1JQVA

The k213e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPEDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase A
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqvA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqvA01
3S5YA 4QSHA 3W7GA 3I65A 3Q37A 4DO5A 4JTTA 4NJGA 5FESA 3TDFA 1JJKA 1FDJA 5EPDA 3LRKA 3QFEA 1FUYA 1LTDA 3L68A 4QIUA 5DY3A 5G2HA 4O17A 1RD5A 2P10A 2E1DA 5KMYA 1L6YA 3LI0A 5K9XA 4YCOA 1NSJA 3RNDA 3LCIA 2J27A 3P67A 5CZ0A 5G1YA 2ISSA 1I8JA 2VENA 4Y8FA 4K7VA 3B05A 5CSRA 1M5WA 4ML9A 4S2CA 5LNSA 1DL3A 1GZGA 4A21A 4MKNA 4NX0A 3OG3A 3LBMA 4LW7A 4GBUA 4LS2A 2C19A 3IIXA 2GUUA 4JTEA 1KFCA 1L6WA 4JIQA 1WA3A 4M6VA 3P81A 1Q6LA 3BARA 4O11A 1KM5A 1JUKA 3TSDA 3WFAA 3W85A 4A2SA 5F4WA 1LBFA 3G8RA 4OGZA 2QCCA 1KM3A 4I9AA 5AYZA 4OT7A 4A29A 4RJEA 4RLIA 3QF0A 1F05A 2ZZ7A 3NM3A 3UPBA 5IBXC 1O60A 1RQHA 2Z6IA 3M5YA 1RVGA 3PUOA 4MZ1A 4GUGA 2ABAA 3ABQA 3DZ1A 2EPHA 3P61A 4O52A 2X1UA 4MJZA 4UTTC 1GVOA 4C1KA 2DZSA 4RZ4A 1IF2A 1T99A 3TU9A 1D3GA 3HBLA 3PS7A 1CX9A 1N8FA 3EWBX 1MO0A 5FI8A 1TIMA 3KRUA 1J4EA 2NX3A 3NR0A 4A2RA 4HNVA 2RDWA 3QQ0A 4RK8A 3W7RA 3M1ZA 4ZQMA 2FFCA 3GAKA 4EF9A 3OEXA 5DBUA 1VR6A 3G1YA 1Q6QA 3LRLA 3G3MA 3DFSA 2BWGA 1VGAA 2CW6A 1QO5A 1W5QA 3IRDA 2A21A 1PHWA 4OBTA 1OJXA 3OVRA 5G2IA 2YPIA 3KVKA 2R8WA 1XI3A 4HNNA 4X9SA 4IMEA 4UTUA 4MLRA 3EX4A 2ZDRA 3FYOA 4PL2A 1Q45A 3WK2A 4YWIA 3CC1A 3B8DA 3OA3A 3W1AA 4JY9A 2ZA2A 3M5VA 3QRHA 3UY7A 5C55A 4MY9A 3ELFA 4AAJA 1L6SA 3UZJA 1G67A 4JR5A 3S1VA 3C0JA 3KRZA 2ZRUA 2VEKA 1JULA 1GYNA 4JD4A 2C6QA 1UJPA 1JCLA 5CPOA 4IGHA 2B0MA 2I14A 3DFNA 3NQAA 5EY5A 3W7OA 2PE4A 3N14A 2H90A 2Q3RA 3GLCA 3MHGA 5CPLA 4FXSA 5F2MA 1VPXA 1AW1A 3ABSA 4NU7A 3IGUA 4UMCA 1QMLA 3SZ8A 3N2MA 3MMTA 2OZ0A 2VELA 5LNVA 2ZRVA 1AL7A 1R2RA 3TJLA 4O54A 1W3NA 2ZRZA 4LC6A 4FX6M 4MPQA 1S5WA 4BR1A 3UXAA 2E6FA 4DF1A 1DJQA 4PCFA 4JEQA 1IXQA 3DAQA 4P2VA 5I3IA 4PH6A 4FNPA 2D73A 4WZHA 4WY0F 2V81A 2B7NA 1KM0A 4CNNA 1XBZA 3TE9A 2ZYFA 3PULA 4HN4A 5KZMA 5FF4A 3R5EA 2CU0A 3TJXA 2ZRXA 3C2RA 2YDAA 3DKJA 3T44A 4R7JA 2E6DA 1KV8A 3MW7A 4KFNA 3DENA 3NXFA 2ISWA 2ZZ6A 4FO4A 5LNUA 1VHNA 1MEIA 2Y63A 2JKPA 3MHUA 1MXSA 2JGQA 1XM3A 3S9YA 1EPXA 1H50A 1OX4B 4UTHA 3G1VA 2CLFA 4ZL1A 2GVLA 2FTPA 4X3ZA 3TW7A 1OVDA 4JTKA 3LI1A 5CZSA 2FB3A 1H7PA 2C15A 3W23A 2B7QA 3G1FA 1RPXA 3L0NA 1H7XA 3P8JA 4JICA 4LUIA 3TK7A 3O05A 3TKFA 4UUIA 4LOCA 1DJNA 2YZRA 4BWLA 1I2RA 2VFDA 2DJLA 2E68A 1LRQA 5DLCA 5LZLA 4NNBA 5F4XA 1QOQA 4MY8A 5CPNA 4WX2A 3NA8A 4XZ9A 3HPXA 2NX9A 3DFTA 5BOOA 4XKYB 3WJZA 3ABOA 1GJPA 1JRCA 1VZWA 4YXGA 2A5HA 1B4EA 2DZTA 4N6FA 4K8HA 4EIVA 3O1NA 3N9RA 1VS1A 2RKXA 3EWWA 1LBMA 1OFRA 3UWWA 1W5OA 1VJIA 3CEUA 3W7DA 4NZFA 4QQ3A 1I2OA 3C61A 2DU2A 3UPWA 1O5KA 4PEKA 1X8FA 3E02A 3VFLA 4LTSA 3G22A 1FDYA 3D0CA 1XXXA 4YMZA 1QR7A 2FDSA 3HPSA 5FF3A 2KZHA 4R33A 1Q6OA 1A53A 3ATZA 1OFPA 4TR9A 1R2SA 1EP3A 3VI2A 2LLEA 3PBYA 2ZA1A 1B9BA 1TPUA 3EXTA 2VEPA 3L0KA 3LERA 4OWGA 3S1WA 3CIWA 2H8ZA 4A22A 1VYSX 5D2VA 1Q3NA 1MEWA 2J9ZA 3QMRA 4FIRA 3NGJA 2NWSA 3S5ZA 1E51A 2XFWA 3R2GA 2VC6A 1SUXA 2E5CA 2CLHA 3UY8A 3GNNA 4O8RA 1TQXA 2HS8A 3LRMA 3NL5A 4JGDA 4TO8A 3TC7A 1V7YA 4POCA 1BWKA 5HNRA 1YTDA 1UUOA 1ADOA 3EWYA 5HWNA 2V0TA 3QM3A 2H3DA 3MBFA 1PS9A 3DHDA 4AMAA 2EGZA 2YR1A 1OF6A 4LRTA 4CCEA 5DCDA 3EKZA 1TPDA 1H1YA 4EF8A 3M7WA 2Z2UA 4JTIA 4RX0A 1HUVA 3M9YA 5F1VA 1ZFJA 1JUEA 5K2ZA 4LRSA 5AHMA 2Q8ZA 2QJHA 1H62A 3PY2A 1LOQA 3PB2A 1TTPA 1W31A 3TMLA 2YW4A 4IJBA 1K8YA 1LLWA 1G69A 1KM6A 5I3HA 1G7UA 2JKEA 3W3OA 1S3HA 3MBDA 4NXKA 3F4WA 3W2NA 4N9CA 3TR2A 1UASA 1O94A 1K7FA 3CWOX 1TV5A 4TX9A 4K7YA 1LYXA 1DVJA 3WJWA 3G1HA 4JTHA 4UXDA 4HNUA 1XCFA 4JTUA 2Z6JA 1WYIA 3UD6A 2HTMA 1X1OA 4FEZA 3TFCA 3SR7A 3HF3A 3IEBA 1SZGA 1U83A 1M7OA 5G5IA 3P84A 2RDUA 3HG4A 1DV7A 3KXQA 3MYPA 3ZR4A 1KV5A 1VYPX 5U7SA 4ADTA 2Z1BA 4MLJA 1TPC1 4N6EA 4NNAA 1XC4A 4QITA 3TA6A 1KFJA 3EXSA 2JBMA 3ZFHA 4XWUA 1W0MA 1ONRA 1KFBA 4FNUA 3W71A 2A6NA 2X1SA 2E5DA 3LXCA 3NO5A 1QO2A 5D2YA 3VE7A 5E93A 4GRSA 5I3GA 4BI7A 1W5MA 1I2NA 1S5VA 3S8HA 3R13A 1K03A 4UTIA 4MYXA 3DFPA 2Y88A 3I7RA 4AWTA 4JX5A 3DBPA 3LX9A 1PIIA 4IXXA 1SZNA 1ZCOA 3IVSA 2WQPA 4AXKA 4EVZA 2ZZ4A 4UFLA 2NV1A 5L6UA 4NUWA 1OFAA 4JTFA 1YDOA 2YXGA 4O0ZA 1L2UA 3SSJA 1PVNA 2WSQA 5AHLA 3ABRA 3S42A 3W7MA 1EX5A 3W7HA 3GNDA 3W72A 1EEPA 5L9FA 4EOUA 2W6RA 2FJKA 3MP5A 4UFJA 3NPUA 4HSNA 4HKPA 5I3FA 2RHGA 1TTIA 1SW7A 4Z1BA 3OBKA 2AAMA 2Y61A 1B57A 3PAJA 3PM6A 1IXNA 1W37A 3QMTA 3TXZA 1TO3A 2DJXA 1W1ZA 4NVTA 1ZAHA 2JGYA 3WK1A 3HMJG 1VLWA 3S0CA 3LBCA 1RZMA 1LZOA 2DP3A 4ONVA 4DF2A 2DZVA 3LGEA 3G0XA 3W1MA 2V9DA 2R94A 4JTLA 4JXCA 2Q3OA 3Q58A 3W7QA 1AG1O 5AHEA 4Q33A 5DELA 3G1DA 4MZYA 2QUTA 1B4KA 3N34A 3FKRA 4BFAA 3S6DA 3BW3A 2QUUA 5FF2A 2QCGA 1P5BA 3LCXA 3O6YX 1OFBA 1NVMA 3G0UA 3LHVA 1VH7A 3SGZA 2EHHA 1H7WA 3OVQA 1F7BA 1WX0A 3S1UA 4RKAA 3NQCA 3Q94A 1OX4A 1SFJA 4U4MA 1FXQA 3MHFA 1KFLA 5A5WA 2BXVA 3BG9A 1PCWA 1XL9A 1IXPA 3L9CA 1LCOA 4AHOA 3BW4A 1IGSA 1KLZA 3HGRA 1XDLA 5AHFA 4BWLC 3HGJA 4CQAA 5J5DA 3I7QA 3IVUA 4DF0A 3L5LA 3W7EA 5BMXA 4O1CA 1TJPA 1NEYA 1EA0A 