1JQVA

The k213e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPEDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqvA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqvA01
1OYBA 2W0UA 1JCNA 4BWLA 2ZRWA 3TX9A 3G3DA 1JCJA 4IXHA 2QCDB 1ZAIA 1GTHA 2JKEA 1LOQA 3GZ3A 2V8ZA 1FWTA 4ML9A 5DLCA 1QPRA 3HMJG 1IXNA 4ZZ9A 2GVGA 3SSJA 1VGAA 2VFEA 1TQXA 4OHQA 2E6AA 3O15A 3KVLA 4LS1A 5AYXA 4TIMA 1KTNA 1SW3A 1SPQA 3MYPA 3TMLA 3UWYA 1TTPA 3WK3A 4NU7A 3NZRA 2WJZA 3UWVA 1OF8A 1KLYA 5KZDA 3CQ0A 2AGKA 1SO5A 4HIBA 4NNBA 4O15A 4QJ1A 1DORA 5I3IA 1EIXA 2AQWA 5AYYA 3NYZA 5LNSA 3BGJA 5KZMA 1G4TA 2NXHA 2R8WA 1SW7A 1I4NA 3TJLA 1MEIA 3N73A 1LROA 5FEXA 3LRLA 3GDRA 1LRTA 3O1NA 5EKYA 4ZL1A 1HTIA 2YFOA 1EP1A 3MP4A 4GC4A 1W3NA 3WJWA 1SUXA 4O4WA 1CW2A 2ISWA 1I2PA 2R14A 2HS6A 3UZJA 3CWNA 2FLIA 3O63A 1O60A 4DBDA 3PBUA 5BMWA 1P0KA 3CU2A 3O6YX 4NJGA 1DOSA 4GXMA 2CWNA 5C2XA 3MW7A 1JJKA 4DBEA 4Z0SA 1KM1A 3TFXA 2WSYA 2QCHA 1K8YA 1N7KA 2DJXA 1TRIA 3LCIA 2ZA1A 4EIVA 3HPZA 3HPSA 2Z1BA 5K4ZA 1H7WA 4O17A 1VC4A 3W72A 1X6UA 4FIRA 3GYEA 3W7MA 3TQKA 1KM6A 1VLWA 5FEZA 1PCWA 5D2XA 4CNPA 4JX6A 1H7XA 3W84A 3C2VA 2B7QA 1Z48A 5HUOA 1H51A 2CLHA 4JICA 5KMYA 1NFBA 3E9AA 4OGZA 3PBYA 5C54A 2WQPA 4L4LA 4HNVA 3T7VA 4IMCA 4EWND 4UFLA 3QQ1A 4LS0A 1OVDA 1FWNA 2E1DA 1Q3NA 3NQ6A 3UYCA 3EWXA 3QW3A 3MP5A 4RZ4A 5FEWA 2RDTA 5G2WA 4I7WA 3QC3A 3EXTA 1EB3A 1L2UA 1XFBA 1ZHAA 1C29A 1IIGA 4JDYA 5K4XA 5D33A 2NV2A 5K2ZA 3FYOA 3GR8A 4I7UA 2TSYA 3KVMA 4IMFA 4KKXA 1LP6A 3NAVA 3DAQA 1WDWA 3W83A 2YGYA 3B06A 3KVJA 5HWNA 5HWJA 3D0CA 4GE8A 1W5QA 1W5PA 1KFEA 2X1TA 4R53A 1KM0A 4O57A 3LI0A 2ISSA 3TK7A 4O0KA 3HG5A 4UTLA 3LTPA 3LBMA 3N9RA 3MI6A 3LX9A 2J9XA 3M1ZA 1B4KA 3G0XA 2X2GA 4JY9A 2Q3OA 1DHPA 4MY1A 3IV3A 3FJLA 4N2YA 2Z6JA 3SIZA 1VH7A 3C61A 1VYSX 1DQWA 3M6YA 2CLOA 3LOTA 4IOTA 1EUAA 2PCQA 5DXYA 3QEZA 2Y7DA 3HQ1A 1W5MA 1T0OA 5FESA 3EX4A 3NQ2A 1DBTA 3QW4B 1H5YA 4IQLA 4HNTA 1LBFA 1VHNA 3BV4A 5CG7A 4CCCA 4IJBA 4XZ9A 5HR7A 2JGYA 1OX4B 5F4SA 4JX5A 2B0MA 1XBVA 2WO5A 2GVJA 1FCVA 4LVFA 1EWDA 4P2VA 2XN0A 4A22A 2ZRYA 1G7UA 4OBTA 4EVZA 2H3DA 2DZWA 1ZY9A 3L0NA 4PC8A 3BW4A 1TYGA 2QJGA 4O1DA 3TQVA 1O5KA 2ZA2A 4IMGA 3WK2A 4ZMGA 4RV8A 1UASA 5DY3A 5FF0A 4RXGA 3W7CA 1SQ7A 3M41A 2V2CA 1RPXA 2CLIA 2QUVA 3LHWA 5K9CA 1SW0A 3G1XA 3T40A 4BK9A 5KINA 1MO0A 5F2IA 1LM1A 5KSWA 5KZEA 2AAMA 1GTEA 3STCA 2CLMA 5U4NA 4Z1AA 3SGZA 3I6RA 3S1XA 4AWTA 1XBYA 1J2WA 4Y6GA 3N3MA 2VELA 3WK0A 1RQHA 2X1RA 1D9EA 1RZMA 3DKJA 3THQA 2LLEA 3O07A 4QNWA 3RMJA 3UQNA 4N02A 4FO4A 2DZXA 4AWUA 2ZRVA 3G1AA 3PVFA 3R2GA 1SFJA 1XXXA 2JKAA 2Y70A 3GAYA 3KOFA 2HS8A 1VCGA 3O05A 1QO5A 2ZQ0A 3S8HA 3RLVA 3CTLA 1EWEA 1RQEA 4YL2A 1KFCA 2CU0A 5LKYA 4XQ6A 4MLJA 1THFD 3C0JA 5J5DA 6ALDA 1QDSA 3M0ZA 2ZDRA 3BLFA 4UCGA 1DQXA 5HNRA 1AL8A 1TPH1 2R94A 4NXKA 4AEOA 2B7OA 3Q37A 1VPXA 3CWOX 4TO8A 3KRSA 1K8XA 3E49A 4Z1CA 2ZCGA 1H60A 5F1VA 3WJYA 3NQ7A 3QPYA 1JR1A 2V2HA 3NR0A 3OEXA 4UTKA 3YPIA 2D73A 4KFPA 1Z41A 3DFNA 3S42A 3C4UA 3A9IA 1KM4A 3QZEA 4UTTA 5D2VA 2J24A 5G2IA 5DBTA 5HJLA 3GDMA 3PG9A 1TO3A 1PE1A 5FF7A 5BOOA 3RNDA 3TSDA 3IVTA 5KITA 1QO2A 1J5TA 3GB6A 2CFFA 2C6QA 1J4EA 4JY8A 4NQ1A 4DF1A 3LDVA 5DCBA 4TMCA 4DF0A 2A6LA 1Z44A 2VFHA 2CLKA 5I3GA 3UPBA 4W9TA 1IGSA 3W2NA 1UUOA 3M43A 4UR7A 1TPWA 3ZFHA 5AOUA 4X3ZA 4JNMA 1H7RA 4R34A 4WY0B 2GJLA 4PFMA 1KW1A 1O94A 1Q6OA 3B04A 4E38A 2RKXA 4ZVJA 3IIXA 1B4EA 1SR9A 2P1FA 1GOXA 3VKJA 1QAPA 1XM3A 4A2SA 4BWLC 3P61A 5D30A 4K38A 4PODA 4Y96A 3PUEA 3MWAA 8TIMA 3A5VA 2ZZ4A 4Y8FA 4N9BA 4UC5A 4LVBA 1MEWA 3BARA 4LWWA 3NGJA 4FX8A 3HF3A 4N6EA 3G18A 3P60A 2RH9A 4UNLA 1T99A 1LZOA 4K36A 3WFAA 3VFLA 4OE7A 1OK4A 4RLIA 3LCFA 1WAUA 4XTDA 1FBAA 4TX9A 4JS3A 4K8EA 4YXGA 1UUMA 4GUGA 1FCBA 3FKRA 3QSTA 4QNEA 5KTLA 4YCOA 4DPPA 4HPXA 4LW7A 5MHBA 2DZSA 4Y90A 5CPNA 2F7FA 3R5EA 1KFBA 3G1DA 1VZWA 1LYXA 3GXTA 2ZZ6A 4UTWA 4LRTA 3MP3A 3DENA 2Y88A 2KZHA 3C2EA 2G5WA 2E77A 2ZRZA 1TJRA 2V81A 4LY8A 3P8JA 1H1ZA 1GG0A 2X16A 2A21A 1Q45A 3MBFA 1HO4A 5LNWA 3NPWA 4IPIA 1K3UA 3ABQA 5CKSA 3E96A 3P67A 4FNQA 2BSLA 4MZ8A 3W1LA 1LORA 3LBCA 2ZRXA 3B0UX 3PS7A 2QCNA 2ZA3A 2YCEA 4S2CA 4AB4A 3P81A 3W1XA 3HBLA 4JDBA 2QEZA 1F05A 4A29A 4R7JA 2NX3A 4FNRA 4ORIA 4AHQA 1QPNA 5AC7A 2OJPA 4BI5A 2E5BA 1MEHA 4DO6A 2NWSA 2WNZA 1XL9A 3GVGA 1H7NA 1V5XA 3RF9A 4XKYB 3TCEA 1KLZA 1EA0A 4LVAA 2A0NA 2QKFA 1VS1A 2VFIA 3CPRA 1ME9A 3ABRA 5AHNA 1QMLA 1ZAHA 2V5BA 3C8FA 3LTYA 1F5ZA 3M44A 1TTJA 2A7RA 4O1AA 4O11A 4JTGA 1U83A 2VFDA 3CLMA 2QUUA 5G4EA 1XBXA 4IWWA 1KV8A 3W7GA 3DH7A 4DO4A 2J9ZA 3JRKA 5CSSA 3LM7A 1V7YA 2QCGA 2FPYA 3BPWA 2C19A 1EP3A 1N8FA 1TRDA 1YYAA 3W71A 1O4UA 2FFCA 4OWGA 2J88A 3W7DA 3SECA 2B7PA 1LBMA 4QM1A 4K8HA 3F4WA 3N34A 3PR2A 1YXCA 3PUDA 2A7PA 4FNSA 4JTIA 1QPOA 2DZPA 4IGHA 1OFOA 5DELA 3W6YA 4XBSA 4G1KA 1T8XA 2JGQA 3K30A 4MPQA 3TR2A 2ZZ5A 4POCA 5AFDA 2QCCA 2B7NA 3TXZA 4MOZA 3AO0A 5HQEA 4LUIA 4KWWA 5AHEA 3BG3A 3PF3A 4JD4A 1LRNA 2QUTA 2Y7GA 4AWSA 3W7JA 4S2BA 3DI1A 1I2RA 1F6KA 2EHHA 1DV7A 1AW5A 3TC6A 4CCDA 1FXQA 2F84A 5TBOA 3NQFA 3LCXA 1G4PA 3PWAA 5F2MA 3PULA 2RDWA 4DPQA 4N9DA 