CDD B;  1ZNG A;  1QWD A;  4DMX A;  3O65 A;  1AU3 A;  3HOE A;  1YWB A;  1KT5 A;  4UU2 A;  1SY2 A;  2AL0 X;  3FR5 A;  4YBP A;  1CB5 A;  2E03 A;  4RKX A;  1IFC A;  1QQS A;  3E1Z B;  2FTB A;  5HZ8 A;  2VHS A;  1JJU A;  4YYR A;  2G8C O;  3PK2 A;  3WJC A;  3OJY C;  3OVX A;  3B2I A;  2IZK A;  3MM0 A;  4ML7 B;  4MZS A;  3VG3 A;  2RTB B;  4W4U A;  4X6J A;  1ME4 A;  4O3Y A;  1TLO A;  2J7Q A;  3PED A;  4CDD A;  2RTD B;  1IWD A;  4N7C A;  3BB7 A;  5FQ8 E;  2HH5 A;  3FID A;  1EXS A;  3VG4 A;  4BOE A;  2IZH B;  1ERB A;  1VWJ B;  2QO6 A;  1IJ8 A;  1EWL A;  4CZW A;  1HMR A;  3WXE A;  4QBB A;  1KL4 A;  4Z2P A;  1CJ5 A;  4O9S A;  5D47 A;  2K62 A;  2VFC A;  1G85 A;  1HBP A;  3T6F A;  1IIU A;  3WJF A;  2A0A A;  3WZN A;  3PPT A;  2FO5 A;  3UEW A;  3IV2 A;  1K3B A;  4XMF A;  2I5V O;  4U46 A;  4GJS A;  2IZD B;  3CKG A;  3P02 A;  1ZNK A;  4YYS A;  3VU1 A;  3ZW1 A;  1DZK A;  4HPB A;  1JIW I;  2KW1 A;  3PHX A;  3FA9 A;  4YKO A;  3QJ3 A;  3HWF A;  2AIM A;  5BYP A;  1NLJ A;  2G79 A;  2GTF X;  2AT8 X;  3Q34 A;  3H8C A;  3FA7 A;  2XU3 A;  4HWM A;  4AZO A;  1S44 A;  4IB8 A;  2UZJ A;  3RVV A;  5IO7 A;  4EFG A;  1SWF A;  4L3R A;  3DSZ A;  3OE3 A;  3PRM A;  3K8U A;  1Y53 X;  1KQW A;  3D96 A;  2Y6E A;  2MHD A;  1LCW A;  3BLG A;  1FDQ A;  1KXO A;  3RKG A;  3BX8 A;  4I04 A;  4ODD A;  3WJD A;  1DZP A;  1DEU A;  3USV A;  3IEJ A;  1LIF A;  5KO3 A;  3RY2 A;  2G78 A;  3NAD A;  3OBL A;  1KT7 A;  1Y9L A;  1PE6 A;  2AF5 A;  1MS6 A;  4U8U O;  2IZF B;  3KFI A;  2HMB A;  2XST A;  5EEE A;  2CBS A;  3B21 A;  3STM X;  4D6A A;  2CM9 A;  3APV A;  1VWE B;  4RF1 A;  1E06 A;  3EW2 A;  4KCA A;  3KWZ A;  1URE A;  3PBH A;  2PI3 O;  3FR4 A;  1DC9 A;  4OKA A;  1U9V A;  3N3K A;  1MOY A;  4QGV A;  2OVS A;  4I3D A;  4Y0P A;  1JYJ A;  4P6E A;  5AEO A;  2E00 A;  4GET A;  2RTR B;  2A5C A;  3KKU A;  3WZP A;  1PTS A;  1FEL A;  2JN3 A;  2MO5 A;  4QQ1 A;  2Y3F A;  1KL3 A;  3JQO A;  4Y0R A;  4KLB A;  2HLV A;  4CPF A;  2MF6 A;  2I5Z O;  4EQA C;  1SWD A;  4AXM A;  1K24 A;  3LHN A;  2DC6 A;  3RVX A;  3OF8 A;  3HD3 A;  1W5R A;  2X8S A;  2Y32 A;  2YJ8 