1JQVA

The k213e mutant of lactococcus lactis dihydroorotate dehydrogenase a
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPEDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 114
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1jqvA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1jqvA01
1QPRA 4K7YA 3S1UA 4XBSA 2TSYA 3G1XA 5DBTA 4FB7A 2DZPA 3LHTA 4WY0F 3UQNA 4JTUA 4IPJA 3LHWA 1KFEA 4IMDA 4UTMA 1N7KA 4K8EA 2WO5A 3FKRA 5BW6A 4O16A 5G2HA 1N8FA 2E68A 4UTIA 3TAOA 1TTPA 4XQ6A 3IIOA 1FDYA 1RQHA 5BRBA 2FTPA 2Y7EA 1W5OA 2X30A 1Z42A 3GDMA 4TR9A 2F7FA 5EY5A 4Z1DA 5LGZA 5MHBA 2Z6IA 4HPJA 1F05A 3LCXA 1QMLA 3WK1A 1W5QA 4OV9A 4OE7A 2J9XA 1YXDA 1KFKA 1V7YA 3NQDA 4EOUA 1TPDA 3IRDA 4ZQCA 1FWSA 1QPOA 4MPQA 3GYEA 4UMAA 3LCLA 1SPQA 2JKEA 4X3ZA 1W1ZA 3CB8A 4MVAA 4CNOA 2QJHA 3QW4B 3IEBA 4Z08A 3T4CA 1S3HA 3R5EA 1TIMA 1YPIA 1OYAA 3I65A 4QNWA 2DZUA 3QJAA 5FF0A 4UC5A 1XDLA 4O1BA 5AHLA 3FFSA 3N9SA 2ALDA 5AC8A 3MHFA 3BK0A 3QYQA 3EX3A 4FX7A 1PV8A 1LYXA 5D2YA 1OFDA 1KTBA 3Q58A 1H50A 1FWWA 2ZRUA 4UFIA 1LTDA 4O52A 3NG3A 1LBFA 3G1HA 3RFAA 2VFGA 5DELA 1OFRA 3BLEA 5KMYA 4LOCA 4ORIA 3W7GA 1T8XA 4EF9A 3L5MA 2R8WA 4GBUA 1YDNA 1EP2A 4CNNA 2OZ0A 4Z1BA 4O28A 4PL2A 2CW6A 4NUWA 1K7FA 1WBHA 2BZNA 1W3IA 5DY3A 4M6PA 4CQAA 2CLMA 5AYXA 1H51A 3FS2A 4K7VA 1IF2A 2Q3OA 3P80A 3NNTA 3SW6A 2WSQA 3UZJA 4IPIA 3A21A 1TYGA 3LHZA 1A5CA 5LNVA 1G4SA 3H53A 1JQXA 1ICQA 3LCWA 3NQVA 1LDCA 4AWTA 2ZZ1A 2QAPA 5H91A 4NU7A 4YCPA 2NXHA 4M5PA 3MJYA 2WNNA 1JQVA 3PBWA 4XKYA 1NF0A 3MBDA 4TO8A 4I7UA 4POCA 1G67A 5D04C 1ZCOA 4ONVA 1IXQA 4JIPA 2OCZA 1WV2A 3LLDA 3W7QA 1R2TA 3QQ1A 3QW3A 1TTQA 1AW2A 1LBMA 3M44A 5KZDA 1RPXA 3TSBA 3S6DA 3TAKA 1XDMA 3FJLA 4JEQA 1GTHA 3GR8A 5DXYA 1BEUA 1DBTA 3L0KA 2NV1A 1FQ0A 3DFSA 3DU0A 4I7VA 1KFCA 2C18A 4FX8A 2GVJA 4GE8A 5CPNA 1D9EA 3R89A 3QRHA 4Q32A 4ML9A 3W74A 2HS6A 1FWTA 4XTDA 1P4CA 3P61A 3IGUA 4JDBA 1F76A 1MSSA 3R12A 5HMSA 2H3BA 4FO4A 2ZCGA 5LNWA 1EIXA 3JR2A 2FQIA 5C54A 3GXTA 4CLMA 3UWZA 4Q4KA 3N9RA 4CNPA 3S9YA 3ATYA 2ZA2A 4HPXA 1U83A 3W7HA 4GC4A 1SZNA 2QCFA 4WOQA 3S5OA 1GJPA 3VKJA 4ZMGA 1OYBA 1XBXA 3GXPA 5DN1A 4OT7A 3KRUA 3EKZA 4WXZA 1TJRA 5HWNA 2ZRXA 3ZR4A 1PHWA 4Z1AA 5LHEA 1XFBA 4WY0B 3EB2A 2ZZ5A 1UB3A 4LC6A 3LTYA 5EPDA 4R33A 3NYZA 4Y90A 3U2OA 3UWQA 2V8ZA 1ICPA 2C6QA 3PULA 4MOZA 2EAWA 2B4GA 1TPH1 1R2RA 1T96A 4ZQPA 1VC4A 3EX4A 4X2RA 5DY2A 3PM6A 2CFFA 4GNJA 1YTEA 5LHFA 2OJPA 1I4NA 2NX3A 3EWWA 1LROA 4QNEA 1L9WA 3F4NA 4IOTA 3STEA 4AHOA 2JKPA 1KV8A 5IM51 1PE1A 2ATMA 2WNZA 3T40A 2YCEA 4DPPA 1FWRA 3OVPA 3W9ZA 4UTTC 3TFXA 1HFBA 5SWUA 5H2ZA 3NPWA 2E6FA 1Q45A 3BG9A 4JTJA 2TYSA 4PFMA 1QO2A 2C13A 2Y62A 3LV5A 5DCBA 3SECA 4PA8A 1UJPA 4JDYA 3SIZA 5C5YA 3MYOA 1NEYA 2E5BA 4Y6GA 1W5NA 3C2EA 3NEVA 1AMKA 4N9BA 3TW6A 5D09A 1F5ZA 3M5ZA 4QITA 1LLZA 5F4SA 3PB0A 1XXXA 4LU0A 3CWOX 5CPMA 2R91A 1WOAA 2E6AA 2CLIA 4NZFA 5AFDA 5BMWA 4O53A 2PCQA 1GYLA 3ABQA 2JKAA 3QC3A 3QFEA 1K7EA 1OHLA 3CU2A 4UTUA 2V2CA 5FI8A 1OX6A 7TIMA 1WDWA 4FNTA 4LRTA 1V5XA 5TQLA 2A7NA 3WK3A 2C14A 4LVAA 5CZSA 3W7CA 4IWWA 3PSVA 4O14A 3BLIA 4WUIA 5FEXA 3W2LA 1F6KA 3A22A 3PWAA 2NX1A 2X16A 3RLVA 3SGUA 4FNPA 3GNDA 1TRIA 5CG7A 1MEWA 1TSIA 3UZ5A 5LNUA 4RXFA 5EMUA 3MO7A 3W1MA 1H60A 1LP6A 3LI1A 2QCCA 4E38A 3GKAA 3OEXA 1A50A 4N02A 4UNLA 5D03A 1RZMA 1UUOA 8TIMA 1I2QA 1H1ZA 1UBSA 3EWUA 4UTTA 1DOSA 3PBVA 5AHEA 3KOFA 4O0ZA 1DKWA 3MI6A 5KSWA 4JYDA 1XI3A 5K9CA 2QDHA 4JX5A 4JTTA 3DZ1A 4HNUA 4O4VA 1X8FA 2YFOA 3KXQA 2NZLA 2FLIA 3OBKA 3LCHA 3QMTA 1B57A 1XKYA 5FEPA 2VFFA 4LS0A 2A1YA 4O17A 1XBYA 4RR4A 2RFGA 3STGA 5KINA 5D38A 3MWAA 5AHFA 4DO4A 2Y88A 3NQ6A 3IVUA 4CCDA 4HHPA 3H54A 1NSJA 3CPRA 2YYTA 4O54A 3DENA 4QQ3A 4XKYB 3DFQA 1FY6A 3QSRA 1PL9A 4UTJA 1TQJA 3B0UX 3RF9A 5DCEA 1SSGA 1GZGA 4ZZ9A 4EIVA 1VHNA 4OWGA 3W70A 3N3MA 4E2DA 3W7RA 3MP3A 3EWXA 3I7QA 4UFKA 3TQKA 1ZY9A 4MYXA 3BGJA 3SGZA 3W1LA 2G95A 3M47A 2QKFA 4JXCA 3TJLA 1YDOA 1CW2A 4C1LA 2VELA 5HWMA 3S8HA 1HUVA 4JTFA 3G8RA 3NQGA 5F2GA 1B4KA 3B05A 5DLCA 4HKPA 5AC6A 4LVGA 2A0NA 3G0XA 4OQVA 2VEKA 4A3UA 4PC8A 1SFJA 2BXVA 5G4WA 1DVJA 4QM1A 4OV4A 5J5RA 3T55A 2GVLA 2UV8G 4MUZA 2YW4A 3GB6A 3KVKA 4NX5A 2FIQA 1EWEA 2BTMA 5U4NA 5D2VA 3R2GA 1FBAA 5E0KA 3M1ZA 1JCXA 4RKAA 2VEIA 2J9YA 4AMAA 3LTSA 4PODA 3TK7A 2G96A 3W76A 4EVZA 4B5NA 3B0VC 2ISVA 1LZOA 2PRMA 1C9DA 3DHFA 4LNYA 3QF0A 4TIMA 5G2IA 2YYUA 1W8SA 4M7TA 3P5YA 1H1YA 1M7PA 3I7SA 4MKNA 3W3OA 4MZ8A 1EP3A 3DFOA 2FPVA 3HPSA 2J9ZA 3I7RA 3AO0A 3TC6A 3GNNA 2JBMA 2I14A 4FX6M 2H90A 