1JQVA

The k213e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPEDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase A
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqvA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqvA01
3VI2A 2Y7GA 3IVSA 3VNDA 4FX7A 4FNUA 3MJYA 1M5WA 2ZZ4A 3QJAA 3TC7A 3MHFA 3ZWSA 1R46A 3CT7A 4MPQA 1A5SA 1KTCA 4XUGA 3G1YA 3FJ6A 1TJPA 1I2PA 3VCRA 3UQNA 2DZVA 4MZYA 5DY2A 1QPQA 2ALDA 1T99A 4RK8A 1DHPA 3S1WA 3CWNA 4JN6A 3B04A 5C5YA 1EP3A 3IIOA 3MI3A 4ONVA 1J5TA 2X1UA 4XTDA 1TV7A 3L5MA 4XKYA 4JTLA 4FX6M 1VC4A 1X7FA 4R53A 1Q45A 2TRSA 3GDMA 2J9ZA 2RH9A 4O17A 1BTMA 2DZXA 4IGHA 3G8EA 1WV2A 4JX6A 4GUJA 1R2RA 1NVMA 4LU0A 3DFQA 3TAOA 2PCQA 5K9DA 3W75A 3TU9A 2NV1A 1O94A 4AH7A 4UR7A 3BG3A 3PUEA 3KRUA 4IQLA 1AW1A 3MP5A 3PBVA 3KXQA 4RZ5A 5AC7A 3TUUA 1OHLA 3SW6A 5E0KA 1KM1A 1ZCOA 1O5XA 5CKSA 1DQWA 4LVBA 1SSGA 5EMUA 1NF0A 1P1XA 2F7FA 1JVNA 2NUXA 4AXKA 4WOZA 3FJLA 1L6WA 5C55A 1KM4A 3TSBA 5KZMA 4MY8A 2FPTA 4O4WA 1TREA 3MP3A 3MP4A 1FWNA 3GXTA 4WZHA 2C13A 4HPJA 2ZBTA 4CCEA 1O5KA 3P5ZA 3GDLA 4XTIA 1VGAA 4O8RA 4O18A 1ICPA 3CB8A 4QJ1A 3PM6A 5HULA 5F2IA 2Y7FA 3IIXA 3S5OA 1LBFA 1LLZA 4ICNA 3W7RA 1N7KA 4OBTA 5LNUA 4ZQPA 2R8WA 2V82A 1D3HA 1TRIA 4I7WA 5G5IA 2E09A 2QJIA 2CLEA 4UFKA 4CLMA 4CQ9A 1OX5A 3TC6A 2VFDA 3MI2A 1WBJA 4PFMA 4ZQNA 3DGRA 3QZEA 4OE7A 4QSHA 5I3FA 3NO5A 2EPHA 3KRZA 5CZTA 4LOCA 2EHHA 5CG7A 3EXTA 1FUYA 5F1VA 3HG3A 1JQXA 3P82A 5HQEA 3W1RA 3P61A 4AEOA 3LBCA 1W3NA 1SFJA 3PG9A 4POCA 1FDYA 3M5YA 2YX0A 2ZFAA 4LUJA 2E6AA 3M47A 1SSDA 4O15A 1QR7A 5CZ0A 4M7SA 1GVRA 3E12A 1I2NA 3H54A 4BK9A 1XBYA 4O0ZA 2O7QA 4MLJA 2E1DA 4NNBA 3UY8A 1VYRA 2WKJA 1AW5A 3F4NA 2JKAA 3EWXA 1LBMA 1G4TA 3WK3A 1MZHA 1DOSA 1EPXA 3ABRA 4N4QA 4ML9A 1OX4B 5CPMA 4O50A 4N9BA 1TIMA 3DH7A 3MBDA 2C19A 4H6KA 2QCLA 3ABOA 1DKWA 3W84A 4GJ1A 3GKFA 3W7NA 4EOUA 3TK7A 1O95A 4P61A 3C2VA 1OG0A 1WDWA 3N19B 4KWWA 3LCLA 1KTNA 5G2HA 1ZAHA 1G7VA 3TQVA 4AMAA 1ZENA 3I7QA 2V81A 3G0SA 1ME9A 2VFHA 2ABBA 4AVFA 2VKZG 4AF0A 4LT9A 1SO4A 2ISVA 5BMXA 4OGZA 1GG1A 3M43A 2QAFA 1FXQA 3WJYA 1RQBA 3N9RA 4LS1A 1YLVA 4FNRA 4GRSA 1WOAA 4S1FA 3W2KA 1W5NA 4NNAA 2JKEA 3BG9A 3C56A 3UYCA 1DJQA 3W23A 4JX4A 3HQ1A 1HUVA 5K2ZA 4XZ9A 4J9JA 5TIMA 3P67A 1YXYA 1EWEA 3CHVA 1FDJA 4BF9A 4WUIA 3HG2A 3R8RA 1LBLA 1LROA 3U8GA 2B7QA 4JDBA 2X16A 1LORA 4R33A 2Y62A 3S6DA 3W1MA 3GXPA 3GAYA 1QWGA 1K3UA 3HB9A 4HNVA 1JCMP 3W7EA 4AAJA 3QFEA 2JK2A 1KFCA 1OFEA 3DFPA 3NL3A 3BW2A 2Q3OA 3QRHA 4M6QA 5KSWA 1LRQA 4O57A 2C0AA 3M7WA 4QITA 1BWLA 3HIJA 1SR9A 5BMWA 2NX3A 1M7OA 1SO5A 3NM1A 3NZRA 2FB3A 3L5LA 2GQAA 2VXNA 1GOXA 2Y85A 3CU2A 3BLFA 3GB6A 2B4GA 4O16A 1SO3A 2ZZ2A 1FY6A 2V8ZA 1CW2A 3G0UA 5FEPA 1Q6LA 3HMJG 1BWKA 2ISSA 3KVJA 5F4WA 3EXRA 4AF0B 4Q32A 1EUAA 3LHVA 3GVGA 1PCWA 1W5PA 2CLFA 1O4UA 2WOQA 1QCWA 4O4VA 2KZHA 2ZRUA 1EA0A 3TNOA 1FCUA 3RMJA 2R94A 1A5AA 4UTTC 5IBXA 1H7NA 3NAVA 4JTUA 4JYEA 4BFAA 3ZFHA 5KTLA 1LOSA 1TSIA 3LTSA 1VPXA 1JCXA 2CZ5A 2A0NA 4WJEA 1TCDA 2DU2A 4RZ6A 3M5XA 4WY0B 1K8XA 1PCKA 3W6YA 1IGSA 3NDOA 3GIYA 1YYAA 4Z1CA 1W5QA 3W87A 4NJIA 3G22A 2FQIA 3LM7A 3NPXA 1W1ZA 2E77A 3A5FA 5TQLA 3K30A 2GVGA 3O1NA 3TQKA 2Y7DA 2VEKA 3E9AA 4E0CA 2V0TA 5GVJA 4X9SA 3FYOA 1AL8A 3R5EA 1EUNA 3WJXA 3C2EA 1C8VA 4P2VA 1X8FA 3G1VA 2NV2A 3PF3A 4E2DA 3IVTA 4PH6A 4RCXA 3QF0A 3QH2A 3PG8A 3NGJA 1AW2A 5D32A 2P10A 1K7FA 3THAA 3PC0A 3W7LA 2YZRA 1OYCA 4RXGA 4WX2A 4NJJA 3W1AA 1TTPA 1LRTA 3TV8A 4FO4A 2C6QA 3LV6A 3KVMA 4MOZA 3E0IA 1XI3A 2QF7A 4X3ZA 4K7YA 4NZFA 1EP2A 5BNKA 2W79A 3LBMA 3B8DA 3DFOA 3SR7A 1TTQA 1A53A 5K3VA 4Z08A 1LDCA 4O54A 1EB3A 4M6VA 3NEVA 3M9YA 4YWIA 4X2RA 5DCDA 5D38A 3C3NA 3EXSA 4QIUA 1AK5A 1GYLA 3LCFA 1TTJA 1ZY9A 1DBTA 1PE1A 5IM51 2TYSA 1SQ7A 4K36A 3G1FA 3G3MA 3O16A 3S5NA 1OFOA 3STGA 2NXIA 1I2RA 3QMRA 3W7IA 4UTLA 5DELA 5HMSA 2NX1A 3D0CA 1W54A 1OK4A 4JTJA 3O8AA 1KFBA 1VH7A 4LNYA 3W7HA 3P62A 1H7XA 2UV8G 4LC6A 4LWWA 3GNNA 4UFMA 3N73A 1R2TA 1GVQA 2GUUA 1RVGA 3JS3A 2WSRA 4NJKA 4TR9A 5AYZA 4MJMA 3G1SA 3EX3A 1GG0A 5K4XA 2ZTJA 1L6YA 4NXKA 1QFEA 4O1AA 2DZUA 4DPQA 1OX4A 5DBUA 4UFIA 4DEFA 4N02A 4JR5A 3VKJA 1V7YA 2ZZ7A 4S2CA 4R34A 4NU7A 4PEKA 2EGZA 1OK6A 2QAPA 4UTKA 3T78A 1WBHA 1NEYA 2BXVA 4FNTA 1QPOA 5DN1A 3DFTA 5AHNA 5DCEA 4ZL1A 4MZ1A 1FWRA 4QNWA 1RQHA 2ZZ5A 2X1SA 3P74A 2V2CA 5KZEA 3WJSA 3JRKA 2H6RA 5D2TA 3LHWA 4MYAA 3A22A 5KMYA 3EX2A 2X1RA 4IPJA 3VE7A 4UTHA 1TMHA 2E5DA 2PRHA 3GXNA 2B7PA 2NLIA 1GT8A 4FNPA 3IRDA 3SECA 1QPRA 3NQ8A 3LOTA 2WV8A 3LRKA 4MKNA 2Y61A 1TPFA 3BO9A 2CLKA 3W2LA 5HUOA 1W0MA 4GC4A 3W7GA 5HJLA 4XQ6A 1C9DA 2ZTKA 4NVTA 4DXVA 4LVDA 1VHNA 1FCVA 2YXGA 1H7OA 3BGJA 2DORA 3M6YA 3N2MA 3DBPA 3MW7A 2J6XA 4NJHA 3C2OA 3HJZA 5AN7A 1OF8A 1VS1A 3NQVA 3PBWA 3RF9A 2QJGA 2NWRA 1TPWA 3DI0A 5LNSA 5HWMA 3LERA 3L0NA 2FIQA 3W9ZA 4LV9A 5D33A 3YPIA 1ZNNA 2AAMA 1D3GA 4AHQA 6TIMA 2EAWA 3QW3A 1TO3A 2CLIA 3OVQA 1R47A 3GNDA 4YCOA 3GLCA 2Y6ZA 4IPIA 4PL1A 1FWTA 4GFSA 5AHFA 3U6WA 3A23A 2NX9A 4IMCA 3N3MA 4UMAA 2NXHA 4GNJA 2PRMA 2A7PA 3HGOA 1I8JA 2YDAA 1G4PA 3CTLA 3LXAA 1TV8A 1S5WA 1YTEA 4M5PA 2JBMA 3L21A 5EA9A 