A;  2UZ2 A;  4NLJ A;  2OF8 A;  1I9H A;  3P5W A;  2ACO A;  1SRI A;  1YWD A;  3MG5 A;  3VHH A;  3NBX X;  4P16 A;  1ERX A;  3U8E A;  1AEC A;  3I17 A;  3MHS A;  1BSY A;  1QDQ A;  1YK8 A;  3SLT A;  3F9D A;  3IFB A;  1YP6 A;  1YWA A;  4ZTB A;  1PEE A;  4DMY A;  1EWP A;  4LZV A;  1MEG A;  4TJZ A;  3IA8 A;  4BS5 A;  1SWN A;  4YKM A;  4HPC A;  4BGF A;  4Y0S A;  1SWL A;  1QY2 A;  1VWR B;  2OL7 A;  3FEL A;  3MVF A;  5FEN A;  3RVW A;  2G5L A;  4FGI B;  3VE2 A;  2OFR X;  4K7C A;  4ZHH A;  4YVB A;  2Q2M A;  1XKI A;  5JZE A;  1YAL A;  4IMN A;  3P5V A;  2L68 A;  4X6I A;  1KT6 A;  4ZHC A;  1A3Y A;  1ADL A;  5H9A A;  1SRE A;  4PI3 A;  5F6B A;  3FIQ A;  4YVA A;  8PCH A;  4ZUX U;  2LB6 A;  3KX1 A;  3ZWE A;  3IOQ A;  1GGL A;  1TW4 A;  3RDU A;  2DOS A;  1SY3 A;  3PH5 A;  4CDE B;  2VDF A;  2FRA A;  1HQP A;  1TVQ A;  1HMT A;  2AGA A;  2KT4 B;  3S5X A;  1JQP A;  4I9R A;  4U8U N;  5B29 A;  6PAD A;  1I4U A;  1Y0G A;  3FDC A;  3KFG A;  3FA8 A;  3RDX A;  4ZFX A;  4Z2V A;  4I3C A;  1OSP O;  1NGL A;  3TF6 A;  1HBQ A;  3BSZ E;  1HMS A;  2RTI B;  1PPN A;  2Q4N A;  1VWL B;  1Y9T A;  1CJL A;  3O22 A;  3H8B A;  2DZY A;  1YT7 A;  3NX1 A;  4JHQ A;  1SWK A;  1T8V A;  4BOZ A;  4YYV A;  1STP A;  3CBJ A;  4KII A;  2QM9 A;  4ON1 A;  2RTC B;  2NNE A;  2FT9 A;  1ZND A;  3B2L A;  2R9O A;  2FUD A;  3PHU A;  5CSE A;  4JNJ A;  5F6Z A;  2ACT A;  4YBU A;  1TOU A;  2X8T A;  1OPA A;  5BVT A;  5L3Y A;  4NNS A;  3F8A A;  4GK9 A;  3BCN A;  1KT3 A;  2B1N A;  3FEK A;  3I0A A;  1PMP A;  3BS2 A;  4XMH A;  1QG5 A;  4OS0 A;  2NQI A;  1W6F A;  3RBY A;  4ZGU A;  1AU4 A;  4ZH9 A;  4OMX A;  1MK5 A;  1LDQ A;  5HZ6 A;  2A2G A;  3D95 A;  3D9W A;  4QRL A;  3S26 A;  1KXR A;  2OY5 O;  1IW2 A;  2OFM X;  2FR3 A;  3D6S A;  1STR B;  1VWO B;  5HAE A;  4UU3 A;  1EI5 A;  3APX A;  4D8B A;  2K23 A;  4TKB A;  3AI8 A;  1TOW A;  3ZUO A;  1YK7 A;  2BU3 A;  1BQI A;  1QFV A;  3FA6 A;  2GC9 A;  3VG2 A;  4ZJ0 A;  1JJJ A;  5EGW A;  5LKF A;  4BCS A;  5A24 A;  4BX5 A;  1TXL A;  1I05 A;  5LJH A;  1YVB A;  3E3C A;  3TRK A;  4QH6 A;  1N7Y A;  5F02 A;  5IO6 A;  4K19 