2FPVA 5G4WA 3L67A 3LLFA 2YFOA 3IIZA 3E0IA 3IIPA 1TMHA 4FNTA 2R14A 4IMCA 3S5OA 1SO5A 3C4UA 3O6DA 1QPQA 1QWGA 4JYDA 2GQ9A 4LWWA 3RFAA 1VLIA 1LP6A 1NFBA 1SSDA 4HSOA 3CM4A 4JYFA 3FJLA 3W88A 3W84A 3LOTA 3LXBA 4HHPA 5AHNA 1VCGA 1YLVA 3THAA 3BW2A 4A3UA 3QH2A 1TRDA 4E0CA 4QJ1A 4ZMGA 5AB3A 4MJMA 2EAWA 1A50A 3EWUA 4K38A 4PFMA 1WV2A 4UNKA 2YFNA 2V30A 6TIMA 1VCVA 2AQWA 3KX6A 3HJZA 5K4XA 2VFFA 5FF7A 4M6QA 1TYGA 1X1ZA 2QCNA 1RV8A 2Y62A 1TSIA 1AL8A 1GPWA 1WOBA 1RR2A 1ZENA 2ZFAA 4UCGA 6ALDA 5IM51 4B5NA 1QPOA 2C3ZA 5D05A 1FQ0A 2G96A 1EWEA 2NUXA 3SIZA 2WOQA 5LNWA 4QNEA 1KM4A 3STFA 3LTYA 1AW5A 3TFXA 3PWAA 1JCXA 2P1FA 5KZDA 1YYAA 3JS3A 3NQMA 2V5LA 3NNTA 2V2DA 3DI1A 3W86A 1SW0A 4UTMA 2X30A 5D32A 3W83A 3QZEA 4IWWA 3P80A 3O07A 1YXDA 1Z42A 5F2LA 1J5TA 2YGYA 2QDGA 5HWMA 1KLYA 2V5BA 5DN1A 1JQXA 4AB4A 3LV5A 2HS6A 3TQKA 4HT3A 5DBTA 1ME7A 1H63A 4FIQA 1W3IA 2V2CA 2ZRWA 2Y89A 4Z1CA 3UWQA 2CFFA 3PUEA 1R46A 4IUOA 1K8XA 4QM1A 2BZNA 4LU0A 3M43A 2OX1A 2FB2A 4O50A 1FCQA 3W7PA 4IPIA 3FKKA 1FDZA 1MEHA 4JYEA 2NX1A 3GB6A 3E49A 3STEA 3TAOA 1I45A 1TV8A 3P8IA 5HR7A 2E6YA 1JR1A 3W6YA 1D9EA 3NDOA 1SSGA 2C1HA 3EX1A 3LHUA 2RDTA 3CPRA 1GVFA 3M41A 1QDSA 3W1LA 2TSYA 4O53A 2DZXA 2UV8G 3S1XA 3MYOA 2I9EA 4WQ6A 3C56A 4GXMA 3TV8A 1FXPA 3GYEA 4FB7A 1TPVA 3GXNA 2BLEA 3NG3A 3DH7A 4RZ6A 1FWWA 5HMSA 4WXYA 3C2EA 2J9YA 3FOKA 4FF7A 3PC0A 3B4UA 3G1AA 1ME8A 2EKCA 4L4LA 3W74A 3INPA 2FPYA 5D02A 4UTLA 1F76A 1UUMA 1BEUA 1QPRA 3GR7A 3MJYA 2PC4A 4ZQOA 1XKYA 2HMCA 3CQ0A 1WAUA 1TPB1 2JK2A 3GK0A 3CIXA 1VCFA 4Z08A 4JTJA 4MIMA 3G8EA 3L65A 2QCLA 5D33A 3U2OA 2B7PA 4GUIA 3GX9A 2GOUA 2WJZA 4P61A 4YLWA 5HINA 1JVNA 2VEIA 3IGSA 4NJHA 1WDWA 1DKWA 3PR2A 4TU1A 3FIGA 3DFOA 4DPQA 4UTTA 1GOXA 3U6WA 1ME9A 4AH7A 1G6CA 4DEFA 3N3MA 3C2OA 5MHBA 2O7QA 3GAYA 1LROA 3G0SA 3LV6A 3TH6A 2ZZ5A 4N2YA 3ZS4A 1IIHA 1DQXA 4MUZA 2VFHA 1SR9A 1W56A 2YW3A 4M5PA 1GEQA 5E1QA 3RF9A 2QCHA 3DI0A 4LNYA 2QDHA 3C2VA 5K9DA 1ICPA 2WNNA 4NNCA 4O1AA 2QJGA 3W70A 2C16A 4LV9A 3O15A 2OMAA 2W0UA 5G4EA 4NT0A 2NXIA 4O19A 1G7VA 5AHIA 3OHIA 4Y6GA 3WK3A 3TIMA 4MY1A 1TPFA 2WSRA 1KTCA 1WOAA 3HIJA 3H54A 1H7RA 3QEZA 2R91A 4I7WA 1YTKA 3M0ZA 2JKAA 3GZ3A 3CTLA 4ALDA 4NXSA 4UR8A 2P0OA 3C6CA 3LCGA 5G1TA 2YSWA 4LT9A 4UFKA 1BWLA 3TX9A 5D2XA 2YYTA 2J88A 1X6UA 3A9IA 2AGKA 4XKYA 1U5JA 3NL6A 1JCYA 3NVTA 5TIMA 3THQA 4MOZA 1Q6RA 3TQ0A 2G5WA 1XDMA 5D30A 3K30A 3P60A 5LGZA 3KFTA 3T55A 4JX6A 3LDVA 2G97A 1T0OA 3LHTA 4Q32A 2QAPA 4O4WA 4PA8A 1GWJA 2VEMA 1TQJA 3BLIA 3QPYA 3A23A 2GQAA 3TXVA 3VE9A 4IOTA 4G1KA 3W2LA 3E96A 3NPWA 3QW3A 4IPJA 3BLFA 4EWND 1OFQA 2FQIA 4IMFA 3CU2A 3MP3A 3MI3A 2XN0A 3T7VA 3LCFA 1OFEA 2NV2A 3ZWTA 4N9EA 4XUGA 1M7PA 2QCDA 2Y70A 1H60A 3B0PA 3BVJA 4KWVA 1PE1A 2Y6ZA 3VNDA 1VHCA 4Z0SA 2A2IA 5EL1A 1ZY9A 5FEZA 2NZLA 1RQBA 3PBVA 4O13A 1HO1A 1HTIA 4LV4A 1XUUA 2NLIA 3GKAA 3YPIA 3UWYA 5KITA 4WOZA 3OVPA 3T78A 4I7UA 1OYCA 4AWSA 3PBUA 2GVGA 3LB0A 4CNPA 1YPFA 3L5AA 3CB8A 3NEVA 4NJJA 4HIBA 3BO9A 1LORA 3WK0A 1KFEA 3W2JA 1J2WA 3DFQA 3KVJA 4O15A 4FX8A 4WUIA 3NQVA 4AHPA 1EIXA 4LVFA 3W9ZA 2FLIA 5CZJA 2QAFA 2GQ8A 5LHEA 1KBIA 5LKYA 2ISVA 4QISA 2TRSA 1P1XA 3BGGA 3NQ8A 4M7TA 4GJ1A 4UNLA 2CLOA 4R53A 5FEWA 5D09A 3QYQA 1GT8A 5C2XA 3QC3A 4NJKA 4L4MA 2V8ZA 3W7NA 3TCEA 1P0KA 3STGA 5CKSA 4AWUA 4NQ1A 3EX6A 5D37A 4O0KA 3ATYA 2ZTKA 1TPWA 4CCDA 1C8VA 3PSVA 3H53A 2GPTA 4PC8A 3DGRA 1ZJIA 1RQEA 2TYSA 1G4TA 4M6PA 1O5XA 2NXHA 3PB0A 1LOLA 2VFGA 3GXPA 2Q8LA 5GVJA 3UWUA 1KM1A 1ZHAA 1OFOA 3CLMA 2QCDB 2ATMA 2ZQ0A 5DCEA 1K02A 3LM7A 3NQDA 3UNDA 1JCJA 1F5ZA 3C2FA 3LLDA 2E09A 1K8ZA 1MSSA 2CZDA 3FYPA 2ABBA 3HGSA 1V5XA 2QR6A 4CCCA 5AOUA 5AC7A 3CT7A 4U28A 4KFOA 3LCWA 4M19A 4IXHA 3AO0A 3GVGA 3GDMA 3RLUA 1GQNA 1TV7A 2A6LA 4W9TA 3NAVA 4ICNA 4ZQNA 3V75A 3W2UA 4UR7A 3QSRA 2QKFA 4HNTA 4N9BA 4S1FA 1W54A 3UZ5A 2A7RA 3HPZA 3N19B 1O4UA 4K6AA 5H2ZA 4NZJA 2ALDA 3QJAA 2Y85A 2VFEA 1H61A 3EKLA 3NZ1A 3W2MA 3KVMA 1R30A 1D3HA 3EX2A 3NL3A 5CZTA 1VC4A 1H51A 3KHJA 4QNWA 3L0GA 4K36A 1F2JA 5DY2A 1FCUA 3C52A 1SU5A 3FEMA 3TC6A 1DORA 2J6XA 3KOFA 3GDKA 3SECA 4K37A 2G95A 5E0KA 3IIOA 1GVQA 5I3KA 4ZVJA 1AMKA 2ZA3A 5EYWA 2NUWA 3UQNA 1I2PA 4FXRA 4FX7A 2ZTJA 2PRLA 4OV9A 2WV8A 4LVDA 4E2BA 1NAL1 3RLVA 5AFDA 1FWNA 3QMSA 1KTNA 1LOSA 3L21A 4UFMA 3TSMA 3W1RA 1EWDA 1GYLA 2CLIA 2E5BA 3SW6A 2BTMA 3T4CA 3L5MA 4N4QA 1LRNA 1K7XA 2A1YA 5TQLA 2H8XA 3WJXA 4BI5A 2DZUA 5K7JA 4PL1A 5KSWA 4IX2A 4WXZA 4ORIA 3SFKA 3W1UA 3M5ZA 1F6KA 2YYUA 2WNQA 2CZ5A 1GVSA 3CEPA 2A85A 2TMDA 3PVFA 5HULA 2GJNA 5DCBA 1X7FA 3MWAA 2WNZA 3HG5A 1KBJA 2QJIA 5LSMA 2OT1A 1PV8A 2CZFA 3CWNA 2C13A 2X1TA 5KZEA 1KA9F 2IQTA 2OCZA 5G2WA 1TTJA 5BRBA 5KINA 1TPH1 3VKJA 4DO4A 1M6JA 4J9JA 1PHQA 4CNOA 3VCRA 3SY5A 1ZAIA 3M47A 1O95A 5LNRA 1WBJA 3BG5A 4O16A 4I7VA 3O16A 3W76A 5K3VA 3I68A 4JDYA 3ANYA 1OHLA 2ATSA 3RK8A 3USBA 3PG9A 3GR8A 1FWTA 3TNOA 5K9CA 3L66A 4XQ6A 3NPVA 4ZQCA 4GE8A 3UWVA 3UXDA 4JNMA 1Z44A 1G4PA 3GDRA 1ZALA 1OFDA 1KFKA 3F03K 4ZQRA 3GKFA 3U8GA 4S2BA 4MZ8A 5FF0A 1XBXA 4MVAA 3PF3A 3N9SA 1QOPA 3G18A 1HFBA 3BLEA 2E77A 1SW3A 4Q4KA 3G3DA 3GXTA 3H55A 4GWEA 4IMDA 