2VEMA 1N55A 1IIGA 1OX5A 4WY0A 1SU5A 1UCWA 5K9XA 3E12A 1X1ZA 4LW7A 3B04A 3S5NA 1C8VA 2AQWA 4GUGA 1QFEA 3W1PA 1SQ7A 3EEGA 3V1PA 2NLIA 2ZQ0A 4RK8A 1G6CA 3O1NA 2H3DA 4LVFA 1QNVA 3F03K 5D05A 2E77A 3SSJA 5AC7A 1Q3NA 3CQ0A 3FKKA 3QH2A 4N2YA 3S0CA 3TCEA 3THAA 2YSWA 3HB9A 3M5VA 3F4WA 2ZZ6A 4RZ5A 1FXQA 3W7IA 3UD6A 3TXZA 1KFLA 1SW3A 1T0OA 3Q37A 3OIXA 3KX6A 1OFQA 2Z1BA 4JTIA 3NQFA 4MIMA 5D30A 3PR2A 1J5TA 3A9IA 3GDTA 3S1WA 4WJEA 4J9JA 5HQEA 5C6MA 3VFLA 3UXDA 4NNCA 2ZZ7A 4TMCA 5CZ0A 2GQ9A 3VNDA 1W3TA 3FYPA 4YXGA 4NJIA 2E6DA 5KITA 3JRKA 4G1KA 2PC4A 1TPVA 5TBOA 3GXNA 5EYWA 3CC1A 4JGDA 2Y61A 4O0KA 4ZL1A 3V75A 3DXIA 1SZEA 3M6YA 3TDFA 4UIOA 1XUZA 2NWSA 1R2SA 1S5VA 3A5VA 1HL2A 4MFEA 3L67A 3E9AA 4LS1A 3TMQA 2VFIA 2W79A 4S1FA 2H6RA 3C0JA 3W6YA 1G4TA 3CM4A 2NXIA 5K4XA 1VGAA 1X7FA 5F2IA 2X1SA 5FF7A 4LV9A 1EP1A 2I9EA 4ADSA 2RDUA 1KM3A 3QQ0A 1H61A 5AYZA 2GJLA 3MW7A 1F7BA 4GUFA 4ZQNA 5K3VA 4IUOA 3NPXA 4OGZA 2WKJA 5HINA 5I3HA 1Y0EA 1EEPA 3A23A 4CCCA 5K9DA 3W1UA 1R47A 1Q6RA 4WXYA 1F74A 2QF7A 3HG2A 4RV8A 1P5BA 3IIXA 3O06A 2Y7FA 3W7PA 4HNNA 3U6WA 3W7JA 1XUUA 4KFOA 1K8XA 1HG3A 2QCDB 3GAKA 3WJXA 3NQAA 1JUEA 3ABSA 2B7PA 2CZFA 2XN0A 5AHMA 2YX0A 4BF9A 2JGYA 1M7OA 2JGQA 2J6XA 2YR1A 3NQMA 2Y6ZA 3EX1A 1W5MA 3W2KA 2OT0A 1QAPA 4E0CA 4MYAA 4NNBA 2VC6A 4UTWC 2QUVA 6TIMA 1BTMA 3NAVA 4RCXA 3W71A 2DZSA 3EWBX 5GVJA 4H4IA 4DQWA 2A2IA 1WA3A 5BMXA 1H5YA 3RU6A 3ELFA 3IV3A 3F1QA 3O07A 1YDVA 4MY8A 2D73A 3KAOA 3QZEA 1TPC1 4M7SA 3T7VA 2VEPA 1K8YA 3MUXA 4YCOA 4R7JA 2ZTJA 2C15A 4FXRA 2Y7DA 3G1SA 4A2SA 3LLFA 4Q33A 3A5FA 3L2IA 3GDLA 1TCDA 2ZBTA 3FA5A 3QSTA 3RLUA 1W5PA 5CSRA 4MZYA 1TPWA 1VLIA 3NQ8A 4DPQA 5HNRA 3PUEA 3W2NA 4A21A 5C55A 2V81A 4Z0SA 3E96A 3C2VA 1W54A 2QAFA 5FF4A 3BARA 2DZVA 2NV2A 1H7XA 4PH6A 3W72A 3RK8A 5C2XA 2A7PA 4K38A 3LHYA 2E5DA 3EX2A 4NJJA 1O4UA 4DF0A 3GIYA 4PTNA 1BWLA 3LTPA 2Y89A 3DI1A 1ZNNA 3K30A 1S5WA 4RXGA 3C2OA 3TX9A 2AAMA 1LOQA 2NX9A 4GFSA 3TXVA 5K2ZA 2WPBA 1LORA 5KZEA 1YTKA 4LVDA 4N9EA 4JX6A 4UTWA 3WJWA 4PEKA 2NUWA 2QCNA 3G1YA 1SFLA 3HIJA 1GOXA 3CTLA 1WQ5A 3LCGA 4XTIA 3GLCA 4WX2A 4Y8FA 4UR7A 1LRTA 2DP3A 1GG1A 2EGZA 3THQA 4N4PA 2J88A 3ZWTA 3GX9A 3G1VA 1KM0A 4O13A 3NR0A 4JTLA 3T78A 1OABA 4JN6A 1XBZA 3LXAA 4S2CA 1ZAHA 3PF3A 4ZQMA 1TPFA 2QUUA 1TPUA 3LXCA 3E49A 1L6WA 3ATZA 2QJIA 4O11A 5F4WA 4JX4A 4HN4A 1QDSA 3IIZA 4UFMA 4MLJA 4N9CA 3BLFA 1G4PA 3CT7A 4AHQA 5U7SA 4E2BA 3P74A 3SY5A 2CZDA 1I2PA 5LZLA 5LNRA 2OT1A 4JY9A 4M6QA 4I7WA 4H6KA 3HG4A 3EWZA 3G18A 4QAIA 1W31A 3TW7A 1KBIA 3NA8A 2VOMA 3DBPA 3W1TA 2YZRA 1G4EA 2CZEA 3TSDA 3EXSA 1SUXA 3S42A 3G3MA 2FFCA 5G4EA 1TRDA 3L5LA 3HPXA 3E02A 3W7NA 1VZWA 1DORA 2CLHA 3KRSA 1UUMA 1ZHAA 3M5XA 4ORMA 3DKLA 3MI2A 2P0OA 4AAJA 2YPIA 3FIGA 2CLEA 3UY8A 1P0KA 1TTJA 2Z6JA 3QM3A 3LRKA 3P7YA 5EL1A 3PG9A 4AF0B 2HS8A 1BWKA 1ZALA 3KRZA 4BK9A 4QJ1A 2ZRWA 3LRMA 3NZRA 3MP4A 3CHVA 2B7NA 3NL6A 3TR2A 3C2FA 3DI0A 4TU1A 4BR1A 2PRLA 2AGKA 4ZQRA 3ZWSA 2ABAA 3L0GA 5BOOA 1FX6A 1XCFA 3NM1A 3L9CA 3NL5A 1PVNA 1TV5A 3KVLA 4P61A 4LUIA 2E09A 4O4WA 1I8JA 3BPWA 3W7LA 5FEZA 5I3GA 1VR6A 3LXBA 3L0NA 1ZFJA 1W37A 1AL8A 2NUXA 2W0UA 1W0MA 3ABRA 1FDZA 4HSOA 2FPYA 2ZTKA 4AWUA 4N6FA 1VHCA 3KFTA 4KFPA 3LOTA 3S5ZA 2QCDA 1UASA 5I3JA 6ALDA 2Y7GA 3VI2A 1PIIA 4LWWA 2FDSA 2PRHA 4OU1A 3LHVA 1JCLA 1OJXA 1TV7A 4UMCA 1JULA 1L2UA 5CSSA 3P62A 4RX0A 2V2HA 4TX9A 4UTKA 3HG3A 1SW7A 3QPZA 3JS3A 2GQAA 3HGJA 5D2TA 3BVJA 3SJ3A 4UFHA 2W6RA 4WOZA 1R46A 3G0SA 1Q6LA 4UTHA 1WYIA 4ADTA 3TIMA 1KM5A 4LV4A 3O6CA 1ZENA 4WZHA 3LHUA 3IGSA 1YXYA 1D3GA 1HO4A 1R30A 1DQXA 3LB0A 3W75A 4O50A 5D32A 1EPXA 4EF8A 2BLEA 1K03A 1GVOA 5CPOA 4MY1A 1RQEA 4O12A 3TROA 2B7QA 2CU0A 3PAJA 2O7SA 3DKJA 1JUBA 4K39A 2ZFAA 4JTEA 1H7NA 5D33A 1A5SA 2YW3A 2RDWA 1U5JA 3IVSA 1LCOA 3TC7A 2OX1A 4BI5A 4RJEA 3H55A 2V2DA 1QPQA 1TPEA 3EWYA 2C3ZA 3LDVA 3IIVA 3OVQA 1JUKA 1ONRA 4XZ9A 4YWIA 2A85A 1Z44A 4H3DA 2QEZA 5EKYA 3BO9A 2V82A 4M19A 4CCEA 2GVGA 2G5WA 3W07A 3W7KA 2VFEA 1FXPA 2R14A 4JTKA 1EUNA 1L6SA 3IGXA 5LGXA 3W73A 5HWJA 4YL2A 5F2LA 2GQ8A 1MO0A 4OBTA 1RQBA 1WXJA 2WNQA 2VFHA 3NQEA 2GUUA 1RVGA 5KZMA 1J2WA 1VCFA 3UWVA 4O1AA 1VCVA 2ZZ3A 4IMGA 5E1QA 3B4UA 1QCWA 1FUYA 1NVMA 5EBUA 2ZA1A 4HNTA 4HIBA 3NXFA 5CGQA 3W86A 3LI0A 2QCGA 1IIHA 5AYYA 3KHJA 3HMJG 3S1XA 3KVMA 4YMZA 1JCJA 1KFJA 3N34A 1SO5A 3W7OA 3NZ1A 2ATSA 4FNRA 3LERA 2DZTA 1KV5A 1OX4B 2CLKA 2V0TA 3UPWA 1X1OA 1EB3A 3VE9A 2A4AA 4N9DA 3TUUA 3GR7A 2GJNA 3PS7A 1G7VA 5FF2A 2DU2A 3TKFA 1B3OA 1MXSA 2WJZA 1TQXA 3HPZA 1Q6QA 4RZ4A 