4IMGA 3UY7A 1BEUA 2PURA 4JTEA 4JICA 3B03A 3NOEA 4JS3A 4K6AA 4LVAA 2X1TA 5C6MA 3MMTA 2QCMA 3THQA 3QC3A 3NG3A 4O0KA 1W31A 5LHFA 4XKYB 4G1KA 1JUKA 1KV8A 1KFKA 1K03A 4JY8A 1GYNA 3LCXA 4U28A 1HL2A 2YSWA 4ZMGA 3GZ3A 3EX4A 5AHLA 5D2VA 2A2IA 1JQVA 2XN0A 3S1XA 4BI7A 1LOLA 5DXYA 4GE8A 4NX5A 3CIXA 4JNMA 5IBXC 5FF3A 5BRBA 3NQDA 1SW0A 2ZCGA 1TQJA 3OBKA 3STFA 4Y6GA 4M19A 2ATSA 3W1UA 2JGQA 3NQGA 4RX0A 2QCFA 3TQ0A 1J2WA 1YTKA 1U5JA 1KLZA 3R2GA 1QOPA 4BWLA 3W7CA 1KM3A 1PHWA 1GEQA 1IXQA 3P60A 4RJEA 3NZ1A 4R7JA 4BI5A 4O11A 2TPSA 5AYXA 3UWZA 2ATMA 5DBTA 3GR8A 4TIMA 1RV8A 3NNTA 3NQEA 5CGQA 5L9FA 2J27A 4MYXA 2H8ZA 5EBUA 3M1ZA 1UUOA 4N2YA 2WNZA 5T26A 4UIOA 1JRBA 1UUMA 1FXPA 1KM2A 3C52A 1XBZA 2CW6A 5G1TA 2NUYA 1UJPA 3TE9A 2ZZ3A 3Q2DA 3N2XA 4YXGA 4Z1AA 1PL9A 1RD5A 1LLWA 2I14A 2YFNA 1W5OA 3WJWA 3T40A 3CPRA 4HSNA 3B05A 4EWND 4UMBA 2V2DA 2G97A 4JD4A 3CIWA 1EP1A 3C2RA 1YDVA 4JEQA 3LCWA 4O14A 3SSJA 4DBEA 3B0VC 4IWWA 4ORIA 1U83A 2C18A 4UFJA 3NA8A 3PUDA 3FEMA 2C15A 2GOUA 4FF7A 1KBIA 4FXRA 2WNNA 1JCJA 2E6FA 3ATYA 3LGEA 3TKFA 1YPIA 3FYPA 1YXDA 5E93A 3OA3A 3UZ5A 4HSOA 4LRTA 3QPYA 5G1YA 1SW3A 1QOQA 3ZWTA 4LUIA 3BV4A 3LCGA 3OEXA 3TJXA 2R91A 4UMCA 1F05A 3V1PA 1CX9A 3EB2A 4JXCA 3QYQA 3GR7A 5K9XA 2BZNA 1B57A 1XXXA 3W70A 2ZA3A 2GVJA 1RZMA 3PS7A 4S2BA 4LV4A 3DU0A 3W72A 5K4ZA 3BW4A 4OWGA 1TPC1 4NQ1A 1Q6QA 1TTIA 2QCHA 1F6KA 8TIMA 3PBUA 5D2XA 5D02A 3UWUA 5I3HA 4K7VA 4H3DA 4ADSA 3W2JA 2CWNA 4KFPA 2AGKA 2QUVA 2Q3RA 3N34A 5CPLA 5C54A 4FIRA 4ADTA 3KOFA 5FESA 2Y7EA 2YR1A 3MHGA 3G8RA 1KM6A 4DBDA 2J9YA 4B5NA 3W1TA 1Q6OA 2QCCA 4RXFA 4EF9A 5I3GA 1NF7A 2X2GA 3OIXA 4K8HA 2OT1A 3TIMA 1T96A 7TIMA 2QKFA 4LW7A 5F2LA 4A21A 2WQPA 3PSWA 3CLMA 3VFLA 3L65A 3A9IA 1JUEA 1R2SA 3IIPA 3P5YA 5G2WA 1TRDA 3W7JA 1VYSX 3QMTA 4LY8A 2QCEA 3LHTA 2C16A 3NL6A 1F7BA 2EF9A 2BSLA 1ZHAA 4HIBA 3GAKA 2WPBA 3KAOA 4O1BA 1SZFA 2E68A 3T44A 3JR2A 3WK0A 4HNNA 2NXGA 3NQ2A 3PBYA 4XBKA 3RK8A 1VLIA 1GQNA 2G96A 4FNSA 4UFLA 4WXYA 4HN4A 3UWVA 3PULA 4KFNA 3MHUA 5FEZA 1ICQA 2BLEA 3NL2A 3DI1A 3NVTA 3C61A 4MVAA 1WA3A 2G5WA 4PC8A 3NPWA 2WSYA 4CQ8A 1WXJA 3HPZA 4Y9AA 2ZZ6A 1PIIA 3N14A 3RLVA 2GPTA 3ZR4A 5DLCA 1DVJA 2DJXA 1XBXA 3ANYA 5G2IA 4DO4A 1XDMA 3R12A 2WNQA 4AHPA 2J88A 3W1PA 3QM3A 1A5BA 3DENA 5FEWA 2ABAA 2CLLA 1EIXA 4NUWA 4ORMA 5F4SA 4N9EA 3LRMA 5E1QA 3DHFA 3BK0A 1Z48A 3LTPA 2AQWA 1L2UA 4Z0JA 4I9AA 1P5BA 2C1HA 4C1KA 1DQXA 4TO8A 3FKRA 3GDKA 1ICSA 4UFHA 3WFAA 2V5LA 5AC8A 3TH6A 2Z6JA 2QCDA 3G1AA 3E49A 3KVKA 5CZSA 4JTGA 2Y70A 1R30A 3L0KA 3DHDA 3BG5A 3G1HA 1G7UA 3SZ8A 1W8SA 1OFRA 3O63A 2B7OA 1FCQA 1KW1A 4OQVA 1XUUA 4O12A 4LTSA 2GJNA 1OYBA 1XL9A 5LGXA 2FLIA 1KA9F 1KLYA 2VELA 4UXDA 1N55A 4DF2A 3SIZA 1QDSA 5KZDA 1NSJA 3C4UA 4IOTA 3W1NA 3INPA 4I7UA 1FDZA 4HKPA 3LCHA 4HT3A 3TSDA 5K9CA 1KBJA 3O6DA 1B3OA 1VCVA 1HO4A 2QDGA 5D30A 3SY5A 4WOQA 3GKAA 1GTEA 1W37A 4U4MA 3FS2A 4Y8FA 3LX9A 3USBA 5AYYA 1DJNA 1P0NA 2Y89A 5D03A 5F2GA 3TX9A 1LZOA 2QCNA 4CNNA 3EWWA 3W1LA 4DPPA 2LLEA 4QNEA 4WY0F 1FCBA 1FWWA 2WJZA 2A21A 3BLEA 4QQ3A 1KM0A 1VHCA 4N6FA 2V5BA 4O53A 2OJPA 3M5VA 2NWSA 4FEZA 1XCFA 4IUOA 3W83A 1NAL1 3TA6A 1S5VA 1YADA 3LHZA 2ZRZA 4CCCA 3MYPA 3DFNA 3QSRA 4BWLC 2DP3A 2A6NA 3LI0A 3UD6A 3IVUA 4ZZ9A 3W76A 3S1UA 3CC1A 4TMCA 1S3HA 1UBSA 3TR2A 1I2QA 3W3OA 4PL2A 3CM4A 1H60A 3G3DA 3QPZA 4YL2A 1W5MA 3G0XA 1GZGA 2VEIA 4O1CA 3NQAA 5KINA 3B0PA 1GTHA 3LXCA 1YPFA 1IXNA 4N6EA 5EL1A 2RHGA 4K38A 3HPSA 3IIVA 5ABTA 3NPVA 3M0ZA 4GXMA 2JKPA 3TAKA 5SWUA 3R13A 2XFWA 2CZEA 4IXXA 1J4EA 2VC6A 3GX9A 4JTHA 2WO5A 1QNVA 2C3ZA 4X22A 4IMDA 5D2YA 2PC4A 4KKXA 3TW6A 2JGYA 4OV4A 4DO6A 1Z42A 4YLWA 1B4EA 1Q3NA 1SPQA 1LYXA 1KM5A 3GYEA 3GDRA 5DY3A 1T8XA 5A8GA 1YDNA 1WQ5A 3QEZA 4N9DA 1SZGA 5D2WA 2HMCA 3KX6A 4Q4KA 3S9YA 2CFFA 3RNDA 4AWTA 5CPOA 4JTFA 4O1DA 3QQ1A 4LVFA 1H61A 2ZZ1A 1HG3A 4OV9A 1OFAA 4AWSA 3LHUA 4A22A 4GUHA 1IXPA 1LOQA 1OJXA 1OFDA 5EY5A 2HSAA 3IIZA 1LTDA 4GUIA 4IX0A 2H3DA 2FPYA 3MO7A 1VJIA 5AC6A 2A1YA 1ML1A 4RLIA 4CNOA 3L9CA 4M7TA 1LP6A 1MO0A 3EKLA 3VE9A 3EX1A 4ZVJA 4CQAA 3NXFA 5KITA 1OVDA 3BVJA 1F73A 4I7VA 3E96A 3W88A 1SU5A 5LGZA 3HBLA 2NZLA 3EWBX 3PR2A 4UTIA 4D2JA 3DFSA 3UWWA 2DZWA 3EWYA 2Q8ZA 3A5VA 1PV8A 2PRLA 4HPXA 2FJKA 2BTMA 5AFDA 1OX6A 1HO1A 1XM3A 2P0OA 3QMSA 4EIVA 3CEPA 4IX2A 3KFTA 2V2HA 1Z44A 3TFXA 4A2SA 2QUUA 1JR1A 2RDUA 4UUIA 3I65A 3EEGA 3HPXA 3NQMA 3GK0A 1N8FA 2ZA1A 3FFSA 1D9EA 3F03K 1NFBA 3TMLA 1H7WA 3L66A 5U4NA 2B7NA 2HTMA 1G67A 3T55A 5CPNA 5AB3A 1K8ZA 1SUXA 2A4AA 1GPWA 3O06A 4YCPA 4IMFA 3ATZA 2GQ8A 3W1QA 3LHYA 1A5CA 3UPBA 5HINA 5LNWA 1JCYA 1SW7A 3PY2A 1PHQA 3NR0A 3PWAA 1IIHA 5FF4A 1VRDA 3EKZA 3C8FA 3QW4B 4NJGA 1WX0A 3SI9A 1H62A 2QJHA 1THFD 1TPEA 1ME8A 3TSMA 1JUBA 3LB0A 2VOMA 4MJZA 4ZQMA 3W22A 3IGSA 3I7RA 3DAQA 2QCGA 5TBOA 3LDVA 2BWGA 2FTPA 4O52A 3PUOA 1X6UA 4FXSA 4LS2A 4PCFA 4IXHA 3W1XA 3M44A 1FBAA 2YW4A 1ZALA 1GJPA 4N9CA 5H2ZA 4AHOA 3IV3A 4UTMA 2W6RA 1QMLA 1VQTA 4BR1A 1EEPA 3AO0A 4EF8A 2CLMA 1H51A 1HFBA 5CSRA 3TDFA 2E6DA 1H1YA 2ZQ0A 2A7NA 5F2MA 4A3UA 2Z6IA 4NX0A 1UCWA 3W86A 3UNDA 1YDOA 1H7RA 3F4WA 4KWVA 4QM1A 3S0CA 2FFCA 