A;  4JGL A;  2BT9 A;  4DNE A;  4I3B A;  2EU7 X;  1BBP A;  1OPB A;  3EYC A;  4ORX A;  4EEJ A;  1RXH A;  4NV7 A;  2OVA A;  2G7B A;  1ZNL A;  5D45 A;  1LPJ A;  3MOR A;  5HWZ A;  1LIC A;  1N9M A;  5B10 O;  2LFO A;  3WZO A;  2GFO A;  5FFH A;  2X55 A;  3CMP A;  1R0U A;  1SWA A;  4Z27 A;  3NP1 A;  3JSQ A;  2DCB A;  1E00 A;  2JMB A;  1DV9 A;  5JR8 A;  3VGW A;  3HWE A;  4GNW A;  3M99 A;  1VYO A;  4QYN A;  1SWU A;  1VWM B;  4ALO A;  1QY0 A;  1LIB A;  2E01 A;  3KSE A;  4FQB B;  4WFV A;  3WVM A;  1N0S A;  4N4Z A;  1RSU B;  4XR7 A;  1MEM A;  1LKE A;  2OVE A;  2AT0 X;  5IO5 A;  1ZCM A;  1T0V A;  4I6S A;  3O2Y A;  1JMX A;  4ORR A;  1PPO A;  4QAE A;  4IB7 A;  4AZN A;  4QRG A;  5HCD C;  1KT4 A;  1SWS A;  2H7J A;  1G74 A;  4R3D A;  2XU4 A;  1PXV A;  4QRV A;  2MWH A;  2FS6 A;  2G8J A;  4FJC A;  4EKV A;  2ACP X;  5B27 A;  1AVD A;  3EM0 A;  1ACD A;  3U9P C;  4KT5 A;  1H91 A;  2ATO A;  2FS7 A;  1JV4 A;  3KFF A;  3U0D A;  2X4M A;  3BWK A;  5HZ5 A;  3T2X A;  5BVS A;  3P6H A;  2BTW A;  3LTW A;  4BOU A;  4Y0Q A;  2ALL X;  3DF0 A;  5D4A A;  4AZM A;  2NQG A;  1PPD A;  1NB5 A;  1XCA A;  2RTL A;  4BVM A;  2CAM A;  3WXF A;  4MVL A;  3EBK A;  1LFO A;  1U9W A;  3UEX A;  1RLB E;  1MM9 A;  4GDZ A;  1SXX A;  1DFV A;  4IBA A;  3RY1 A;  5LJE A;  4NV8 A;  4WA6 A;  5E6J A;  1SLD B;  1GCB A;  1FEN A;  5LJK A;  4YV8 A;  1M6D A;  2AKQ A;  2ARY A;  1K3B B;  3VHI A;  2JU7 A;  3P5X A;  3WJE A;  2WQA E;  3C9E A;  3ZW1 B;  2WEX A;  1HXL A;  1EWM A;  2F09 A;  1CBI A;  4ZH6 A;  4WBK A;  3P6D A;  5HCC C;  3TGC A;  4FK5 A;  4QGW A;  4GUZ A;  4CPE A;  3HOL A;  3OVZ A;  1B56 A;  4Z2O A;  3B2K A;  4XMG A;  2OVD A;  1I78 A;  1AEL A;  2GTL M;  1NB3 A;  3F75 A;  2BS6 A;  4LKT A;  1IFB A;  4IB6 A;  3NQK A;  4FBV A;  1SRH A;  2IZL B;  3GCB A;  2F1G A;  1ALB A;  1EWO A;  3TMP A;  2QMI A;  3T1D A;  3W31 A;  3APU A;  2RTP B;  2FHL A;  2O6X A;  3ZW2 A;  4ID2 A;  1Y52 X;  1ICN A;  4GGT A;  2JW1 A;  1F2A A;  1MHW A;  1AU2 A;  5EDC A;  4FIP A;  2JU8 A;  1G7N A;  1HN2 A;  2DC9 A;  3IMA A;  2ANS A;  2RCQ A;  1BM5 A;  3APW A;  1SWG A;  3PRP A;  