2YYUA 1H63A 3P62A 1UCWA 4UR8A 5F2LA 2Y89A 1TTQA 2H3BA 3LLDA 4IX0A 3W87A 4E2BA 3N19B 3TAOA 1OABA 2FB3A 3W22A 4C1LA 4DXVA 3MHFA 2VEMA 3TV8A 3NPXA 4KFOA 3TJXA 1PV8A 3M5XA 1QOQA 4QITA 1G7VA 3NQEA 1GVOA 4PCFA 2FTPA 4E2DA 3LRMA 5IBXA 3M5ZA 2J27A 5I3KA 2PE4A 3IGSA 3W7LA 4AF0B 4R33A 4O1BA 4OV4A 4GUFA 1Q6RA 2H90A 2NLIA 2TPSA 4X9SA 5D2TA 4D2JA 3P8IA 1K03A 4UIOA 3C3NA 5AN7A 3TIMA 1JCLA 3W07A 3MI2A 4JIQA 3MJYA 2TYSA 1WOBA 1LLWA 3NM3A 1M6JA 4QQ3A 1GPWA 1JQXA 3NQDA 1A5CA 5D05A 5EYWA 5G1YA 5CZJA 3G22A 2A5HA 1OJXA 2I1OA 1W3TA 4Y9AA 3OIXA 1SZNA 4E0CA 3TW6A 1C9DA 4RZ6A 3Q2DA 2TMDA 3NQVA 4JTUA 3BVJA 4WJEA 4P61A 1B9BA 3EXRA 1DJNA 4FNUA 2GVLA 3I68A 4AHOA 3RLUA 1ICQA 1EP2A 1OFRA 1TREA 4PL1A 3N9SA 1GVRA 5EY5A 4FXRA 4NT0A 3G24A 1W56A 3UY8A 2DZUA 3F4NA 4H6KA 5A5WA 1MXSA 3W7IA 1TPC1 3SR7A 2YW3A 2QCLA 3MO7A 4ADTA 4AH7A 2G96A 1Q6LA 2B4GA 1ADOA 3HGJA 3W3OA 1YLVA 2C1HA 1K8ZA 3S0CA 3W1TA 3M7WA 1VYPX 2QCEA 2I9EA 4UNKA 5G5IA 4LU0A 3IEBA 2NV1A 1QR7A 5HWMA 1LOLA 3S5YA 2NUXA 4TR9A 2E09A 1K7XA 2ZRUA 3LCWA 3M9YA 5AC8A 3L2IA 2C3ZA 2CLLA 3DI0A 3QH2A 3QJAA 3DHDA 1OF6A 4CCEA 5LNRA 3A5FA 1DL3A 4O28A 2ZTJA 3MHGA 3FEMA 3IIZA 5F4XA 3PY2A 1PCKA 4DEFA 2BTMA 4UTTC 3TH6A 3FOKA 4K37A 1Q6QA 3NQAA 3VNDA 3W2KA 4NX5A 1OFPA 1W0MA 1VCVA 3UD6A 5G4WA 4N4PA 1WX0A 3NEVA 1ME8A 2YR1A 1OFDA 5CZTA 3ZWSA 2TRSA 3L5AA 3R13A 1OYCA 1KTBA 4YCPA 4MFEA 3TSMA 1KTCA 5AHMA 5AYZA 1TPB1 2QDGA 1SSGA 4UTIA 2EKCA 3WJZA 2NUWA 3W1NA 4BR1A 2Y61A 4PL2A 1OX4A 3GIYA 4MJZA 2WSQA 5DXXA 4HSOA 3DFPA 3LXBA 2ABAA 2X1UA 2YFNA 3Q58A 4GUJA 3OVQA 4HHPA 3G0SA 3NZ1A 5I3JA 1YDNA 4XUGA 4Z1BA 3B0PA 4AAJA 3W7KA 4NUWA 1YTDA 1TSIA 3E12A 3KXQA 1JRBA 3SFKA 4NZFA 2HTMA 5U7SA 2C13A 3GDKA 1R2TA 1L6SA 1JQVA 2Z2UA 3W73A 3DFTA 5CZSA 3NG3A 5D2WA 4FIQA 6TIMA 2P0OA 3OVRA 4CNNA 5G1TA 1VHCA 1QNVA 4UFMA 1ME7A 2A7NA 3W74A 5C6MA 3L9CA 1I45A 1I2NA 3FJ6A 2E5CA 3NM1A 3STGA 3V75A 3G8RA 3NL2A 3N2MA 3ANYA 1QWGA 3DU0A 2H8XA 5HINA 2W79A 3C2OA 4ZQCA 4UTWC 4CNOA 3RU6A 2GPTA 2VEPA 2YXGA 3LB0A 2CZFA 4JX4A 4HNUA 5AHIA 3CEPA 4MVAA 3W1PA 5E1QA 5EMUA 1GT8A 3U8GA 4O13A 1S5WA 5F4WA 3T44A 4LV4A 1MSSA 1PHQA 1PHWA 1OFAA 2ZZ2A 1WXJA 4FNPA 1RD5A 3SI9A 5K3VA 3FIGA 4L4MA 3UZ5A 1YTKA 2CZEA 1ZAJA 3W2UA 3BLEA 2NX1A 3LHTA 2O7QA 3CT7A 1RV8A 1EPXA 5EA9A 2FPTA 3M5YA 3M5VA 4RCXA 4LV9A 2VEKA 5LSMA 1M5WA 4I9AA 1F73A 1K02A 1KFJA 1B57A 3PB0A 3CC1A 2X1SA 3CB8A 4LVGA 5T26A 3T55A 1OFQA 5LGXA 4O14A 4RX0A 3DKLA 5HUPA 2QAPA 2VOMA 4JYFA 1HO1A 2FPVA 1TJPA 3W7RA 3KX6A 5DCEA 2CZDA 5DY2A 1UB3A 4UXDA 4ORMA 3KRUA 1TMHA 3FKKA 4WY0A 3IIOA 3R12A 3ZS4A 3W23A 3L0GA 4UMBA 3INPA 1ICPA 4N4QA 1CX9A 3P82A 3P84A 4OU1A 4YMZA 1GQNA 3H54A 4MLRA 1SFLA 2OZ0A 5HR6A 3DFQA 2Y7EA 3THAA 1A5BA 3L0KA 4UMCA 4ICNA 4RJEA 3W7NA 4KFNA 4JYDA 3NPUA 4ZQOA 3W2MA 3SJ3A 3MUXA 5F1UA 2CZ5A 1S5TA 4LUJA 4M7TA 4MJMA 4A21A 4WD0A 3GXPA 2ABBA 1NEYA 1YPFA 3GNNA 3QM3A 4NJJA 4HT3A 1OK6A 1XKYA 1XUZA 3HIJA 4MY9A 1OYAA 2R91A 1H50A 3E0IA 5D02A 4NVTA 2C15A 2V5LA 4M19A 1DJQA 1ZFJA 3G3MA 4FHAA 1C8VA 1VQTA 1F7BA 3DBPA 3W2JA 1A5AA 3E02A 4O19A 1JVNA 3DHFA 1OX5A 1X7FA 1TPVA 3GAKA 3SZ8A 4ZQRA 1OX6A 3B05A 3W1AA 3MMTA 4GNJA 1KBIA 3OG3A 4NXSA 3GXNA 3S5NA 3LHVA 3NVTA 1FY6A 1L6YA 4JXCA 1F74A 2ZTKA 3G1YA 3LRKA 3QQ0A 4LTSA 4A2RA 4N9CA 3W2LA 3S5ZA 3TQ0A 2Y62A 5IBXC 2E68A 4O12A 2ZZ7A 2GOUA 3W88A 4K7YA 5TQLA 3W7PA 1JUEA 3LI1A 3DFOA 3EXSA 1O5XA 4FNTA 3G1FA 1ICSA 3G1SA 4WY0F 2Y85A 2Q8LA 4Z08A 3Q94A 3G8EA 5FF3A 5D2YA 3GKFA 4ADSA 1KFLA 2RDUA 4UTUA 5G2HA 5FF4A 5LHFA 4CQAA 2FDSA 4JTHA 1BWKA 3B0VC 5CPLA 2A4AA 3BGGA 4B5NA 1SZFA 4EF8A 4JR5A 4NNAA 4QSHA 3L21A 4CQ9A 1XCFA 2YYTA 1RR2A 4LS2A 4JTJA 4XBKA 1H1YA 4JEQA 3O8AA 3PSWA 4MZYA 1SO4A 4LRSA 2XFWA 1TQJA 1EX5A 4M5PA 1WOAA 3DFSA 4N6FA 3I7SA 1W3IA 2ZZ3A 4UTHA 3ATYA 5I3HA 3P5YA 3LHZA 3W85A 3IGXA 1W54A 1VRDA 4I7VA 1IF2A 1NAL1 1QCWA 2EPHA 1R2SA 5D03A 5CPMA 3NQCA 1XDMA 1Z42A 4TU1A 5LHEA 4JYEA 3TE9A 1H7PA 2OT1A 2W6RA 1QPQA 3PB2A 3UY7A 1LLZA 1FCQA 1TPDA 3A21A 1TPEA 4O54A 5SWUA 2V30A 2QCDA 5I3FA 1G6CA 4BFAA 4N9EA 2V82A 2JKPA 1LRQA 1GG1A 4GWEA 3PUOA 2ZYFA 3HGOA 2BZNA 1K7EA 3VE7A 3GK0A 3FYPA 4O4VA 1S5VA 1A5SA 5H91A 4EF9A 3KFTA 3CEUA 3C6CA 5L6UA 3PAJA 2EAWA 3IRDA 3LV5A 3UWUA 3A22A 5CPOA 3QF0A 2QCMA 4QIUA 1YDVA 2QDHA 4OV9A 3AJXA 4JTEA 1XUUA 2J9YA 3NXFA 4O52A 1XC4A 2QJHA 2OMAA 4J9JA 3LERA 3S9YA 3W7EA 1ZJIA 4WOQA 1SO6A 2PC4A 3B03A 1M7PA 3OHIA 5DCDA 5AHLA 4Q4KA 1IXQA 5FEPA 4K6AA 1TPFA 3BW2A 1YDOA 4IMDA 1VCFA 1K7FA 4KWVA 3FA5A 5J5RA 4YWIA 1FX6A 5GVJA 5CSRA 3JR2A 4UTJA 1L6WA 3HG3A 3W7OA 1YPIA 1HL2A 1ZENA 1KV5A 5D37A 4EOUA 3TXVA 4AF0A 2Y63A 3C2FA 4NJKA 1GYNA 1I8JA 2FJKA 3HG4A 3KAOA 4BI6A 4LVDA 1X1OA 3C56A 3FLUA 5K9DA 4GUHA 3L68A 3RFAA 4O16A 4IPJA 3UXDA 1H7OA 2OT0A 1XBZA 4UFIA 3CHVA 4IUOA 1VR6A 1YXDA 4K39A 4Q32A 4IXXA 2X30A 2FB2A 1JCMP 1AL7A 1EUNA 3ELFA 2QR6A 4BF9A 3W75A 3LGEA 1PIIA 1PL9A 1W37A 3TW7A 5LZLA 1GEQA 3PBVA 4MFDA 4ZQPA 4CQ8A 1F2JA 1R30A 3EX1A 3HGSA 4UUIA 2YW4A 1BEUA 3KHJA 3L5MA 4FF7A 1XDLA 2C0AA 4BI7A 3ZR4A 1G67A 4AVFA 2HSAA 3KRZA 2ATSA 3PSVA 3BG9A 3TKFA 2VEIA 3HO8A 1ML1A 3NA8A 