1M5WA 1IXPA 1DHPA 1QOPA 3HGRA 4MJMA 4W9TA 1Z48A 4O8RA 1YADA 1H7RA 3FYOA 3IIPA 4CQ9A 1L6YA 5I3KA 1ICSA 4C1KA 3OG3A 1LOLA 3N2MA 4FIQA 1PHQA 1KM1A 3W1QA 2QDGA 1B9BA 5LSMA 3STCA 3HGSA 3C2RA 3W87A 1VPXA 3GDRA 4DBEA 1P1XA 1OK4A 3EX6A 1KM2A 5F2MA 1WAUA 2E5CA 2VXNA 1I45A 3LX9A 4HT3A 3W2UA 4NT0A 4UUIA 4A22A 4MFDA 3UWWA 4O1DA 3OVRA 3VCRA 2ISWA 1BKSA 2Q8ZA 2P10A 1ME9A 5DXXA 1FCQA 4AF0A 3NL2A 1T99A 5I3IA 3W1AA 2V5LA 3I6RA 3GAYA 3TFCA 4R34A 3UYCA 3OA3A 3L66A 3STFA 2I1OA 2WSYA 3G8EA 3QMRA 4YLWA 1QR7A 3W23A 1CI1A 2J27A 3BGGA 5AB3A 5AHIA 4K8HA 1ALDA 1THFD 3D0CA 3P82A 3G1FA 5LKYA 4L4MA 3O8AA 1VJIA 4JYFA 4LC8A 5AHNA 3SZ8A 3P84A 3NPUA 3P8JA 2XN1A 3TSMA 3SR7A 2PE4A 1K02A 3W7EA 1E51A 3I68A 2ZRZA 4N6EA 3O6DA 3HJZA 3A24A 4IMFA 2XFWA 1OG0A 1JRCA 1JR1A 4MZ1A 3YPIA 3NVTA 3S5YA 3MBFA 4IMCA 3BW2A 4I9AA 4IXHA 1NFBA 3WFAA 5J5DA 1YYAA 2ISSA 1OFPA 3L68A 3TV8A 2H8ZA 4O18A 3ZFHA 3W7MA 4JTSA 5HR7A 5DCDA 3MYPA 4Z0JA 2VENA 4ADUA 2E1DA 4DF2A 4AVFA 4X9SA 4JY8A 1RV8A 3S1VA 3O63A 4O10A 3P60A 3L21A 4AEOA 1YLVA 3CWNA 2EF9A 2ZZ2A 4AWSA 1SSDA 1VYRA 1MZHA 2LLEA 3MHGA 4N4QA 1OK6A 5A8GA 2FB2A 4LT9A 4RZ6A 3O15A 4FNQA 2CLFA 2VKZG 4NXKA 4XWUA 3Q2DA 3C4UA 1O5XA 1GVQA 3NPVA 1GVSA 4FNUA 1A5BA 1F73A 4GJ1A 3UXAA 2VFDA 4FIRA 1IXNA 3W83A 1O95A 2HTMA 4IX2A 4UCGA 1VH7A 1TO3A 2A21A 1GTEA 3GVGA 2CLOA 1TREA 3G22A 5HUOA 4NXSA 2WSRA 2BSLA 2V5BA 3NOEA 3KVJA 1NF7A 1ZJIA 3G0UA 3OHIA 3PUOA 1FCBA 1ME8A 2ZRVA 1W3NA 3C52A 2FB3A 3M0ZA 4IMEA 3LCFA 4LS2A 1VRDA 2B0MA 5FEWA 1IXOA 3PY2A 4RLIA 3C8FA 1W56A 5CPLA 1FCVA 1OFOA 4DBDA 3LGEA 3MMTA 2ZDRA 4GXMA 1P0NA 3G24A 3FOKA 4AH7A 5T26A 1IGSA 3BW3A 3N19B 3E0IA 4ICNA 2DZWA 1KTNA 3W85A 2NXGA 3HBLA 1RD5A 1K8ZA 4EWND 1O94A 3P67A 3B0PA 3W1RA 2X2GA 3C3NA 4QIUA 1WOBA 4S2BA 4CQ8A 3HOJA 1G69A 1PCKA 3QPYA 4KWVA 5K7JA 4KFNA 4O1CA 2ZZ4A 3M5YA 3LM7A 1KTCA 2H8XA 4Y9AA 2CZ5A 4QISA 4NNAA 3RMJA 4LTSA 3U8GA 3DFPA 4MLRA 4PCFA 5D2XA 4K36A 5AOUA 2C16A 2DJXA 3NQ7A 1GG0A 4AB4A 2WV8A 1JCMP 2Y70A 4K6AA 2TRSA 1SW0A 3HG5A 3W1NA 1OX4A 1EX5A 4UR8A 1ADOA 4DO5A 2A7RA 1VYSX 1MEIA 3DFNA 2C19A 1PS9A 4K37A 2Z0IA 3DFTA 4UMBA 3CLMA 3T44A 4IXXA 4JD4A 1QO5A 1OFAA 4O15A 3SFKA 1TJPA 3W7DA 4JTHA 3LV6A 2QJGA 3GK0A 3DAQA 1OYCA 4NJGA 1ML1A 4O19A 1KW1A 1LBLA 1QWGA 3MI3A 1YPFA 1DQWA 1OFEA 1XM3A 2A5HA 4A2RA 2Y63A 3PC0A 4NZJA 1MEHA 2KZHA 4UTLA 5FESA 5FF3A 1SR9A 2E6YA 5ABTA 3QEZA 4JICA 1LLWA 1VLWA 4BI6A 1TTIA 1F6PA 1AW5A 2RHGA 4AXKA 1C29A 3EXTA 3PB2A 1TV8A 4NVTA 3W84A 1NAL1 2B7OA 3CEUA 4OHQA 3UWYA 5EA9A 1GYNA 1LOSA 2HMCA 3N73A 1AL7A 4UNKA 2V30A 4JYEA 3DGRA 1A5AA 4QSHA 2V9DA 1RR2A 5AN7A 5F1UA 1XBVA 4MY9A 3WJZA 5G1YA 1KFBA 2FPTA 3M7WA 1XC4A 5CKSA 1I2RA 3PSWA 5BNKA 2Q8LA 4LY8A 1JVNA 4UXDA 2RH9A 3PBUA 2QCLA 4JNMA 3P5ZA 4DELA 2G97A 1XL9A 2QCEA 1X6UA 4FEZA 1HTIA 1H7PA 1I2OA 2WQPA 2Z2UA 2BX7A 3NL3A 1WBJA 3L5AA 2CLLA 1QOQA 3G3DA 4BWLC 1WX0A 3O16A 3W88A 1SZGA 3TH6A 3O6YX 4JR5A 1F2JA 3G1AA 5DBUA 2X1TA 1TPB1 4WD0A 3RNDA 2QUTA 1VS1A 5LNSA 2FJKA 1O5KA 2YDAA 1FCUA 4MJZA 4R53A 4GUIA 5G2WA 5A5WA 2IQTA 3G1DA 4L4LA 3NQCA 4DO6A 2X1UA 2EPHA 1OVDA 4UFJA 1DV7A 4GUJA 3CEPA 4FXSA 2BWGA 4WQ6A 4DEFA 2Y85A 3ANYA 3TE9A 4JIQA 3CIWA 5L9FA 4JTGA 3P81A 1JJKA 2X1RA 2C1HA 4TMBA 2ZRYA 3Q94A 1AW1A 3C56A 1K7XA 3N2XA 1B4EA 1K3UA 3UPBA 3UWUA 3WK2A 3TA6A 4HNVA 2J24A 4LVBA 5HUPA 3M16A 2OMAA 4Z1CA 2ABBA 1QPNA 1CX9A 1FDJA 1S5TA 3LBMA 5E93A 3TJXA 1OFBA 3R8RA 1TB3A 1HO1A 4LUJA 3UY7A 3BW4A 3HQ1A 2QR6A 2NUYA 4D2JA 3ABOA 5D02A 2XN2A 3NDOA 4NQ1A 3W2MA 1Q6OA 3MP5A 2WOQA 2EKCA 5L6UA 4O57A 2QCHA 1DJNA 5G1TA 1GPWA 3W1XA 4BWLA 3NQ2A 3FEMA 1J4EA 1H63A 2PURA 5TIMA 3TU9A 5F1VA 5K4ZA 2O7QA 3M43A 4BFAA 1OF6A 5IBXC 4U28A 1M6JA 4Y96A 4ZQOA 3P8IA 4NJHA 4M6VA 1JCYA 1VYPX 3BV4A 4NJKA 3ZS4A 1AG1O 4PL1A 1ZAJA 2F84A 1PCWA 2HSAA 1SO6A 2P1FA 3NGJA 2RKXA 3PVFA 4FNSA 1DL3A 4IQLA 3NM3A 3INPA 3W2JA 1KBJA 4IJBA 4U4MA 4GUHA 2TMDA 1I2NA 5G5IA 5CZTA 4AHPA 4GRSA 1KLYA 1OF8A 1YXCA 5D2WA 1FWNA 3LBCA 3TQVA 1O60A 1LM1A 1G7UA 5HJLA 3BG3A 4DF1A 3W22A 2A6LA 4A29A 2CWNA 3HF3A 5HULA 3AJXA 1LRQA 1D3HA 2GPTA 4ALDA 1TMHA 3CIXA 1EA0A 4XBKA 2DJLA 1VQTA 1H7WA 3PBYA 3B03A 1SO3A 3EXRA 4P2VA 1SZFA 2YXGA 2YGYA 1KA9F 2R94A 3IVTA 2C0AA 3UNDA 3DH7A 3TNOA 3WJSA 3LCIA 5I3FA 3MHUA 3WJYA 4NX0A 1A53A 1DJQA 1GVFA 3HGOA 4DXVA 3O05A 3BG5A 3C6CA 1H7OA 1KM4A 3TQ0A 1AK5A 3L65A 2A6NA 3EKLA 1VCGA 3M9YA 4UFLA 1EUAA 4FF7A 3QMSA 2GOUA 1ME7A 1EWDA 2ZYFA 3B06A 3TMLA 4X22A 3N14A 5IBXA 3DHDA 3VE7A 2ZA3A 3PG8A 3GDKA 4XUGA 2EHHA 5F4XA 3NO5A 4BI7A 4FHAA 3WK0A 1JRBA 3PUDA 1GVRA 5HR6A 4KWWA 3FJ6A 1GWJA 2DORA 3M41A 2JK2A 4JS3A 3SI9A 3LRLA 2DZXA 2NWRA 1YTDA 4KKXA 3HO8A 4IX0A 1GEQA 3USBA 2RDTA 1ZAIA 3GZ3A 4IGHA 5CZJA 4LRSA 1LRNA 5KTLA 5D37A 3B8DA 1H62A 2TPSA 1GT8A 1KM6A 1SO4A 4GWEA 1JCNA 3FLUA 2Q3RA 1KLZA 2QCMA 3GKFA 2YFNA 4HSNA 3C61A 1Z41A 3R13A 4ZVJA 1GQNA