4HHPA 4H4IA 1TPUA 3Q94A 3P8JA 1DV7A 1F74A 1G69A 4QISA 5I3KA 3S1VA 4DO5A 1PVNA 3O15A 1H63A 2RKXA 3LRLA 2YYTA 1K7XA 1GVOA 3C6CA 2ZA2A 3W73A 3LLFA 3W7MA 2GVLA 3GDTA 4AB4A 3ZS4A 1A50A 3QQ0A 3RU6A 4JIQA 3W7DA 2YW3A 2Q8LA 5G4WA 1P4CA 1F2JA 1X1OA 1P0KA 2YPIA 4PODA 1RQEA 5LNVA 4IMEA 1IIGA 1OYAA 1IXOA 1TV5A 4WY0A 3Q58A 5DCBA 3BARA 5LKYA 3TXVA 1I45A 2XN2A 3HG4A 1B9BA 1UASA 3W2NA 3HF3A 4UNLA 4L4MA 4OT7A 1ADOA 3W74A 2C14A 4FX8A 1C29A 2RFGA 4JTKA 4FHAA 1H1ZA 1KFLA 1TPVA 4PTNA 3NQCA 4W9TA 3S42A 2VFGA 4DF0A 2X30A 4TX9A 1L6SA 1AG1O 3S5YA 1XKYA 3P80A 1TYGA 2QEZA 4UTWC 1SZNA 3I68A 1SFLA 3PVFA 1OFBA 2RDWA 4MUZA 3BW3A 3P84A 1JRCA 1E51A 1VLWA 3S5ZA 5CSSA 1KFJA 2ZRXA 3IGUA 3E02A 1WAUA 3W7PA 2DZTA 4Q33A 3LCIA 4CNPA 3LLDA 1ME7A 3KHJA 4UTUA 3CQ0A 4RR4A 4LRSA 5HWNA 5FF2A 2TSYA 2QDHA 2VFEA 2QCDB 5U7SA 4N4PA 1XC4A 6ALDA 1Z41A 4MZ8A 3PB2A 3EX6A 4UTWA 2V30A 2G95A 1F76A 2B0MA 3L68A 2ZDRA 4Z1BA 1OF6A 3T4CA 5BW6A 1KV5A 1K8YA 4WQ6A 4XWUA 5D09A 4DELA 2E6YA 4E38A 5FEXA 1XFBA 1LM1A 3H55A 1FWSA 3WK2A 5HR7A 1UB3A 1Q6RA 4C1LA 5C2XA 1T0OA 3MUXA 1VCFA 5J5RA 2A7RA 3P81A 1WOBA 5HNRA 1SZEA 1ZFJA 5I3IA 3Q37A 4JGDA 4XBSA 4TMBA 3U2OA 4NNCA 1FQ0A 1ZJIA 2HS8A 1G4SA 5F1UA 3W7OA 3OHIA 4MLRA 3I7SA 5EYWA 4LC8A 4E2BA 1VZWA 1VYPX 2OCZA 3C0JA 3L0GA 2J9XA 1BKSA 1QO2A 3BGGA 1AL7A 1YXCA 1OFPA 1L9WA 2BX7A 4DF1A 4PA8A 4RKAA 2H90A 4MFDA 5LSMA 1W56A 3FA5A 4JIPA 5FF7A 2GQ9A 3EWUA 3IGXA 5LHEA 3PB0A 3HOJA 1ALDA 4O28A 1MEHA 1TB3A 2GJLA 4TU1A 1ZAIA 3HO8A 5CZJA 3FLUA 5AHEA 2Y63A 1PS9A 3LXBA 3PSVA 1WYIA 4K37A 4GBUA 1MSSA 2CU0A 4QAIA 4FB7A 4OHQA 3UPWA 2D73A 3TROA 2V9DA 4YMZA 4GUFA 2YFOA 1TQXA 4A2RA 3SGUA 1XUZA 4K8EA 3L2IA 3P8IA 2VEPA 4JTIA 1I4NA 3L5AA 3W7KA 1MEIA 3MYOA 2OMAA 1HTIA 5AOUA 4ZQOA 1W3IA 3NQ7A 3ELFA 3W71A 1FX6A 3W2MA 3MBFA 4LS0A 2ZRYA 2EKCA 3CEUA 1GVSA 2A6LA 1F5ZA 3P7YA 4L4LA 3M41A 1M7PA 3NQ6A 4JYDA 1S5TA 2NUWA 2XN1A 3G1XA 3TW7A 3RLUA 1GVFA 5D37A 4NZJA 3KVLA 2TMDA 3S8HA 5D05A 3UWYA 3W2UA 2PE4A 3TFCA 2YYUA 1JCNA 3W7QA 3SJ3A 2VEMA 2ZYFA 4GWEA 5LZLA 1XDLA 2E5BA 4WXZA 3TJLA 1OFQA 5EKYA 2FPVA 3TCEA 4GUGA 4EVZA 1LCOA 2VFIA 1M6JA 3O07A 2YCEA 2Z0IA 4NT0A 2O7SA 3SFKA 4LVGA 4JTTA 3F1QA 3O6YX 3V75A 1MEWA 2OT0A 2FDSA 4WD0A 3OG3A 1SO6A 5BOOA 3SGZA 2QR6A 3DZ1A 4M6PA 3G24A 1Y0EA 1K7EA 3NL5A 1MXSA 5D04C 1RPXA 1TJRA 3DXIA 3W07A 2CZDA 4FIQA 4JY9A 4MIMA 5F4XA 4O19A 3WJZA 4JX5A 1EX5A 1DL3A 1RR2A 3CWOX 2HS6A 1G4EA 4UNKA 2CLHA 4MFEA 2J24A 2R14A 3DKLA 4A29A 5AHIA 4ZQCA 3A21A 3UWQA 1TPB1 1I2OA 3HGJA 4KFOA 2OZ0A 2CZFA 3NYZA 4CCDA 1AMKA 1JJKA 3HGRA 3UXDA 2VFFA 1OABA 3NQFA 1GWJA 3L67A 4ADUA 3OVPA 1H50A 4HNUA 5J5DA 1CI1A 1LRNA 2ZRWA 1JULA 2F84A 3O6CA 3HGSA 2RDTA 4AWUA 5HR6A 2ZRVA 1QAPA 3W85A 3NM3A 3BPWA 1IF2A 3TMQA 4Y96A 5DXXA 4ALDA 3A24A 5HWJA 4UTJA 4NXSA 3QSTA 5MHBA 1KFEA 4BI6A 1TPDA 2A85A 5FF0A 2P1FA 4UCGA 4UTTA 1EWDA 4DQWA 1VCGA 3ABQA 2W0UA 1QPNA 2FB2A 2DJLA 5LNRA 4Z1DA 4ZQRA 3STEA 4Y90A 1G6CA 3HG5A 1F6PA 2DZPA 5FI8A 1TPH1 3IEBA 2I1OA 1DORA 1O60A 4JYFA 5G4EA 3RFAA 4OU1A 4FNQA 3OVRA 1ZAJA 5A5WA 1JCLA 3AJXA 3TXZA 2I9EA 4O13A 1K02A 3FIGA 1KTBA 2VENA 1X1ZA 2YGYA 2ISWA 3M16A 1XBVA 2H8XA 3C2FA 4K39A 2Z2UA 3LI1A 3LV5A 4JDYA 3T7VA 1YTDA 3STCA 4O10A 5I3JA 3N9SA 3ABSA 4Z0SA 3BLIA 1VR6A 4MY1A 1ONRA 3KRSA 3DKJA 3MWAA 3UXAA 1H5YA 4RZ4A 1H7PA 1W3TA 3R89A 3G18A 2H3BA 3B06A 3M5ZA 3PAJA 2Z1BA 3I6RA 3WK1A 5L6UA 4RV8A 2WSQA 3G1DA 3MI6A 2IQTA 3O05A 3UZJA 1QO5A 4IJBA 3B0UX 3LTYA 3FOKA 1B4KA 2DZSA 2QUTA 3B4UA 5HUPA 5AHMA 5EPDA 5H91A 2A5HA 3NPUA 2E5CA 4UC5A 1V5XA 2Y88A 3EWZA 4JTSA 4UR8A 3FKKA 4HNTA 4MY9A 5K7JA 3H53A 2OX1A 2CLOA
chains in the Genus database with same CATH superfamily
3IVSA 3URNA 2WW5A 4HTBA 3VNDA 2BNJA 4CU7A 2BG5A 1M5WA 1G01A 3TC7A 3UZYA 3K13A 1R46A 5A6JA 4A6GA 4XX6A 1A5SA 1KTCA 3FJ6A 3SIMA 3WNOA 1I2PA 2I7GA 5BOEA 1T99A 2JFEX 3K4WA 5CBBA 3B04A 1W9UA 3O9NA 3MI3A 1J5TA 1VP5A 1U1UA 4LF2A 3GDMA 3VM7A 2RH9A 3QY7A 3RILA 2WZMA 5GNXA 4TXEA 4K8GA 1R9ZA 1NVMA 3MWCA 2YXXA 3PJXA 1K9DA 1ZCCA 3W02A 3STPA 1T40A 3MP5A 1W2VA 3KL3A 4RZ5A 1F8IA 2GL5A 5AC7A 3TUUA 3VD5A 2FZ8A 1QNPA 1CXLA 4MSSA 1HIZA 4AVOA 1NF0A 1JVNA 3VDAA 4WOZA 3VCCA 1UR1A 3FJLA 1L6WA 5FIPA 3TSBA 4NAFB 4O4WA 2P5NA 5EMJA 1TREA 4IIGA 3MP4A 1FWNA 3GXTA 4WZHA 1O5KA 5C9RA 4Q3MA 3I3BA 1ZS2A 1P6CA 4QJ1A 3PM6A 5F2IA 2Y7FA 2DQXA 1QBBA 4S38A 1UWTA 3S5OA 4ICNA 3W7RA 4OBTA 3AYVA 3N17A 4DJED 3CYVA 3H2OA 2V82A 1D3HA 3BICA 4LAKA 2YL9A 5G5IA 2E09A 2QJIA 4UFKA 4CLMA 3W0KA 3EMQA 4ZQNA 3R10A 1TZ7A 4OE7A 5DMYA 4MB1A 4GLEA 5A6AA 1UP3A 1OIFA 3R6IA 1E43A 4LOCA 1E6PA 1E15A 1JXKA 5CG7A 3SY8A 3MJMA 5DEZA 1FUYA 3T8LA 3P93A 3P82A 3LBCA 1W3NA 4XVEA 1E0UA 3COTA 5E0FA 2E6AA 4AXNA 5ABGA 5CZ0A 2ZC1A 1Q6FA 1XBYA 5G1MA 2E1DA 1AW5A 4EPKA 3TVAA 4Z1YA 1Y5WA 1HP4A 1MZHA 1DJYA 1VIZA 4N4QA 5EU9A 4J3SA 1EYWA 2FMNA 1X39A 3URBA 4JTCA 3MCNA 1AMYA 1XRVA 1UH4A 5HAOA 2C19A 3M0KA 4GJ1A 4P61A 1OG0A 4C6OA 4KWWA 3LCLA 1KTNA 1W9PA 1ZENA 3AHXA 1NY1A 2VFHA 4GFIA 4AVFA 2VKZG 4AF0A 2ISVA 5BMXA 1DTNA 1R3QA 2NQ9A 4B3ZA 5JIWA 3PZNA 4LS1A 1YLVA 1WOAA 1VFFA 1E9IA 3W2KA 3VTRA 2OYMA 3BG9A 1RK5A 