1AW1A 4U4MA 4JTFA 4OQVA 2WV8A 1GVQA 2H6RA 2OX1A 3HJZA 3N2XA 2WKJA 4X22A 4ZQNA 5FI8A 1LOSA 1G69A 1TV5A 5F2GA 1TV8A 3TDFA 1PVNA 1FDJA 5EBUA 3S1VA 4YLWA 2GQ9A 2PRLA 1KFKA 1SZEA 4WZHA 4WUIA 4O53A 2GQ8A 4M6QA 2BX7A 3TC7A 1AMKA 1WBHA 5EPDA 4Z1DA 3TA6A 3P5ZA 1UJPA 3W1UA 3QMSA 3G1VA 4U28A 1KM3A 2QCFA 4NNCA 3U6WA 3G0UA 3KVKA 2Y7FA 3U2OA 4DF2A 1GVSA 3GR7A 1RQBA 3IIVA 4HN4A 2DU2A 4X2RA 3OVPA 3I65A 3C2RA 5BRBA 1T96A 3SGUA 1XI3A 3EKZA 1ZCOA 3NO5A 1IXOA 2WNNA 3CM4A 2VKZG 3WK1A 5ABTA 3IGUA 1KM5A 3H53A 5D09A 3W7HA 3MI3A 2DP3A 3NL5A 1HUVA 4MIMA 1TB3A 1LDCA 2O7SA 1B3OA 5A8GA 2NUYA 5C5YA 4O8RA 1W31A 7TIMA 4RK8A 1U5JA 1GJPA 1M7OA 3NQMA 3T4CA 1ONRA 4ZQMA 3IIPA 3I7RA 3B4UA 1P5BA 3P80A 2Q3RA 2A1YA 4DQWA 3W7QA 1FQ0A 3LTSA 1G4EA 2E6YA 4MZ1A 3EX2A 2J6XA 5IM51 2PURA 4GRSA 2QAFA 2Z6IA 2Y6ZA 3LCGA 2A6NA 1R46A 3GDLA 3PG8A 2ISVA 4JTTA 1X8FA 4JTKA 4JIPA 1WV2A 1W5OA 4XWUA 4AMAA 3IVSA 3VE9A 2ALDA 3GDTA 3HPXA 3PBWA 3QSRA 3DZ1A 2RFGA 3UWZA 2G95A 1JCXA 4FX7A 1HG3A 4FXSA 3STEA 3NL3A 3VCRA 5FF2A 3G1HA 4Q33A 2GJNA 1GYLA 1AK5A 3CIXA 1SZGA 3H55A 3LLFA 4FB7A 3EEGA 2C16A 3EKLA 3TSBA 3LHYA 3TAKA 3QMRA 4DELA 5C55A 1NF0A 2NXIA 3N14A 3EWUA 3TROA 1A50A 1P1XA 2CW6A 4UTMA 3FS2A 3HOJA 3PM6A 1DVJA 3JS3A 3LXCA 4LT9A 3W1RA 1TCDA 1WQ5A 3TNOA 4GFSA 2G97A 2RHGA 2C18A 4GUIA 2EGZA 5BW6A 1G4SA 4WOZA 1IXPA 4UMAA 2XN1A 1BWLA 2EF9A 1AW2A 3I7QA 4M7SA 3OBKA 4IMEA 4UFJA 4JN6A 1FCUA 1IIHA 1FDZA 4NZJA 4OT7A 4QISA 4C1KA 2HMCA 5LNVA 4HNNA 3L65A 1JUKA 4ALDA 4UFHA 3LCHA 1VLIA 3BK0A 4HKPA 2Q8ZA 5H2ZA 4RXFA 3PC0A 3EWYA 2ZZ1A 3C52A 2WNQA 4AHPA 2V0TA 4M6VA 4K7VA 4PA8A 3RK8A 2NX9A 1VYRA 3W1MA 2VENA 5D04C 4LOCA 3SW6A 1OG0A 4O50A 3W9ZA 1LBLA 2JK2A 3V1PA 1QFEA 2YSWA 3EWZA 1R2RA 1R47A 4WX2A 4WXZA 3O6DA 2BXVA 1FDYA 1BTMA 1D3GA 2V2DA 1SO3A 1D3HA 3L5LA 3LXAA 2CLFA 3EWBX 3S1UA 2ZFAA 2PRMA 3T78A 2E5DA 2FQIA 3MHUA 5EL1A 1L9WA 1OFBA 1LCOA 1RVGA 3NL6A 3NPVA 4HPJA 1FWWA 3GNDA 2XN2A 3EX3A 5D38A 1F76A 4ONVA 3UXAA 1YADA 3O16A 4XTIA 1A53A 2CLEA 2JBMA 3GLCA 2YDAA 3EWWA 4PEKA 1KBJA 4S1FA 4UFKA 1F6PA 5AHFA 3WJXA 4RKAA 2E6DA 1UBSA 1TIMA 4FX6M 1SSDA 1H62A 4GJ1A 4LC6A 1JULA 5E93A 1FUYA 1BKSA 1H61A 3QRHA 3UWWA 3W86A 3EX6A 5BMXA 3STFA 3HB9A 1TTIA 4NJIA 1AG1O 2V9DA 3USBA 4WQ6A 1YTEA 5DN1A 1E51A 1S3HA 4JTSA 1PS9A 3B8DA 3O6CA 2OCZA 2DZTA 3OA3A 5K9XA 3NNTA 3R8RA 2UV8G 2A2IA 2PRHA 2I14A 1KM2A 1W5NA 1GVFA 1W8SA 3IVUA 3HG2A 1TPUA 3DXIA 4O10A 3QFEA 4O1CA 1DKWA 2WOQA 3A23A 4Z0JA 5AB3A 4ADUA 4MY8A 3BW3A 2DORA 5D32A 4A3UA 2NWRA 3W1QA 2NXGA 3WJSA 1OFEA 4JTLA 1GWJA 4FEZA 2YX0A 1I2OA 5DBUA 4QAIA 3ATZA 3L67A 2VC6A 3F1QA 3W70A 4O18A 5CZ0A 3CIWA 3GKAA 4TMBA 5CGQA 2VXNA 5HMSA 3S5OA 3A24A 3W76A 3DGRA 2BLEA 4M6PA 4JGDA 4MKNA 2E6FA 2ATMA 1WBJA 1P4CA 3F03K 3LHUA 1OHLA 2Z0IA 5BNKA 3QPZA 3QMTA 1W1ZA 1O95A 3O06A 2C14A 1JRCA 5E0KA 5LGZA 5HULA 3M47A 1X1ZA 1Y0EA 1QOPA 3MYOA 3UNDA 1I2QA 3NOEA 3BO9A 3QYQA 2YPIA 1NSJA 3ABOA 3P7YA 4HSNA 5TIMA 3VI2A 5K7JA 2A85A 4H3DA 1ZNNA 3ABSA 2BWGA 5LNUA 4MUZA 2H8ZA 3ZWTA 3EB2A 1N55A 4MYAA 1JUBA 1ALDA 1FWSA 3R89A 3M16A 3NQGA 4CLMA 3BLIA 4XKYA 4PH6A 2IQTA 2WPBA 3GX9A 1WYIA 3FFSA 4LNYA 2FIQA 3HGRA 1NVMA 1ZALA 3NDOA 4O0ZA 3TFCA 1SU5A 1FWRA 5AC6A 3MBDA 2GQAA 4AXKA 3UPWA 2ZBTA 3S1WA 1KA9F 1EEPA 1FXPA 3L66A 3LCLA 1GZGA 5L9FA 2P10A 1YXYA 2VFGA 4NJHA 2QF7A 1VJIA 3TMQA 4WXYA 3UWQA 4PTNA 4RZ5A 2GUUA 4MYXA 4RR4A 4GBUA 3TU9A 4LC8A 4IX2A 3P74A 3LV6A 2QJIA 3S6DA 4NX0A 4H4IA 1TV7A 2WSRA 1WA3A 3TUUA 1P0NA 3SY5A 1HFBA 1LTDA 2NZLA 2DJLA 3NQ8A 2VFFA 1MZHA 4DO5A 1NF7A 1JCYA 2DZVA 2YZRA 3BG5A 1CI1A
chains in the Genus database with same CATH superfamily
1U33A 1W17A 4BWLA 1F3WA 4J35A 1WDQA 2XIOA 2G3MA 4D71A 3TZNA 2E28A 3IGHX 2Y2WA 4W5UA 2PB1A 1VP5A 1XYBA 3H23A 2NVCA 4DI9A 4DWSD 5H1WA 1I1WA 3WELA 3QYSA 1E5JA 1IXNA 2GVGA 3OHMB 1A5LC 4EKJA 2VFEA 4FXJA 1A3XA 4K2SA 1ZBVA 5AKQA 2WWCA 3ARUA 4TIMA 4Y9MA 3MYPA 3QKEA 2WAGA 1XLEA 4NU7A 1Q2SA 2WJZA 2EJ1A 4B2DA 2Z28A 5KZDA 1Q6FA 1Z69A 2ACRA 3AWNA 4PRRA 5I3IA 5C7HA 1RXOB 5REQB 2PDUA 3LA4A 4B9YA 1MYRA 1NELA 3CQJA 5BCAA 4K3ZA 4GD0A 3VNJA 1L6FA 3GG0A 1I4NA 3TYEA 3O1NA 1GVYA 4ZL1A 2YFOA 1EP1A 4W8BA 3WJWA 2ISWA 1QUMA 3OZOA 4FF5A 1I2PA 2WMHA 2HS6A 3URBA 3FA3A 4M81A 5CJMA 1V08A 3AROA 4GXMA 3HU7A 1AFSA 4E5TA 4XD3A 1JJKA 3LEPA 4DBEA 3ITXA 1V02E 4GJIA 3UZXA 5HNTA 4KEVA 2CC0A 2WSYA 1E55A 1K8YA 1KO0A 1E6QM 1PZ2A 3CH0A 1TE1A 5K4ZA 1H7WA 1ONWA 3RO8A 2PC8A 4HHMA 3W72A 3FSTA 4ZOEA 3TQKA 1OIFA 5IDIA 1CT5A 4QSFA 5LA2A 4CNPA 3W84A 2B7QA 3MKKA 1Z48A 4ML4A 1X6LA 1XIJA 3MANA 5ECUA 3TR9A 3RCMA 4UFLA 2YCLB 3MVTA 4HMEA 3QW3A 3PTQA 4LAMA 5CCZA 5FEWA 3ARPA 2RDXA 3V3WA 2WBGA 1C8XA 1GJWA 3NDZA 4DUVA 3B8SA 3QC3A 1AQ0A 4QG8A 3WBXA 2NV2A 5TAOA 3QHMA 4DUXA 5K2ZA 2TSYA 3ZT5A 2PU1A 1TVPA 1WDWA 3W83A 1DEDA 3N2CA 1E1FA 2D2GA 1PO9A 1W5QA 4O57A 1B1YA 3LI0A 3TK7A 4ZR8A 4HNOA 3LTPA 3WNPA 3LX9A 4V1YA 4OBRA 3WN6A 3G0XA 2X2GA 3VOHA 1DHPA 1Q13A 3IV3A 5HPCA 4QRNA 3O0KA 5A6BA 2WHKA 2GK1B 2Z6JA 1M3UA 4H01A 3QFWA 3LOTA 3ITTA 1EUAA 5DXYA 2FVKA 3QEZA 2Y7DA 1F3EA 1HQTA 1W5MA 4AWEA 2D23A 1DBTA 3GHSA 2WKLA 4W88A 1KQZA 