chains in the Genus database with same CATH superfamily
1W1TA 2PDFA 4NP7A 5DBTA 2DZPA 3LHTA 3EPNA 4WY0F 4HHHA 4JTUA 4IPJA 1L6GA 3LHWA 4ACZB 1KFEA 2WWDA 3NO3A 3RRAA 4ICMA 5BW6A 4OOUA 2PLKA 3UZWA 5G2HA 2AQOA 2HDJA 2E68A 3TAOA 3WF1A 1TTPA 1RQHA 2Y7EA 2X30A 1Z42A 3HPAA 3TONA 4Z1DA 4DM1A 2GDVA 4HPJA 4FOUA 1KNWA 2KX9A 2D2GA 3LCXA 4P8XA 2TAAA 3THDA 1PKLA 1W5QA 5GQBA 4OE7A 3GNOA 4WDXA 1MQQA 2RUSA 2WC3A 1V7YA 3NQDA 3ES8A 3M0KA 1GZJA 3GYEA 1HF6A 4X3ZA 4JL2A 1W1ZA 3RPMA 3GW0A 3PNZA 3R79A 1CNVA 3H7VA 1NARA 4Z08A 1BWVA 3T4CA 4PRRA 1M9HA 4MNJA 3UJEA 4GOAA 1MVYA 1YPIA 1OYAA 2HRWA 3NZQA 5AHLA 3SCQA 3FFSA 5DMLA 3GHRA 3S2CA 3GW3A 4HTYA 3EX3A 2ODOA 1UR3M 5AZ0A 4B15A 4H7CA 2OFJA 4B5XA 4P8UA 4QS6A 1IEIA 5KMYA 3VZYA 4Q3MA 1A0EA 2PDIA 3KL3A 4H9YA 4G7FA 1TA3B 4NUWA 1RALA 3LM3A 3AYRA 4ZO6A 1WBHA 1ONWA 1GVEA 2Z1WA 3FS2A 4U5KA 3P80A 5D8WA 4IPIA 1TYGA 5LNVA 1JQXA 4QP0A 3NQVA 1LDCA 5ABHA 4AVNA 4YCPA 2NXHA 4FP1A 4M5PA 1OBAA 3MJYA 2WNNA 2FVMA 4KEZA 4ECLA 3OGRA 4I7UA 3ARWA 3WNPA 1G67A 5D04C 4ONVA 1IXQA 3LLDA 2W4XA 3P14A 1W3HA 3QQ1A 3OVGA 5A8OA 1WUFA 5CZKA 2INFA 1RPXA 4IGMA 1UUQA 1XDMA 2ZC1A 3V3WA 4JEQA 1WDSA 1GTHA 1K9FA 3GR8A 3CT2A 3WL0A 2NV1A 1FQ0A 3BLKA 3EGJA 3WELA 1KFCA 4FX8A 2ISDA 5HXMA 4KW2A 2Y2WA 1D9EA 1R3QA 2DSZA 2FJUB 1OEPA 1P4CA 3ZIZA 1TE1A 3WQOA 3U2CA 3NUKA 2H3BA 3ZVHB 4FO4A 3F2BA 1D8CA 2CBIA 3GXTA 1Q8JA 1YKWA 4AD0A 1YIXA 2VDIA 3MSGA 3GC2A 4W7UA 1XINA 1VIWA 1CXIA 1YPXA 1U83A 4JIHA 4S3FA 4EPKA 1SZNA 4HSHA 1UQYA 2Y8VA 4KWOA 4K2SA 3ORWA 4LUSA 1IE7C 4ZMGA 3T0CA 4MDPA 5DN1A 2PDJA 2IPGA 4DBUA 5JQ9A 5T9CE 4AZGA 2ZRXA 3VOIA 3BAIA 4L4PA 3BWWA 1KQYA 1XCWA 1XP3A 3MZ2A 3IPWA 1AFSA 1TPH1 1EYEA 1R2RA 1NFGA 4X2RA 2DFAA 1R9ZA 2WMIB 2OJPA 3MANA 4RNIA 3EDDA 3OW1A 2J7FA 4QNEA 4DI8A 1Q13A 2VCBA 3F4NA 5IHRA 4AHOA 4D6DA 1FH8A 1WDRA 2ATMA 2PTDA 2NT0A 4DPPA 1IEVA 4R85A 3TFXA 5SWUA 3QXBA 3NPWA 3QLDA 4WDWA 4JTJA 4PFMA 5C7HA 2Y62A 4ACZA 3KDOA 1N2VA 2G4FA 2X05A 1JF5A 4Y6GA 1S38A 3C2EA 2PU1A 1AMKA 3WLQA 1EJWC 3U2EA 3M5ZA 4MJ2A 1LLZA 4LU0A 4DI9A 5CC6A 1H2JA 2FZ8A 2PTXA 1IQ8A 4NZFA 2AKZA 3UG4A 1R3TA 4O53A 3AIBA 3QC3A 2PDMA 3QFEA 2OTDA 5JMUA 1VKFA 4IFRA 4FNTA 5TQLA 2IKIA 7REQA 2OKOA 2A7NA 1IT0A 1F4AA 4GYPA 1YQ2A 4E2OA 4O14A 5FEXA 4LEFA 4GZEA 1F6KA 3A22A 3BSHA 3ARPA 2NX1A 5I0DA 4AC1X 5CG7A 3QY8A 1DE6A 1TSIA 3WUEA 1CECA 1UJQA 4B3LA 4RXFA 2X0YA 2XFYA 3LI1A 3E2SA 1FFQA 1J96A 2POZA 4I90A 3IJ8A 2Z2BA 2ZIDA 1FWGC 1DOSA 3UEQA 4JKKA 2INEA 3KOFA 4O0ZA 2WYSA 1DKWA 4B3KA 1XLLA 3U7BA 3EMCA 4JTTA 4HNUA 5LA0A 1E72M 1X8FA 3GRIA 3W24A 3U4FA 1TA3A 1JF6A 3IK2A 1BHGA 1XKYA 4PTMA 4QTGA 3DG7A 5E6YA 4LS0A 3OG2A 4O17A 3KOYA 1XBYA 2YLAA 3STGA 5D38A 3M0JA 1F9CA 3MWAA 3UG5A 1JDAA 1PZ2A 2J7EA 1NSJA 2D69A 2YYTA 4QQ3A 4XKYB 4NHVA 2Y0FA 5CJ5A 1PL9A 1TQJA 1NJJA 1UMYA 1UWQA 1P0DA 1SFSA 2FHCA 4OWGA 3N3MA 4AYGA 4YTTA 3EWXA 1KWGA 3I7QA 3TQKA 2Z7KA 3ZM8A 1BSLA 1I60A 2G95A 1Q7QA 1IT7A 4IGNA 3TJLA 2VVSA 4ASTA 4C1LA 1R8LA 3S8HA 1R86A 1HUVA 1B4KA 3B05A 2G3IA 4HKPA 4LVGA 4OQVA 2JALA 2VEKA 3GE7A 4GKTA 3T55A 3B8TA 2PGFA 2D0GA 4Y9PA 3ZVHA 2J8GA 3WNKA 4NX5A 4OECA 2HV5A 2DDXA 3R2GA 4X9YA 1AQ0A 1XKJA 1SR0A 3MMUA 3DUGA 3HV9A 4RKAA 4MM1A 4D8AA 3I4KA 1VFFA 4LB3A 2NSXA 4EVZA 5FJOA 6PTDA 3DHFA 4DUWA 3N4FA 1SGJA 3DFOA 2FPVA 2HBXA 4MB3A 4PMNA 1W1A1 1SU5A 3TJIA 4WEVX 5K9XA 3E12A 2KAUC 1ZUAX 5C0QA 3S5NA 4GUGA 1QFEA 4Q4QA 3B97A 1C8YA 3TC3A 1QNVA 3F03K 4GYKA 4RNHA 4HJWA 1EBHA 1Q3NA 1PKNA 2WJEA 2WMIA 4OFCA 4TX8A 3ZJ6A 3C0LA 4U31A 2ZZ6A 1QHZA 1JXKA 1J01A 3KCOA 3W7IA 2WANA 4HQVA 1T0OA 3OIXA 3QPEA 4L56A 3PR2A 4ROQA 3ITLA 3A9IA 3GDTA 2CITA 1KCXA 4WJEA 3VFLA 4NNCA 2ZZ7A 4TMCA 2ZUWA 3VNDA 2YZ5A 4PYSA 5EMJA 4YXGA 2P0IA 3JRKA 1TPVA 2PMQA 3VKBA 2FZ9A 1DWFM 1W1YA 4D71A 5FSDC 3M6YA 3TDFA 1R9XA 1XUZA 4C6MA 2PWDA 2J79A 3A5VA 1QBBA 3L67A 4GQQA 1J0ZA 9XIAA 4KPLA 3TMQA 2CBJA 2W79A 3KWSA 3VNIA 1DXEA 1HKVA 4GZ7A 3UG8A 2HK0A 5GJMA 1X7FA 4FSAA 1WKFA 4LF2A 4QE1A 4LV9A 2PS2A 4YTUA 3CZEA 4ADSA 2RDUA 3EDJA 3WBXA 4YU1A 3G1RA 1H61A 1TMQA 4GUFA 1J18A 3DOPA 4QG8A 4C90A 1YDYA 5HINA 1EEPA 3A23A 1FOBA 1KC7A 3AU2A 1M01A 4XZHA 4XKMA 2EEXA 2GGJA 1P5BA 4HNNA 2Y5JA 1SJDA 2TODA 2NT1A 1JPKA 3WJXA 1DJZA 5IDZA 