1P6P A;  4RUN A;  2X32 A;  4WHI A;  2FTD A;  4CDC A;  3P6G A;  1YIV A;  1PVJ A;  2X34 A;  1AVE A;  5CHT A;  1VWI B;  4XUI A;  1VWH B;  5EZQ A;  1PIP A;  5C0N A;  1CVZ A;  4MIS A;  2WBF X;  1KFX L;  5HZ9 A;  2AUZ A;  5HTE A;  3PT2 A;  3WYQ A;  2KD2 A;  1FE3 A;  4XZX A;  2OL8 O;  4R0B A;  4GGZ A;  4YDB A;  2HZR A;  2W2F A; 
#chains in the Genus database with same CATH homology
 4X6I A;  1AYU A;  4PI3 A;  4YVA A;  8PCH A;  4ZUX U;  2R9M A;  3KX1 A;  3IOQ A;  2BDZ A;  1QOL A;  4CDE B;  2AUX A;  3TNX A;  2FRA A;  1DF0 A;  1PBH A;  3NHE A;  4N79 A;  3V6C A;  4CDC B;  1JQP A;  1GMY A;  2FYE A;  6PAD A;  1HUC B;  3OIS A;  2AU1 A;  4OEM A;  1PPP A;  1AYW A;  1KFU L;  2YJ2 A;  4OEL A;  3LFY A;  1PPN A;  1U9X A;  5FPW A;  3K24 A;  1BP4 A;  1X9Y A;  3HHA A;  3B79 A;  1CJL A;  2R9F A;  1XKG A;  3H8B A;  2DZY A;  1YT7 A;  3MTN A;  1AIM A;  1GEC E;  2AVW A;  4CDF A;  4YYV A;  2NQD B;  2CIO A;  3CBJ A;  3S3Q A;  3N4C A;  2XU5 A;  2PNS A;  1CTE A;  1EF7 A;  2R9O A;  2FUD A;  4BQV A;  1ZIV A;  2R9N A;  2FRQ A;  2ACT A;  1VSN A;  2JQG R;  5CHV A;  1SP4 B;  4W5B A;  1AYV A;  2AYO A;  1AU0 A;  3WXG A;  4MZO A;  1BY8 A;  1Q6K A;  3BCN A;  2OZ2 A;  3KW9 A;  1CPJ A;  2B1N A;  2FT2 A;  2OP3 A;  4BPV A;  3KWB X;  2NQI A;  1W6F A;  1AU4 A;  2DZZ A;  5JA7 A;  3N3G A;  2HD5 A;  1E2T A;  3IUT A;  5CVO B;  4C5P A;  2BDL A;  3CH3 X;  7PCK A;  2G6D A;  1F29 A;  1KHP A;  1BGO A;  4BS6 A;  5CVN B;  2GHU A;  4I07 A;  3D9W A;  5J94 A;  1KXR A;  4CDD B;  2R9C A;  3D6S A;  4DMX A;  9PAP A;  2JQF R;  1AU3 A;  1CS8 A;  4B55 A;  4QRX A;  2VFB A;  1CB5 A;  2E03 A;  3AI8 A;  3CH2 X;  1YK7 A;  3KFQ A;  1BQI A;  2F7D A;  3E1Z B;  2VHS A;  5EGW A;  3H6S A;  3K9M A;  2YJB A;  4CDF B;  4YYR A;  5A24 A;  1YVB A;  3OVX A;  4QH6 A;  4MZS A;  2PAD A;  4W4U A;  5F02 A;  3H7D A;  4X6J A;  1ME4 A;  1STF E;  1POP A;  2NQA A;  3QT4 A;  1TLO A;  2G8E A;  4CDD A;  2FQ9 A;  3IHP A;  1IWD A;  4NV7 A;  2G7Y A;  1ME3 A;  2HH5 A;  2XU1 A;  3I3T A;  5EF4 A;  3MOR A;  2E02 A;  4RY2 A;  4MSX A;  3PW3 A;  3HHI A;  1EWL A;  4CZW A;  2GFO A;  