3TZFA 4AWEA 4Z2HA 3W23A 2BVDA 5K2ZA 5C71A 3P67A 2OLHA 4PUKA 3RJYA 4JL2A 4WIWA 3W24A 2DPEA 3OLDA 4WUIA 1A5MC 1LBLA 4QXIA 3AALA 4R33A 1LORA 1UD5A 3KE0A 3ZLGA 1K3UA 4G8TA 4AAJA 2WAGA 1EBHA 1J0JA 2ALRA 3DFPA 4P7LA 3BW2A 2XVNA 4BQ4A 3QRHA 4HK6A 4O57A 4ZTYA 1J10A 3QR1A 1MVYA 4V1XA 1YNPA 4B91A 4F79A 2CXGA 2OSWA 3LZ5A 5ECVA 2VI0A 3U4FA 2VD9A 3SRKA 4XD3A 2B4GA 2E25A 4ZSTA 5FEPA 4ZODA 1GK8A 4W7VA 3VX1A 4AF0B 1TX0A 4FZIA 1W5PA 5FJOA 1QCWA 1F3EA 3EMZA 2ZRUA 2R94A 3NAVA 3BMVA 1PKLA 4BFAA 3ZFHA 5CXPA 2UBPC 1A80A 3MANA 1E0XA 1GOKA 3ARTA 1IGSA 3PWIA 4LF1A 1W5QA 1W9VA 3AS3A 3S2LA 4ACZA 2FQIA 3VOIA 3LM7A 3UJRA 1FHVA 5MKGA 1IGWA 2P76A 1ZB5A 4QLKA 3O1NA 5CJ5A 2Y7DA 4PGLA 3E9AA 2WSPA 1XLBA 3FYOA 4ZE4A 3E74A 4WJXA 3WJXA 4GVGA 3C2EA 2CBIA 4P2VA 1X8FA 1CXKA 4UCFA 5I78A 5HPCA 3CHFA 1PWLA 2D3NA 4A35A 4E2DA 3H7VA 1JF6A 5A6BD 2GSJA 3TWBA 2OQYA 3QH2A 5A6BA 1XIMA 3NGJA 4U31A 1F9CA 3PC0A 5KEZA 3W7LA 1OYCA 4RXGA 3TN4A 5C70A 4WX2A 1Z8AA 4NJJA 1TTPA 1DXIA 3TV8A 4KF1A 3N25A 1XI3A 3VNYA 3WDRA 1IZJA 5BNKA 4NZFA 3B8DA 1TTQA 2HE8A 5A6MA 5K3VA 1EX1A 4W7WA 3FN9A 3QHMA 5T91A 3TYEA 2FTWA 3CL6A 3ZO9A 3W81A 3H2MA 3LCFA 2J7GA 1TTJA 5IM51 2TYSA 1KBKA 1FFRA 3S5NA 4ASTA 4B4HA 4C1NA 2CEQA 2NXIA 1I2RA 2GUBA 3E38A 4J1OA 2NX1A 1MNZA 3D0CA 1OK4A 1A0DA 4JTJA 4PCPA 1KFBA 1R3TA 3RX3A 3P62A 2UV8G 4LC6A 1FKXA 3GNNA 3N73A 5I2UA 3SEPA 4C91A 4Q7BA 2FZBA 1GVQA 4I6VA 2GUUA 4PUNA 2WSRA 5AYZA 3W28A 5BRQA 1G5AA 3SJNA 1GG0A 1L6YA 4O1AA 4DPQA 1W9BM 2VGIA 4UFIA 4DEFA 2ZZ7A 9XIAA 4NU7A 4PEKA 3BCFA 5IHSA 1D2KA 3CV2A 4BA0A 1NEYA 3TP4A 2RJHA 3ONBA 1Q8AA 5FJJA 3VZYA 3OQEA 4XUYA 4MZ1A 4Q7IA 2INEA 1FWHC 4TVUA 4CVUA 1RQHA 3WJSA 4F0LA 2H6RA 3BWWA 3A22A 3KEHA 1R9XA 4JOMA 4WVXA 5M1TA 1F4AA 1AH4A 2QZRA 4MWAC 5T9CE 2PF0A 4DWSB 2E5DA 3WBEA 2HNEA 1LF1A 1M41A 5FAGA 4IG2B 1QPRA 4HQVA 1Q85A 4GO8A 2GJPA 2CLKA 2YLLA 4GX8A 5HUOA 1PZ1A 5HJLA 3CHEA 1RSCA 4NVTA 3OODA 5BU6A 2V68A 3BGJA 2DORA 2CHRA 3BLLA 3H4GA 3BURA 3WN6A 4JKLA 4LYQA 3QC0A 2QPUA 5DMMA 2OB3A 4RDVA 1XP3A 3KCOA 3RF9A 2NWRA 5LNSA 5HWMA 4TV6A 3LERA 2JIEA 2FIQA 3C0SA 3W9ZA 1FH7A 3CO4A 1RBAA 3K1GA 3RLHA 3S46A 3VOJA 4J2PA 3RCYA 3SUVA 3CNYA 4AHQA 3EOSA 3QW3A 2C1GA 3N3TA 4C90A 1R47A 1SMAA 2Y6ZA 4FI4A 4IPIA 3BAJA 3WLHA 1FWTA 2AKMA 1XICA 4GFSA 4Y9PA 4JPGA 5EMYA 3CQIA 4IIFA 3S3GA 3N3MA 5LXXA 4UQBA 4B2DD 4QS6A 3SM0A 1YNQA 1KCKA 2OKOA 3U7VA 4IMGA 3UY7A 2PURA 4JTEA 4M80A 2KAUC 4LVAA 3WLIA 4JS3A 4UTFA 2G3NA 2NQHA 8A3HA 1TV3A 4M51A 1E6NA 4UQAA 5LHFA 2D2GA 4KMQA 5T8GA 1KFKA 1K03A 5TAOA 1DIKA 3IAPA 4H8VA 3GZ3A 4GABA 2VGGA 1I1XA 1JQVA 2XN0A 1QVBA 4F48A 5I07A 3S1XA 4GE8A 4NX5A 1BSLA 3CIXA 3ZXWA 4Q4SA 1R7OA 2DZBA 5BRBA 4FK9A 1U1JA 2VEFA 1SW0A 1TQJA 1OGGA 2P3EA 3OBKA 3STFA 4NZCA 2R6OA 3B9OA 1PBGA 1U2YA 1WZKA 3WLJA 2ZVIA 1FOBA 1KM3A 1GEQA 3ARVA 1IXQA 3W26A 3BLKA 2PF8A 4EPDC 3GR8A 3RJXA 3OO2A 4LGXA 3NNTA 3NQEA 5DRCA 1R3VA 4MYXA 2H8ZA 1I75A 4LANA 3M1ZA 2Z2BA 1HJWA 5T26A 4AFYA 3M07A 5EB8A 2CW6A 5FJTA 2NUYA 4H1ZA 3TE9A 2ZZ3A 1MUWA 1EJWC 1V3IA 4ZR8A 4YXGA 4MDPA 4Z1AA 3AMCA 3SGGA 3WJWA 4Z2LA 2VCBA 3PJWA 3LU2A 2GGIA 6TAAA 2G97A 4YTRA 1EP1A 3C2RA 4IISA 1YDVA 3LCWA 2X42A 4ORIA 3M0LA 1U83A 2XSBA 3PTDA 4MWAE 4HU3A 4GHRA 4ES4A 3FEMA 4IUGA 2C15A 4FF7A 3ATYA 3UF9A 1PKMA 2QT3A 3TKFA 1E56A 3WUBA 1CXEA 3K4AA 3QTGA 2R91A 4UMCA 3A3HA 3MZ2A 1F05A 3RM9A 5A8PA 1ECQA 3QYQA 2ZA3A 2D0HA 4NQ1A 1Q6QA 8TIMA 1GKPA 2XIBA 3WBAA 4K7VA 2VEGA 5JQ9A 1E73M 2HE5A 3MC5A 2HXTA 2ASHA 4KFPA 3ZR5A 5EMLA 3LGGA 1XWYA 4BQ2A 4NAEB 1EHNA 8RUCA 2J7CA 2DUAA 1UR8A 3CXOA 2QF8A 1B31A 2Z2AA 3KOFA 3ARRA 3MHGA 1T8QA 2J9YA 4P7OA 2QCCA 1EL3A 4KCTA 5I3GA 4FOJA 3GQYA 2GK1A 2HPIA 2OT1A 1LJYA 1T96A 3NOYA 2EXOA 2BS9A 4HHLA 4GH3A 3VFLA 1JUEA 3WEMA 2YL8A 3P5YA 5G2WA 3W7JA 1M53A 2PD9A 2J13A 3LHTA 3NL6A 5FACA 1F7BA 6CGTA 4CCZA 2BSLA 1S2WA 3JR2A 2E9LA 2FH8A 1CGUA 5AVHA 4EACA 1A5UA 2XFFA 3RK8A 2C7FA 4C5ZA 3PN8A 1HGYA 1MW2A 1NWSA 1HX0A 1QHZA 4KFNA 5FKYA 1ICQA 3HU7A 1GVEA 4AD3A 2G5WA 2J25A 3NPWA 2BDQA 1M3UA 4A3HA 2WSYA 5FD0A 1WXJA 1XYAA 3BMWA 2GPTA 3ZR4A 2A3HA 4G1NA 2ZE3A 4WDXA 1DVJA 2CKRA 1P0BA 4DO4A 3QVQA 3V0UA 1NTHA 3DENA 5FEWA 3PZVA 2ABAA 1EIXA 1BVZA 3HJEA 1UQYA 1Z48A 3LTPA 2DT1A 3B8IA 4I9AA 1J79A 1P5BA 4C1KA 2Z26A 4RUBA 2DT0A 1JDEA 1ICSA 3MVIA 4UFHA 3VIMA 1WPCA 3BE7A 2AL2A 2QYGA 3QN3A 1FRBA 6REQA 3PPCA 3GVRA 1QK2A 4MHBA 4E8GA 4PUJA 4S3BA 4C6MA 1R30A 3T8QA 2ISFA 3MVTA 1OFRA 3O63A 3VXGA 3BOFA 3R7MA 1OYBA 2OZ8A 3N18A 2FLIA 4RE3A 3GNPA 4B9YA 1XSIA 3ARPA 4L6DA 1N55A 4JAWA 3SIZA 2VO5A 5KZDA 1CENA 4IOTA 4I7UA 3INPA 1M01A 4GG9A 4HVXA 5FJPA 1UWRA 2FZDA 1KBJA 1WDDA 1V6XA 2PZ0A 4WOQA 1DQUA 3VKAA 3F4CA 1GTEA 2XZ9A 1WCGA 2POZA 3FS2A 1SMDA 3T1GA 2Y89A 5D03A 2VNCA 4DJEC 1EDGA 5F2GA 2XGBA 2VD8A 3TX9A 4YYCA 2QCNA 2WCSA 1VJSA 3EWWA 4P8UA 3OOQA 1EGZA 1S38A 2WJZA 2WM0A 2A21A 3PZTA 3BLEA 1LQAA 2WCGA 1KM0A 4N6FA 3QLDA 4W7UA 2YKKA 1BYDA 4IUOA 1NAL1 1S5VA 3H23A 2ZRZA 2DSZA 3MYPA 3E0FA 4BHYA 3LI0A 2DVUA 4ZZ9A 3QFWA 3ALFA 1XIBA 1W3JA 1HKJA 3MPGA 5C8BB 2E40A 2A3AA 3TR2A 2QUNA 5EBAA 5HATA 1H60A 3AS2A 2XIMA 4UQ9A 4QG8A 5HNNA 2D0FA 