2CZFA 2XN0A 4Y9MA 1E5NA 2YX0A 4D6HA 2JGYA 1M7OA 4QX4A 2JGQA 1PIGA 2J6XA 2YR1A 2Y6ZA 4HTBA 4NAFB 3H2OA 1NDZA 4CNUA 4S3DA 3W6LA 3AHVA 3KLKA 4NNBA 1JYVA 6TIMA 1BTMA 1BVNP 4UZSA 5FJPA 3W01A 4ZXLA 1WA3A 4PUWA 1XRFA 3OGSA 1YNYA 4AX7A 3L12A 3F1QA 3W00A 3GNXA 3VA8A 4AWEA 3KAOA 2P50A 1JDDA 2VEPA 4LCSA 3MUXA 4O8AA 4YCOA 1XGDA 5CQ1A 4R7JA 3R10A 2OKTA 3NOYA 4IH3A 4Q33A 3L2IA 2ZBTA 3FA5A 3RLUA 1VBHA 5CSRA 4MG4A 2OWXA 1MMFA 4DO7A 1TPWA 5HNRA 3W2NA 4AZIA 3BLLA 2G4JA 2V81A 1MWOA 1RD6A 3E96A 1GPFA 3BQ6A 3ARUA 2VI0A 3W82A 1W54A 2QAFA 5FF4A 5BOFA 1K70A 2NV2A 4GJJA 1HKKA 1VBRA 2GSEA 4PH6A 3S1GA 1JFHA 4NI3A 3LHYA 4S3GA 4AIUA 2E5DA 4NJJA 1O4UA 3R6IA 3WH7A 3LTPA 4FPSA 3DI1A 1S5WA 4DUXA 2OLSA 4Z2IA 1BYCA 1PTAA 2XTKA 5HQMA 4LQ1A 1VBUA 1QI3A 4LVDA 4C7DA 3WJWA 2QCNA 3G1YA 3DBNA 3VNYA 1SFLA 1GNXA 3SY1A 3BAYA 4XTIA 2XVLA 3GLCA 4Y8FA 2GK1B 4UR7A 3KS5A 4EAMA 4YTSA 3CUJA 1UWAA 2J88A 1EJVC 3G1VA 1IZJA 3DC0A 2GSHA 1M41A 3FV9A 3VYLA 2PFHA 4YHEA 3E2RA 1TPFA 3C3UA 2POTA 3ITGA 2GSJA 1C7SA 4O11A 5F4WA 5HK4A 4MLJA 5H8PA 4IIDA 5DQPA 1KGUA 2GJRA 4WJ8A 2ZUSA 4M1RA 2IKGA 4MSSA 1NOWA 5LZLA 4PN2A 5LNRA 4JY9A 3HG4A 3HQPA 2YA2A 3UW6A 3G18A 3EB3A 3TYUA 4LYPA 1MYRA 3RO6A 2QHAA 3AWOA 1BQCA 4DLMA 3W1TA 2CZEA 1G0CA 5CBIA 3TR9A 2Z29A 3EXSA 2R1LA 3S42A 3A12A 1U1UA 4PEEA 1XYBA 3HPXA 2PDUA 1ZHAA 3WLJA 5CJMA 2P0OA 5HDRA 3FIGA 3VAVA 5LXXA 2CLEA 1PWLA 4V1YA 1P0KA 1ITXA 4PUKA 3PG9A 1ZRQA 4AF0B 1U2YA 1BWKA 3LY0A 2PODA 2YCKX 3LRMA 1PZ0A 1A4LA 4TV5A 4KEUA 3CHVA 3NL6A 4IZGA 3TR2A 3C2FA 4TU1A 4BR1A 2BDQA 4HMEA 2OWWA 4ZQRA 3ZWSA 3H24A 2ABAA 3L0GA 1FX6A 3FHAA 3QV6A 3L9CA 1PVNA 3ZZ1A 1XWYA 3IJIA 4S3EA 2XM1A 4PULA 2DW7A 3W7LA 1B2YA 5FEZA 3SQMA 3QR3A 5C8BB 4TVUA 1VR6A 2YOCA 3V7PA 1J11A 1D2KA 5CG0A 2WSPA 2ZXDA 1R6WA 1B9ZA 1MXGA 4CVUA 1HVXA 1KXHA 3KFTA 4PTXA 1S2CA 3LOTA 3S5ZA 3CLWA 1EPVA 4GX8A 2FDSA 2PRHA 3V0TA 4GKLA 5DO8A 1TV7A 1CLVA 1JULA 1E4NA 2EJ1A 2EG6A 3M0YA 4NAFA 4TX9A 3CH9A 2Z28A 4HCLA 3JS3A 2EO7A 4K68A 3BVJA 2VP8A 2XZ9A 2DUZA 3TP4A 3G0SA 3AYVA 3QGKC 4UTHA 1TWSA 1WYIA 4LAOA 4LV4A 3V0SA 3R94A 3LHUA 1YXYA 4F2BA 4GK8A 4M81A 1GZ1A 1HO4A 1R30A 1DQXA 4W85A 2VX5A 2VGGA 1K03A 4XAZA 4H6EA 2C8NA 4WF7A 3TLLA 2CU0A 3SRFA 4DX3A 1EQPA 2ZFAA 3SUUA 3WQ8A 3MUZ1 3FJ4A 2P5NA 2V2DA 1QPQA 1NQ6A 1KCZA 3CS2A 4QAWA 3EWYA 2JEQA 4J40A 1WDDA 3LDVA 4CN6A 3KBWA 1R9YA 2A85A 1Z44A 1TMLA 1QTWA 3BO9A 1JI1A 2DW6A 4M19A 3FK4A 3TLQA 2VFEA 3WG6A 2R14A 1JIBA 2VURA 1R3RA 4FI4A 2QGYA 2GQ8A 3G5EA 2QXWA 4GLEA 4L1XA 1VCVA 4YVVA 3B4UA 3L4VA 1FUYA 5EBUA 4CUCA 2ZA1A 2YL6A 4HIBA 1IIHA 4AD1A 3BURA 1C9WA 4AZCB 3S1XA 2WBGA 4A8IA 4KH2A 4YMZA 1RA0A 2GK1A 3GVVA 3TOPA 4MGGA 1F07A 2CETA 3W38A 1CYGA 2ATSA 3LERA 4OUEA 3NSMA 1M7JA 1W9XA 2V0TA 3UPWA 4M24A 2Z1SA 4GC3A 4P7OA 2A3AA 4NRRA 3VIHA 2OLHA 3GR7A 4G7EB 3OLEA 1G7VA 1UD3A 5FL0A 1KQZA 4HZ8A 5FF2A 2DU2A 1VPQA 1TWWA 1TQXA 3HPZA 4XVEA 4RZ4A 1W2PA 4IT1A 2J47A 4MJMA 5MF5A 3G6LA 4O8RA 3FYOA 4CQ9A 2G3NA 4C1KA 4I5UA 3AIVA 1LOLA 2BY1A 4TXEA 2WCAA 2GQ3A 5LSMA 3STCA 3N4EA 3PJXA 3W87A 3GDRA 2CBUA 1P1XA 4C65A 1JZ2A 4KRTA 1KM2A 3PPHA 2E5CA 2VXNA 1J0IA 4NT0A 3EZ4A 3UWWA 1QW7A 4O1DA 3OVRA 3WF4A 3ZJ8A 4GD0A 2DV0A 2Q8ZA 1ME9A 4AF0A 4F79A 3NL2A 1MW3A 2Q6ZA 5I3IA 3VD4A 3B8UA 4QLJA 3TFCA 4E5TA 2PLJA 3QLLA 4DB7A 4YLWA 4ZB2A 1CI1A 5AB3A 3UR8A 1ALDA 3UETA 3K8KA 3RMEA 1CXLA 4B5WA 1UKTA 1UA3A 3WLKX 1Z69A 4JYFA 3H4WA 1U33A 3SBFA 4K8GA 4IP4A 1XX1A 2DVXA 3G6MA 2I5IA 3SR7A 2QJJA 1E6NA 2PE4A 1K02A 2BMBA 3DGBA 3R4IA 4QSFA 4N6EA 1C92A 3T08A 3R58A 1SVDA 4AG0A 3MBFA 3VD7A 3WFAA 5J5DA 3CUFA 2W67A 1OFPA 2H8ZA 1EEXA 1Q5MA 3W7MA 3FEQA 3GNPA 5B7YA 4X61A 1WKEA 3NGFA 4MB1A 3O63A 4O10A 1BPLB 4LFYA 3FDGA 1QJWA 1YLVA 4S3BA 3WBEA 3CWNA 1I6NA 2EF9A 1ZJHA 4AWSA 2WM1A 2LLEA 3MHGA 4N4QA 3WEOA 1NWUA 1RY0A 2VC7A 2CHNA 2PGWA 2ZUUA 3TA9A 3LS9A 2CLFA 2AKMA 2VKZG 4NXKA 3C4UA 3UR7A 3VC5A 1P0BA 1A5BA 1F73A 2D20A 4LAZA 4MPKA 3THUA 4IX2A 4UCGA 3VNKA 1WO2A 2A21A 4DUOA 2CLOA 3AOFA 2WSRA 4H83A 2BSLA 3KVJA 2A3HA 4JKLA 4PE8A 1ZJIA 1J6PA 2NQHA 2FB3A 3M0ZA 4NIRA 2B0MA 2BHZA 5A2CA 1IXOA 4IP5A 2GJPA 1J9YA 1GEHA 2XSAA 5CPLA 3K8LA 1OFOA 3WMLA 3CMFA 4DBDA 3HU7A 4UCFA 4EXBA 3BW3A 3N19B 3E0IA 2DZWA 1FWAC 3TYAA 1RD5A 4EWND 1O94A 2CEQA 4PUUA 3C3NA 2FTWA 3JU2A 3AROA 3DN5A 3LUTA 1PDYA 4AX6A 1G69A 3QPYA 4CD7A 4KWVA 4AZ7A 2ZZ4A 3EA1A 3LM7A 1QI4A 4C6PA 4QISA 3F5LA 2PDXA 4Q22A 3U8GA 1GQLA 4OVXA 4AZCA 3AHXA 5AOUA 3KBNA 4A6GA 1KCLA 1OINA 5J04A 4I5XA 1JCMP 3KDNA 3WO8A 1QW9A 3E0FA 4DZIA 1DIDA 3QHOA 4DO5A 2A7RA 