3WXE A;  4QBB A;  4I05 A;  3V6E A;  1SNK A;  2DCB A;  4YYQ A;  2VFC A;  1THE A;  1GX3 A;  3M99 A;  4P6G A;  3I06 A;  1QMY A;  1NL6 A;  2FO5 A;  3IV2 A;  1PAD A;  1K3B A;  2E01 A;  3KSE A;  4G54 A;  4N4Z A;  3BOW A;  4XR7 A;  4YYS A;  1MEM A;  1ZCM A;  4BSQ A;  2DCA A;  2DJF A;  2DJG B;  3BC3 A;  1F2C A;  5JH3 A;  3QJ3 A;  1PPO A;  3P5U A;  2AIM A;  4QRG A;  1KHQ A;  2DC8 A;  2H7J A;  1NLJ A;  1ICF A;  3HWN A;  3H8C A;  1F2B A;  4PAD A;  2XU4 A;  1PXV A;  2XU3 A;  4QRV A;  5CVM A;  1Y4H A;  2G8J A;  3RVV A;  4YYU A;  2DCC A;  4FJC A;  4PP2 E;  3K8U A;  2HHN A;  2Y6E A;  1VJV A;  2P0R A;  2ATO A;  4I04 A;  3BWK A;  1ATK A;  1DEU A;  3USV A;  2BSZ A;  3LTW A;  3IEJ A;  3DF0 A;  2NQG A;  1PPD A;  2C0Y A;  1NB5 A;  3WXF A;  4X6H A;  1U9W A;  2DJG A;  1MDW A;  1PE6 A;  1MS6 A;  4AXL A;  3ERV A;  1QXP A;  2R6N A;  4NV8 A;  4WA6 A;  5K16 A;  1GCB A;  2P7U A;  4YV8 A;  1M6D A;  2ARY A;  1K3B B;  1S4V A;  4W5C A;  3P5X A;  3ZUA A;  3C9E A;  2IPP B;  4Q8G A;  1EWM A;  3KWZ A;  4FK5 A;  2DJF B;  4GUZ A;  4YYW A;  2PRE A;  3OVZ A;  3PBH A;  2AS8 A;  1U9V A;  2CB5 A;  3N3K A;  1TL9 A;  1NB3 A;  3F75 A;  2YJ9 A;  1W4T A;  3QSD A;  4P6E A;  2DC7 A;  2E00 A;  2AYN A;  3O0U A;  2B1M A;  3KKU A;  3GCB A;  2F1G A;  1CSB B;  3H89 A;  1O0E A;  1EWO A;  4Q8H A;  4KLB A;  1MIR A;  2O6X A;  1CQD A;  2Y5B A;  4AXM A;  2HXZ A;  4HWY A;  2DCD A;  2DC6 A;  3RVX A;  3OF8 A;  3HD3 A;  1W5R A;  2YJ8 A;  1F2A A;  3F5V A;  1MHW A;  1AU2 A;  3P5W A;  3PDF A;  4N8W A;  1A6R A;  2YJC A;  4FIP A;  1U5I A;  4CDE A;  2DC9 A;  3IMA A;  3U8E A;  1GLO A;  1AEC A;  5PAD A;  3MHH A;  3MHS A;  3BPF A;  1QDQ A;  1YK8 A;  4CDC A;  2FTD A;  4DMY A;  2P86 A;  1EWP A;  5CHT A;  2PBH A;  1ITO A;  4XUI A;  3BPM A;  1MEG A;  2OUL A;  4BS5 A;  1NQC A;  3PNR A;  1PIP A;  1CV8 A;  1CVZ A;  1TU6 A;  1NPZ A;  4BGF A;  2WBF X;  1KFX L;  2AUZ A;  3S3R A;  1FH0 A;  3CBK A;  4PP1 A;  3RVW A;  1PCI A;  3LXS A;  4K7C A;  1U9Q X;  1Y08 A;  2VHF A;  3O1G A;  2IBI A;  1YAL A;  3OF9 A;  3P5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...