2VEIA 4O1CA 3KHDA 4XO7A 4EX4A 3LXCA 3VGHA 7ENLA 1FH8A 4N6EA 4K38A 3HFTA 1ZPTA 2WC4A 2XFWA 2QJNA 4DBSA 4HJWA 1XYCA 3GX9A 4JTHA 5I7GA 1QNVA 3B40A 4E4UA 3N9KA 4OV4A 1XH1A 1LUCB 1Z42A 7REQA 1Q3NA 1LYXA 3GYEA 4JQ2A 4U3CA 1ISYA 3QGAC 4L5ZA 3QEZA 3R79A 1BYAA 3UVAA 3T2QA 4Q4KA 1OC5A 4LH8A 4AWTA 4P7NA 4JQAA 1Q6GA 1HG3A 5LA1A 4AWSA 3AI0A 1TE1A 1GKQA 4LYKA 1JPHA 1OFDA 1OGSA 2HSAA 3IIZA 3SN0A 4CQDA 3L4VA 4PMRA 4UB9A 5AC6A 2A1YA 4KWUA 3VDGA 8CGTA 2X0HA 4ZVJA 4AG0A 3FHAA 3NXFA 4NF7A 1OVDA 3GE7A 3WDIA 3W88A 3RN6A 4R88A 7PTDA 2OVLA 5CBJA 4D2JA 4IP7A 3UWWA 3LS9A 1UOKA 3EWYA 1FFQA 4GGBA 1IWPA 3ITLA 3A5VA 4PB5A 2PRLA 4H83A 4HPXA 3B8WA 4Y9OA 2BTMA 1OX6A 4EKJA 1XF0A 1XM3A 3RGTA 2PB1A 2V2HA 4GPNA 4A2SA 1YBQB 2QUUA 1JR1A 2RDUA 3WFLA 1JPKA 4RE4A 2GJXB 5E9AA 2XUCA 2DT2A 2J78A 4UUIA 6REQB 1AD1A 4OZOA 3KOXA 3GK0A 1RLDA 1NFBA 2IW0A 3AMGA 1H7WA 2DT3A 3AXIA 4H8HA 4HNOA 4PB4A 2GVEA 1RJPA 2W62A 1C91A 2A4AA 3EDEA 4GBDA 3VNJA 5FL1A 1GPWA 1R85A 4YWSA 3FJNA 3O06A 1VFHA 2GQ8A 3W1QA 5HINA 1B54A 1R0MA 1TMQA 1CBGA 4M82A 4E4FA 3GUWA 3PHAA 2FHCA 3IJ9A 1BVWA 3TTSA 4RDWA 3CIVA 4L6OA 3QW4B 2QV4A 4AIOA 3SI9A 3ZT5A 3ZJ8A 4MWAB 1H62A 2PWUA 4C6QA 1W17A 2PDKA 1ME8A 3Q67A 1QW7A 1H0IA 1EXPA 1HVXA 3OP2A 3GWQA 3I7RA 2W66A 2ZX7A 5TBOA 2GGHA 2VVSA 4O52A 3VMPA 5E9XA 4PCFA 4IXHA 2Y5JA 1GJPA 1KB3A 2Y8UA 1VENA 3NEHA 1LLOA 4DJDD 4EF8A 1R87A 2GQ3A 1BRLB 3S9IA 3MS8A 2E6DA 4S3CA 1E9LA 2ZQ0A 4H9TA 5F2MA 3LSCA 1X7IA 4A3UA 1PDYA 1UYQA 4S39A 5LIXX 1UCWA 2Z1SA 2D69A 3WF3A 3NSMA 4QLLA 3DEQA 3F4WA 2PTYA 3JW7A 4HHPA 2OLAA 3WUGA 3MMUA 1CGXA 2PWFA 1J0HA 1A5LC 2ON3A 5DMNA 1G69A 3WQDA 4PBFA 3VDCA 3TYZA 2WZTA 2YYTA 1GVOA 3C6CA 3L12A 3W73A 1R3SA 4JFVA 3TW9A 2GVLA 3ZSTA 3KTSA 1S3TC 4JIQA 3RU6A 3OGSA 2DSVA 2NSOA 1RQEA 2ZUVA 5LNVA 5BXSA 2VWTA 2VDGA 3TXVA 5DFAA 1TWIA 4OT7A 3BSMA 3WO8A 2ISDA 4M6UA 1W1B1 4FHAA 1XS2A 1TPVA 1CLVA 4D6EA 4F0MA 1YQ2A 3NQCA 3S42A 3PFRA 1AZ1A 1O12A 2VDIA 2VFGA 3MT1A 2A3BA 3REQB 1X97A 4IL2A 1L6SA 3FVMA 3S5YA 1XKYA 4YN5A 4H8UA 2QEZA 2Z4GA 1JYXA 2PBGA 4IGSA 3WDJA 3BW3A 4XZNX 1JRCA 1E51A 1VLWA 4Q8TA 1LQ2A 1KFJA 2DVXA 3E02A 3L4YA 3W7PA 3LLDA 1ME7A 3KHJA 1R9YA 4UTUA 1V6VA 4IQJA 5GPRA 2GK1B 4LRSA 5HWNA 4V1YA 2VFEA 3N13A 4N4PA 1XC4A 5CLTA 1CPUA 2CETA 3FK4A 3PB2A 4UTWA 1YBQA 3L2LA 2CLPA 3LA4A 2ZDRA 3T4CA 2IS7A 1K8YA 2W3ZA 4HD5A 3DGBA 3BSGA 1XFBA 3H55A 4KEVA 3LGDA 3HZ3A 4C1LA 4JBRA 1TWDA 3CHCA 1ZFJA 3EPMA 2F61A 2YA0A 4KGLA 4NNCA 3VOCA 1ZJIA 2X8RA 2F2KA 3W7OA 4HYVA 5C0QA 1N8WA 1VZWA 4KT2A 4UQEA 1I0DA 2JALA 3C0JA 1XHGA 3AZRA 3IWPA 3CUXA 2XISA 3SADA 1L8PA 3CB3A 4IMAA 4PA8A 5LSMA 1EBGA 2GQ9A 1ONXA 1SVDA 3IGXA 5LHEA 3NSXA 3T0CA 1I6NA 4O28A 1MEHA 3S4TA 4S3DA 2E7FA 3MDWA 2BHUA 2VGBA 1PS9A 3VA8A 1KQZA 2Z27A 3OPSA 1MSSA 2CU0A 1JXJA 2E9MA 2BGSA 4FB7A 3UPWA 1KWGA 1AUSL 3H2NA 3I4KA 4GUFA 3CS2A 4B5UA 4A2RA 2GJXA 3B9NA 2VEPA 4JTIA 1I4NA 3W7KA 5D9NA 3TYAA 1W3IA 3UZZA 3NQ7A 3EB4A 2HV5A 1TA3B 1RBLA 2PLCA 2IPGA 1T41A 2EKCA 3U5YA 3CEUA 1KBBA 6XIMA 2A6LA 3P7YA 1M7PA 3NQ6A 1NELA 3G1XA 3CPUA 2GDQA 1W8GA 4NZJA 2ZUUA 4X2PA 2QGHA 5D05A 2PE4A 3TFCA 1JCNA 1E1FA 2VEMA 2OWCA 3APTA 1KQYA 3TJLA 4WXZA 1LUCA 3KOYA 2Q02A 5A1AA 5EKYA 3ANVA 2E9BA 3QYSA 4NYYA 4GUGA 1QW9A 2VFIA 5AZ0A 3MV11 1GEHA 2YCEA 2O55A 3TTYA 2QDEA 4LVGA 4GK8A 4CGTA 1MYRA 2DW6A 2BGNE 2FDSA 4PMJA 2HEJA 1ZBWA 4GZEA 1YMYA 3NL5A 3ARQA 3W07A 3DXIA 3F5JA 2QW5A 4JX5A 1W1VA 4LCSA 3K8LA 3NWRA 2HS6A 2I56A 1G4EA 3W25A 3UESA 5IFPA 2FZMA 3AZSA 2PDWA 3KTXA 2IXUA 1BWVA 4A29A 3RMEA 2OU4A 1M04A 1BRLA 2HCVA 5AHIA 1MQRA 3A21A 3II1A 3HGJA 3I4EA 2CZFA 4CCDA 2PUZA 3UXDA 4H01A 4RNFA 3QZ6A 1DXFA 4ADUA 3OVPA 1JD7A 1F3XA 4C65A 3QZAA 5J5DA 2ZRWA 1PIGA 3HGSA 4D8ZA 3E6EA 4AWUA 3VILA 3W85A 3NM3A 5JU6A 3PUGA 4H2HA 3BPWA 4N0RA 1BXBA 3TMQA 4Y96A 1XCXA 3RU8X 1VIWA 5HWJA 5MHBA 4BI6A 1HKKA 2A79A 3UR7A 2A85A 4Z2KA 5FF0A 4UCGA 3QLLA 1EWDA 3V1HA 1DIEA 3ABQA 1QPNA 4QRNA 3SRHA 2QUMA 4GI9A 4Z1DA 4RNIA 1S1RA 3AS0A 1G6CA 5A6LA 2DZPA 2I1OA 1DORA 4JYFA 3RFAA 4OU1A 4LCQA 1LL7A 1ZAJA 3Q65A 3AJXA 2Q6ZA 3TXZA 3GU9A 1J11A 2VENA 4KCWA 3FXGA 3EYPA 1XR2A 2Z2UA 4JDYA 3VOHA 1DHKA 4CD8A 1EJUC 5I3JA 3BLIA 3F2DA 4MY1A 1ONRA 4B9ZA 3V16A 3IS4A 1ITUA 1YDYA 3GDBA 3VFCA 4J3TA 3VNKA 4XAFA 3T2OA 1JPMA 2V3DA 3B06A 3M5ZA 3T42A 2PCEA 3I6RA 3WK1A 2ZVRA 3MI6A 3THCA 3K5XA 1QO5A 4ATDA 3WX7A 3WNKA 2EJ1A 3B0UX 3QOKA 4LB3A 5HUPA 2ZX5A 5EPDA 5H91A 1NP2A 3SQMA 1US0A 4Q8QA 2O4MA 4GJIA 2VUYA 3WD1A 3EA1A 1MZRA 4JTSA 4PTXA 4MY9A 2CLOA 1P7TB 4FX7A 4A8NA 3QJAA 3MHFA 1V77A 3RPTA 3OZOA 1O68A 1SJBA 3ZSSA 4L80A 1TJPA 2PGRA 3UCQA 3VCRA 2DZVA 3WELA 2FH6A 3CWNA 3UBPC 2VX6A 4M29A 1QOXA 4ONVA 4C6BA 5RUBA 1TV7A 4PCNA 2WVSA 4XKYA 4JTLA 4FX6M 2W61A 2E28A 2PP1A 2TRSA 1BTMA 3G8EA 4LU0A 4NIRA 1XIEA 3POCA 4IH3A 4UR7A 2WK2A 1Y5VA 3BG3A 3PUEA 2TODA 4IQLA 3PBVA 3CJPA 3KXQA 2PA6A 1PIFA 4NP7A 3M0IA 3DYMA 1YW1A 3RRXA 2OFJA 3BUVA 1E5NA 4HPGA 4RL3A 3AUOA 2ESCA 4LVBA 1SSGA 1VBJA 5EMUA 2F7FA 3F4VA 2J7FA 1GZ1A 1TWZA 1QI0A 1AODA 1R5YA 3HM7A 5KZMA 4ZFCA 3W82A 2FPTA 4HPJA 2ZBTA 4CCEA 4W86A 4NZ1A 3GDLA 4FR1A 4XTIA 4KCVA 2NVCA 3A12A 