4E4FA 4IJBA 1A3WA 2GSJA 3CBWA 5AZ0A 5HR7A 4HB7A 1BLIA 2XFYA 5F4SA 2GVJA 1V4YA 3CV2A 4P2VA 4QROA 3L0NA 4PRTA 1TWDA 2XGZA 2G50A 1O5KA 2ZA2A 1QWKA 4IMGA 3U2CA 4QLLA 1EF3A 4RV8A 1FWJC 3M41A 1NY1A 4EACA 1E9LA 5FJPA 2PDQA 7REQA 1SW0A 1XPYA 3BICA 1WDPA 3EGJA 3G1XA 4BK9A 3MWCA 4PB3A 4P7QA 3AQUA 5U4NA 3WQFA 3S1XA 1XBYA 1UKOA 4Y6GA 2CWXA 4XD4A 1D9EA 4NRSA 2VD8A 4QNWA 1AJ0A 1HKVA 4AZBA 1S2WA 4PSPA 1IR1A 1L0PA 1CGXA 3BSHA 4QLJA 4EP8C 1EXPA 3UFYA 3SURA 3ZVHA 2Y70A 2HVNA 4F0SA 1GOMA 3L7RA 3G5EA 2V5CA 4FOKA 3FAXA 4MKVA 2OQYA 5TD4A 3OLDA 1EWEA 4LJ3A 4GY1A 4YL2A 1VRXA 5I2UA 4B92A 1KFCA 4KF1A 2CU0A 4U31A 1P7TB 4OECA 4QJ4B 4XQ6A 3EB3A 4GY7A 4GC3A 5J5DA 6ALDA 4IH3A 4TX8A 3L4TA 2NT0A 1LQ2A 3OJGA 2INEA 3IJ6A 5HNRA 1AL8A 4AEOA 5EU9A 4KQNA 3TYCA 4RDYA 3WQVA 4UBPC 3CWOX 3DUGA 3BQ5A 5HNNA 3E49A 1DWJM 4Y8EA 3WJYA 1ODUA 1MXDA 3WDPP 5HAOA 1W9BM 2JEQA 3A9IA 4UTTA 3UT0A 5G2IA 2OGJA 2XPKA 3PG9A 2QVNA 1CGYA 4F3HA 1J5TA 3GB6A 1X97A 2C6QA 5DCBA 2A6LA 4JQ4A 1FWIC 3P6LA 5I3GA 3NOYA 3UPBA 1T5AA 1IGSA 1NWUA 1E6RA 2ONEA 3IANA 1AQHA 4X3ZA 3BLDA 3R1ZA 3KP0A 1Q6OA 1CBGA 1SR9A 1FOBA 2ZUMA 1J9YA 3VKJA 4H8HA 3P61A 1FFRA 3WQGA 4K38A 4V1XA 4ACZA 4QAWA 1KRCC 1NDYA 4US5A 5I06A 2YB4A 1TUXA 4UC5A 1G5AA 2WJFA 1MEWA 1JI1A 2YLAA 4KRUA 3HF3A 3EWDA 3WEMA 5C2CA 1LZOA 3KZPA 2Y8UA 1Z7AA 2YDQA 4R3UA 4OE7A 4H41A 4JHZA 4K8EA 4GGBA 1FFQA 3CZEA 2WJEA 1NDWA 3QSTA 4QNEA 2XHYA 3EAUA 4Y90A 1XLMA 3TZFA 3AIVA 4LUYA 1LYXA 1H3GA 1X1NA 3REQA 5HATA 4IJCA 4E3TA 2GL5A 2V81A 1TX0A 5CSUA 3CAVA 5A6BD 1GG0A 1BYAA 2X16A 7ODCA 4HN8A 3MBFA 5LNWA 2QPSA 1OCNA 2BHYA 3ABQA 3NPWA 4IPIA 4Q3MA 3WKZA 1MW0A 3TTOA 1H5VA 4RV3A 5M5DA 2ZA3A 4QS6A 5M1TA 3WLJA 3W1XA 2MANA 3FVDA 4NAEA 1RK5A 3E0VA 4PCTA 5EMLA 1PWMA 4AHQA 1UBPC 3ZT6A 2OJPA 2F2KA 3T05A 1K9EA 1UR3M 2WNZA 4V15A 1TVNA 4RUBA 3UF9A 1EBHA 1XL9A 3GVGA 3V7PA 1V5XA 2YL9A 5DEZA 1EA0A 1HGYA 3CV1A 1C8YA 3NDYA 3CPRA 2NV9A 3AFBA 2V5BA 5LIYX 3M44A 4O11A 4ATDA 1XSKA 5JBFA 1UKSA 3KHDA 1XBXA 3H2OA 3RR4A 3H2MA 1BVWA 2J9ZA 2FPYA 5HJXA 2W92A 1S5MA 1GOIA 1N8FA 4OWGA 3W7DA 3SECA 1TG7A 2QDEA 4AY7A 4GNVA 3PUDA 2A7PA 1XP3A 3KM8A 4GHRA 3WLNA 2RJGA 4LUTB 4FR6A 1XHGA 1OFOA 2GWNA 3HV9A 3URAA 2O0TA 3K30A 4J1OA 3VNMA 3GNOA 4WJ8A 1OGSA 1JEZA 2PP3A 2ZZ5A 5AFDA 4JN8A 3DYOA 2B7NA 3TXZA 2XVKA 4LUIA 3PF3A 4BA0A 2QUTA 2Y7GA 3PTDA 3W7JA 2WCGA 3UNTA 3DI1A 1TR1A 1EEXA 3OP2A 1Q7ZA 1J93A 1FXQA 5TBOA 3PWAA 3IJIA 1ZLPA 1OEPA 2V67A 3V5FA 3S2MA 2DZBA 5F2LA 2Y89A 3DC8A 2PTWA 3SCPA 4IX0A 1EO7A 2F8QA 3OZMA 3PHAA 4KWUA 3EZ4A 1B3XA 1UHVA 1K77A 1XLBA 5DANA 3TNBA 1JPIA 1QOQA 4QITA 1GVOA 3QBUA 4E2DA 3LRMA 3OZYA 4AF0B 4R33A 4O1BA 1RJRA 4OV4A 1M65A 1Q6RA 3BCDA 4GKLA 1VBGA 3U5YA 4GZJA 2TYSA 4HHHA 1BXCA 1POJA 1JQXA 1A5CA 5D05A 1QBAA 4C6MA 4M6UA 4Y9AA 1SZNA 4GNKB 5CBIA 3S2CA 5IRPA 5T8GA 2O56A 3EXRA 4FNUA 2GVLA 1ICQA 4KPLA 1OFRA 4PL1A 4US5D 1GVRA 2OEJA 4NT0A 3G24A 4MADA 4HNLA 3C0SA 3GTNA 2E4TA 2NQJA 3F4NA 4H6KA 3SCRA 1WUFA 1GOWA 2PGFA 3KWXA 4AH7A 4FR1A 2V5DA 3DG3A 1GOKA 3LPOA 3W3OA 4MWAE 2C1HA 4XUYA 1ISZA 1K8ZA 2J7FA 3M7WA 3TTSA 2X7WA 3UEQA 2I9EA 4UNKA 4QG9A 5G5IA 1XD0A 4MM1A 3EWCA 1EQCA 4Y2WA 5HWMA 4B3KA 3ARSA 4NYUA 2WMJA 2NUXA 4TR9A 2D2HA 2E09A 1K7XA 4PMYA 1FWDC 4IG2A 1NFPA 1HKWA 3L2IA 2ZUSA 3DI0A 1VFFA 5LNRA 1RLCL 3QPEA 1DL3A 2ZTJA 3IIZA 2CEQA 5GQBA 5F4XA 4EE9A 4PYSA 3KRBA 3M07A 3FOKA 3EPMA 3OGSA 1UKPA 2BV9A 4NX5A 4L6DA 4ACYA 1Q6GA 1W0MA 1VCVA 5G4WA 1WX0A 3NEVA 3ICJA 1ME8A 5CZTA 1XRVA 3L5AA 4RNFA 1J5SA 4AZ6A 3SQSA 3WLIA 1OYCA 1JYNA 4EWJA 4MFEA 3NSMA 2IUZA 4FZIA 1MFUA 2EKCA 1EJTC 2NUWA 4BR1A 2FHFA 2X05A 3CTTA 4L9ZA 1EC8A 5DXXA 4J4KA 3IJLA 4AX6A 3GWQA 1OADA 2OZ8A 4A05A 3Q58A 5CPQA 3NZ1A 1YDNA 3ZR5A 1UZDA 2CERA 3AXXA 3TYUA 3EB4A 4BQ3A 1LLOA 2IKIA 1TSIA 3W53A 4RPPA 1JRBA 3SFKA 4NZFA 2HTMA 3GDKA 4TVDA 1R2TA 5E0CA 1EDTA 3DFTA 5A1AA 3G77A 4D1JA 2P0OA 3OVRA 1DP0A 3AIBA 4ATWA 4DNHA 5BOFA 2A7NA 5BWFA 4JCMA 1OT2A 2VCBA 1L8NA 4B15A 1I2NA 1IWAA 2IMRA 2E5CA 5ABGA 3ME3A 1QWGA 2ZXQA 1E1CA 2WZTA 1BF6A 3DU0A 2H8XA 4HHLA 5HINA 2GDQA 8CGTA 4ZQCA 2CBVA 4LUSB 4UTWC 4FOUA 4JHMA 2YXGA 3FJ4A 2POZA 2C1IA 2PCEA 4R88A 4HK6A 3W1PA 3ZM8A 3KBNA 3GU1A 3RHGA 3CGTA 2DIKA 3HA1A 1ZJHA 2FHBA 5B80A 2HJPA 1OFAA 2ZZ2A 4E6MA 4F4RA 1WXJA 4FNPA 1RD5A 4H9XA 5K3VA 4L4MA 2WPGA 3VINA 4YHEA 1YTKA 3AYRA 3QC0A 2PP0A 1ZAJA 3ZMRA 4DVOA 1PTAA 4IFOA 2XWEA 1CGTA 4C6JA 3MCMA 1RLDA 3BSMA 2ON3A 4XAPA 3M5YA 2O9PA 4GA8A 4RCXA 3O0FA 3MDWA 2DUZA 3E38A 1T41A 4HA4A 3CC1A 2X1SA 4XV0A 4LVGA 1QI3A 1OFQA 5LGXA 2IW0A 1XLCA 1KCLA 2WZIA 1JYVA 4XG1A 2WWDA 4MSSA 1UQZA 1TJPA 3W7RA 2I17A 4HYWA 4IMAA 5DCEA 1UD5A 2CZDA 4BKNA 2PDMA 4DBWA 2Y24A 1UB3A 4UXDA 3AYVA 3KRUA 1TMHA 3C0QA 2REQA 3R11A 1WXYA 3MUIA 1IEIA 1HVXA 3P82A 3QQWA 5HBFA 4NAFA 1I0DA 2D69A 4MPKA 3H54A 1SFLA 4ASTA 4WDTA 5HR6A 3DFQA 4WDXA 1PSCA 1YNYA 2Y7EA 3LK6A 4NI8A 2Z1SA 3BGAA 2VRJA 1GQKA 3S83A 3AMDA 4RJEA 3KTCA 4JYDA 1R3WA 4RNIA 2ACUA 2YBVA 4ZQOA 3W2MA 1O5QA 2VDGA 5LIUX 4LUJA 4MJMA 2CBIA 2DUAA 4WD0A 2ABBA 2Z00A 1DXEA 3GNNA 3GTIA 4Q8PA 1JPMA 4NZ5A 4HCDA 3IUIA 3A12A 4MY9A 1YNQA 1A0CA 4W8LA 