3W07A 1TREA 2QCFA 2YCEA 3O06A 3M44A 1Z41A 2E6AA 1LRTA 3A5VA 4E2DA 3R8RA 4UMBA 4XBKA 3HB9A 4UTKA 3TW6A 5LHFA 3BGJA 2DORA 8TIMA 1SQ7A 4O4VA 3F1QA 3G24A 1OK4A 5AC8A 5EBUA 5C54A 2BX7A 4RZ5A 2V2HA 2ZCGA 3P5YA 2C0AA 3A22A 3I6RA 1YXYA 4RXGA 3SI9A 5EKYA 5BMWA 5F2IA 4UTWC 2EF9A 1SFLA 4CQ9A 1EP1A 3IIVA 4IQLA 3MI6A 4UC5A 1LM1A 4HPJA 3M16A 3WJYA 4OQVA 4O1BA 3GIYA 1G4SA 1OF8A 3W1NA 1THFD 3W7LA 3AJXA 1NF7A 3LCLA 1UCWA 2FIQA 1Z48A 4RCXA 3NOEA 4N4PA 3W7KA 1DHPA 1QNVA 3LHYA 2O7SA 3FS2A 3PSWA 1CW2A 2CLMA 1SZFA 1JQVA 3NQ2A 2ZZ2A 3ZWSA 1VYRA 3HG3A 2CLKA 1A5BA 1I4NA 3NL2A 5HWJA 1F74A 3IGXA 1HG3A 1P4CA 1OG0A 2X2GA 2WPBA 5BW6A 4LY8A 1YADA 3NZRA 3OIXA 1EUNA 2H6RA 2RH9A 2W79A 3JR2A 1N7KA 3EWZA 3B03A 3FA5A 4Z1AA 5CPMA 5J5RA 2TPSA 3NYZA 1GG1A 4GNJA 4Z1DA 1T96A 1OYAA 1L9WA 3A21A 3DKLA 5DXXA 4X22A 5KTLA 2PRMA 4OE7A 3NQFA 3S5NA 3W75A 5C5YA 1QPNA 1LLZA 1MZHA 1TJRA 3UYCA 1SO6A 3L2IA 4DELA 5LGXA 3GDTA 4LC8A 3HG2A 1YDVA 4JDBA 2WO5A 3CHVA 1QFEA 1YXCA 4MYAA 3NQEA 2NWRA 3C3NA 4WJEA 3V1PA 3QQ1A 3B0VC 5HR6A 1QCWA 3M5XA 1EUAA 1YPIA 3WJSA 4LS1A 4UTJA 1DBTA 1WQ5A 4WY0B 1PL9A 3W1QA 4CQ8A 4QAIA 2Z0IA 4TIMA 4WD0A 3LCHA 3BK0A 3EXRA 4H6KA 4OHQA 3TQVA 4JTGA 3O6CA 2Y7GA 3PUDA 4AEOA 1OABA 5D2WA 3BV4A 2A7PA 3FLUA 3QSTA 3PG8A 1XFBA 7TIMA 3EEGA 2GVJA 1BKSA 5FEXA 1JRBA 5U4NA 1LBLA 5T26A 4ZQPA 1UB3A 2FPTA 3TMQA 1A5CA 4AHQA 5D03A 2X16A 3RU6A 5IBXA 3R12A 2ZRYA 1VRDA 2ZZ1A 2A4AA 2QEZA 4Y96A 2C14A 3NQGA 4AF0A 4X2RA 4JS3A 3TAKA 1C9DA 4O1DA 2VOMA 2ZZ3A 2Y7EA 4Z0JA 1A5SA 1K3UA 4JN6A 1YDNA 3BG3A 3T40A 4C1LA 3DHFA 3UWZA 3LHWA 3W1PA 4O57A 1JUBA 1CI1A 1H5YA 2J9XA 3W2KA 3HOJA 1FBAA 1FCVA 4JTSA 1B3OA 4TMCA 1DOSA 2VKZG 3P82A 4AF0B 4FNRA 1GTHA 3G1SA 4H4IA 4TMBA 3MO7A 5AN7A 5HJLA 2VXNA 1ALDA 4XTDA 5A8GA 4UFIA 3P7YA 4R34A 5F4SA 1F73A 1OK6A 3LXAA 1FWSA 1ZAJA 4YL2A 3IV3A 4LS0A 2PCQA 1KM2A 3N73A 3B06A 5C6MA 3C8FA 4XBSA 5SWUA 1WBHA 1GTEA 3SGUA 2WSYA 1ICQA 1ML1A 3DXIA 3PBWA 4GUJA 1EP2A 3KVLA 5H91A 3W22A 1OX5A 4IMGA 3W7CA 1W8SA 2DZWA 3NQ7A 1GG0A 1LDCA 5F1UA 2OT0A 4O28A 2XN1A 3R89A 3O63A 4RXFA 2B4GA 1SZEA 3TSBA 5HUPA 3EWXA 4KFPA 3P5ZA 5TBOA 2WKJA 3KAOA 1FY6A 3HO8A 3W1XA 1AK5A 1SO4A 4UFHA 4WY0A 4Y9AA 4DBEA 4O10A 3STCA 4BF9A 2J24A 3G1XA 4ADSA 1R47A 4DQWA 3KRSA 5CG7A 3BPWA 1H1ZA 3LTSA 4RR4A 1GVRA 4GUHA 2QUVA 1FX6A 1KTBA 2RFGA 4GUFA 1N55A 4KKXA 2F84A 3M6YA 1OYBA 4JX4A 4FHAA 3FJ6A 2B7OA 2Y7FA 2X1RA 4OV4A 1TB3A 3E9AA 1W3TA 3W7IA 3MI2A 1XBYA 1JCMP 5AC6A 3DU0A 2V82A 5ABTA 3F4NA 4JIPA 4NX5A 3NPXA 1OX6A 2F7FA 4NJIA 1Y0EA 2QF7A 4ZZ9A 1AW2A 1IXOA 4MFEA 4IX0A 3SJ3A 1A5AA 5HQEA 1TCDA 2PURA 3NM1A 5K4ZA 4O14A 2CZEA 5F2GA 4H3DA 4ORMA 4YCPA 5BNKA 2PRHA 3JRKA 3LTPA 3P62A 4UTWA 2NXGA 5D2TA 1TPEA 1H7OA 2Y7DA 2CWNA 3EX3A 4DXVA 1W5NA 1TRIA 3NQ6A 3MP4A 4M7SA 3HQ1A 5DXYA 5AYYA 4PODA 3W87A 1HO4A 2QCEA 4CLMA 3N2XA 2DZPA 3W73A 4HPXA 1C29A 3MUXA 4JY8A 1FCBA 3B0UX 3O8AA 1I2QA 3GDLA 1HL2A 4GC4A 2BSLA 2OJPA 3HGOA 4ADUA 1H7NA 1WXJA 2H3BA 4O18A 1PCKA 1S5TA 3B04A 5EMUA 4FNSA 4PTNA 1FWRA 1YTEA 3A24A 3I7SA 3QW4B 2QCMA 4OU1A 2A0NA 2XN2A 5D04C 4UIOA 2GJLA 3TUUA 4E38A 2ZBTA 5EA9A 4UMAA 1IIGA 1W5PA 3LHZA 1XBVA 5CGQA 1SPQA 4LVAA 4AVFA 4BK9A 3W1TA 4LVBA 3QPZA 3TROA 4LVGA 5CSSA 2VFIA 5AYXA 3EB2A 1DQWA 3A5FA 3FFSA 4RV8A 2C18A 5I3JA 4LUJA 3P74A 1ZNNA 4N9DA 4N02A 1NF0A 1TTQA 4DPPA 2A7NA 1T8XA 1JCNA 4BI6A 2CLLA 1QAPA 1KW1A 3W7JA 2I1OA 1K7EA 5HUOA 4FNQA 1BTMA 4WOQA 4K8EA 2YX0A 4D2JA 5D38A 1F6PA 1VQTA 1ICSA 3RMJA 3IVTA 1R2TA 4KWWA 1SO3A 4DBDA 2HSAA 2CLEA 1XUZA 3E12A 1EB3A 4XTIA 1UBSA 4DO6A 2NUYA 4O12A 3Q2DA 5FEPA 1G4EA 4Y90A 4MFDA 4GFSA 4K39A 1P0NA
chains in the Genus database with same CATH superfamily
2VC5A 1CNVA 4QRNA 2DFAA 4XZHA 1AQ0A 1G0CA 2E9BA 1QXLA 5EPDA 3AUOA 3QFEA 1XLHA 2IKHA 2A79A 3BAYA 3APGA 4QIUA 2ZXAA 3FDKA 5DY3A 3WD2A 4IHCA 2P10A 1SJBA 1E4LA 2E1DA 4YCOA 1NSJA 1F3WA 2ISSA 1I8JA 2VENA 5IHRA 4K7VA 3B05A 4OZOA 5LNSA 1DL3A 1AFSA 4CQCA 1UZ1A 3GS6A 4GBUA 1MDLA 4JIQA 3WLMA 3P81A 3LPPA 3L7RA 1I1XA 1KM5A 2J7GA 1ODUA 1XRSA 2VD8A 1V6WA 4DLFA 3W85A 1JD7A 4UNIA 4PTWA 2FH8A 3U57A 5AYZA 1E4IA 2EPNA 1Z8AA 3H8AA 4Y9MA 3TTYA 3QF0A 2OFJA 3HURA 1RQHA 1QWKA 3M5YA 3PUOA 4LX4A 3ABQA 2C0HA 3AHXA 5LA2A 2VX5A 4PFHA 4FI4A 1K9DA 3AHTA 4XIAA 3VZZA 3MVTA 4MJZA 3FX4A 4UTTC 3KWSA 3HV9A 4C1KA 3HMCA 2DZSA 4DM2A 3IANA 3DN5A 3WDIA 4AZHA 5HQLA 1QASA 3W0KA 3URAA 3D5HA 3B8VA 3CQKA 1MO0A 4H00A 3KRUA 3AIQA 2ODOA 1PDZA 4MWAC 3QQ0A 4DLMA 3L4YA 3M1ZA 2VT0A 4GFIA 4EF9A 4PSPA 3OEXA 1VR6A 3G1YA 1Q85A 3AZRA 3F5JA 3CBWA 4KT2A 3F4CA 4W4QA 1VGAA 3KBMA 4F0RA 2CW6A 1W5QA 3IRDA 2PUZA 4OBTA 1L8NA 1XI3A 5AZ1A 4X9SA 4MLRA 3EX4A 4EXAA 2ZDRA 1EDGA 2WC3A 3FYOA 4DZHA 4YWIA 5E0CA 3GTNA 3W1AA 2WZIA 1GVEA 4MY9A 3B8WA 1UKOA 3QGKC 3ELFA 4AAJA 1H41A 4PCPA 1L6SA 3QV7A 2X1IA 4D6FA 1L8PA 2ZRUA 5CC6A 4FLRA 2BS9A 1CXFA 3LGDA 3DFNA 5DT5A 2DUZA 2ZIDA 1UW9A 3G1RA 4JL1A 3GLCA 2UY5A 3MHGA 5CLTA 3DEQA 2YDSA 3ABSA 4UMCA 4R9XA 4CKQA 4URIA 1P6CA 1MQQA 5C0QA 4KEUA 4AY8A 1EGZA 2IKIA 5LNVA 1AL7A 2FGBA 2CC0A 3AYRA 1AZ2A 2TODA 4GINA 1ECEA 3N6HA 1TJ0A 4DF1A 2E6FA 1J0JA 1PKLA 1DJQA 3GVQA 