3PHAA 2XM2A 3SUWA 2C19A 1X7IA 1WZAA 3W27A 3AIWA 5BYWA 2GUBA 4G7EA 1Q63A 1XYFA 4JTHA 1ISWA 5CAHA 5ENLA 3VM7A 5I7GA 4G56A 1YPFA 2A5HA 5FESA 2YB1A 2KZHA 4UTLA 3BZJA 4FOKA 3EBVA 1F6PA 4XO7A 2VUYA 1JYXA 1B3YA 4YJ5A 4NVTA 3W84A 5GNXA 3T42A 4US6A 3UWYA 2HE5A 1CXHA 4BKNA 4UNKA 2ALRA 3ABXA 3RHGA 1NWSA 1RR2A 1UKPA 5F1UA 3WJZA 4FR6A 3TVAA 3AXKA 2FPTA 4HPGA 2BBFA 2VRQA 3M7WA 1I2RA 1FA2A 5HNTA 1AODA 3PBUA 2QCLA 4DELA 1XL9A 2IPWA 3IJ7A 2QCEA 1TUXA 2WQPA 2Z2UA 4CU6A 1WX0A 3KBJA 1K1DA 1BYBA 3O16A 2YDSA 3ARSA 3O6YX 1KCKA 4L9XA 4D6JA 3K5XA 1VS1A 5BXRA 1MNZA 2FJKA 4W4QA 1XLFA 1XLBA 3M0XA 1JZ4A 4MJZA 4R53A 5A5WA 2GJXB 1ZTVA 2ZXBA 3NQCA 4DO6A 2ZDSA 4JEJA 4Y8EA 4UFJA 1DV7A 1O12A 4GUJA 2Y24A 4DEFA 2XVPA 3M6DA 4JIQA 5CEWA 6A3HA 1JJKA 2ADAA 2X1RA 4HMDA 1K7XA 4FR1A 3WUFA 3OTRA 4A3RA 4QROA 4UWMA 3UWUA 1Y5VA 1OCJA 4FMVA 3AZSA 2OMAA 3M16A 4F2TA 1CX9A 3D3AA 5H6HA 3TJXA 4DXXA 5C2GA 5CPSA 1Q6FA 2VRJA 4LUJA 2Q71A 4EXAA 4MADA 3I3EA 1ONXA 3HQ1A 2QR6A 3N6JA 4D2JA 3WQFA 3CHFA 2EPKX 3ABOA 5D02A 3NDOA 2WHKA 4NQ1A 1NDWA 3W2MA 3MV01 1Q6OA 1AH4A 1HJQA 4DNMA 2EKCA 4RUBA 4KEMA 2WMGA 2NQ5A 2QCHA 3MY9A 2CIPA 4YWSA 1E6RA 3AMCA 3AJ7A 3FEMA 5K4ZA 1A49A 1W1B1 3LMYA 3FAXA 3CPUA 1YNQA 1UKSA 3LPGA 3BLPX 2HSAA 1SO6A 5LA2A 3AHZA 5RUBA 1V02A 3CBWA 4FNSA 3O3RA 3W2JA 4IJBA 3B9NA 2TMDA 3O2LA 5CZTA 3W25A 1S2VA 4KBXA 5LYRA 1EJTC 1QWKA 2GDUA 4IGSA 5A1AA 3TQVA 3S6OA 2FYMA 1O60A 3ZJ7A 5HJLA 3QC0A 4DF1A 3W22A 2CWNA 4XZNX 3DECA 1SJAA 1LRQA 1V3MA 3AMDA 4B4HA 3BCDA 4WSKA 1EA0A 3PANA 1XIDA 2V68A 4P2VA 5A6JA 1XIGA 3UNDA 3TNOA 1JGMA 3LCIA 1QUMA 4NX0A 2JF6A 3PZTA 4GVIA 1I9CB 3HGOA 4DXVA 3LGGA 1U30A 3BG5A 3C6CA 1KM4A 3TQ0A 1AK5A 3VKCA 2A6NA 3M9YA 4M6UA 3FX4A 3P6LA 1ME7A 3QN3A 1EWDA 2ZYFA 8XIMA 5TD4A 1TWIA 3CQJA 3A4XA 4FHAA 3WK0A 4AD5A 4CU7A 2BVTA 3H4XA 3O6AA 3CZKA 1B30A 3FJ6A 3GHUA 4Z2HA 3WLHA 2YDQA 2FZBA 1FWCC 3SI9A 5XIMA 1V6UA 2I9UA 1HKJA 3F5JA 2Z26A 2HNEA 1KM6A 2TPSA 3TQPA 2WMKA 4X0NA 3FLUA 1KLZA 1KXVA 1EXPA 3GKFA 3GC5A 3ABZA 4XAPA 4B5TA 3C61A 1ZCCA 3R13A 1FP9A 1XH1A 1ESWA 4ACYA 1XQKA 4IHCA 1CZ1A 1E73M 3GTHA 4XG1A 4IMDA 2VT0A 2WO5A 4O16A 1HL9A 2XIOA 3ZO9A 5D4YA 4QJ5B 3VUSA 1OC5A 1EFZA 2VZTA 2WW5A 1HJVA 3BXWA 4PRWA 3KL0A 2DH3A 2VVNA 3U4AA 2G3MA 3MSDA 3O0KA 1FDYA 4PUNA 2L5HA 4MHBA 4XUYA 5BRBA 3SCNA 4GY7A 2J25A 3GDMA 5EY5A 2A3EA 1UZ4A 2Z6IA 3WD4A 1F05A 1QMLA 1HL8A 1WAWA 3ITYA 1OM0A 1KFKA 1TPDA 4ZQCA 4ERAA 4QR6A 1FWSA 2GJXA 1QPOA 3KTSA 4IQDA 2JKEA 3CB8A 3WX7A 4DJEA 2QJHA 3IEBA 2OVLA 3PWIA 1S3HA 1DIKA 3COTA 1TIMA 3RILA 4S3JA 2R1KA 4BHYA 4HOWA 8CGTA 3QJAA 5FF0A 4UC5A 1XDLA 3WDIA 1JD7A 3MHFA 1NQKA 1LYXA 1VFLA 5D2YA 3ZLFA 2QMKA 2OWCA 3DEQA 3H2NA 5A8MA 4HMNA 3NG3A 1EXBA 4UR9A 2VFGA 5DELA 4ZCWA 4ORIA 1LJYA 3AQUA 3OJGA 2QJMA 1EP2A 2CW6A 1YHTA 4L64A 1C8QA 1E1CB 5DY3A 3H2FA 3WIJA 5AYXA 4K7VA 1IF2A 3NNTA 2WSQA 1I75A 1LWJA 3MVTA 4L1GA 1A5CA 2OU4A 1ICQA 1SZRA 2FVLA 2YCIX 4AWTA 4NU7A 1D3CA 1UMLA 2D2OA 4IJCA 1FRBA 4WSJA 2BY0A 1JQVA 3PBWA 3AALA 1NF0A 2YJQA 3RM9A 4POCA 1HJSA 5KZ6A 1IGWA 1WV2A 1OD0A 2QIIA 4UQEA 1HX0A 1LBMA 2OO0A 5ABGA 3MZNA 2WXDM 2J13A 4LCRA 4PTVA 2ZVIA 1ISYA 1FWFC 4GZIA 3VKKA 4HHMA 3URNA 2X7VA 1QNRA 3VDBA 1EYWA 2GVJA 1GVYA 4Q32A 3W74A 2HS6A 4DAIA 2G50A 1MSSA 3FJNA 4QG9A 3UJSA 1RVKA 4Z2KA 5D9OA 2FQIA 4WKAA 3H7RA 2OGYA 2XIMA 4H9XA 4Q4KA 4CNPA 2ZA2A 4GC4A 1XW8A 4WK9A 2V5JA 1POJA 1E4IA 3UCQA 3GVRA 4UOQA 1PYFA 2QV4A 1GJPA 4GH1A 3GXPA 3E0LA 2CPUA 4OT7A 3KRUA 3EKZA 3BCFA 3WDQA 1XG4A 4C6DA 1C7TA 5HWNA 3GG8A 2J7DA 2XISA 5I77A 4Z1AA 2W91A 1ISXA 3FHQA 4D1JA 2XIQA 1VFUA 4CN4A 1Q2SA 4LC6A 3NYZA 4U10A 4DM2A 4PGLA 1T96A 4J28A 1A3XA 3PM6A 4GNJA 2FZMA 2VM8A 4LAKA 1KRMA 3EOLA 2C79A 2NX3A 2VTFA 5GJNA 1L9WA 4IOTA 3WDJA 3STEA 3RJXA 3OZYA 2JKPA 1KV8A 2R24A 3GG1A 2OZTA 3KW3A 2WNZA 3T40A 2YCEA 4UTTC 2WCGA 3NSNA 3GC4A 5H2ZA 2E6FA 4H9TA 5A6LA 4MWAE 1Q45A 4GJIA 1V6WA 1EHNA 1PSCA 3ZR5A 1UR4A 5IDIA 2WNWA 4NZ3A 5DCBA 3RPDA 3AZTA 4PA8A 1UJPA 1EC7A 1GW9A 1E71M 3NEVA 4PRTA 4QITA 3UVIA 1XXXA 1IEWA 2E6AA 2CLIA 4MKSA 5AFDA 3B8IA 3URBA 5BMWA 5I07A 2PCQA 4IMAA 1E43A 1OX6A 1C3FA 3SCOA 4LRTA 1V5XA 4HMCA 4L80A 2WVVB 5IXEA 1HN1A 5CZSA 4IWWA 2RAGA 3PSVA 1ITCA 1TX0A 3PWAA 4QCFA 4QJ3B 3RX2A 2X16A 1PAMA 3SGUA 2WHMA 3GNDA 2OLAA 4KF1A 3NEHA 4Q8WA 2WMFA 5LNUA 3T2OA 5DMNA 4KCUA 1DWAM 3MO7A 4ZB5A 1LP6A 2E67A 1V79A 2ZXAA 2MANA 5D03A 4KRZA 5DRIA 1RZMA 1UUOA 8TIMA 1I2QA 2Q09A 1H1ZA 4Y9OA 4A3HA 3EWUA 3TTOA 4UTTA 2VX7A 3BZGA 4R27A 5D9PA 4JYDA 4JX5A 3GHTA 2A3CA 2OQHA 4O4VA 2YFOA 