3R0UA 3IIXA 2BY2A 1LL4A 1LLZA 1VD6A 3K8KA 3CL7A 1XYBA 1YPXA 4I7WA 4M0XA 2CLEA 1XISA 1OX5A 3TC6A 4PMVA 2JE8A 4QSHA 3DCPA 3AMKA 1XCWA 2XVLA 2EPHA 3KRZA 3RITA 3JZEA 4EE9A 4UOJA 2EHHA 4AISA 5C9XA 2X41A 3T0TA 3TYBA 3KM8A 3TYDA 2EPKX 1JQXA 3ZVHB 3P61A 3PTQA 2E1WA 4EANA 4POCA 3PZMA 1FDYA 2YX0A 3M47A 2Y2WA 2VP8A 2XYLA 3SAZA 4O15A 4US6A 3U4AA 1QR7A 4M7SA 3EBVA 2F6UA 3H54A 4BK9A 1QBAA 4ZO6A 2O7QA 4NNBA 3WD0A 2WKJA 4BKNA 3Q45A 3F4NA 2JKAA 3GG1A 4XAYA 1G4TA 3USZA 3WK3A 4DNHA 1EPXA 3ABRA 1FH9A 4R85A 1V79A 1OX4B 1GQIA 5HMFA 1TIMA 2CXEA 1EJTC 3ABOA 1HN1A 2EG7A 3AHTA 1J93A 3SCSA 1G7VA 5BCAA 4PMQA 4AMAA 2WVVB 5LIYX 4AY1A 1VEMA 4W87A 2ABBA 3NCOA 1QT1A 4LT9A 1SO4A 1UZ4A 1GG1A 1MFVA 1RQBA 1QWKA 4KS0A 1E6SM 4GRSA 3LENA 4URIA 4NKCA 3UYCA 1DJQA 3IACA 4JX4A 4R27A 2QMJA 3ZOAA 4XZ9A 4J9JA 5TIMA 2V63A 4CQBA 3CHVA 1FDJA 3FW6A 4RE2A 4MJ2A 3R8RA 1LROA 2BY1A 6A3HA 3ZLHA 4QE1A 3U8GA 4CEUC 1ZBCA 4U2YA 1OB0A 3W1MA 2V5DA 3HTWA 3DBNA 3HB9A 1I60A 1JCMP 4D6HA 1E70M 2JK2A 1OFEA 3NL3A 2Q3OA 1LRQA 3IGHX 3GTNA 2C0AA 3UJ2A 3CWHA 1BWLA 3HIJA 2XH2A 5BMWA 4XSLA 4HA3A 2DZAA 1P6WA 1SO5A 3NZRA 3DG3A 2FB3A 2OGYA 1CGWA 3CU2A 3L4ZA 4O16A 2ZZ2A 1W9DM 2WNWA 2V8ZA 1JD9A 2Z25A 1V4YA 2ISSA 4GMEA 4GVHA 2UY2A 4Q32A 4CNSA 2VUNA 1P7TA 3MB9A 1POJA 1UIOA 1EA0A 1BVNP 1M65A 4REQB 1A5AA 1X8CA 1H7NA 4JYEA 3KWXA 4DUWA 1X38A 4IGMA 1TSIA 1MWOA 1U5HA 1VPXA 1G0CA 1VPQA 2CZ5A 4RZ6A 1IQ8A 3AQUA 2J6VA 3IUHA 1PKYA 4Z1CA 4R7OA 5DMLA 3W87A 3G22A 2E77A 1MRQA 3M46A 4TUFA 5CSYA 3TQKA 3GVWA 2V0TA 1JG9A 3FXYA 1BHGA 4X9SA 3R5EA 2NV2A 2QXWA 4I8DA 3UEQA 3PF3A 5EMMA 3BL3A 1I1WA 4PH6A 2WMGA 3QF0A 1KGWA 1MW0A 1QI2A 1NJJA 2XH4A 3GBEA 1MMFA 4L4OA 1QUMA 1UR0A 4L6HA 4DVOA 4GJJA 3WNLA 2C6QA 4MOZA 4DI9A 3E0IA 4BQ3A 2QF7A 4J27A 1WZAA 3LBMA 3MTWA 1F61A 1A53A 5TD4A 3MUY1 4Z08A 1EB3A 1ONEA 4X2RA 1UC5A 3CMFA 3LEPA 4QIUA 1AK5A 2VYOA 2SFPA 3HV9A 1V02A 3CASA 2CITA 1ZY9A 1HL9A 3SCRA 4MUPA 1PE1A 4AD1A 4Q8UA 2VZVA 4K36A 1ONWA 4IP4A 3GVQA 5DELA 5HMSA 3M0XA 5HMEA 3VIGA 4LBSA 3WD3A 3OBAA 4ZSUA 1H7XA 4QJ3B 3E0LA 1KCXA 2Z28A 5AECA 4LY4A 2HVOA 1K9EA 2PDFA 1XIHA 1A3XA 1B9ZA 1OY0A 4V27A 3QY6A 5K4XA 2VMFA 4NXKA 4RPQA 2HDJA 3EA3A 4JR5A 3T05A 3DESA 4S2CA 2G4JA 3GG0A 2EGZA 4YTQA 5DO8A 5JH1A 1CGTA 4FNTA 5FSEC 3DFTA 5AHNA 2YZ5A 3B0YA 3PBGA 3N6QA 3WEOA 5KZEA 1GNXA 4FXFA 2ZUSA 3LHWA 1ODZA 5HK4A 1DYSA 3EX2A 1HKMA 4G2DA 1KBLA 2E4TA 5I6SA 2X1RA 3PWGA 1UD3A 2VX7A 2PRHA 2AAAA 5GQBA 4D1IA 1ZBKA 2VRKA 2NLIA 2HROA 4FNPA 4OBSA 3IRDA 3NQ8A 3LOTA 2DSWA 2WV8A 3LRKA 4MKNA 4J35A 5AKQA 2O9OA 2PSNA 1TPFA 3WLNA 1E1CA 1V6WA 2DFAA 1C9DA 2ZE0A 1VHNA 2YXGA 5LIWX 3OGVA 3KW3A 5BYWA 3M6YA 4ATWA 3HV8A 4H04A 5EFFA 3MCMA 3MW7A 2J6XA 2PWHA 3R25A 3HJZA 5AN7A 3WG6A 4DUXA 3DI0A 4D8AA 3L0NA 2EG8A 4LV9A 3LMZA 3NJ3A 1XJBA 3YPIA 1JFXA 2WMIB 1E3ZA 5LYRA 4IFOA 3QTPA 3GIPA 4PTMA 1TO3A 2CLIA 3OVQA 3GLCA 1GVIA 4DLFA 4GY7A 1PWMA 3OA5A 5AHFA 1UWIA 3A23A 1DWJM 1EO7A 2DIKA 4GNJA 1B5TA 3OGRA 2PRMA 4O8AA 2HISA 3F4DA 1G4PA 4KEZA 5PTDA 4FMVA 4Q4MA 2JBMA 5M17A 4JICA 4K6AA 4HU4A 4BF7A 2V3EA 2QMKA 3BAXA 5A8OA 4XKYB 3HMCA 4G1KA 1JUKA 1KV8A 1UZ1A 4J3WA 3LCXA 3D3FA 4U28A 3EX4A 1UD2A 2A2IA 2NLYA 3CH0A 3CUFA 4ZOCA 1F4HA 1LOLA 4JKKA 5M3WA 4XO6A 4JNMA 5XINA 5FF3A 3P0XA 2ZX8A 1KCLA 2ZCGA 4Y6GA 4M19A 4I9TA 3KL5A 1LWHA 2JGQA 5CCZA 2QCFA 3NYDA 2PFHA 3TQ0A 2WM1A 1YTKA 4LFYA 3R2GA 4ICCX 3W7CA 1SJAA 3ES8A 3P60A 4RJEA 3NZ1A 2DSKA 4O11A 3UWZA 5I03A 2ATMA 4X0NA 1DTUA 1LWJA 4EK7A 5C9UA 5C7VA 4ZOAA 5L9FA 4I5XA 3WH9A 4N2YA 2WNZA 1CWYA 4UIOA 1FXPA 3F5KA 3C52A 1XBZA 5G1TA 1UKSA 2XIQA 4FS9A 1Q66A 1UJPA 1TJ0A 3Q2DA 1J01A 3VUSA 1TVLA 1RD5A 4MAVA 3T40A 1M7JA 3CPRA 4H7CA 3B05A 4DM1A 1WDQA 4UMBA 2V2DA 4YHEA 4JEQA 3P6LA 4O14A 3MUZ1 4IWWA 2C18A 1PX3A 1RK6A 4DZHA 2BY0A 3NA8A 2GOUA 4DJDA 4F9DA 3KL0A 1YPIA 5A6TC 3UZ5A 4HSOA 2VR5A 5M03A 4LUIA 1HVQA 2XFYA 3OZMA 3TJXA 1GCYA 2Z1WA 1CX9A 4Z42C 4TV5A 4L56A 4DJFD 2BZNA 2GVJA 2XZ7A 3PS7A 1S5NA 3DU0A 4GYPA 1FWAC 4GACA 2GZXA 1C92A 5K4ZA 3BW4A 3AYTA 1TPC1 4D71A 4C60A 1TTIA 5CLWA 2W67A 3KLKA 1XSKA 4DI8A 5I3HA 3W2JA 1A47A 4WGXA 3VM5A 4K68A 5C54A 4FIRA 1IEQA 3TN5A 4DIAA 5FESA 1SJDA 1X6LA 4DBDA 3GD6A 3W1TA 1H2JA 2MUCA 3WEZA 2XWEA 4UQCA 4RXFA 3S6TA 1EXBA 4QG9A 3OZYA 1NF7A 3UXIA 3BCJA 3UZXA 2QPSA 4Q8OA 4HPHA 7TIMA 4LW7A 4A21A 4OJYA 2YJQA 4XD6A 3AOFA 3CLMA 2J8TA 4B92A 5JBDA 2WHKA 1R2SA 3CV7A 1E71M 4AZCA 1TUXA 1VYSX 3UXKA 4K3ZA 2QCEA 2WVTA 3ZM8A 1TWSA 5I02A 1OCBA 3KAOA 1SZFA 3T44A 4AX6A 4I6KA 2V5KA 4HNNA 2HJPA 1J2BA 2A3LA 3PBYA 4LB4A 1GQNA 3LSBA 4FNSA 4WSHA 4WXYA 1HT6A 4PMYA 3UWVA 4ILSA 4PUMA 5A2AA 3C8NA 1ZJAA 4XG1A 3WH7A 3VX0A 5JVLA 3NVTA 1ECEA 4V33A 1V08A 3V4BA 3VMNA 3ZR6A 1PIIA 3RLVA 1NWTA 3GTXA 2DJXA 2W4XA 3HPFA 1S2AA 4I90A 1XDMA 2WNQA 4AHPA 2J88A 3W1PA 3TN6A 5AYBA 2CLLA 1ISXA 4ORMA 3U2CA 3MKCA 4PTWA 3WLOA 3NDZA 4P8VA 8XIAA 5E1QA 1KD0A 3BK0A 2HPMA 4MB3A 4CN1A 2AQWA 3L4WA 3LNPA 2FGZA 5FJIA 4PSPA 2C1HA 1DQXA 2GDUA 2FVLA 2BFGA 1G9HA 2VWSA 3N4EA 1OCNA 4QROA 5AC8A 3GC5A 3SN4A 1CYGA 2QHAA 4E5TA 4GX9A 3KVKA 1UG6A 4PUWA 4OTKA 4IZGA 1E72M 4JTGA 4ZO9A 3BG5A 3GZAA 