4DJEA 1Y5VA 4AXNA 4FNPA 4Q7NA 1KGUA 4G8TA 3DYMA 5FJUA 1KM0A 3TE9A 1WO2A 4HN4A 3TYZA 3A4WA 4Q7BA 1AJZA 3FV9A 3NURA 3PPHA 2CU0A 3TJXA 2AOSA 2NQJA 3MKCA 4J3SA 1P7TA 1S1RA 3MW7A 3EDFA 1VHNA 1EHAA 3MHUA 5EB8A 1XM3A 2R1KA 3S9YA 2OOGA 1OX4B 2CLFA 4ZL1A 1QU4A 4JIIX 2YOCA 4Q6XA 1LT8A 4DJED 3LENA 5I78A 2C15A 2JQXA 3L0NA 1B0IA 1H7XA 4GACA 4RZBA 2PWGA 1EO7A 3QZAA 4UUIA 3GQYA 3RM9A 2XUCA 3LU2A 2YZRA 4BWLA 1C93A 1CXLA 3OQEA 4KETA 4H9YA 5F4XA 1WKDA 3VK5A 4MY8A 4OBRA 3NA8A 3IARA 2J77A 3UCQA 3HPXA 5BOOA 4JCLA 3CH9A 3WJZA 2B81A 2PWHA 3HN3A 1VZWA 1QI0A 2J6VA 4XZLX 3O1NA 1VBJA 1VS1A 4ZXOA 5C2CA 4R3UA 1Q13A 4OUIA 1CB7B 1O5KA 4PEKA 3E02A 3T1GA 1XXXA 4YMZA 4H6QA 3SY1A 4R33A 3ATZA 4UQCA 1EJVC 3B40A 3MJMA 4C6NA 2VUNA 4AD4A 3VI2A 2LLEA 3PBYA 2ZA1A 1TPUA 2VEPA 3DUGA 1JNDA 3BC9A 3VX1A 5B7YA 2CETA 1YDYA 2Y5JA 2AL2A 3S5ZA 1E51A 2JFEX 5LIYX 3VIFA 4C90A 1QPKA 2E5CA 2EPKX 1PWLA 4C6EA 3PJUA 1R86A 4O8RA 1RP9A 3NL5A 3LRMA 4TO8A 2YKKA 3G6MA 1UUOA 3UGVA 5HWNA 3UJRA 5HMEA 2SFPA 3QM3A 4C6KA 4C91A 3PWIA 1DHKA 1A0DA 2FKPA 2VZOA 1TPDA 4FLOA 3I3DA 4V1YA 6TAAA 1XKJA 2Z2UA 4XAZA 1UP2A 4MGGA 2VZVA 2MUCA 2VCCA 1E1CA 1JUEA 5K2ZA 1B31A 3S2MA 2Q8ZA 1H62A 3G5EA 3PY2A 3EPOA 3CV2A 4H9VA 4B5SA 3W3OA 3NZPA 3F4WA 4N9CA 1UASA 1O94A 1N8IA 1K7FA 4D8ZA 1LYXA 4JTHA 3GXMA 1XCFA 4HNUA 2ZADA 1CYGA 1H09A 3IEBA 4RW5A 5G5IA 4IFKA 1UA7A 2E25A 2GSHA 5U7SA 2Z1BA 3TN5A 4QITA 1XQKA 3TA6A 1UR3M 1X8CA 3ZFHA 4I6KA 1PB0A 3MUIA 1TX0A 3IGHX 1UQYA 3BCDA 5JIWA 3UYIA 2INEA 1GKPA 1BWVA 3ZVHB 1KRMA 4U5KA 1V6VA 1S2CA 4CD5A 2X1SA 3RCNA 3SCSA 4Q7IA 1UZHA 3LXCA 3NO5A 1PZ1A 5A6JA 2CBJA 5AVNA 2OQYA 1RD6A 3L2LA 1PZ2A 2ACUA 1W5MA 3VNLA 5I3GA 1RALA 2NQZA 2AMGA 3F4DA 3EPMA 4J35A 3NO3A 4AWTA 2HVMA 1CXEA 3LX9A 1PIIA 3IVSA 6XIAA 3JZUA 3TZFA 3DHUA 4AXKA 1NDVA 2ZZ4A 4AX7A 2DUXA 5L6UA 4NUWA 5BYWA 3WMSA 4JTFA 1YDOA 2YXGA 4O0ZA 3P2VA 1S46A 1ENUA 1EX5A 3VM7A 3GNDA 4UOJA 3SCOA 3W26A 1V0KA 4HSNA 2RHGA 3XIMA 3KUMA 4Z1BA 1LQ0A 1EXBA 3IJ7A 1UR2A 1TO3A 2DJXA 5MF5A 1TVNA 3QGAC 4K1GA 3UA3A 4DXXA 4C5YA 2IS7A 4DF2A 3F4VA 3AALA 1W9BM 3VIGA 4PGLA 3G0XA 4AY7A 1XYMA 4RUBA 2V9DA 2Q3OA 2YXOA 4HBKA 4UQ9A 3IJQA 3EEZA 4DM1A 1MRQA 3PUGA 3KCOA 3FKRA 4BFAA 3ZJKA 1ESWA 4JTAA 2QCGA 4XKMA 4HU4A 1P5BA 4H8HA 3BAWA 3O6YX 2BNJA 5C9UA 2YB1A 4IFOA 4J3WA 1OCNA 3G0UA 3LHVA 3SGZA 5FSEC 3BOXA 4GIYA 3O7UA 4B92A 1F7BA 1AJ0A 2FTWA 3DX5A 3MHFA 2Y8VA 3ARZA 1XL9A 3HV8A 4JZ5A 1E15A 1JZ8A 4QJ4B 4MPKA 1V02A 2GJXA 3HGRA 2V5JA 3U9IA 1XDLA 4BWLC 3HGJA 4KCTA 1MVYA 2NT1A 1X96A 3I7QA 1AJ2A 5BMXA 1RCOB 4WCJA 2PWDA 3CMFA 5E5CA 2YFOA 3IIPA 1S5NA 3LG3A 3MVIA 1H0GA 3AXIA 4M81A 3O6DA 4XD4A 4BS0A 4YTUA 1LP6A 3H23A 4HSOA 4BZYA 3CM4A 2XDFA 2YDQA 3DC0A 3W84A 4EAYA 4JL2A 3BLLA 1VFHA 2PEVA 2WM0A 5FD0A 1R3WA 3WLPA 4HU0A 1QBAA 4TXEA 4W89A 4ZMGA 1NOWA 4MJMA 1PX8A 4ECLA 4PFMA 5K4XA 2YDRA 1MFUA 3KZSA 3T81A 3RN6A 1AL8A 1GPWA 1XDJA 4GI6A 1OG6A 5C7VA 2ZUNA 3GC4A 4MKSA 5D9MA 4UCGA 3N13A 1MWOA 2ZDSA 5IM51 1CGWA 3JUGA 2G96A 3OLDA 1KWGA 4G56A 4C6MA 5LNWA 1KM4A 2OODA 3F5KA 1AW5A 3TFXA 4BKNA 1YYAA 3TYUA 1OD8A 4YIWA 1M41A 3KL0A 4CEXC 4FA3A 2X30A 3K4DA 2BASA 2J7BA 5F2LA 4DJDC 2YGYA 1ZGDA 3GYCA 1CPUA 1JQXA 4AB4A 3GO2A 3LV5A 4DNMA 2VDGA 3TQKA 1BAGA 5DBTA 4C6OA 2VHLA 1H63A 1VAHA 1EXPA 2Y89A 5E09A 2CFFA 1GPFA 4IUOA 5I6SA 1HJUA 1ZPTA 2BZNA 4LU0A 3UT0A 2OX1A 4HMCA 3OTRA 1FCQA 4H7CA 4LYKA 3TR9A 2XVNA 1KCLA 3GB6A 3E49A 4DWDA 3TAOA 4Q8OA 1E9IA 1TV8A 2YBTA 1A4MA 2Y5SA 1KO0A 2E6YA 4J2PA 1FWHC 1UD6A 1SSGA 3EX1A 3NQBA 3LHUA 3VIJA 3WNNA 3W1LA 3E0VA 1M68A 2UV8G 4IF2A 1T7LA 3S1XA 4NI3A 2WVVA 3C56A 1V3IA 2XIQA 3TV8A 4WGHA 1DJXA 2IQ0A 3DCPA 1TPVA 3GXNA 3QY7A 2BLEA 3RR1A 3VGEA 2PB1A 3WF3A 3HTWA 5HMSA 3IJ9A 1JCTA 4ZBCA 3B4UA 3VO0A 3PPFA 2EKCA 1E1CB 2FPYA 3WD1A 1F76A 3VD5A 1BEUA 3V5FA 2C79A 4RE0A 3WUFA 1XKYA 2HMCA 3N4FA 3ONBA 3ZLFA 1RSCA 2JK2A 2AQVA 3S3GA 2EG7A 4M82A 5FA5A 4MIMA 3WLKX 2WJZA 5HINA 3MDWA 4NJHA 5EBAA 4B2DA 3VIHA 3FIGA 3MO4A 1G6CA 2VMFA 4W7VA 3VINA 1LROA 2Z29A 3LV6A 2OELA 3ZQ9A 4GY1A 1IIHA 1O7AA 4PMOA 1DQXA 2H9AB 4GIEA 4M5PA 3USZA 4KWUA 4Y7EA 4NNCA 2FYMA 2W63A 3MV11 1EDTA 4LV9A 3O15A 3VCNA 1QATA 4MUPA 4MAVA 3SB0A 1ZB5A 2NXIA 3PWGA 1HP4A 1G7VA 4O19A 3PTDA 4HA1A 1WKFA 5A8QA 1NFPA 2GK1B 1TPFA 4L1WA 3V16A 3E5PA 3QEZA 4LBUA 3VX0A 3WBWA 3T08A 3H70A 3M0ZA 3BCFA 4JHMA 3GZ3A 3UVIA 5FJRA 4JIHA 4F8XA 4NXSA 3F5LA 7XIMA 3K8MA 3B8UA 1F61A 2W4XA 4XKYA 2AGKA 3NL6A 4H2HA 2QVNA 4R27A 2G5WA 3V18A 3LGGA 5FOOA 4HQVA 4JX6A 3RX4A 2G97A 3WSUA 3THUA 4OVXA 4A8RA 2J8TA 4O4WA 3F2DA 3A23A 1E43A 2GQAA 1V0NA 2WHKA 2GUBA 1HJSA 3MZ2A 4K8GA 1OFQA 2FQIA 3GSMA 4W8BA 1DJZA 5FCZA 3E2VA 3QKEA 3A4JA 3A4XA 1OFEA 2GZXA 3B9AA 5C9RA 2QCDA 2Y70A 2PDMA 3V1HA 1PE1A 5DMLA 1AH3A 4C6JA 5FEZA 5EL1A 3CIVA 1CZ1A 4PCTA 4D8LA 4O13A 1HO1A 3R1ZA 1HTIA 2G8ZA 3QZ6A 3GR4A 2W91A 3YPIA 5KITA 2Y2WA 2ACQA 1S5MA 1OYCA 3TN6A 3DIPA 2J62A 1VF8A 3ITOA 1QW9A 4HIBA 4NJJA 3W02A 4TVUA 2WJDA 4WK9A 1LORA 1P0EA 1J2WA 3NQVA 4AHPA 1E6RA 4PUJA 5CZJA 3CAKA 1VFUA 2GQ8A 2ISVA 3QYSA 5FEWA 4LF2A 2DT0A 5C2XA 3QC3A 2Z1SA 1ZZMA 1IEXA 4IFRA 3PZIA 3AZTA 5CKSA 