1H50A 3E0IA 5D02A 4NZ4A 2C15A 2V5LA 4M19A 1H0IA 1ZFJA 1VQTA 1M7XA 1D8WA 3E02A 4O19A 2PU0A 1JVNA 1X7FA 2X2YA 2R1PA 3TN6A 4M24A 3B05A 5E9AA 4MWAC 1D8CA 1YBQB 5CBJA 2ACSA 2AGTA 3V5OA 3NVTA 4GH1A 5A6MA 4KIEA 4MGGA 1F61A 1ITQA 4LTSA 4FAMA 5I0DA 2E68A 5HA7A 4WCJA 4K7YA 3GBDA 5TQLA 1QK2A 1O5XA 4FNTA 1AH0A 2OR2A 1PX3A 4Z08A 3Q94A 1LG2A 2CCRA 3VIFA 4J3VA 4ADSA 2QQ6A 5G2HA 3AMLA 3SSZA 2FDSA 5CZKA 2X40A 4C6FA 1BWKA 3B8TA 3B0VC 5CPLA 3G2GA 3BGGA 4B5NA 1SZFA 4EF8A 4IT1A 4AMCA 4RE4A 1RR2A 4LS2A 1B3ZA 4XBKA 3O8AA 3PSWA 3UJEA 2ZKMX 3CUGA 3LPGA 2BOFX 3CV6A 1TQJA 4M5PA 2Z7GA 3ARZA 3VNKA 4IFKA 3WLRA 1W3IA 4DYJA 4UTHA 3D3FA 5I3HA 2EKGA 3T6CA 3W85A 1IF2A 4KGLA 2Z29A 4HBKA 2VURA 2EPHA 5C0QA 4U33A 1JFXA 1XDMA 1GNXA 1R3QA 3OU8A 2AOSA 1MRAA 3PB2A 3UY7A 3UGVA 3DDMA 4J3SA 1LLZA 2NSXA 2QHAA 1TPDA 2GSHA 3VKBA 5I3FA 1V3KA 1REQA 4DZHA 3IJ9A 2IXVA 1GG1A 1KXTA 3LNPA 4CU7A 4GWEA 1UD4A 3VE7A 2WSPA 3SIMA 2BVYA 3PP7A 3RIKA 3KFTA 3WIJA 4QEEA 2XSXA 4HOWA 3C6CA 5L6UA 2EAWA 9CGTA 3F2CA 3UWUA 2NT1A 5CPOA 3QF0A 4Z17A 1NDZA 4YVPA 4P8VA 1GPFA 1YDVA 2QDHA 2J13A 3QGVA 1V8EA 1XC4A 3LERA 3W7EA 1TWZA 4P5UA 4AC1X 5REQA 1GHRA 5DCDA 3C5QA 1IXQA 3LZ3A 5FEPA 1YDOA 2J79A 2CBJA 4S3FA 4YWIA 5CSRA 3VOFA 1L6WA 3GUWA 2J8FA 3AZTA 4A3QA 1PPIA 3VO0A 4B3LA 3OOQA 4NJKA 4NIRA 3URNA 1I8JA 2XISA 3HG4A 3LM3A 1VB9A 1TWIA 3PFRA 1X1OA 2VEGA 1GJUA 2CETA 1J0YA 3FLUA 3EOOA 3RFAA 2WVTA 3WF0A 4UFIA 3CK5A 5ECVA 1BKHA 4IGNA 2FB2A 4P8XA 1S2AA 1XGZA 4DB7A 5A8QA 2AL2B 1I75A 1RHCA 5E5CA 4IM4A 4RE2A 1W37A 1GEQA 1F9CA 1P0DA 2FMNA 1JG9A 1GVEA 3AXIA 2VGGA 4UOQA 3GFYA 2ATSA 3PSVA 3BG9A 4GQRA 3TKFA 4XAYA 1ML1A 4G5DA 1UOZA 1AW1A 4U4MA 3WUGA 4JTFA 2V3FA 4OQVA 5LIXX 4QDWA 2H6RA 4HOZA 4X22A 5A6JA 3LSBA 2ZX7A 4GX9A 4A3HA 3S1VA 4HOXA 4YLWA 3OIHA 1I0BA 2PRLA 3BDKA 3MUCA 5JXQA 3DC0A 2BX7A 3GW0A 2E8ZA 4GOAA 1VKFA 3C8NA 1WBHA 4Z1DA 3TA6A 1CENA 3P5ZA 4C91A 1ZBWA 3M0LA 1EDGA 3QMSA 3G1VA 3U6WA 4NNCA 1WP6A 3CZKA 2JFEX 4PCNA 1RQBA 2ZX6A 1BRLA 4HN4A 1HX0A 1LWHA 2E7FA 3APGA 5FL0A 4H1ZA 4DI8A 3OVPA 5BRBA 3C2RA 2PI6A 2XIIA 3BOXA 1UP2A 2PMQA 2H9AB 2OOGA 2WC7A 1GW9A 2FDMA 2VQTA 2OWXA 4ZB5A 2HNHA 3IGUA 5CH9A 5D09A 1MWOA 1PZ1A 3K5XA 4A6GA 3SN4A 2OXNA 2YB1A 3VGFA 2QNEA 4HPHA 5T9CE 5A8GA 1W31A 3AHXA 1ONRA 3M0YA 1LUCB 4DQWA 2CLPA 1RCXB 4DJDC 4DO7A 2Z6IA 2Y6ZA 1DIEA 2A6NA 3CO8A 3DESA 4IP5A 3ZO9A 1EYEA 2FTYA 2DT1A 1S38A 3T4WA 1ZPTA 3DZ1A 2RFGA 1JCXA 4US6A 3TWAA 3VAVA 2ZX8A 3P0XA 3STEA 3VPLA 4C6PA 3KTSA 5FF2A 1AK5A 3LLFA 3EEGA 5BXTA 3LHYA 1BWVA 4R85A 3AIUA 3T07A 1FHLA 3NZQA 4J2PA 3TROA 1A50A 1Z32X 3FS2A 3GC4A 3PM6A 1DVJA 3WH8A 1Q4NX 2C7FA 3LXCA 4LT9A 2JF7A 3OB8A 1TCDA 2C71A 2RHGA 1US3A 2C18A 5D8WA 5BW6A 3DN5A 4WOZA 1IXPA 3HMCA 3NCOA 3I7QA 4IMEA 1JPHA 1FWEC 4ZOAA 1FHVA 1QI2A 3WFLA 3UETA 1IZJA 1CDGA 5A6TC 1JUKA 2P5NA 2PD5A 3LCHA 1KXVA 2Q8ZA 5H2ZA 5FJTA 3PC0A 2ZZ1A 3C52A 4G9PA 1QI5A 4PA8A 4WVXA 2VENA 3BAXA 5D04C 2QGHA 3RJYA 5HQMA 4GISA 3AYSA 4IHCA 2AMXA 4IIFA 3O6DA 4YYCA 3EDEA 1QHPA 2VX4A 3A47A 3NZPA 1SO3A 2HZGA 4DYKA 2ZADA 1D3HA 3S1UA 3AYTA 4F0MA 3PZVA 4AEEA 4X63A 4PRWA 2I7GA 2DVTA 3NPVA 4HPJA 5DQPA 3EX3A 4MNJA 1WPCA 1VFUA 1F76A 4Q8VA 1R9ZA 2BASA 1YADA 3O16A 3NUKA 2UY4A 2YDAA 3BAJA 4PEKA 2PTXA 1JZ2A 1KBJA 3GNXA 1TIMA 4FX6M 9XIMA 2QMJA 4EXQA 3AU2A 1H62A 4GJ1A 3E2SA 1ADDA 3MMUA 1JULA 3QRHA 3W86A 3EX6A 2CNCA 3L2LA 4C60A 1MI3A 2V9DA 3CL8A 3WF3A 2OCZA 4DJFC 5K9XA 2A2IA 2I14A 1W5NA 1GVFA 2E67A 2XVPA 3IVUA 1DE5A 3HG2A 2VT0A 3ZOAA 4MKSA 2I5IA 4YTQA 5HK4A 1R8LA 1PKYA 4O1CA 1SM9A 1I60A 3NQBA 1DWGM 3HQPA 3BW3A 2IPGA 3VZZA 3EBVA 1CXFA 3QY6A 3TP4A 4O1EA 1U1JA 1I2OA 5DBUA 2MNRA 1JCTA 2ZXAA 3QLDA 4QAIA 4V28A 1MUMA 2E8YA 1EJUC 4LXFA 2ZE3A 3W70A 4O18A 5CZ0A 3UZZA 3GD6A 1PB0A 2RGLA 1PTDA 3VX1A 4Z2KA 3FXYA 3N15A 4W7VA 2ATMA 3F03K 1M04A 1OHLA 5D4YA 1XF0A 3QPZA 1J2BA 4AD3A 1QRQA 3AISA 5HULA 3MB9A 1X1ZA 3AC0A 1Y0EA 4ICMA 1QOPA 5I09A 1NWRA 4FMVA 3MYOA 5LA1A 4AD1A 4ZOBA 3WLHA 1S1PA 1GQIA 2QLYA 4GVIA 1ITXA 3GQYA 3P7YA 1XSJA 2FZ8A 3VI2A 1XG3A 1AQFA 2HE5A 1ZNNA 1J0IA 2V38A 1UKQA 3NO3A 1KRAC 2H8ZA 3GG8A 3EB2A 5XINA 2P3ZA 4P8UA 1NWSA 3AHTA 4FXFA 4UQ9A 3V0UA 1YNPA 1WYIA 2WB5A 3UW6A 3HGRA 3MQTA 3SUVA 3DG6A 4MDPA 4AXKA 3UPWA 3S1WA 3U9IA 3CPGA 1FXPA 4XSLA 3L66A 2VR2A 2ZUWA 1RJPA 2VFGA 4NJHA 3BCFA 4B5TA 3KLLA 4MYXA 5FSDC 4LYKA 3ONCA 1DXFA 3OGRA 4LC8A 4J3ZA 4IX2A 4ROQA 3TU9A 2QJIA 4DHGA 3TUUA 1U5HA 1IZKA 1P0NA 3K1GA 2R82A 1WB0A 2VDHA 1Q8AA 1UD8A 1MZHA 2BGSA 4LFYA 4IF2A 1A80A 1LL7A 4BQ4A 1R9YA 2ZRWA 3ISIX 2Z4GA 3TX9A 4H8NA 5T9BG 2V3DA 4JIEA 3VNLA 2QCDB 1GTHA 3LZ5A 3U7BA 1E71M 3RUBL 1ECEA 1QPRA 2VC5A 1TWSA 3HMJG 3OODA 3SSJA 1VGAA 2VJXA 2E6AA 3KVLA 1LF1A 2QIIA 3B9NA 3T2PA 1XIDA 3URQA 3WFZA 3WO8A 3BMWA 1KTNA 3E5BA 3NZRA 3UWVA 3CQ0A 2AGKA 4I6VA 2CXGA 4L4PA 1SO5A 4IP4A 4ZSTA 2PF0A 4ZENA 3VILA 1LJYA 3ALFA 4L1WA 2AQWA 1OC7A 4LF1A 5AYYA 3A4XA 2GJPA 1UMLA 3BGJA 4MWAB 3UP8A 4UOZA 1KWGA 2QJJA 5KZMA 4EANA 4MNKA 4DJEC 5I78A 2R8WA 3KE0A 4AZCB 1M7JA 2X8RA 3OZPA 3LRLA 4I5RA 1CXHA 1HTIA 4GC4A 3COTA 1W3NA 4I5UA 1W1B1 2Q01A 5M17A 2VCCA 2R14A 1BYCA 