4XKMA 4GOAA 2YCIX 3UERA 4P7RA 5EGRA 5FL0A 4JQ1A 4LTSA 1DJXA 3T0AA 4F66A 3H2FA 2WVUA 3MUAA 4IFKA 3A9BA 4DF2A 3WH8A 1QDSA 4DY1A 3C4UA 3W1NA 5E70A 2E8YA 1FDZA 2OYLA 3TSDA 1S1PA 2C8NA 2PC8A 2E0PA 5D30A 4B5SA 3SY5A 4HTYA 4LUYA 4Q6JA 1MQPA 4U4MA 4Y8FA 3LX9A 4HZ8A 4S3KA 3USBA 4QJ5B 3B8UA 1DJNA 3TLQA 2REQA 5CPSA 4C7FA 4GH1A 4CNNA 3W1LA 4QNEA 3CUIA 1FCBA 2VCCA 2QNEA 4QQ3A 2X7VA 2VR2A 2WJFA 4ERGA 4PUEA 1ITCA 1TG7A 5GNZA 4LEQA 1AQFA 2OJPA 1XV8A 3M5VA 4IFKB 1XCFA 3SDOA 1NH6A 3W83A 3MA8A 1DWAM 4CCCA 4BWLC 2DP3A 2A6NA 2O56A 3GXMA 3UD6A 3W76A 3S1UA 3V35A 1TR1A 3CAKA 1S3HA 4AUBA 3VKDA 3N12A 1I2QA 3OJGA 5C9ZA 1IEWA 4YL2A 2W92A 3PANA 1XLIA 3G0XA 3AXHA 5AYIA 1GONA 3TOPA 3W38A 1EF3A 4RDYA 3V18A 4FLSA 5EL1A 3IIVA 2JKPA 3AIVA 5SWUA 4PTDA 2C1IA 1IE7C 4QCFA 3R13A 3B4YA 2WO5A 3BQ5A 2C3ZA 4X22A 5D2YA 4KKXA 2JGYA 5GJPA 1GOOA 1KM5A 2NQJA 5D8WA 3D5HA 5DY3A 5A8NA 5A8GA 1AFSA 1REQB 3UNTA 1WQ5A 4NY2A 3RCNA 4ACZB 4N9DA 1SZGA 3B9DA 1FWGC 2HMCA 3KX6A 3S9YA 2CFFA 5CPOA 4O1DA 3QQ1A 4LVFA 3GG7A 2ZZ1A 1TUFA 4JHMA 4A22A 2FHFA 4GUHA 1OJXA 3OLGA 1LTDA 4GUIA 4IX0A 4UOZA 3AHZA 3M0MA 2WHLA 3ARXA 4DNMA 3FDKA 4M7TA 1LP6A 3EKLA 4CQAA 5KITA 3BVJA 1GOQA 2YDQA 4I7VA 3HBLA 3DFSA 4EAYA 1XD0A 2P0OA 4OOZA 4EIVA 4IX2A 4A3YA 5I3DA 5IXEA 4HZMA 4PMUA 3I65A 3EEGA 3HPXA 2ZA1A 3FFSA 1D9EA 2EBNA 1PKNA 2V3GA 3VPLA 2B7NA 4B4FA 1EA9C 4K1GA 1V02E 2WMFA 5AB3A 4UR9A 4W5UA 1Z89A 4YCPA 1U22A 3WDPP 3LMYA 3ATZA 3EGJA 4CNTA 3UPBA 3AXMA 5I00A 3VMOA 1JCYA 1SW7A 2VOTA 1F07A 1QJWA 1W3KA 3PWAA 1AQMA 4D6CA 2IPFA 1X98A 4AYSA 3C8FA 4NJGA 2F6KA 3IV8A 3I3EA 4QEEA 3N04A 1UWAA 1OBAA 1WX0A 3GY1A 4QBXA 1FWFC 4EXAA 1JUBA 4HCLA 3WL1A 1JYWA 1B3WA 3W22A 3IGSA 2REQB 1H49A 1OT2A 4NAFA 5CC5A 3DAQA 2CKSA 4FXSA 3V36A 4MM1A 4LS2A 3S9ZA 4B5VA 3WUEA 2YW4A 1ZALA 2OGJA 5H2ZA 1XPGA 4ZB5A 1FA2A 3KZSA 4CU8A 4NILA 1KFWA 2CERA 3U2ZA 4GI8A 2GWGA 1BGGA 1JI2A 1LG2A 2CLMA 1OQFA 1H51A 3SFWA 4CD5A 5CSRA 3KP0A 4L61A 1KRCC 4KGJA 1H1YA 1KR1A 9RUBA 2A7NA 3N2BA 3AIRA 4GY1A 3DC0A 3UNDA 3ENLA 1S39A 3ZVHA 4TTUA 5HPOA 2IKHA 1H7RA 4I5RA 1XRSA 2VR4A 4H4IA 3AHYA 3Q94A 3P8JA 3VU2A 4JIRA 4L9ZA 1F74A 3IJIA 4QISA 1A3WA 4UOQA 1A4LA 1AH0A 4DO5A 2ACRA 3DUGA 4QJ4B 2DQWA 4FXJA 2WZHA 1ZGDA 1I9CB 3V7PA 5GJMA 2VX5A 2Y5EA 3POHA 4TVDA 2Q8LA 5G4WA 1P4CA 1MUMA 2XM2A 2BHZA 4Q6XA 1OZMA 2PDNA 3TJIA 4IMEA 5BOFA 1IXOA 2VT0A 1TV5A 3MMDA 5DCBA 1JI1A 1JPIA 2WZEA 5LKYA 2HZGA 4PRTA 1UASA 4UNLA 4L4MA 4YTSA 4FX8A 2IKJA 2BASA 3WSUA 4JTKA 2OG9A 1ZU8A 5BZAA 4PTNA 4E8DA 2QDDA 1QNRA 1BXCA 2X30A 2J7EA 4TX9A 2WKLA 4M24A 1AG1O 5C9WA 4AIEA 4UTWC 2PEVA 2OO6A 3PVFA 3DIPA 3EAUA 2BOFX 4PRWA 3TNBA 5ABFB 4F4RA 3MMWA 3H26A 3GTHA 4GXPA 1WAUA 4CN4A 2DZTA 2WLZA 3WDHA 4CNPA 3AS1A 3WLRA 4RR4A 4JN8A 2WPGA 5FF2A 3VCNA 1JDDA 2HVMA 2BGQA 3ZMRA 4H9VA 3QR0A 4ERIA 4MZ8A 4UBPC 1CDGA 4HMDA 2V30A 3PJTA 3L68A 1UW9A 3ORWA 4TOQA 4FLQA 4QHRA 3AIUA 4XV0A 2XIJA 4XWUA 1S46A 3B8SA 2ONEA 4DELA 2YBTA 3R11A 5FEXA 2R82A 1FWSA 1YEYA 5HR7A 1PSCA 3ITOA 1BQCA 5IRPA 4AEFA 3HPAA 1VCFA 2A7RA 3MY9A 1RBOB 5HNRA 2OWXA 3XINA 3MSYA 3Q37A 3CZJA 3SUSA 4TMBA 2V69A 3J7HA 2F38A 1RY0A 1MXGA 4U5IA 4MLRA 3I7SA 4AU0A 4LC8A 1VYPX 2XDFA 2J9XA 2EPOA 1NFGA 2WHJA 3UCDA 4LYPA 1L9WA 1EHAA 2IPWA 2J7BA 4XD5A 1W56A 3FA5A 4Q22A 4UNIA 2VVNA 3HOJA 1ALDA 4GIYA 1B3XA 1L6FA 1ZAIA 3LD5A 1J9YA 4HMNA 3HO8A 3QV7A 3LXBA 1V6YA 4H9ZA 4LJ3A 3PSVA 3W01A 4AD4A 1DXEA 4K37A 4YJ5A 4JTDA 3S6OA 4U33A 1XSJA 1XLMA 3WLMA 1XUZA 4K8EA 1XH2A 3P8IA 4OIFA 4H6QA 5A3HA 3NZGA 2PZNA 3AU2A 2OMAA 1HTIA 2PDHA 3BLPX 5AOUA 3IPWA 3VOFA 2GYIA 2P8CA 5HBFA 3G2GA 3W71A 4HK5A 1FX6A 1ADSA 4C6PA 1MW1A 4GIRA 4LX4A 4DAIA 3AIWA 4QDMA 1GVSA 1YE6A 3N11A 1F5ZA 3RX4A 3M41A 3UCCA 1Q2RA 1TCMA 1O1ZA 5C2GA 3S8HA 4WLCA 2FVKA 1PTGA 4HA4A 2CYGA 3ERPA 3W7QA 4GQQA 1AJ0A 1ZP3A 5LZLA 2DGAA 1OT1A 5G4HC 3GHTA 3IJQA 1KCZA 2P88A 1OFQA 4QX4A 1VFTA 2QS8A 3IRSA 1XH0A 1HJSA 2VDHA 1LCOA 2Z0IA 2O7SA 1QW8A 4IPPA 3SFKA 2ZC8A 3P2VA 2G3FA 4DUOA 3F1QA 3ABZA 2VZTA 3PZUA 3O6YX 3FCPA 1X96A 3OG3A 1SO6A 3AXXA 4ZO8A 5BOOA 5A2CA 1FVPA 3DZ1A 2WMHA 3LUTA 3G24A 3Q4DA 4FF5A 1MXSA 3WQCA 1XLAA 4MNJA 5F4XA 3H22A 4O19A 4PCTA 3IK4A 1EX5A 1DL3A 2R1PA 1RR2A 4MG4A 3UYIA 2CLHA 4MFEA 1IR2A 3MZNA 3IJDA 1LQ0A 1N2VA 2R14A 1XDJA 3KBJA 4ZQCA 4L9YA 3GC4A 5H1WA 4MNKA 3HGRA 2VFFA 4E8CA 3NQFA 4Q4OA 2VGFA 1HJQA 2RAGA 1U33A 1XIGA 3TCSA 5AZ1A 1Z7AA 5CG0A 1B3VA 4LUSB 2GFTA 5A6SA 3P3BA 1ZLPA 4ALDA 3DN5A 4UTJA 4XB3A 2PDXA 2P1FA 4DQWA 5J8LA 1NOUA 4QGCA 5FJRA 2PPGA 2DJLA 4MDOA 2V5CA 5FA5A 4C6EA 1R3YA 2WC7A 4Y90A 1F6PA 2TAAA 1E4NA 1TPH1 3IEBA 4DWSA 1J5SA 1ZP4A 2H9AB 5G4EA 3VIPA 4YNGA 4LBRA 1JCLA 2MNRA 3VABA 1XGZA 4A4AA 2POTA 3FIGA 2PDJA 1KTBA 2EKGA 2YGYA 1XLGA 3CT2A 2NVDA 3M16A 2D3LA 1XBVA 2Y5SA 4BF5A 4XZMX 3H2AA 1JDAA 5CJNA 3U5UA 3STCA 3EWDA 4M8UA 4GYKA 4HK7A 1RVKA 3ABSA 1RP9A 3R0KA 3OU8A 4JTRA 3W29A 1GQKA 2J7HA 2NT1A 1KXTA 3DX5A 4HNCA 1H7PA 4ZFMA 1XKJA 1K77A 4CD7A 3PAJA 3TC3A 2Z1BA 4KEMA 4N7QA 4WEVX 4RV8A 2ICSA 3A3WA 1WDPA 1OZQA 2OQLA 2IQTA 2ZUWA 1I0BA 1U5VA 3LTYA 4ZXLA 2DZSA 5AHMA 2YXOA 4DM2A 1WXZA 1F3WA 1V5XA 4KWOA 2YLAA 