2NZLA 3QOMA 4H7VA 1AA1B 1B57A 3ZSTA 2ZADA 1E1CA 1AJZA 4GIAA 3T2QA 2J7GA 2P76A 4AMCA 2Y88A 3TTEA 4F0SA 3IVUA 4CGTA 4PMDA 3H54A 3OA5A 1Q4WA 2RGLA 3DFQA 3RJYA 1OGSA 1EBGA 1FY6A 4UTJA 3D5HA 2PGEA 2WM0A 5DCEA 1SSGA 2Y8KA 4UBPC 3UA3A 4E2DA 3W70A 4GIEA 2QYGA 2X1IA 4UFKA 1ZY9A 4GX9A 2WVSA 4C5ZA 1QASA 2BY2A 3E74A 4JXCA 1YDOA 2H9AB 1V08A 2HISA 3KRBA 3MA8A 5HWMA 4JTFA 1PIFA 4C6JA 5DLCA 5AC6A 3SUSA 5AKQA 1XYCA 2PI6A 2ACSA 4PC8A 2IUZA 3CIVA 5G4WA 2GVLA 3VUPA 1CGXA 4MUZA 5H1WA 2YW4A 3GB6A 1Q66A 4GVFA 2FIQA 4PBEA 3UJRA 4KCWA 2IXVA 4FK9A 4AY8A 2VEGA 3T2PA 1UBPC 1NP2A 4G9PA 2J9YA 3LTSA 1E5JA 2PWUA 1PPIA 1JPIA 3W76A 1W2VA 4M3PA 1LZOA 2PRMA 4LNYA 1BG9A 1H4PA 1Q65A 5G2IA 3HPFA 4M7TA 4KT2A 3DHPA 3CXOA 1M7PA 3W3OA 4MZ8A 1EP3A 1VEPA 4L9YA 3S9ZA 1XLAA 5B7ZA 1XF0A 3H2MA 1LL4A 3GNNA 2H90A 5IFTA 2AMGA 1OX5A 3WLNA 3QYSA 1X1ZA 2IPFA 2X7WA 2AQWA 4XZIA 1PX8A 1ODUA 4ATWA 3EEGA 4XAYA 4RK8A 1G6CA 5HA7A 3U5UA 5D05A 2E77A 4K1GA 3WLMA 3S0CA 3TCEA 2DEPA 1Q6GA 2GUYA 1UYQA 5A8PA 2Q8XA 3GBEA 2DUAA 3M7SA 3UD6A 3SADA 4UQCA 3PTDA 1J5TA 3S1WA 1Q85A 4J9JA 2FGZA 4J5NA 2PDPA 2OSWA 5CZ0A 1F8IA 1W3TA 1G5AA 2VYOA 2E6DA 1OGGA 4X0VA 4G1KA 1H09A 2DSUA 3CC1A 4JGDA 3V75A 1AQMA 1GJWA 3DXIA 4HHLA 4W7WA 1ZP4A 4J2MA 2NWSA 3CHDA 3P2VA 4RDWA 4XZLX 2WK2A 2D3LA 5KEZA 1HL2A 3SCUA 3E9AA 4GA8A 4RPPA 4W93A 4B5VA 1TV4A 2VFIA 3F7JA 1OWQA 3TEVA 3UXIA 3OU8A 1Q2RA 1YNPA 5K4XA 3E1F1 4MDOA 4XZBA 1VGAA 2Z7GA 2GVEA 2PWFA 2JFEX 3OB8A 5CCZA 1H0GA 4K1WA 3E2VA 5HPCA 1MXDA 3P3BA 4Q7NA 2I9EA 3KBSA 4B5SA 3HN3A 2WVVA 1KM3A 4HU0A 3QQ0A 4E3TA 3OZOA 4NILA 3MUIA 1XLDA 5K3VA 1EO5A 3NPXA 5CPTA 1ZBWA 3K2GA 4EKJA 4KCTA 3G77A 3AMLA 4EP8C 2MNRA 4CCCA 4DLFA 3TYEA 4ZO7A 4DZAA 1F74A 1XGEA 3DESA 3O06A 1SJBA 2YKKA 1S3TC 5A6TC 4BCEA 1V51A 2ZUTA 3W7JA 1E0VA 1DIEA 1RCOB 1BF6A 4EXQA 2B7PA 2BHUA 4GBDA 4CD5A 2GL5A 3GH5A 4BF9A 3NQMA 4LCQA 1W5MA 2XDFA 3UF9A 2OT0A 3L4ZA 4E0CA 4IL2A 2VC6A 4F9DA 3USZA 4G6CA 1OCQA 4RCXA 2DZSA 3AYTA 3EWBX 5GVJA 1KXTA 2A2IA 3I10A 1TVLA 1H5YA 3RU6A 3ELFA 3IV3A 1VFTA 3UZXA 3ONBA 4MY8A 5FJJA 4DWSC 2EG7A 1J6OA 1KKRA 3RYSA 4IISA 2ZTJA 2UWFA 1F4HA 3EOUA 2FZDA 1EO7A 1W5PA 2IKJA 3PUEA 4YPJA 1P6WA 2DQWA 2H9AA 3PN8A 4LYQA 2Y5SA 5C55A 3ARTA 4Z0SA 3C2VA 1ECEA 2J66A 3DG6A 4S39A 3BARA 4WLCA 1L2QA 4JHMA 2DZVA 1GW1A 3WMBA 3W72A 3FN9A 3RK8A 1XD0A 3BUVA 3OHMB 5C2XA 4K38A 3MS8A 2PZ0A 3VMOA 1LT7A 3GIYA 4PTNA 1ZNNA 2D2JA 3K30A 4EPDC 1IZCA 1X6LA 3VDHA 5K2ZA 2WPBA 1LORA 5BOEA 1YTKA 2ZX9A 1AH3A 4JX6A 4PEKA 1CT5A 3K13A 1R7AA 3PBMA 2PZNA 1WQ5A 1KR1A 4CVWA 3I3DA 2G3JA 4HZ7A 4WX2A 4C6IA 4JFWA 2W61A 1LRTA 5LIWX 1GG1A 4MNMA 3ZWTA 3N9KA 1OABA 4JN6A 1JYNA 1XBZA 4V2XA 4S2CA 3PF3A 1CBGA 4ZQMA 1Y8BA 4JHOA 1TPUA 4CN1A 2IS7A 2CNCA 3E49A 3ATZA 2QJIA 4JX4A 4HN4A 1QDSA 3IIZA 1AUSL 4N9CA 3IUIA 4F8XA 5U7SA 2YCJA 1M04A 2P53A 2JIEA 5C9WA 1X38A 3P0WA 1OQFA 3PP7A 3APTA 4MNLA 3AI0A 1FWBC 4I7WA 3S47A 3WLPA 2XUCA 3L4XA 4QAIA 3WNOA 2YZRA 1G4EA 1SUXA 3MKKA 2E7FA 2FFCA 3AS1A 1TRDA 3L5LA 2QMJA 3E02A 1DORA 3KRSA 3M5XA 4ORMA 3MI2A 2YPIA 2E3ZA 3UY8A 1EQCA 3QM3A 3LRKA 4D6IA 3P7YA 5EL1A 5HATA 3KRZA 3A47A 3CJPA 4QJ1A 2ZRWA 4A3QA 1EZWA 3CHCA 4JNYA 2SFPA 1AJ0A 2B7NA 1XDJA 4GZJA 2WPGA 4IPNB 6REQB 3SM0A 1R0MA 5BOOA 3H7UA 3NL5A 4H2CA 1TV5A 3KVLA 3UP8A 3ZYZA 1WE5A 1UQZA 4JTQA 3CO8A 1QK0A 4JN7A 2D23A 5I3GA 1XLGA 1E3ZA 2BASA 2E8ZA 3LXBA 3BJSA 1CEOA 1EL3A 2OO6A 1W37A 4JIIX 4DHGA 1AL8A 2W0UA 3VD9A 3JVAA 2OEJA 3ABRA 4H6RA 1IWAA 3QQWA 3D3FA 1NDVA 4KFPA 3MUAA 4PZVA 1LT8A 2Y7GA 3VI2A 2AMXA 4QS5A 4MMWA 3LHVA 3UGRA 4UMCA 1L2UA 4PCPA 5CSSA 3P62A 1CXEA 1IT8A 4ZEPA 3HG3A 3QPZA 2PTZA 2GQAA 4QFUA 4GGBA 3FDKA 2W6RA 4WOZA 3OYXA 4I9JA 1R46A 4AZ5A 4ADTA 3AHYA 3TIMA 3SB0A 3WQ6A 2JF7A 3O6CA 2XVKA 4WZHA 4YNGA 2WMJA 2XVNA 4JTDA 4QCEA 4JTCA 4PMJA 1UR2A 1NU5A 3MT1A 4O50A 3W75A 4GYJA 4EF8A 1FKXA 2IPJA 5A3HA 4IQJA 2A3LA 4J3XA 1HKWA 3TROA 2B7QA 3II1A 1XG3A 2BODX 1JPDX 2O7SA 3DKJA 1JUBA 2EPOA 2JQXA 1CGWA 1UD5A 3GU9A 5D33A 2NSOA 3ITVA 2XGZA 1A5SA 1QHPA 2ACQA 2I56A 2RDWA 3L2MA 1JNEA 1EJRC 2CCRA 3TN4A 3ARYA 3OLDA 3H22A 4IG2B 2VGBA 2DZBA 1ONRA 4H3DA 1UC5A 1DHKA 2QEZA 1GGOA 2XIIA 1YW1A 3OP2A 3QVQA 1EUNA 1A3HA 1RY8A 3IGXA 5LGXA 4IIHA 5HWJA 4YL2A 5F2LA 1WXYA 3ITCA 3VNJA 1NM9A 3NQEA 1A5UA 1J2WA 1VCFA 3UWVA 4O1AA 5HPOA 3AU6A 2ZZ3A 4ES4A 4AZBA 3F5KA 4F0LA 2VDGA 2E9MA 3IAQA 1OC7A 3VABA 5HMEA 5AYYA 3L7RA 3ZMRA 3VCCA 5CC3A 4TVCA 2CWXA 3EA2A 1JZ5A 1JCJA 2YA0A 3GD6A 1SMAA 1E6PA 5DMMA 3SQLA 4Y7EA 1KV5A 4IQEA 1JDCA 1Q4NX 4PMQA 1E56A 1X1OA 2XIBA 