4GK8A 2FGZA 2W67A 3LY0A 4QE5A 4AW7A 2WM1A 4IGMA 3O6YX 1DOSA 2CWNA 3MW7A 4GJJA 2OOFA 4Z0SA 1KM1A 3UCDA 2ZUTA 4OBSA 4V2XA 1W9XA 2DY3A 2HISA 1X39A 3HPSA 3T0CA 1WKDA 1NJJA 1VC4A 4S3GA 3W7MA 2PWHA 1JGIA 2I5GA 5D2XA 5EMKA 4JX6A 1VPQA 5BXRA 3C3UA 4JICA 2IQDA 5KMYA 3WUEA 4H8UA 4L4LA 3T7VA 1K6AA 3BXWA 3FW6A 3EWXA 3UVIA 2XSAA 3H7UA 2VL4A 4DWSC 2BVWA 3IJDA 1AODA 1EB3A 4DNMA 1U22A 1DHKA 1E6XM 3DERA 1DJWA 5E70A 1IIGA 5AY7A 4LB3A 5JH2A 3KVMA 4M56A 4KKXA 1UH2A 1B2YA 2A3BA 3ZT7A 4YTTA 3XIMA 3KVJA 4XAZA 5HWJA 4R27A 2VMFA 4DIAA 1KFEA 1OGBA 4R53A 1KM0A 2PLMA 3SN1A 3HG5A 3MI6A 8XIMA 2J9XA 3WF1A 2PDHA 2Q3OA 3VGBA 1EFZA 4MY1A 5LXEA 1JPKA 2FH6A 1XLGA 1ITCA 1P48A 5EMMA 1EJ7L 3V5CA 4PUEA 1XCXA 2PCQA 2YCJA 1VFLA 1E6ZA 4KRTA 5FESA 3EX4A 3EOLA 2EPOA 4AD4A 2BBFA 3CV7A 3EEZA 4XSMA 5JQ9A 3TJIA 4IQLA 4HNTA 1LBFA 3BV4A 3AUJA 1E9YB 1FA2A 1ZBKA 3RX3A 1KGXA 2RUSA 4LNCA 4JX5A 4LVFA 4F9JA 4H2HA 4KEZA 4PUUA 5D9OA 2DZWA 1ZY9A 3PBGA 1TYGA 4O1DA 3WDIA 4KWSA 4QR6A 3ARQA 1UASA 3KLKA 5FF0A 4PMQA 4EPBC 1RPXA 1R87A 5CLWA 1OIMA 2DW7A 3BZJA 5KINA 3WNNA 4M8UA 1MO0A 1LM1A 4PGLA 2CKRA 4E3VA 5KZEA 2Q02A 3STCA 2CLMA 2PS2A 1W32A 2Y4SA 1UZ1A 3S2JA 2DSUA 4XO7A 1J2WA 3N3MA 1C9WA 2X1RA 2NW0A 5FD0A 4KESA 1RZMA 1CXLA 4NY2A 3CZGA 2LLEA 2E9LA 4N02A 1UC5A 2VC7A 1FH7A 2ZRVA 3CZ8A 3WQ6A 2P50A 4DM2A 1HT6A 1XXXA 2JKAA 1J79A 2HS8A 4PUMA 2VTFA 2HK1A 3AJ7A 3H6OA 1ONXA 4BS0A 3T9PA 3RLVA 3CTLA 4DAFA 2WCAA 3EDDA 4KT2A 3CIVA 1R6WA 3M0XA 1C92A 4LB4A 1W6TA 2D3LA 1QDSA 4HA0A 3VIHA 2D0HA 2J7CA 2HVMA 4ENLA 1TPH1 2R94A 4NXKA 2D2OA 1VPXA 3ALGA 4TO8A 3UGRA 4HGXA 3UVAA 2PTZA 3KRSA 4H6QA 3VTRA 4Z1CA 1IT7A 2ZCGA 1B0IA 3QPYA 2V2HA 5T91A 4C6EA 3LMYA 4AFYA 4UTKA 1QI0A 2D73A 3KOYA 2HBVA 1TELA 3QZEA 1PE1A 5BOOA 3TSDA 4AEFA 3IVTA 4PMNA 2HEJA 4DF1A 3LDVA 4CD6A 1W9UA 4DF0A 2J62A 3PBMA 2E9MA 4QFUA 3U4AA 4DWDA 1UUOA 1YKWA 5B7YA 2VC9A 1Z6KA 5HJYA 1H7RA 1QNPA 4L65A 1OM0A 1FWGC 2Y0FA 5A2CA 1HN1A 2OZTA 4ZVJA 1XWYA 3IIXA 1B4EA 1CB7B 4B5SA 3CHCA 2P1FA 3GW3A 4PTXA 4M29A 2O4QA 1W1YA 1AD1A 3AZSA 4BWLC 4PODA 2PLCA 4LY4A 3GHTA 2DV0A 3A5VA 3H12A 2F6KA 3VDBA 4LVBA 2OWWA 1JZ5A 3CQKA 1H0GA 2V3EA 3P60A 4UNLA 4J7RA 4RLIA 3CXOA 1TMQA 1KBKA 2CIPA 1ZGDA 4GINA 4GUGA 1YBQA 5FIPA 2P53A 4DPPA 5MHBA 5CPNA 4EXBA 2BVDA 3BC9A 3PZTA 1VZWA 1BAGA 3GXTA 3BUVA 4Y9PA 4PZVA 4PUDA 4DBUA 2KX9A 2ZRZA 1TJRA 3OPSA 5DF0A 4LY8A 1ZUAX 4XZWA 1H1ZA 1TX2A 5J04A 1Q45A 1HO4A 4UQDA 5CKSA 1E1EA 4FNQA 2BSLA 3U3HA 4JKLA 1O5RA 2ZRXA 3PS7A 1R3YA 1BGAA 3LMZA 2WVVB 4S2CA 2I16A 1A5OC 3P81A 4KRZA 1XIHA 3QV9A 3HBLA 4JDBA 1WZAA 2QEZA 1F05A 3GTFA 2FZBA 2W61A 4FNRA 1WE5A 4DO6A 5I77A 3VYLA 2NWSA 1MDRA 3J7HA 4PMDA 4N42A 1CXIA 3B8WA 3WNOA 2R1NA 5HXMA 4CD4A 4H9UA 4I5XA 5E9XA 1V7AA 4LCQA 1F3XA 4LVAA 2A0NA 3TOYA 1DWAM 4R9OA 5AHNA 1QMLA 1CXKA 1VFHA 1M53A 1F5ZA 3U7VA 1WKFA 1KRMA 1QHZA 1BVNP 2QUUA 4NF7A 4L6HA 4B5VA 2PDKA 1KV8A 3W7GA 3UR8A 4CCZA 2FVMA 2PF8A 1E72M 1V7YA 2QCGA 5BOEA 3BPWA 2G3NA 1TRDA 1LBMA 4K8HA 3N34A 1V02A 3PR2A 1YXCA 3RU8X 5JBEA 4KCTA 4DLFA 1QPOA 2DZPA 4GPNA 4GGHA 4G1KA 3U2ZA 3DGBA 1DPMA 1UWIA 1WDRA 3TR2A 1RUSA 4X60A 5DT7A 1FWHC 2BHUA 2VX7A 3WH5A 2OU4A 3RPMA 3TW9A 4KWWA 5AHEA 1P6WA 3BG3A 4AWSA 5MKGB 4YU1A 4A8IA 1F6KA 1V6UA 2EHHA 1Y5XA 1DV7A 3VUPA 3LN3A 3VNYA 4HPNA 3TC6A 4CCDA 5F2MA 2XJ7A 4DPQA 1GONA 4DRSA 3PN8A 3GR4A 4UR8A 5DMNA 3RN6A 1E5NA 4MB4A 3ZZ1A 5KEZA 2R1MA 1WDSA 2H3BA 1DTUA 1MDLA 1K9FA 1C93A 2JIEA 1FVPA 1V0LA 2VEMA 3KTXA 3RCNA 3NPXA 4S38A 3M5XA 1G7VA 3NQEA 2OYKA 2Y8KA 2FTPA 3VIJA 4QS5A 5IBXA 3M5ZA 1MUCA 3ITGA 2DT0A 1V93A 3W7LA 4GUFA 3B0YA 1Q66A 4K1WA 4IIEA 3BLLA 1J0HA 4LBRA 1E3XA 4H9YA 4X9SA 3WBWA 5D2TA 3WLOA 3P8IA 2BY0A 2XWDA 4UIOA 4RL3A 4AISA 1JCLA 3MI2A 3L4VA 1RK6A 3S9IA 2QPUA 5XIMA 3NM3A 2Z1WA 5CC6A 1Q5MA 2HE8A 5CZJA 3G22A 2A5HA 1OJXA 1ISYA 1IWPA 4PN2A 3OIXA 4E0CA 3TW6A 4RZ6A 4A4AA 4IQJA 4V33A 5DO8A 5FACA 3RGTA 3QLLA 3KDNA 1B9BA 1DJNA 1H1NA 2YBTA 1FHDA 3I68A 3IS4A 3EYPA 1TREA 5EY5A 4S3JA 6TAAA 1HJXA 5E6YA 2V63A 2XGIA 5CXPA 1XPGA 2DGAA 3WQPA 1TPC1 4QQUA 4FLQA 2WKGA 1J11A 1ADOA 2DUXA 4U2ZA 3G1RA 3WQ4A 3WDHA 3GHUA 3S0CA 1ZSXA 1P6BA 2QCEA 4LU0A 1VFMA 1SJDA 2NV1A 5IFTA 1J6PA 1QNQA 3LCWA 2ZRUA 3ITVA 2GVYA 2PDYA 2OYLA 3QJAA 3DHDA 2EXOA 4CCEA 3WD2A 3FEMA 4IL2A 2UZ9A 4UTTC 3TH6A 3OLIA 4W87A 1Q6QA 3VNDA 4QHRA 4B3ZA 1PIFA 1FH9A 3M0KA 4H9TA 3RRAA 1QOXA 3VD5A 1ADSA 4G7EA 1Q2RA 1G9HA 4JTAA 4Z2JA 3L2MA 2XZ7A 1UW9A 4Q8OA 5HMFA 3VKAA 1KTBA 4KCUA 3TSMA 4MDOA 5AHMA 4YWSA 4UTIA 1XV8A 1YE6A 3WJZA 3W1NA 1MUWA 2Y61A 1OX4A 3GIYA 1Y5WA 3JVAA 1Y5VA 4MAZA 2WSQA 1UR4A 3DFPA 3GU2A 1TA3B 2ABAA 5M3WA 3QY8A 3OVQA 4HHPA 5I3JA 2OEKA 1NFGA 1CGWA 1CZ1A 4ZBCA 1XX1A 2FHCA 4PSRA 3KXQA 2G8ZA 2C13A 3N04A 3RYSA 3TWBA 4WK9A 2ZDSA 4S3AA 5A8MA 1E43A 5A94A 3N29A 3HFYA 3HQNA 6TIMA 1QNVA 2PZ0A 2VQUA 2Q8XA 2FGLA 2VI0A 2W4XA 2YXOA 3H2CA 3O7UA 2E9BA 4HA1A 3L9CA 1I45A 2EO7A 3PAOA 2XYLA 3FJ6A 2O9RA 2PDLA 3GIPA 3G8RA 4LH8A 3NL2A 5JMUA 4EX4A 3UYIA 3RDKA 4QG6A 4QTGA 2QUNA 1WKEA 1A49A 1HP5A 3RXZA 2YCKX 4CNOA 1VEOA 2GJXA 2GPTA 2VEPA 4JX4A 4HNUA 4MVAA 1BHGA 4ZXLA 5I07A 5EMUA 