4AWUA 3EX6A 3P0WA 4PTXA 4KRZA 4L6DA 4O0KA 4GQQA 3ATYA 2AL2B 2ZTKA 5HXMA 4PBFA 1CBGA 3PSVA 4Q8PA 1JYXA 1RQEA 4IIHA 2TYSA 1G4TA 2DVTA 4M6PA 3W6LA 3IJIA 1I1WA 2NXHA 2O9PA 4LFYA 2VFGA 3GXPA 5GVJA 2O92A 1KM1A 1OGGA 4H9XA 3CLMA 4Y9NA 5JBFA 2ZQ0A 4AY1A 4ZA0A 5DMMA 3MUZ1 3NQDA 3RITA 2E09A 1K8ZA 1HKIA 2QR6A 4CCCA 3WF1A 3CT7A 5F7UA 3AO0A 4DJFC 3GVGA 2PWVA 3RLUA 3HFTA 3NAVA 4ICNA 3ZVHA 4ZQNA 4XVEA 3V75A 2QNEA 4HNTA 3NIYA 3P93A 1E0UA 3HPZA 3RYSA 3ZIZA 1O4UA 2XSBA 5H2ZA 4NZJA 1NQ6A 1RJRA 1J2BA 1ZJBA 4E5TA 3NZ1A 2BGQA 3TP4A 5CZTA 3KVMA 1W3KA 3NL3A 1WAWA 4V15A 1O12A 1O66A 2G41A 2VCBA 1VIWA 3AMDA 4QTGA 1SU5A 2A3EA 1DORA 1FKWA 3KOFA 4S3JA 2YL8A 1RH9A 3GDKA 4UZSA 3SECA 3VCCA 5E0KA 1XLDA 3T0CA 4XAFA 4LUSA 1I2PA 4QROA 4FX7A 1BXCA 1YRRA 2BV9A 3LN3A 3RLVA 2CKRA 2R1MA 4GISA 4XD6A 1E9ZB 2C71A 3N4AA 1NOUA 1GYLA 2CLIA 1OWQA 3SW6A 1A5MC 1B2YA 1K7XA 1LRNA 5TQLA 1FA2A 1E56A 1GNXA 5KSWA 4IX2A 4WXZA 3M5ZA 5DMYA 1F6KA 3OQ8A 1V79A 1GVSA 4HZ6A 4F3HA 2XVGA 3IUDA 4JQ2A 4EK7A 2VC7A 1ZCCA 1UKSA 4ZTXA 2OT1A 1PV8A 5M17A 1RAKA 3CWNA 2C13A 3N2CA 4JQ1A 2X1TA 4M8UA 3WH7A 1KA9F 3SADA 4CD6A 3UJSA 3NDZA 1TTJA 4U33A 2YA2A 2PSNA 2AGTA 3CHFA 4CNOA 1GOMA 4YVPA 1O95A 2FFIA 1QUMA 4GKTA 2J7DA 2RJGA 5A2BA 4JDYA 2J78A 3VOHA 3BAKA 1WZMA 4R7WA 2ATSA 3T2PA 4K68A 1J6PA 4FXFA 5E9XA 5JU6A 3H21A 3KBVA 3TNOA 1ITQA 2WCAA 4GE8A 4OKDA 3UWVA 3D6NA 2HNHA 1CCWB 1IEVA 1Z44A 1XQLA 3HZ3A 4IGSA 3T8QA 1OFDA 2EPLX 1G01A 1IEIA 1WP6A 1H5VA 1HNYA 4S2BA 3LM3A 3MMWA 3VABA 3UZZA 3CUJA 4MVAA 4D8AA 3N9SA 1QOPA 3G18A 4D72A 3BLEA 2GJPA 1RCQA 3BZJA 3G3DA 3GXTA 3BICA 5LYRA 2WMFA 4QG6A 4OUEA 5MKGA 2QCFA 4LYQA 2YCEA 3A5VA 1FH9A 2BMBA 4W8LA 4E2DA 1J96A 4UMBA 4XBKA 3TW6A 5LHFA 1F6YA 4X0VA 4E8GA 3F1QA 4RDYA 5EBUA 3CO4A 4PMZA 5C54A 4TX8A 2V2HA 3SCUA 2QV4A 2QV5A 2C0AA 2R24A 3A22A 4NZ4A 1J79A 3ZT7A 4H04A 3S83A 5BMWA 4C6PA 4UTWC 4IQLA 2Z4GA 4LF1A 3FGCA 3M16A 3WJYA 4OQVA 5HNUA 1AMYA 3WLJA 1THFD 1X38A 4HA0A 4N4PA 3KS5A 2Z7GA 2I56A 1QNVA 3LHYA 2O7SA 3WLNA 3PSWA 1CW2A 1AUSL 2FHBA 3LEPA 1I4NA 4WSHA 3IAPA 3N9KA 1ITUA 2WPBA 1UMLA 3PPCA 4LY8A 1AA1B 3NZRA 4XG1A 1Z3NA 4IUGA 1JDFA 3I3EA 4GNJA 3M07A 4DX3A 4XD3A 2W5FA 1L9WA 1Q8JA 5DXXA 4X22A 4OE7A 2DSZA 1EJRC 1TA3B 1HJVA 4L80A 3E2SA 3W75A 3MS8A 1QPNA 2VD9A 1LLZA 3U4AA 4ZFCA 1Q7ZA 3GDTA 1MQRA 3HG2A 3NXLA 2Q02A 1QFEA 3N1AA 1C3FA 4QG8A 1GHRA 4GQ0A 1CWYA 4LS1A 2Y8UA 4UTJA 1OIMA 2Z7KA 4J3ZA 3CV1A 3UCCA 3W1QA 4CQ8A 1JDAA 4XD5A 2PFHA 1PUDA 3OZOA 4OHQA 2OWCA 4JTGA 1XYZA 3BDKA 1K70A 4S3FA 1XFBA 3W53A 2PD9A 5FEXA 3B0YA 1JRBA 5U4NA 3FAXA 5LIUX 2D2GA 3UXIA 1Q4NX 1UB3A 2AAAA 3UG8A 1UH3A 3L12A 2J7FA 4AHQA 2POZA 1QT1A 4KRUA 4U3CA 3H12A 4AD3A 5IBXA 3OO2A 4MB4A 1NWRA 1VRDA 2A4AA 2QEZA 4Y96A 2FHCA 4AF0A 2EBNA 4X2RA 3TAKA 1KRAC 2Y7EA 4Z0JA 1QBBA 1A5SA 5EMJA 4GIRA 1YDNA 3T40A 3L2MA 2PDQA 4C1LA 3H2MA 3W1PA 4O57A 4OOUA 1CI1A 1HVXA 1W6TA 3K46A 3NEHA 4P5UA 4IGMA 1DOSA 1BRLB 2W67A 1GTHA 3G1SA 3N2OA 2YJQA 4LYPA 1B3XA 4H4IA 1ALDA 4UFIA 1XYFA 1OK6A 2D3NA 1FWSA 3LXAA 1R9XA 4D6JA 1ZAJA 4YL2A 4WGXA 2NQ9A 5C6MA 3OZPA 1GTEA 3RX2A 1P1MA 3SGUA 4IFKB 4DJFA 1ML1A 3MY9A 3DXIA 4JEJA 1OX5A 2VP8A 3U2CA 3QV8A 4P8UA 2XSXA 4DO7A 3QBUA 3NQ7A 3T9PA 5F1UA 5AZ0A 1HKVA 2OT0A 1TUXA 4QHRA 2HWGA 3O63A 4RXFA 2J8FA 4B90A 2D3LA 4YHEA 3TOYA 1WNOA 3H6OA 4GXWA 1O68A 2WLZA 4KERA 5C9XA 4DBEA 4O10A 4US5A 4BF9A 2J24A 4ADSA 1R47A 1KR0A 1T6MA 3VZXA 2VC9A 4RR4A 2QUVA 2UY3A 3SCTA 1N55A 3M6YA 1OYBA 4JX4A 4FHAA 2Y7FA 2X1RA 3CPGA 4PUMA 4LAZA 2R6OA 2OXNA 2XFYA 2PDCA 5AC6A 4FF5A 3F4NA 5AYIA 4NJIA 3UZYA 1Y0EA 3VOFA 2QF7A 4ZZ9A 2AL1A 4W7WA 1DJGA 1RA0A 4D71A 5D9NA 5BWAA 3NM1A 5BNKA 3P62A 2WB5A 5ECUA 1TPEA 2Y7DA 4MWAE 1UC4A 2D2HA 4WDTA 3OODA 1J11A 2QS8A 1W5NA 1TRIA 4DHGA 2UY2A 1HO4A 4D6IA 3E5BA 1LQAA 2OEKA 1LG1A 4JY8A 5TD4A 2Q09A 2VX6A 1I2QA 1MMFA 1CT5A 3T09A 2OJPA 2NQ5A 3HGOA 2BVYA 2CBUA 1WXJA 1PEZA 4PTVA 4ZR8A 4LH8A 4GKLA 5JBDA 1FWRA 3A24A 1HGWA 2J66A 4XAGA 3QW4B 2QCMA 2QPUA 4OU1A 3AQUA 2HV5A 1D7KA 1QNRA 1UD3A 1IWPA 3T05A 3TTSA 4QEEA 1W5PA 3RPTA 3LHZA 1ONEA 2BHYA 4AVFA 1HKJA 3VM5A 3QPZA 3IUIA 3N2BA 1W2PA 2E3ZA 4RV8A 3LNMA 2XINA 4QDMA 1RVKA 3OW1A 4N02A 1XYCA 1JCNA 1Z89A 3ID7A 4CU6A 1KW1A 4MNLA 2FVMA 1K7EA 4PUKA 1BTMA 5CCZA 3I6EA 4AVNA 2FMOA 5D38A 1VQTA 3RMJA 1K6AA 3R25A 1UC5A 4DBDA 5KETA 3IPWA 2CLEA 3VKDA 1XUZA 3E12A 1EB3A 1UBSA 2G50A 1P0BA 3B8TA 1UBPC 2HXUA 3MPGA 1E0WA 4MFDA 2WJEA 1CXKA 3LUTA 3S5YA 4GJJA 4QSHA 4CD4A 3W7GA 3I65A 5G1MA 4KEZA 4DO5A 3TDFA 4HPNA 3BAJA 2DW7A 2WZTA 4KESA 1LTDA 4FR1A 3CH0A 5CH9A 1ZLPA 1O1HA 2E0PA 4BQ2A 2ONEA 1U30A 2OZTA 4AWEA 1R9ZA 1WB0A 1OC7A 2B31A 2OPJA 3RNDA 1LUCA 1Q6DA 2J27A 3WNKA 5G1YA 2WZEA 1E6NA 2Y0FA 2CHNA 3D46A 1GZGA 1GKQA 4A21A 4NX0A 4JQ3A 4LS2A 2C19A 1L6WA 2D2JA 4TTUA 1Q6LA 3BARA 5A6BD 1E0TA 1BVWA 4ZE4A 5FJIA 2QJJA 3DYPA 3AXKA 5M2FX 3NSMA 2GUYA 4EP8C 3ITLA 3VILA 1LBFA 3PTQA 5HPCA 4I9AA 1RBLA 3EWDA 3VZYA 4EWJA 9RUBA 4HVXA 1GOQA 1F05A 2ZZ7A 4GGBA 3NM3A 5IBXC 1XWYA 2ABAA 4A8NA 3ZJ7A 2VDHA 4M24A 4MKVA 1E9YB 1HIZA 1NP2A 4O52A 2X1UA 4AC7C 1Q63A 4CNSA 2NVAA 5C7HA 1IF2A 3I10A 2BY3A 2X40A 