3D3AA 3PTMA 2OX1A 3BV7A 3VI2A 2Y7GA 2Q01A 1QXLA 3WKZA 4FNUA 4RZBA 3NDYA 3W00A 2ZZ4A 2GOKA 2BXZA 1KGXA 3BMXA 4XUGA 3G1YA 4H6EA 4G7EB 4ZA0A 3UQNA 2J4GA 4RK8A 1DHPA 1JCTA 1VPYA 1Z32X 2ZWZA 1DEDA 1C9WA 2PWGA 5C5YA 1EP3A 3QXBA 4INFA 3A6OA 3VINA 2X1UA 4XTDA 5CQ1A 3DG7A 3L5MA 3DERA 1PYMA 1J6OA 1HJXA 5ABEA 3L2MA 4R53A 2O4QA 4IPNB 4JN7A 4O17A 4IGHA 1Q6EA 1RA5A 4JX6A 3DFQA 3TAOA 3VGBA 3T2PA 1JDCA 3WENA 2PCQA 3VGGA 5K9DA 3W75A 3M7SA 3AYSA 3A4AA 3SW6A 3OQ8A 5E0KA 1KM1A 4AX7A 5CKSA 4JHOA 1XLFA 2FDMA 4FR6A 3H4WA 4J3UA 3FSUA 4KEUA 1Z69A 2NUXA 3FAXA 4PEEA 3A64A 2FHBA 3V3WA 1E4MM 2JIWA 8XIMA 2OWWA 4MY8A 4W85A 2C13A 4GCAA 1VGAA 4O8RA 2G37A 3SY1A 3F2BA 5HULA 4XIAA 4IIEA 1FTXA 1PEZA 3H8AA 5A8MA 5LNUA 1PZ0A 4Q4QA 4ZQPA 2R8WA 1GUVA 3TZNA 2VURA 3C0LA 2VFDA 1NP0A 3IJ6A 3IK2A 4XVDA 3A4XA 3QZEA 2D2OA 5I3FA 4F2UA 3NO5A 1KWKA 2CPUA 1W1TA 4WCJA 5HJXA 2E8ZA 3T0BA 1EZ2A 4Z2GA 3FDGA 2PTWA 5HQEA 1J8VA 3W1RA 1Q63A 3AICA 4AEOA 4DLMA 4GQGA 3PG9A 3M5YA 2DVTA 2ZFAA 1NQ6A 4XK2A 3M0VA 3MCOA 4E2OA 3WMSA 3TYUA 1ZSXA 4W8AA 3SCQA 2IMRA 1R6WA 1TR9A 4MLJA 2EG6A 2HQAA 1EOKA 3EWXA 3RLGA 1S2UA 3DFYA 5CPMA 3GU1A 4XAPA 1AZ2A 2OEJA 2ZXAA 5FOOA 3DH7A 3MBDA 5AC4A 3CAWA 4D9PA 1G94A 3W7NA 3TK7A 3BXWA 3C2VA 4F0KA 3E0VA 3N19B 2DIEA 3I7QA 1HKIA 4EWJA 4CUCA 1FWDC 3PNZA 1DWHM 1QI4A 4B5TA 4WSKA 2OEMA 3M43A 1FXQA 4RW5A 3WJYA 2X0YA 3AUJA 4ZB0A 1ENUA 4S1FA 3CAVA 1PAMA 2BHYA 2PTDA 3DHPA 2VRQA 1A49A 1DWGM 1EH9A 2JKEA 1HUVA 1GPFA 3WLSA 4HU8A 1R38A 4H9UA 2OZ3A 1YXYA 4E3VA 2JF6A 3VD4A 3VIIA 3VK5A 2BMBA 2G41A 3H2EA 1D7FA 4DO7A 4YS1A 5GNYA 4MNMA 2B7QA 4JDBA 1EEXA 2Y62A 3GXPA 4AZ6A 4IHCA 2WBGA 4HNVA 3FJ4A 3W7EA 2DEPA 3QFEA 3DHUA 1O66A 1ITXA 1EJXC 2VTFA 3LZ3A 3PFMA 4M6QA 4CQCA 5KSWA 2EPNA 3QPEA 4I9JA 5HA7A 1UZDA 3CZKA 2ODOA 3VNLA 4QITA 4XISA 4DYJA 3WH5A 2PMQA 2NX3A 3NM1A 4CU6A 1HW6A 1WB0A 2VXNA 1KXHA 4M81A 3GB6A 1FY6A 1AD4A 2INZA 4XSMA 4B3KA 1CW2A 3G0UA 1Q6LA 3V0SA 4E2VA 3EXRA 4MTVA 3LHVA 3RCMA 4ACYA 1S5MA 1UPMB 2CLFA 2WOQA 5H8UA 4O4VA 2KZHA 3U9IA 1QHOA 3RRAA 1VAHA 3TNOA 1FCUA 2R24A 3RMJA 4UTTC 1A4MA 4JTUA 4OKDA 4AD0A 4WDWA 4C6DA 1DIDA 3ZLFA 2WWDA 3VIOA 5KTLA 3R0DA 3APYA 3THDA 4PULA 3WY1A 2DU2A 1OEPA 4W88A 4AMCA 3M5XA 1PCKA 2PBOA 3NDOA 3GIYA 3RO8A 1YYAA 5HQMA 2WANA 3CK5A 4NJIA 3ITTA 1EIBA 2AQVA 3NPXA 1W1ZA 2J62A 2YCJA 1J0YA 1FWEC 2GVGA 4CEXC 2VEKA 4RW3A 5GVJA 1AL8A 3EA2A 2HK1A 1C7SA 4LALA 1C8VA 3G1VA 1TZ9A 4EP8C 4PMDA 3IVTA 2OKTA 3CH9A 5EMKA 2D22A 3VOGA 2YCLB 1E4IA 4RCXA 4DXXA 5BWFA 3PG8A 2IUZA 1K7FA 1EQCA 3WBWA 3KBVA 4IT1A 3W1AA 2IKIA 3KOZA 3WQFA 4M3PA 1JNEA 4FO4A 5D9MA 1GHRA 5H8PA 3LV6A 3KVMA 4X3ZA 5A69A 4PSRA 1EP2A 3TN3A 3G6MA 4C7GA 3DFOA 1EF2A 1K70A 3SR7A 1RALA 4B3LA 3NEVA 3M9YA 3VD9A 5DCDA 4HJFA 1FWCC 4LEFA 1JL8A 1EJ7L 3EXSA 1GYLA 2VZOA 3LPGA 1DBTA 4H6RA 2D23A 3G3MA 1Q7QA 1PTDA 3STGA 3QMRA 3W7IA 3QV8A 2J8FA 4WKHA 3GTFA 3O8AA 3CZLA 3N15A 2XU2A 1UJQA 4L7ZA 4KH2A 1YRRA 4UFMA 1QNOA 1XQKA 4ZXOA 4NJKA 4GD0A 4TR9A 3G1SA 2Z7KA 3DYPA 1JDFA 1WUEA 4I3GA 3U57A 4G6CA 1QFEA 2DZUA 4IG2A 4JL1A 3UJEA 1OX4A 4MKVA 3O0KA 5DBUA 2CC0A 3PP7A 1TFVA 4N02A 5HNTA 3VKJA 5D9PA 4JZ5A 4R34A 1VKFA 2QAPA 2PLMA 3T78A 3UT0A 4JCMA 5CPQA 3OLEA 1EJVC 2O9PA 4BEUA 5DN1A 3AWNA 1FWRA 2RGLA 4DBUA 4AZ7A 1A0CA 1L8NA 3V5OA 3UXLA 3JRKA 1VFSA 5D2TA 4JQ4A 4HA0A 4CVWA 2YA2A 2PWEA 4IPJA 4PBEA 3VE7A 3NUKA 4UTHA 2B7PA 1EJRC 5LXEA 4XAZA 1GT8A 3PK7A 1TWWA 4KETA 2Y61A 4HZ6A 3W7GA 4GC4A 2WC3A 1X6NA 2ZTKA 4REQA 4DXVA 4MGGA 4IJCA 1FCVA 3LLXA 3IUDA 3M64A 4F0HA 4HYRA 2GUYA 2WVVA 1NWUA 1ZTVA 4NJHA 3OB8A 3C2OA 3NZQA 4UZUA 4PN2A 1TPWA 1B3ZA 3LN3A 2QIWA 1RA0A 1FWBC 2EEXA 2GDVA 1UR3M 3FNDA 3WQWA 2BVWA 5I0DA 4HHMA 2AAMA 4QS5A 3GFYA 3WQ5A 3E1F1 1RPKA 2B31A 2Y24A 3AC0A 1Q8JA 2IPJA 2FGBA 3SB0A 3U6WA 1OGBA 4MB4A 5C2CA 3OTRA 2VC7A 1B3YA 4PTVA 4UMAA 3DOPA 2NXHA 5IDZA 3HGOA 5IHRA 2YDAA 1CLKA 2QPXA 2XG9A 3KP1A 1S5WA 2FZ9A 1YTEA 1VBUA 4M5PA 3ANUA 3L21A 4M1BA 2RGMA 3B03A 2X1TA 3WD2A 5C6MA 4LNCA 2QCMA 2I5QA 3GTIA 2J7DA 1VEOA 4O0KA 3G77A 1BFNA 4X9YA 1GYNA 5IFTA 3A4JA 1ELSA 3WNMA 4ZMGA 5AHLA 3N6HA 5D2VA 4PCSA 1S2CA 3GXIA 2BV9A 1R3RA 4BI7A 5DXYA 2WQDA 1OG6A 3H2CA 3E0WA 1YX1A 1GVYA 1E6XM 1JGIA 4YHGA 2JQXA 4ZGYA 2ATSA 4KW2A 5E6YA 4RX0A 3RO6A 3H12A 1KLZA 1QOPA 1PHWA 4Q8NA 1VFMA 1BD0A 1H41A 4R7JA 4BI5A 2TPSA 5TNVA 4S23A 3T09A 3QOMA 2DUZA 1RV8A 3E5BA 5CGQA 4XD4A 2BBFA 2YCKX 1E0TA 2XHYA 2PD5A 4PMXA 1W1PA 4EXBA 1UUMA 1KM2A 1E5JA 3UR5A 4B15A 3N2XA 2XIIA 4R9OA 2WWCA 1LLWA 2YCLA 2I14A 2YFNA 1JZ5A 1K6WA 1W5OA 1GW9A 4YIWA 4HCHA 2GWNA 4AY8A 3CIWA 3VYLA 2ZIDA 4PZVA 3GSMA 3B0VC 3RG6A 1KRMA 2WKGA 4UFJA 3UETA 3BGAA 3PUDA 3R8GA 3GFZA 4TTGA 4FXRA 2WNNA 3QV9A 3SQSA 3W6LA 1QRQA 3FYPA 2NVAA 3EDDA 3FGCA 3BV4A 3NZPA 3LCGA 2Z1KA 3SCTA 3V1PA 2CBJA 5HNUA 3EB2A 4JXCA 2YL5A 2QVNA 3AFBA 4KERA 3CGTA 3W72A 4OWGA 5H8MA 3ZJ6A 3RR1A 4H3DA 4ADSA 1HNYA 2QUVA 1FHLA 2Q3RA 1A5OC 3N34A 1U30A 3AAMA 4QCEA 5CPLA 1Y5XA 2XWDA 4ADTA 4KRZA 1RJQA 4KIRA 4B5NA 1Q6OA 1M1BA 4B5WA 2GSEA 4EF9A 2NQLA 4JFSA 3NURA 3UJSA 1CLXA 4IIBA 3RYSA 1N8IA 1W1A1 2X2GA 3MQTA 4K8HA 3TIMA 3ARZA 4K1WA 2QKFA