4HU0A 4E2VA 3CT2A 3HFTA 3QXBA 4LALA 1K70A 1MSSA 1EJVC 1W2VA 4PBEA 1E0UA 3PJXA 1BSIA 4W7UA 2NX1A 3EMQA 3LHTA 3CT7A 4PMUA 1UWQA 1J6OA 3SADA 3M5VA 3GDBA 2VEKA 2IKHA 1ZB5A 1R3SA 2P88A 4H83A 3CHDA 4O14A 3DKLA 2QAPA 2VOMA 2R1KA 2FPVA 3KX6A 5HDRA 4JIRA 2GUBA 3GVRA 1XICA 1DJZA 4MUPA 5I23A 4WY0A 2VZOA 3W01A 3ZS4A 1NDVA 3W23A 3L0GA 4UMBA 4WGHA 2W91A 2BNJA 3WH9A 1E15A 2OZ0A 2XGBA 1T7LA 2ZXDA 2WBKA 1W9VA 4QXIA 4H9ZA 2UY5A 2YOCA 3W7NA 1IQ8A 3CL7A 1NWTA 3D46A 1S5TA 1XQLA 3GXPA 5LA0A 1NEYA 4C5ZA 3QM3A 1POKA 1XUZA 2YL5A 2PDNA 1OYAA 1R7OA 4NVTA 2VGBA 1Q85A 1TMLA 3G3MA 4FHAA 1HJWA 3GZAA 3QR0A 1A5AA 4NHVA 1IT0A 3DIPA 3PPHA 3DHFA 3KZSA 4W93A 2VP8A 1S2VA 1XRTA 3GAKA 4S3CA 1EGMA 2GQ3A 2X0HA 5EFDA 4CKQA 4BF5A 3AIRA 1IHIA 3OG3A 4NXSA 3I3DA 3H24A 4HMNA 3TEVA 1XLKA 1L6YA 4S3EA 2BG5A 4B5WA 3EA1A 2HDJA 4YJ5A 2IS7A 4A2RA 3TQ0A 4A3RA 4BF7A 2YL6A 3W88A 4MAVA 1YDYA 3W7PA 2WSKA 2FFIA 3G1FA 1ICSA 3G1SA 2Q8LA 5D2YA 3UJFA 1JXJA 2O9TA 1SFSA 3ORWA 3UG8A 5LHFA 1PAMA 4CQAA 4C5YA 3PZNA 4F48A 1EJWC 2A4AA 3PZQA 4TXEA 3EOSA 4JR5A 1XC6A 3TJ4A 4CQ9A 3RPTA 4TTGA 3WLPA 4F0HA 1XLHA 2XFWA 2CXEA 3SQLA 2PODA 1MRQA 3E0LA 3WBAA 2WHLA 3ATYA 1DIOA 4JNZA 3GIQA 1VRDA 1NAL1 4RW5A 1R2SA 4XIMA 5D03A 5CPMA 3NQCA 1Z42A 4TU1A 1QATA 4REQB 4JYEA 5LHEA 1H7PA 2OT1A 1XIEA 2EQDA 1GGOA 1QPQA 3GUGA 3M4HA 5IHRA 3A4AA 3N11A 5FAGA 4HD5A 4ZOCA 1BYDA 2V30A 2QCDA 4FOJA 4Q8TA 5HANA 2JKPA 3V18A 1EOKA 3SFWA 3PUOA 3HGOA 2OEMA 4FLSA 4HMCA 3GK0A 2PDXA 1M9HA 3CUIA 4O4VA 3CAQA 3AIWA 3FN9A 1Y65A 4WIWA 4F2TA 3LV5A 2VDIA 2PGWA 1W1IE 2CESA 4QIUA 3XINA 1CYGA 1UR1A 3ARYA 3GXDA 1XUUA 3NXFA 1ENUA 3QY7A 1GK8A 2DIJA 2YA1A 1FRBA 1IEQA 1ZJIA 4WOQA 1RY0A 2PC4A 1M7PA 4QDMA 1HF6A 4K6AA 4CEUC 1TPFA 3BW2A 4IMDA 2VR4A 4CN1A 2QV5A 2C91A 4AZCA 1K7FA 3FA5A 2ODOA 3KP1A 5J5RA 4C6CA 4CN4A 1FX6A 3OQ8A 3HG3A 3T2QA 2AKMA 4XB3A 5D37A 1KV5A 3R10A 2XH0A 4EOUA 1JDDA 6ENLA 1AZ2A 1TJ2A 3C2FA 1GYNA 2FJKA 3HJEA 3EOEA 4ZTYA 3M0JA 4BI6A 4LVDA 5CSYA 2VVSA 3AS2A 3C56A 3K8LA 2J4GA 5GJMA 2PWEA 3RILA 4GUHA 3L68A 3AWOA 2VHLA 3LBOA 2OSYA 3EA3A 2OT0A 3NFUA 4YNGA 3M0MA 1YXDA 4K39A 4IXXA 4J3UA 1TCMA 1TV4A 5C8BB 1AL7A 1EUNA 5I79A 4M51A 1KFWA 2VVNA 4FPSA 2QR6A 3IUHA 4RPQA 4PUJA 2R9RA 4ZFCA 3RX2A 4J40A 3NGFA 1B3VA 4WKHA 4UUIA 1BEUA 3KHJA 3L5MA 4FF7A 2J8GA 3ZR4A 1FH8A 1G67A 3BAIA 3KRZA 4GZ7A 4GO9A 3R79A 3SGGA 4MMWA 3W82A 3PZOA 2WV8A 1GVQA 3GXFA 2WKJA 5FI8A 5EBAA 1R3TA 1TV8A 3TDFA 1PVNA 3QOMA 3PPGA 2GQ9A 1KWKA 4UWMA 2BY3A 4O53A 2GQ8A 1H11A 3EMCA 3I4KA 3MJMA 1A5NC 1AMKA 4ZO7A 5ENLA 5CJNA 3CO4A 1W3KA 1QNRA 3ZLGA 1CLXA 1UA3A 1UJPA 3KVKA 3U2OA 3GR7A 3N13A 4LEQA 1K9TA 4NL1A 2DU2A 4X2RA 3I65A 4H9MA 1T96A 3R4IA 1XLFA 3S9ZA 1I9CB 3EKZA 1ZCOA 4D6IA 3AIEA 4E8CA 1VENA 3UZYA 1VJZA 2X0YA 3BANA 2DFAA 3KL3A 3H53A 2V5JA 3MI3A 3S2LA 1HUVA 3T0TA 3WBEA 3T0AA 4Q8UA 1X7IA 1TB3A 3PFMA 1B3OA 2IXUA 5C5YA 3UG5A 7TIMA 1M7OA 2ZX9A 2J6VA 2Q3RA 3R6IA 1JDFA 1G4EA 4MZ1A 5FJUA 2PURA 1HVQA 4WSJA 1R46A 3GDLA 3PWGA 2J7DA 3HV8A 3T0BA 4L7ZA 4OKDA 1OZQA 4JTKA 2Z1XA 2HPMA 4XWUA 5D8ZA 1NARA 5C2GA 3HPXA 3W28A 3LU2A 4FX7A 1HG3A 4V27A 4FXSA 1MVYA 3N6JA 3WD0A 4AD5A 4Q33A 3BAKA 2GJNA 1GYLA 4LEFA 3V36A 1V6XA 3VIOA 1EF2A 3MTWA 3PUGA 3GH5A 2A3LA 3A64A 1TZ9A 3QMRA 7REQB 4GX8A 4N7QA 3S47A 3VIPA 3N14A 4B16A 1UR2A 3EWUA 5FA5A 2CW6A 2X09A 3HOJA 5A6SA 2GLKA 4YN5A 3VABA 2F9RA 3EMZA 5JU6A 3W1RA 1WQ5A 3TNOA 4IPLA 3OQEA 4J3WA 2EGZA 4UMAA 1BWLA 1AW2A 1UUQA 3EOUA 3OBKA 4JN6A 2X1IA 1IIHA 1PZ3A 4QISA 2O92A 1WZMA 2J7HA 3ZJ7A 4C1KA 3ZVHB 5CG0A 4J27A 4IIGA 1DE6A 4HNNA 3ITLA 5C9XA 4ALDA 4ZEPA 4UFHA 2FGBA 5DT5A 1F4AA 3EWYA 4WEVX 4K7VA 1DWHM 4B5XA 1AD4A 4RZBA 3SCQA 1RH9A 2PFHA 2BHZA 2PDFA 5AZ1A 7A3HA 1ECQA 3V1PA 1PWLA 3EA2A 4I3GA 3VGHA 1FDYA 4JQAA 1BTMA 1LQAA 3GSMA 4J5NA 4AZGA 3L5LA 3BJSA 3AMCA 2PRMA 2E5DA 2FQIA 5EL1A 1U5VA 1LCOA 1RVGA 4PUWA 4QJ5B 1W3JA 4GYFA 2XN2A 4CGTA 4JTDA 3DECA 1AA1B 4ONVA 2INFA 3GTXA 3UXAA 2PTYA 2CLEA 1F6PA 3WJXA 2NQ9A 2QUMA 3GRIA 2E6DA 1UBSA 4OOUA 4CQDA 1HZYA 4GIAA 4R7WA 5E93A 1FUYA 4M82A 3UWWA 2VM8A 4AC7C 5BMXA 1UR9A 1Y8BA 4LX4A 3TYZA 2F38A 3SUSA 5IHSA 2I5QA 1S3HA 1R86A 1E4NA 1V6YA 4HQVA 2UV8G 2Z2BA 5M03A 1C3FA 2PRHA 3THUA 5BWAA 1V0NA 1W8SA 4JKKA 1TPUA 4ACZB 3ZLFA 3SEPA 1XLAA 2WOQA 3GNRA 3A23A 2KAUC 4OOZA 4Z0JA 3UZWA 4ADUA 1X8CA 1S2UA 2DORA 3PZIA 5D32A 2NXGA 2XVNA 1Q6EA 1W91A 3HQOA 3L67A 2VC6A 1BVZA 3R8GA 1RVKA 2XFRA 1XLJA 3P93A 4TMBA 6REQA 5HMSA 2OVLA 2BLEA 2VZVA 1VEMA 1CECA 3HM7A 2E6FA 4MKNA 1P4CA 4OVXA 3REQB 1O68A 5BNKA 3ARRA 2ZUUA 5LXXA 2OO6A 3O06A 1XYLA 1SZRA 2RGMA 3QR1A 1UC4A 3MMDA 4X0NA 2G37A 2FJUB 1TV3A 3BOFA 1UWUA 3UNDA 1I2QA 3BO9A 3TC3A 1XH1A 2UWFA 5TIMA 2J8TA 6PTDA 1OT1A 3ABSA 3CPUA 2G3FA 1B54A 4BQ2A 5I02A 2V3GA 3EPOA 3MSDA 4L6OA 2ZC1A 1JUBA 4XK2A 3BZGA 3NQGA 4IL0A 3PANA 3BLIA 4KGJA 3SRHA 3MCOA 1W1VA 4PH6A 2IQTA 2WPBA 2C0HA 1NVMA 1ZALA 3FV9A 3NDOA 1SU5A 2WXDM 2QF8A 1VD6A 4C90A 4B9ZA 2ZBTA 1VBUA 3DOPA 1KA9F 3QKZA 1MMFA 3LCLA 3FNDA 4HCHA 5L9FA 1H09A 1YXYA 2QF7A 2XH2A 1VJIA 1OY0A 2ASHA 3LPFA 2OX4A 2CKSA 2IKJA 2VX5A 4GBUA 2P8CA 3MU7A 5D9MA 4B5UA 4NX0A 