2G4FA 4S3AA 3VAVA 1TIMA 1FKXA 4ZFMA 1J4EA 1E6PA 2NX3A 3NR0A 1E73M 1EZWA 1JNEA 1V7AA 4L4OA 2RDWA 4DB7A 3WEZA 4RK8A 1FHLA 3M0IA 5DRIA 3KW3A 4KBXA 3G3MA 3DFSA 2PPGA 2XH4A 1CDGA 1VFMA 3TEVA 4REQA 4AC1X 3MSRA 1PHWA 1KKRA 2PP3A 4GX8A 2V3GA 3RO6A 2Y24A 3PBGA 2ICSA 4PL2A 2J7HA 1Q45A 3WK2A 3UJFA 4LUYA 3B8DA 1E1FA 3AXHA 3QRHA 3UY7A 5C55A 3CQIA 1FWCC 3QHMA 5I0DA 1S2UA 4JFTA 3GW3A 4JR5A 3SQMA 4HK5A 4LXFA 3C0JA 3D3FA 4PRWA 1GYNA 4JD4A 2C6QA 5CPOA 5A94A 7CGTA 1XLEA 2I14A 3KOWA 4ATLA 4D6EA 3NQAA 4XZMX 1OT1A 4JKKA 1TFVA 4V2XA 4WLCA 5DF0A 2D1ZA 4ZOEA 3UERA 4FXSA 4NI8A 1GW9A 3JU2A 2PBOA 1XH1A 1KRCC 3E2RA 3NYDA 1SVDA 3SZ8A 1E0VA 1MUMA 1IR1A 2FMNA 2OZ0A 5HBFA 2I16A 3GIQA 3SJNA 3M7SA 3BV7A 1VP5A 3TJLA 3K8KA 4LC6A 4BR1A 4FXJA 2WK2A 3AS3A 4JEQA 3VYLA 1IXQA 3DAQA 5C9WA 4E3VA 3FW6A 2PLKA 1KBBA 1UPPA 4WZHA 4WY0F 3QTGA 3LPFA 2V81A 1XLFA 5DRCA 2XH0A 3PULA 5FF4A 2NLYA 4P7LA 4F0LA 1V6XA 2ZRXA 2IW0A 2YDAA 3DKJA 4R7JA 2GJXB 3WO8A 2E6DA 3CPUA 1WDPA 4KFNA 5E70A 1IV8A 4FO4A 1XLBA 4GI4A 2DT3A 4XSLA 4IPLA 4E2VA 1VB9A 4KWSA 2GVLA 2FTPA 3TW7A 1TIWA 4XB3A 1OVDA 1XLIA 1UH2A 4Q4PA 3LI1A 3KTSA 1H7PA 5BXPA 4XZWA 4P8XA 1E3XA 2B7QA 5HJYA 1RPXA 3VD7A 3VFCA 1E6SM 3G2GA 1TE6A 4OBSA 3TK7A 2FVKA 3TKFA 4L56A 3DG3A 3LA4A 5JUVA 1I2RA 3OOQA 4GGHA 1LRQA 1Q6CA 1ODZA 5IDZA 3W25A 4CN4A 5CPNA 4RNJA 1S3TC 4LY4A 5XIMA 3KOXA 4XKYB 3AIRA 1GJPA 4WF7A 4YXGA 4K2SA 2A5HA 1B4EA 1NFGA 2DZTA 1EGMA 4N6FA 3EWWA 1UKQA 1FWIC 1W5OA 1VJIA 2PGRA 3CEUA 3RGTA 1BXBA 1A0EA 2DVXA 3UPWA 1FHUA 3VFLA 1JL8A 4RW3A 3D0CA 3R8GA 1QK0A 3HPSA 5FF3A 5LXEA 3ALGA 1LWJA 3WFZA 3SRFA 1EP3A 4C6BA 4JKMA 4F9JA 2YL9A 1B9BA 4OWGA 3LERA 5BXSA 3CASA 4FLQA 3CIWA 2FJUB 1VFTA 3SRHA 2J9ZA 1LL4A 4XZNX 1XLLA 5E6ZA 2NWSA 4Q4OA 1SUXA 3UVAA 1GOOA 1B54A 1E70M 4BJHA 4CU8A 4LUTB 4JN7A 1V7YA 3QR3A 1BWKA 3H2EA 5H8PA 3EWYA 4QG9A 3OGRA 4KMQA 4IIDA 4GO9A 3VGDA 1OF6A 1DP0A 4Y2WA 2DQXA 4D9PA 3M7WA 4JTIA 3M9YA 3Q65A 3EDEA 1ZFJA 2VO5A 4KW2A 1JZ3A 4AG0A 3WD0A 3GTIA 1FWAC 3QHOA 3PB2A 1TTPA 1W31A 1GK8A 3FJNA 3GHTA 1NM9A 4IQJA 3DFYA 5DANA 2DW6A 5CC3A 5AC4A 1S3HA 3MBDA 4WKAA 4DN1A 3TR2A 4S3BA 4F40A 4K7YA 1HKKA 2I9UA 3G1HA 1CGYA 4PMUA 2ZX5A 4JTUA 3AU2A 2Z6JA 1EIBA 3UD6A 4C7DA 5ABHA 1SZGA 5I06A 2GGEA 2PLJA 3BXWA 3HG4A 2J13A 4KWOA 3MYPA 1KV5A 3WIJA 2EJ1A 4MLJA 4US6A 4NNAA 3CJPA 1OGBA 4E8DA 3VOIA 5EFDA 2GSEA 3ARQA 3GRIA 4JFUA 4PN2A 1R87A 1IT7A 2E5DA 2XGIA 5D2YA 3TYDA 4GRSA 1MW1A 1I2NA 1J6OA 3S8HA 3POCA 3R13A 2GWGA 4I5RA 4PB5A 1GZ1A 2WZHA 3DFPA 3URBA 1J0HA 3I7RA 4XAYA 2QIWA 3D47A 4PE8A 4IXXA 1ZCOA 3CZJA 1JIBA 2WQPA 2VVNA 4C1NB 1XSJA 1VJZA 2GGJA 2V5KA 4UQEA 3CLWA 5FL1A 4UFLA 3RG6A 3UR5A 1OCQA 3URQA 3W7MA 1LL6A 3W72A 1EEPA 2BB0A 1ZP4A 4HKPA 4EKJA 1TTIA 2IQDA 2WQDA 2XTKA 1D8WA 4LAOA 3CTTA 4QCFA 5CEWA 1B57A 2PDBA 3PM6A 3A3XA 4FS9A 3PP7A 1S2VA 3QMTA 3TXZA 3SAZA 1W1ZA 4UB9A 4NVTA 3OLGA 4ZSUA 3WH6A 1ZAHA 4I90A 2JGYA 2NQHA 2EPMX 3BCJA 1VLWA 1ISYA 1YHTA 1QTWA 3S0CA 2D22A 4ONVA 2DZVA 4DUOA 4HP5A 1XS2A 2G37A 1MW0A 3W1MA 3AYTA 3TONA 1PTDA 3CHEA 2D0GA 4JXCA 3IAQA 3W7QA 1AG1O 5AHEA 4Q33A 4E4UA 4NZ1A 3WD4A 3G1DA 1TA3A 2VR4A 4RNFA 3W01A 1B4KA 3N34A 4J7RA 3BW3A 1UYQA 4CU7A 1PJ9A 5FF2A 3T0DA 4DI8A 4HMNA 3GVWA 1A5UA 1OFBA 1PXGA 2BVTA 1P6BA 4AD1A 1VH7A 2ZX9A 2X09A 2EHHA 4H9MA 2E1WA 3NQCA 2ZXQA 4G9PA 3PJXA 4I9MA 1M03A 1FXQA 1XH2A 1KFLA 1V3LA 3OBAA 3BG9A 1IXPA 3HM7A 1F3XA 2VGIA 3OZYA 1R38A 1EYWA 1IGSA 5AHFA 2ACRA 5J5DA 3VXGA 8XIMA 4LAUA 1J0IA 4BY3A 3L5LA 3W7EA 1NDYA 4GQRA 3EDJA 2X41A 3WLTA 4MADA 3LLFA 3IIZA 1TMHA 3O0FA 1HJXA 2R14A 1RCXB 3S5OA 1SO5A 3C4UA 5HNNA 3OP2A 3EOUA 1VLIA 1E5NA 1NFBA 4LALA 5AHNA 1EJSC 1VEMA 4HHPA 1IT0A 3ZZ1A 5EFFA 1U1HA 5M3WA 4Z2GA 1FWJC 4MNJA 4JOMA 3VDAA 3QH2A 3LNPA 2DIJA 3MDUA 4QJ1A 2PP0A 3EWUA 4G2DA 1WV2A 4H6RA 2YFNA 1VCVA 2PLMA 7ODCA 3NZGA 2VFFA 4PRRA 4M6QA 1W1IE 3MSGA 2QCNA 2Y62A 3TLLA 1CLXA 4W86A 3RPDA 1XYLA 1WOBA 4AX6A 1RR2A 4EPBC 1SR0A 2ZFAA 1MI3A 6ALDA 4EPEC 1QPOA 3EKGA 2YCJA 5D05A 1XH0A 4JFWA 1EWEA 2PWUA 2PDFA 4QNEA 4EAMA 1PYMA 3S46A 3CAQA 1JPMA 1EEXA 5KZDA 1J9YA 3NQMA 4HJFA 1Q7MA 5CSYA 1JPKA 3RM8A 4UTMA 4CUCA 1I9CB 1TELA 3QZEA 4IWWA 2DQWA 3OLEA 1QI5A 1J5TA 3N11A 4GIAA 5BXTA 1I0BA 3HPAA 5DN1A 3GHSA 2HS6A 4B91A 2Z2BA 4WRHA 1B30A 2V2CA 2ZRWA 1LQ2A 3UWQA 3PUEA 3TN4A 4LAKA 1K8XA 4QM1A 5GJPA 4H9UA 3M43A 3W7PA 4IPIA 1XIHA 1V3MA 4TV6A 3FKKA 1FDZA 2VNCA 1HL8A 3V36A 3O6AA 1MEHA 2NX1A 2C91A 1KXHA 3M0MA 2CPUA 5HR7A 1D9EA 4C5ZA 5LXXA 3NDOA 2C1HA 3ZR6A 2RDTA 3CPRA 4L1XA 1QDSA 1XLCA 3CQHA 3DFHA 1ZBCA 4O53A 1K9EA 1R5YA 4GXMA 2YCIX 4M1RA 3H2AA 3PHAA 3GYEA 4FB7A 1X1NA 4RZ6A 3CV7A 3WBYA 1TWIA 4FF7A 2OU4A 2QULA 1ME8A 4L4LA 3RX3A 3INPA 2GDQA 1CXIA 5D02A 1UUMA 4BQ3A 1IWBA 4ZQOA 1XLKA 1WAUA 4AISA 1R7OA 4TOQA 1KNWA 4IG2A 1VCFA 3PZOA 4YVVA 1K9FA 3C86A 3U2OA 5D33A 4GUIA 3GX9A 2GOUA 4XAPA 1WDWA 1OQFA 1DKWA 3PR2A 1J8VA 4TU1A 1U22A 2REQB 3WQVA 3DFOA 1DXFA 4AH7A 1PYFA 3ZLHA 3C2OA 4LPCA 4YTTA 2O7QA 5MHBA 1NU5A 4W93A 1DWGM 3ZR5A 2ZZ5A 4N2YA 5A95A 4MF4A 4MUZA 1SR9A 2W3ZA 3RF9A 4LNYA 5T9BG 3ZJ6A 2QDHA 4K1WA 1C8YA 4O1AA 3W70A 3D3AA 5B80A 2CXGA 2D2OA 1T8QA 4GY7A 4CNUA 4GPNA 2QMJA 2XIMA 5JIPA 1NARA 3TIMA 2XVKA 4MY1A 4QR6A 3THDA 1WOAA 4ATDA 2R91A 4F79A 1FWDC 4ALDA 3SCNA 1W3LA 1SMAA 2P0OA 3C6CA 3LCGA 4G6CA 5G1TA 1BWLA 1TMQA 1J12A 5D2XA 1U5JA 1JCYA 3THQA 1DE6A 4S38A 1TR9A 3P60A 3VKCA 5LA0A 4DUXA 3T0AA 4Q32A 4YTSA 2QUNA 4TUFA 2V5DA 1BYDA 3LMYA 4NYYA 1GWJA 3QPYA 3T0BA 1PX3A 3VE9A 3KBSA 1IEQA 4G1KA 5ABFA 3CS2A 3QW3A 4HHHA 1EC7A 3BLFA 4EWND 1UR1A 4JNYA 1A3WA 1KFWA 2NV2A 3ZWTA 1F4AA 1WDDA 5I07A 2D23A 1O1ZA 2J7CA 4KGLA 2F6UA 3B0PA 4KWVA 2XPKA 2A2IA 3KM8A 4RDVA 1M3UA 3ZT6A 3AUJA 4MG4A 6REQA 2PDUA 2CZVA 1RQBA 3PBVA 4HGXA 5IXEA 1VKFA 3GKAA 2D0HA 1EBGA 1J0ZA 1CGXA 5D8ZA 1C92A 4AWSA 2CXEA 3LB0A 4IQEA 1YPFA 1EYEA 3BTNA 2P3EA 3BO9A 5ABFB 1KFEA 4FX8A 5CC5A 1M65A 1S2AA 1EIXA 4AZ5A 1ITCA 2QAFA 2XVPA 4XK2A 1KBIA 5LKYA 4QISA 2TRSA 3KP0A 3EOEA 3OBEA 4GJ1A 3T4WA 3AMLA 1P0KA 3STGA 3VD4A 3WQEA 2JEPA 1WKEA 2FZ9A 4NRSA 1TWSA 3APYA 5D37A 3RM4A 2QDDA 1TPWA 3KEHA 1C8VA 3UU0A 4AUBA 1E6XM 4NAEA 3S2LA 1GQIA 1R6WA 2VYOA 3GIPA 5HATA 1W17A 3PB0A 3CHCA 4W84A 1ZHAA 3VNYA 3R0DA 1J0KA 3ES7A 2ATMA 1TV3A 4QDPA 1PKYA 1JCJA 4F48A 3C2FA 3LLDA 1SM9A 2RDXA 3FYPA 2ABBA 3BUVA 1LLOA 1NQKA 5AC7A 3TC3A 4OIFA 3GDMA 4HK7A 1TV7A 2A6LA 1YNYA 3W2UA 3VGHA 2QKFA 1EGVA 3RRXA 1W54A 3UZ5A 2ZWYA 3N19B 1XJBA 2VJXA 4ZB2A 1EKOA 3V35A 1K77A 4AD5A 3W2MA 4GZEA 1XIEA 5H1WA 1F2JA 4UCFA 1FCUA 4DBUA 1RXOB 4GZJA 3FEMA 3TC6A 3LS9A 3G6LA 1RY0A 3SN4A 2W9MA 4K37A 2G95A 4ZVJA 3SCRA 2ZVRA 2PRLA 3PNZA 3APTA 1NAL1 5AFDA 1IZJA 2XH2A 1KTNA 3L21A 2DZAA 4P7OA 3TTEA 3ZSTA 1G9HA 4WVXA 4PTDA 3AROA 2BFGA 3L5MA 1PIGA 1MW3A 3N29A 4N4QA 2A1YA 4WKFA 1B1YA 3WJXA 2OX4A 4IIGA 3C3UA 3AS2A 3PZVA 4NILA 3SFKA 1QI4A 3W1UA 4FOJA 4R5EA 2FDMA 2CZ5A 2Q8XA 3PZNA 2NT0A 3CEPA 4OFCA 3H2OA 5HULA 2EJAA 3WFLA 3MWAA 2WNZA 4Y9PA 1IR2A 1KBJA 4CQBA 2YXXA 4ZO6A 2XJ7A 4HPHA 3XINA 1VIZA 2I17A 2WMIA 5BRBA 2WMIB 1TPH1 3VKJA 4DO4A 4GH3A 3VCRA 2OWXA 5CQ1A 4NG3A 1WBJA 6REQB 2C7FA 3WUEA 1RY8A 5EU9A 3ITCA 3W76A 5C2GA 4LANA 3ANYA 3W27A 3RK8A 1R3YA 3AIEA 3PG9A 3GR8A 1FWTA 1Y5XA 3L66A 4XQ6A 1O6IA 4H01A 4DWSA 3H4XA 3UXDA 1XRVA 1G4PA 1VENA 4M6UA 3MU7A 2IMRA 4DJDA 4ZQRA 4DZ5A 1LWHA 3U8GA 1DJIA 5D8WA 5FF0A 2R9RA 1XBXA 4KIEA 2WVVB 2ZE0A 2E77A 4QP0A 1UQZA 3M0XA 1OT2A 2HPIA 1JPHA 2ACSA 4IMDA 3BMVA 4QX4A 1TREA 2GFTA 3W07A 3WDJA 4TVCA 4QCEA 3REQB 1HT6A 3O06A 3GFZA 3M44A 2QW5A 2E6AA 1EJ7L 3K1GA 4G5DA 4X0NA 8TIMA 1SQ7A 4O4VA 1ZP3A 3JVAA 3S2NA 3DG6A 4QJ5B 1BVNP 3SUTA 2Q6ZA 2BX7A 4U31A 1GOWA 2UY4A 4W85A 4PEEA 3I6RA 4B4FA 2EEXA 1VBHA 4ERIA 3SI9A 5EKYA 4AIUA 4IL2A 4CQ9A 3AFBA 4R9OA 2EKGA 3MI6A 5EGRA 3LYEA 1BSIA 4M0XA 3I3BA 4HHLA 2V6AA 4BF5A 3KZPA 3GIYA 3W1NA 1LT7A 1CGTA 3W7LA 3M46A 2G0WA 2FIQA 1DWAM 4RCXA 1CXHA 1GKRA 3NOEA 3V7PA 3HQNA 3T8LA 1KCXA 3FS2A 2ON3A 1HKMA 1SZFA 3NQ2A 1ZBVA 3ZWSA 1M7JA 3S6TA 5CSUA 3GUGA 1F9CA 1P4CA 1E4MM 1OG0A 1HGYA 2X2GA 1ZS2A 3VOCA 2V38A 3U2EA 3OIXA 5XINA 1EUNA 2W79A 2ZWZA 3JR2A 4U2ZA 3FA5A 5J5RA 5CPMA 3OGVA 3NYZA 1EA9C 4YJ5A 1T96A 2PA6A 1OYAA 4UZUA 2ZC8A 3DKLA 4W87A 2PRMA 2E40A 4FK9A 2HZGA 3S5NA 3A6OA 5FJPA 1UWIA 3DGBA 4UQDA 5LGXA 1K9TA 1CLVA 1YDVA 3CHVA 1ONWA 4WSJA 1E5JA 1YXCA 1UZ4A 3C3NA 2NWRA 2O55A 4WJEA 1Q65A 5HR6A 1QCWA 1H1NA 1H0IA 1DWFM 1JI1A 1EUAA 1YPIA 4GYKA 1DBTA 1WQ5A 3UG4A 1JDDA 3R43A 2Z0IA 4H19A 4WD0A 3BK0A 4Q4SA 2BY0A 3TQVA 3O6CA 3U5UA 3SDOA 4F9DA 3BV4A 3FLUA 3QSTA 2ISFA 6XIMA 4IP7A 3EEGA 4V33A 4HN8A 2GVJA 4ERGA 2G3NA 5CBJA 2L5HA 5T26A 1Z7AA 3GHUA 2PDPA 4ZQPA 3TQPA 3SURA 1QRQA 2FZ8A 1BGAA 1LWIA 2WCSA 3BJFA 3RU6A 1U5VA 2DSKA 3RJYA 2WXDM 1R8LA 1S39A 2WM1A 2ZZ1A 3BLOA 2C14A 1KCZA 4O1DA 2VOMA 3NO1A 4US5D 3GD6A 3SCVA 4HCLA 3DHFA 5J8LA 4D1JA 2HJPA 2IXUA 3LHWA 3WLRA 1JUBA 1H5YA 1CB2A 1RBOB 3W2KA 3HOJA 3N25A 4ZOBA 4JTSA 4YS1A 2VKZG 4AF0B 1X6NA 3P0XA 4KCWA 3V0SA 5HJLA 2QYGA 4E4FA 4XTDA 4F0MA 3U4FA 5F4SA 1UWAA 2FHFA 3B06A 2FZDA 4LCQA 1JDEA 4CNTA 4X63A 2WSYA 4HYVA 3A4AA 5I24A 3A47A 3URNA 1DIOA 2VQUA 3W22A 3AIBA 3MTWA 4GH1A 2P76A 3SGGA 5ABGA 5I03A 1KXVA 2OYMA 4E6MA 3GH5A 5HQMA 1DTUA 3R89A 5BCAA 4I3GA 2NV9A 3QQWA 3TSBA 4IIEA 3RPMA 5AC5A 3P5ZA 3UEQA 3VNJA 2HXTA 2WKJA 3KAOA 1FY6A 3PZGA 4U10A 5IFTA 1C7SA 4B4HA 2HCVA 4EXBA 1O5QA 1VEOA 3GTFA 3DDMA 4DIAA 3KLLA 4UFHA 4Y9AA 2PBGA 5A6TC 3STCA 2V63A 3E74A 3CL6A 5BU9A 2VZTA 5CG7A 5M03A 3BPWA 4M1BA 5HDRA 3WEOA 3GTHA 2VX4A 1KTBA 1VD6A 1OZQA 4GUFA 3SFWA 4KKXA 2F84A 2GQ3A 4OV4A 4F2BA 4Z2JA 3E9AA 3VMOA 1W3TA 3R10A 3K4WA 4Q6JA 3DU0A 4NX5A 3T07A 1XSIA 1HP5A 1PKNA 1IXOA 3BANA 3AMKA 3ZT5A 2WJFA 5DFAA 4O14A 1W3JA 4H3DA 4HSHA 4ORMA 5AECA 5A6AA 2CBIA 4UTWA 5A3HA 1H7OA 1U1UA 2CWNA 1PX4A 3TVAA 3CNYA 3ARRA 4M7SA 2FH6A 2XGBA 3W87A 3AHVA 1TWZA 2DZPA 3CQJA 3W73A 4HPXA 3RILA 1C29A 4MWAA 3MUXA 3KLKA 3SCQA 4H1ZA 3CGTA 3HU7A 4XZIA 3GDLA 2WMKA 2QPSA 4O18A 1S5TA 3B04A 2OZ3A 4FNSA 4NF7A 4P7QA 2DPEA 4IL0A 5A2CA 1BQGA 2WC7A 4GMEA 3AOFA 3TUUA 2ZBTA 5EA9A 1TJ2A 5CGQA 1SPQA 1W8GA 4HU8A 4JFVA 1ECQA 3W1TA 3CYVA 3TROA 4LVGA 2VFIA 3ZYZA 2DVUA 1D8CA 3A5FA 1EFZA 4IPNB 3FFSA 3VIOA 3W38A 3WQ6A 3P74A 3ONCA 2D24A 1ZBWA 1ZNNA 3H7RA 1NF0A 2A7NA 