2I56A 1TV7A 2VFFA 1NF7A 4FLRA 3U4FA 4Q4QA 3BG5A 1CI1A 4AZHA 1S39A 1PX8A 1OYBA 3W29A 2ZWYA 5EFFA 2OQHA 4R7OA 3TYBA 4C7FA 3G3DA 1JZ7A 1JCJA 4GYKA 4OZOA 3VOCA 1EIBA 2A3AA 1ZAIA 2HNEA 4GG9A 5MKGA 3GZ3A 2V8ZA 1FWTA 3VKKA 4ML9A 3MKVA 3HURA 5DLCA 4ZZ9A 6XIAA 2EPMX 1HKKA 4EAYA 4OHQA 1XLLA 3K4WA 3DYPA 1SW3A 1SPQA 3RG6A 3GNPA 3WK3A 1OF8A 2EBNA 1E6NA 4GQ0A 3UR2A 3PZMA 4HVXA 2YIHA 4WF7A 4HIBA 4NNBA 4R5EA 1EYWA 2L5HA 3ITYA 4QE1A 5LNSA 1G4TA 4AVNA 1SW7A 5XIAA 4UTFA 4CN6A 3VNIA 1MEIA 3N73A 1LROA 5FEXA 1CXEA 1QT1A 2Y5EA 1HJQA 3GH4A 3PJUA 4UZSA 5EKYA 1ZTVA 3MP4A 3WYZA 3MV01 4HYVA 2DSWA 1AVAA 2XSBA 4DJDD 1SUXA 1Q6CA 3VZYA 2D20A 1B3YA 3CWNA 4DBDA 3PBUA 4QE4A 3H2FA 1P0KA 2BVTA 4AZ5A 3N17A 2J7BA 2QCHA 1N7KA 1KR1A 1TRIA 2YA2A 3LCIA 4EIVA 3MV11 1E0WA 4GACA 4FIRA 3GYEA 5H8MA 1RP9A 3MDUA 4DAIA 1PCWA 3FYYA 3C2VA 1C90A 4MF4A 2CLHA 3E9AA 4OGZA 2PZNA 1CIUA 2PP1A 2Z27A 1JDAA 3FHAA 4IMCA 1PKNA 1J0KA 4GQQA 3WLLA 4EWND 3QQ1A 1OVDA 1A5UA 1FWNA 4I8DA 4YVVA 4MB1A 3NQ6A 3UYCA 1SMDA 3MP5A 4RZ4A 2EPLX 2RDTA 3SAZA 3M0HA 3CZLA 3EXTA 1L2UA 1XFBA 1ZHAA 4DY1A 2XG9A 3M46A 5K4XA 4CD7A 4RDVA 3FYOA 3GR8A 4I7UA 4L61A 4FLOA 3OYXA 4IMFA 5LIKX 3NAVA 3WDQA 3K46A 3APTA 3B06A 4LAZA 5HWNA 4GE8A 1OD8A 4IG2B 2X1TA 4XO6A 3FGCB 1EL3A 2ISSA 3F5LA 2WVSA 4BZYA 1JD9A 3LBMA 4UQCA 5ABFA 1AMYA 1N2VA 2PBGA 3M1ZA 3TN4A 4IIDA 1MZRA 3RO6A 2HRWA 3USZA 4KBXA 1VH7A 3C61A 4D6JA 1WZLA 2CLOA 4IOTA 3CS2A 5CPSA 4H6EA 3HQ1A 4UNIA 4XX6A 2D0FA 1DWIM 4EXAA 3IACA 3EDFA 1UJQA 4S23A 1H5YA 1UD3A 5CG7A 2GYIA 5A6KA 4PMRA 3BOLA 2JGYA 2B0MA 1DJYA 2XN0A 4A22A 2ZRYA 1G7UA 4OBTA 4EVZA 2H3DA 1UOKA 2XVGA 4PC8A 2QJGA 3I3EA 2OYMA 1XW8A 3UESA 3H4XA 2J7GA 4H2CA 4ZMGA 2J74A 2UY3A 4RXGA 3W7CA 1SQ7A 2W66A 2CLIA 3AUOA 5K9CA 3T40A 3WX7A 3W0KA 1Q6DA 5F2IA 3ZJ8A 3UR7A 5AVHA 5C70A 3FXGA 4W5ZA 2ICSA 4Z1AA 3STPA 4AWTA 1US2A 2OZ3A 3ZLHA 2VZSA 2VELA 3WK0A 1BSLA 1RQHA 5I5RA 1RPKA 3DKJA 3RMJA 4FO4A 2DZXA 3G1AA 3KDOA 3PVFA 3R2GA 4IICA 1SFJA 1OZMA 1UIPA 1E1CB 4JKMA 1KCKA 2G0WA 3KOFA 3OVGA 1VCGA 4D8LA 3O05A 3WENA 1UIOA 3UPMA 1QO5A 2VRQA 3S8HA 4AD2A 3T2OA 3VM5A 1RQEA 3KS6A 3KBSA 1QU4A 4JQ1A 5LKYA 2DPEA 4IQEA 3C0JA 3N3TA 1EJSC 3M0ZA 2ZDRA 4DZ5A 3BLFA 4UCGA 2E25A 1DQXA 3E6EA 1TWWA 2B7OA 1KRBC 3Q37A 4F2BA 1YX1A 4ZXOA 4UQBA 5CC7A 1O1ZA 5F1VA 4CNSA 1JR1A 3VD3A 3K1DA 3UR5A 1RBOB 3CYVA 1Z41A 4KFPA 3DFNA 3S42A 5D2VA 4HYRA 5HJLA 3GDMA 3M0VA 5FF7A 3PK7A 2VWTA 3RNDA 1NOWA 3CNYA 4TUFA 1QO2A 4TX6A 4OUIA 1KB3A 1KBLA 2CFFA 4C6BA 4JY8A 4NQ1A 1NQ6A 4TMCA 4OJYA 4BJHA 1Z44A 2CLKA 1HJVA 1EC9A 3VIKA 4DZAA 4W4QA 3ERPA 4ZO6A 3VDGA 4ROPA 2DEPA 3W2NA 4Q6XA 4Q8WA 3WEOA 4JNMA 4R34A 2JE8A 4PFMA 2JALA 1O94A 2REQB 3B04A 1LQ0A 4K8GA 4C1NA 1GOXA 5A6AA 4NAFB 3F4CA 1QAPA 1PDYA 2GFTA 5D30A 1PYFA 3HZ3A 4Y96A 3PUEA 2Y5JA 5FOOA 4M0XA 2GZXA 2XH7A 1MQRA 1QPKA 1O7AA 1UPMB 3W26A 2EG6A 4L1GA 2ZZ4A 3IK4A 4GXPA 3GYCA 1XQKA 3BARA 1UWAA 4LWWA 1ONEA 3NGJA 4FX8A 1T99A 3KOZA 4K36A 2CBUA 2W63A 4XAFA 3LCFA 1WAUA 4XTDA 1FBAA 4JS3A 2JIWA 3R8HA 8RUCA 1IEWA 3FKRA 4YCOA 4HPXA 2DZSA 3OG2A 1L8PA 1P0BA 4OUEA 3G1DA 2CITA 7ENLA 1ZS2A 3UU0A 1EHNA 2D24A 4U3CA 1B3WA 3DENA 3AHVA 2KZHA 2G5WA 1MW1A 1OB0A 1XIFA 1YRRA 4PTWA 3P8JA 3MY9A 1XKJA 2INZA 1X38A 1K3UA 3E96A 3P67A 3FJNA 4MZ8A 3KBWA 1TJ1A 3T0DA 3LBCA 3PPCA 3B0UX 2OWCA 3VM7A 1A47A 2PUZA 5CC5A 1CEOA 2YL8A 3T08A 3SCNA 1JGMA 4ORIA 3VDCA 5BROA 2BXYA 4KW2A 2Z25A 1PKLA 3A3XA 1XH2A 1XISA 1W2PA 5HMDA 5DMLA 1J8VA 1H7NA 4HZ7A 3WQOA 3RF9A 1HXJA 1C7SA 1KLZA 3SCUA 4O1FA 1VS1A 2VFIA 4IFKB 3ABRA 3N2TA 1ZAHA 3S6TA 3LTYA 1TTJA 2PGEA 5C9WA 1C91A 2VFDA 4QGCA 1XIBA 3KOWA 3MS8A 8A3HA 3QZ6A 4NYYA 3DH7A 4A35A 1TZZA 4MNLA 3DYMA 2ZVRA 4Z42C 1EP3A 4XD6A 1YYAA 1O4UA 2J88A 4AY8A 2B7PA 2C79A 3WD1A 2GGJA 3JZUA 3R25A 4F79A 3VFCA 4FNSA 5C71A 3RM4A 1REQB 2GGGA 4PMOA 3W6YA 2BGNE 4XBSA 2GOKA 3SJNA 1T8XA 3BLKA 2BOEX 1SR0A 3D3AA 4POCA 1UP3A 4MOZA 3W24A 1LT7A 1XFCA 3RJXA 5DFAA 4TV6A 4S2BA 1WO2A 4FALA 4DN1A 1AW5A 2DVXA 2F84A 3S4TA 3NQFA 1UR0A 3WLMA 4PB4A 2EPNA 4GQGA 3LLDA 4J3TA 3W87A 1A3HA 3II1A 1VPYA 2FB3A 3W22A 1OCBA 4DXVA 3MHFA 1QVBA 4ICCX 3TV8A 1PJ9A 1XRFA 5HPOA 2GJRA 4KFOA 2F6UA 1PV8A 1YW1A 5HMEA 4GKTA 3BAYA 2QJNA 3CJPA 3DEQA 3V4BA 4D6GA 7XIMA 2PE4A 3IGSA 4W85A 3L12A 5HOSA 3WY1A 5A95A 4JBRA 2H90A 3E1F1 1VBRA 1K03A 1UKTA 3C3NA 1CGUA 3W07A 2OB3A 4JIQA 1XCWA 4Z2LA 2J77A 4AY1A 4MNMA 1PDZA 1WOBA 1LLWA 5A8NA 1TKKA 1M6JA 5EMYA 3NQDA 5EYWA 2I1OA 4F2UA 1W3TA 5A2BA 1XDJA 1WAWA 3WL0A 1XLDA 2WCSA 2JF6A 3NQVA 9XIAA 2PWUA 4P61A 5G1MA 4QDPA 5FCZA 4LGXA 1S3TC 1EP2A 4KEUA 1XG4A 1W8GA 2G4JA 4GYJA 2YA0A 2YCLA 1XYCA 4LBUA 5AYIA 3RRXA 2YW3A 2QCLA 3MO7A 3LENA 1GHSA 3OYZA 3GFXA 3PZUA 4RDWA 3A6OA 2DT2A 3IJQA 5E6ZA 1OD0A 1P43A 3AXKA 1W1PA 3CAWA 3B8UA 1VYPX 4BEUA 1LOLA 1NOFA 1CLVA 4JOMA 4C6DA 2C3ZA 1BRLB 3ABZA 2G4FA 3A5FA 3QN3A 4O28A 3MHGA 4CU6A 3O3RA 2VGIA 1WCGA 5FSEC 3PY2A 5KZ6A 1PCKA 4DEFA 1AJ2A 2GGHA 2GK1A 4GI4A 5JIPA 3PZ9A 5A69A 1OFPA 4C6LA 3WH6A 3PPFA 4LAKA 3ZJ6A 1EZWA 4X2PA 4N4PA 5BRPA 2YR1A 3ZWSA 1DJXA 1U2YA 4NZ1A 2WLZA 3R13A 2ESCA 3SRKA 5DMYA 4YCPA 3AALA 5AYZA