3S1GA 4LQ1A 4B3LA 2CEQA 3W7JA 3U7BA 1XLAA 2I1OA 5HUOA 4K8EA 3IWPA 4X9YA 4D2JA 4R88A 2OR2A 1F6PA 4PMNA 4FALA 4KWWA 1HJQA 2HISA 5D9PA 1SO3A 4LBSA 2HSAA 1GHSA 4DO6A 1E40A 3M0YA 1TZ9A 8RUCA 1XFCA 1QOXA 1F8IA 1V08A 3DG7A 1R85A 5AY7A 1MQPA 3Q37A 1J18A 4JTTA 1XD0A 1JJKA 1FDJA 1FUYA 4KGJA 6PTDA 1LG2A 4O17A 3GU9A 3EA1A 5KMYA 2PDLA 3C0SA 3LI0A 5K9XA 3MWCA 1Q5MA 3P67A 5CZ0A 1EOMA 2GOKA 4NP7A 1P43A 2ASHA 1BYBA 1M5WA 3P14A 4ML9A 1CTNA 3Q45A 4N7QA 4Q8VA 4HMEA 3VGFA 3OG3A 3LBMA 4LW7A 4AYGA 2GUUA 2XIJA 1KFCA 2DZBA 3H26A 3RLHA 4M6VA 1A80A 2R1PA 1ZL1A 3N04A 2G3MA 1F3EA 3PPGA 1VBGA 3TSDA 4AW7A 1BD0A 5T8GA 4A2SA 5F4WA 1XLGA 4OGZA 3G8RA 1SMDA 1DPMA 1WUEA 2QCCA 3F2CA 1KM3A 4A29A 4RNHA 1JAEA 4RJEA 3AIWA 2PF0A 3UPBA 1O60A 2Z6IA 1S38A 5CJMA 4MZ1A 4GUGA 2DSWA 2EG6A 3EB3A 3WDPP 3PZUA 3DZ1A 2EPHA 1QHOA 1GVOA 5FAJA 4Q8WA 4HTYA 2XVLA 2OLAA 4RZ4A 5EMLA 4QJ3B 3TU9A 3QGVA 5HANA 4J3UA 4HMDA 3AYSA 5BU6A 1CX9A 3TJ4A 1N8FA 2E9MA 1YW1A 2Z25A 5FI8A 2PDXA 2C8NA 4HNVA 3W7RA 2ZC1A 4ZQMA 4GCXA 1W9UA 1Q6QA 3H2NA 3LRLA 1JFXA 2OEJA 1JZ5A 4W5ZA 1QO5A 3PTKA 3PFRA 5G2IA 4YPJA 4Z42C 4HNNA 4Z2HA 4IMEA 4UTUA 9XIAA 3UWEA 4C7GA 1RBAA 2WAGA 3E0WA 2DIKA 3OA3A 5CGMA 1POKA 3KBNA 4JY9A 3GW0A 1VFSA 1XGEA 3S1VA 2HEJA 1WDSA 3OJGA 4PUDA 1JCLA 2VWTA 4FPSA 1EJTC 4IGHA 2XISA 4DUWA 3UZXA 2Y5EA 2D20A 1KBKA 3XISA 4EXQA 4RNIA 2WPGA 1JXKA 3N14A 2H90A 2IPFA 4LEFA 1BKHA 1NDZA 2YZ5A 5F2MA 1KWKA 1VPXA 1AW1A 1QI2A 4NU7A 1MRAA 4XO6A 3IGUA 4QSFA 3R0KA 2GYIA 3N2MA 2XU2A 3MMTA 1UHVA 4X60A 3LD5A 4O54A 2J74A 1W3NA 2ZRZA 2PDHA 4MPQA 4CVWA 1S5WA 3UXAA 1QVBA 4S23A 4PCFA 6CGTA 4WJ8A 1C90A 2REQA 4P7NA 3B9OA 4TV5A 1IZKA 3DHPA 3PJTA 3VDGA 3S5SA 4CNNA 1XBZA 5KZMA 4AFYA 1XP3A 2F6KA 3WELA 5BRQA 1GQJA 3R5EA 3TYEA 4MB3A 3TYBA 3R94A 4DZIA 3DENA 3NXFA 1GJWA 2ISWA 2ZZ6A 4PBGA 3T2QA 1MEIA 2Y63A 2JKPA 1HW6A 1MXSA 4PSRA 2MANA 2PDIA 3ITXA 4UBPC 5C9ZA 4UTHA 3G1VA 3BQ5A 4Q4QA 1ELSA 1CEOA 3NGFA 4JTKA 2FB3A 5CZKA 3W23A 3VKKA 3TWBA 2PC8A 3L4WA 4D6CA 2XG9A 2E67A 4JICA 4NZ5A 3BH4A 3LK6A 3GC2A 2OLSA 4LOCA 5IFPA 5DO8A 2DJLA 4NNBA 1QOQA 2JF6A 4WX2A 3WENA 4XZ9A 2CESA 3DFTA 4GVIA 2WVUA 4R7OA 3KWXA 3WLIA 5A6KA 1JPIA 1JRCA 3AISA 4EACA 3CMJA 3ABXA 4XX6A 1AH4A 4K8HA 2HRWA 1FH7A 4L9XA 4WIWA 1OFRA 3VVGA 1E72M 3AS0A 3RHGA 5GJMA 1V51A 4NZFA 3W7DA 1OCJA 1XG3A 4QQ3A 1WDQA 5DEZA 4GYPC 3C61A 3A3HA 1X8FA 1J5SA 2JIEA 3G22A 1FDYA 1QR7A 2P3ZA 3R6IA 4B5TA 3FJ4A 1MNZA 1QNQA 2R82A 1QHPA 4I6VA 5T91A 3F7JA 4TR9A 1R3QA 3TYAA 4MJ4A 4KCUA 1R2SA 4ZSTA 2PGEA 1NWTA 3A13A 3L0KA 1BF2A 4FAMA 1JGIA 3WCZA 1VYSX 1GQKA 3N6JA 3WNOA 3CK5A 4FIRA 1EBHA 3SN0A 2XFWA 3R2GA 4ZB5A 5GJNA 3VKBA 4ACZB 2CLHA 3GNNA 1TQXA 1XX1A 3PJWA 2HS8A 4JGDA 3TC7A 5A6MA 1BVZA 5HNRA 4WSKA 1YTDA 3WQWA 3GFXA 1XCXA 2DSUA 5G4HC 4X2PA 1G5AA 3NVDA 3QOMA 4DY1A 5A8MA 4L1GA 3WLSA 2EGZA 1SJCA 5GQBA 5DCDA 4CCEA 3EKZA 3GU1A 1A0CA 3J7HA 3QOKA 3TNBA 1H1YA 4LUSB 1M01A 2IPJA 4E8CA 2VR2A 3WMBA 1MFVA 1HUVA 4RX0A 1EH9A 2QJHA 3B9EA 3OHMB 1LOQA 1FWGC 1IYXA 4IJBA 1TUFA 1K8YA 1F3TA 1KM6A 1G7UA 3EDDA 3SQSA 3WH9A 3W2NA 4MWAD 1UWTA 1PSCA 3CWOX 1TV5A 4TX9A 2CYGA 1DVJA 3WJWA 3TYCA 4UXDA 1WYIA 4PMRA 3SR7A 4F2TA 3UJ2A 3HF3A 3P84A 3AIVA 1DV7A 5CPQA 3RUBL 3ZR4A 3QR0A 4ADTA 1XRFA 1TPC1 3RO8A 1XC4A 3EYPA 1KFJA 2BY2A 3EXSA 2JBMA 3BJTA 3QPEA 1HJWA 2A3AA 4XWUA 3VMPA 1BRLA 4Y8EA 1ONRA 4Q8QA 4P8WA 1XCWA 1KXQA 4OTKA 2EQDA 1KKOA 4PMYA 3GWQA 7PTDA 1GGOA 2A6NA 2Y4SA 4Q8TA 1QO2A 4LUTA 3VE7A 5XIAA 4BI7A 2PD5A 1S5VA 2D69A 3S4TA 1K03A 4UTIA 3CUGA 2QGHA 2Y88A 4JX5A 3DBPA 3ECQA 4UOQA 4IP4A 1EDQA 1M04A 1UWRA 2XM1A 1SZNA 5CJ5A 2RJHA 2W27A 3NWRA 4NL1A 2OGYA 4IJRA 3WF0A 4O8AA 3MCNA 2A3LA 1L2UA 2WSQA 1EQCA 5AHLA 1LUCB 3MMUA 1L0PA 1UKTA 2Z00A 3LPGA 2OGJA 3E3HA 4EOUA 4QXIA 3MP5A 3NPUA 5I3FA 4U3AA 2A3CA 1QW8A 1RHCA 2GLKA 4HU3A 1SW7A 3MCMA 3OBKA 5FACA 8CGTA 2Y61A 2OYLA 3WBXA 1W37A 4EE9A 1WE5A 3WZ0E 4DAIA 2HBXA 2HE5A 4Y9OA 3LBCA 2QVHA 3M64A 3SRKA 1RZMA 3TTQA 1LZOA 1V0LA 2DP3A 5GNXA 2VRQA 4KPLA 3BSGA 2R94A 4JTLA 3GG7A 3Q58A 1K4GA 4J40A 1FWFC 3WD3A 4MZYA 5CBBA 2QUTA 2DT1A 2VI0A 3FHQA 3SUWA 3W4RA 2VGBA 4U5IA 3WY1A 1P7TB 1NVMA 1EJWC 5DQPA 3OVQA 1SFSA 3N15A 1J93A 4RKAA 3RU8X 3Q94A 1OX4A 1SFJA 4U4MA 3NSNA 2X0HA 3O2LA 1HQTA 2BXVA 2XSAA 1PCWA 3B0XA 4ZENA 1QJWA 4EANA 3L9CA 1LCOA 1TE1A 1JPDX 3EOSA 3BW4A 1TX2A 3ZXWA 1BYCA 4QE4A 2IUZA 4O1CA 2CBVA 1TJPA 1NEYA 1EA0A 4C6LA 2Z1XA 5G4WA 3L67A 4Z2LA 3DERA 2V3FA 4FNTA 3VUSA 4AZCA 4ZO9A 4IMCA 1BSLA 3ANVA 2BBFA 3WNLA 1QPQA 1QWGA 4JTCA 2VL4A 1FRBA 1PAMA 4JYDA 4LWWA 3RFAA 3V4BA 1XG4A 1SSDA 1UPMB 3QXBA 3FJLA 3W88A 1TCMA 3LXBA 1YLVA 3BW2A 5BRPA 2RAGA 3MSDA 1TRDA 1B3VA 5AB3A 1XGDA 1A50A 4K38A 4UNKA 2V30A 6TIMA 4MDPA 3KX6A 1XPGA 4GVHA 5GNZA 1B3ZA 4YHGA 4LJ3A 1TSIA 3SRDA 4BEQA 3MZNA 5BWFA 2C3ZA 1FQ0A 5CAKA 4C7FA 4ZGYA 1ADDA 4KIRA 1CLKA 1X7IA 2XFRA 1B9ZA 2PGWA 3N12A 3STFA 3LTYA 1JCXA 1US2A 2P1FA 1OCBA 3JS3A 4ZO8A 3NNTA 2V2DA 3AS1A 3H22A 1SW0A 1AQFA 3ITYA 2F61A 1UR0A 4J3XA 5D32A 2W62A 3MKKA 3TTOA 3P80A 3O07A 1Z42A 4DVOA 4PMJA 2QDGA 3AWOA 2PP1A 2CHOA 2V5BA 1I75A 3V5CA 3L4VA 4HT3A 1W3IA 3GXDA 3HPFA