3DFYA 1V0NA 2PWEA 1EB3A 3O9NA 1R85A 3RU8X 5EGRA 1VD6A 1YRRA 1JFXA 2YIHA 4PSPA 4AY1A 4J3TA 3SIMA 4BF5A 2BGNE 7TAAA 1K77A 1GOMA 1UWRA 3BOFA 1IXPA 3HGRA 5IHSA 4HOXA 4M51A 1YADA 2ZE0A 1H7RA 3IIPA 3T0TA 1B3VA 1L6YA 1RBAA 3OO2A 3OG3A 1PHQA 1HGWA 4R7OA 3W1QA 3CZ8A 3VGGA 1XJBA 1EIBA 5CGMA 3C2RA 1ZLPA 3SCVA 4B92A 3CUGA 5AVHA 3AHTA 3MDWA 4DRSA 1KO0A 1PWMA 1MFVA 3LX9A 3IV8A 1FKWA 5F7UA 5JVLA 4UUIA 1GOOA 4CNTA 4A22A 4MFDA 4L6HA 5A6SA 2ISWA 3VTRA 2VD9A 3FW6A 4HD5A 2P10A 3MMDA 3ID7A 1FCQA 4YTRA 3W0KA 3LPFA 1T40A 1QK2A 4JN8A 2PSNA 4HP5A 5FCZA 4R34A 1TIWA 5TF0A 2OGJA 3FYYA 2VQUA 3QMRA 4TOQA 6REQA 3W23A 1TV3A 4K8HA 3UG3A 3VZXA 3P82A 5LKYA 1VJIA 3U9IA 5AHNA 1BXNA 5EB8A 3P84A 2W5FA 3NPUA 4RW5A 3IANA 3TSMA 1OT1A 5FJRA 2VEFA 1K6WA 1ISVA 3A24A 3N3TA 2INZA 3QV9A 2VC5A 1OIFA 1OG0A 1JRCA 4MZ1A 3UZYA 3S5YA 4HGXA 4IMCA 1UR1A 3E2QA 5T8GA 3M4HA 5FJUA 2ISSA 4QQUA 3TV8A 4O18A 3ZFHA 1IR2A 4NAEB 3URQA 2NLYA 4LXFA 3R1ZA 1IZKA 3QY6A 4L5ZA 5HR7A 5DCDA 3MYPA 3L2LA 4Z0JA 5CH9A 1V6TA 2Z4GA 2ONEA 4AVFA 2QNEA 2VDHA 1F3TA 3TYBA 4KQNA 4QE5A 3P60A 4QJ4B 3MSRA 4FXJA 5IRPA 1W9PA 3B0YA 4NRSA 1DJWA 1MZHA 1WKDA 4ML4A 5A8GA 4LT9A 4RZ6A 3PZMA 4L4OA 3O15A 4FNQA 1FVPA 4ZTXA 2VRKA 1V03A 3P93A 4A8NA 3EWDA 3NPVA 3FNDA 4GJ1A 3UXAA 3ARVA 3LENA 1F6YA 2O9OA 1VH7A 3BAWA 1GTEA 1TREA 5HUOA 1BTCA 4ZB0A 4NXSA 2V5BA 1EGMA 3NOEA 3IK4A 1RK5A 2OXNA 1OGBA 4NY2A 3NQBA 3EKGA 1W3NA 2BVWA 3UR2A 3MDUA 2DPEA 3MKCA 1GQJA 4IG2A 4RLIA 2G37A 1FCVA 3LGEA 3FOKA 4XO6A 5T26A 1IGSA 5E9XA 3NURA 3W85A 2NXGA 4Q8QA 3P67A 3MCNA 2VZVA 3E0VA 3IUDA 1JZ7A 2X2GA 1WOBA 4S2BA 1P0EA 3BTNA 1Y5WA 1PCKA 4HPHA 1UD8A 3W4RA 2W9MA 1J0KA 3WQCA 3B4YA 3JW7A 1BGAA 2WZMA 4LTSA 5FL1A 4PCFA 4JCMA 3BANA 5I02A 2C16A 3T09A 4EPEC 1CB2A 2OODA 2E9LA 1GG0A 4XISA 4AB4A 3WF3A 1M1BA 1ZPTA 2JE8A 1SW0A 3HG5A 3W1NA 2HPMA 4UR8A 1QU4A 2QPXA 1MEIA 4O0QA 2XYLA 4K37A 3GM8A 3DFTA 4IXXA 3UGVA 2Z1VA 3AS3A 3QGAC 2IMRA 4JD4A 3PJWA 2PPGA 3D47A 3DIPA 1V3LA 2QJGA 2QVNA 2F6XA 4H8NA 4IM4A 7ODCA 1QWGA 4EX4A 4P7QA 2HXUA 3MI3A 1O6IA 4A2RA 2Y63A 4OTKA 3EOEA 5FF3A 1SR9A 3IJQA 1PX4A 1XPGA 3QEZA 4W8BA 5ABTA 3DYMA 5A94A 2XH4A 1UD6A 2W63A 3GUGA 1AW5A 4ZA0A 4WJXA 4KGLA 2DH2A 2E40A 3L4YA 5PTDA 3S9IA 3UNTA 3CEUA 4OHQA 3WF2A 5EA9A 1GYNA 1AL7A 2EQDA 1AD1A 3DGRA 2WSKA 1A5AA 2BV9A 7PTDA 4QDPA 4QSHA 4GNKB 2ICSA 5E0FA 3MCOA 1K4HA 3N18A 3KL5A 1L8NA 5G1YA 1KFBA 1XC4A 2Q8LA 4UXDA 4ZFCA 4LJ3A 5HNUA 3WEMA 4FEZA 1HTIA 1H7PA 1I2OA 1ZQ5A 2BX7A 1XSIA 4BWLC 3VGEA 1O7AA 3W88A 1TG7A 2D22A 2QUTA 1RLCL 2J8FA 4F40A 1N82A 3PZIA 4GUIA 3QOKA 2X1UA 6TAAA 1TJ1A 1OVDA 4AC7C 2XGIA 2QZRA 2GGIA 2HK1A 4WQ6A 4WSHA 2ZWZA 2PLCA 4JTGA 3N15A 1MUWA 1GOWA 1UKOA 3LG3A 2C1HA 1W3KA 1MDRA 1AW1A 3V35A 1M7XA 4RE4A 1B4EA 4IIBA 5FOOA 4XD6A 4NAEA 3URAA 4LVBA 2R1PA 1QPNA 3SRKA 4AY7A 3AMGA 4JQ4A 1XIHA 3R8RA 4J3WA 4UQAA 4PFHA 2NUYA 3CZLA 4A05A 1LG2A 3GSMA 4HJFA 4BQ2A 3ISIX 4FLQA 5BXPA 3GYCA 1C91A 4E2VA 4UTFA 1UP3A 3V18A 2VC9A 4PB4A 1KFWA 1VPYA 4BWLA 1PBGA 4PMRA 3ERPA 1FWDC 4LX4A 1K9EA 5TIMA 1OF6A 2CXEA 5IBXC 3N2OA 5C2CA 5HJYA 3UCCA 5T9BG 1NFPA 4M6VA 5CXPA 3AMKA 1VYPX 2NQLA 3BV4A 3SN1A 4PL1A 4PUDA 3TJ4A 2J77A 4EWJA 3CAKA 3BJFA 3E5BA 2RKXA 3SRHA 1DL3A 4F0HA 2EXOA 3MPGA 4HK7A 1I2NA 1SJCA 4AHPA 2DSVA 2NVAA 2DIKA 5MKGB 4OUIA 1ZS2A 4JOMA 1LQAA 3H2AA 3GXFA 4GHRA 2ZXQA 1AH0A 3GVQA 1ODZA 2WKLA 4H8VA 3AJXA 1E3XA 1TMHA 2J7HA 4XBKA 1VQTA 4Z17A 2DUXA 3PBYA 2PTYA 3EXRA 2E8YA 4GISA 3V1HA 2R94A 3IVTA 2C0AA 2P8CA 3DH7A 3R7MA 4HNLA 3MHUA 1DP0A 1LLOA 3BOXA 3H70A 1QRQA 3LZ5A 3WBWA 3WQ5A 4MAVA 4JFSA 1UIOA 5JXQA 4FF7A 4CQBA 2GOUA 4BJHA 3VGDA 3VPLA 3TMLA 1JXJA 2V5DA 3N14A 5IBXA 3VE7A 2ZA3A 4MWAD 2OYMA 2UY4A 3PG8A 5HAOA 4HCHA 2EHHA 4XSLA 3NO5A 3CTTA 2B81A 2VGFA 2ZUNA 4MJ4A 3VD3A 3VIJA 5HR6A 3RAOA 5I23A 1D8WA 2DORA 3K4DA 2JK2A 4JS3A 1KWKA 3LRLA 2DZXA 1J10A 4KKXA 1ITQA 1VFHA 1ZAIA 3WLLA 2I16A 4LRSA 1XIBA 5D37A 4GWEA 2G41A 3HFTA 1GORA 4CEUC 1CGTA 4JQ3A 2GDQA 3GHSA 1GOQA 1HJUA 1D7KA 1GQNA 1QPRA 4K7YA 3A9BA 3OYZA 4GFIA 4XBSA 2TSYA 2BXYA 3G1XA 4GNVA 1V3HA 3H23A 3RM4A 1RAKA 3HA1A 1E6XM 3UQNA 3AFBA 4C6EA 4UTMA 4K8EA 4TTUA 4A8LA 2I17A 4KCVA 3VFCA 1EA9C 1N8FA 4UTIA 2Z1KA 3IIOA 5JU6A 1OCNA 2F7FA 2VR5A 5MHBA 1DTNA 3L4UA 5FAGA 4B9YA 5IOBA 1YXDA 3VXGA 1BLIA 3D6NA 1EF2A 1RP8A 1DEDA 2X42A 1G1YA 4MPQA 3OODA 3LCLA 1SPQA 4Q4PA 4QGCA 4CNOA 3RPTA 1TV2A 3TZNA 1GQIA 2CBVA 3TNBA 1YEYA 4U5IA 4QNWA 2DZUA 1UHVA 8XIAA 1K4GA 4Z2JA 1WDPA 1U5HA 3N9SA 2ALDA 3Q4DA 3BK0A 3WH9A 5JBDA 4FX7A 1OFDA 1KTBA 4ZE5A 4UFIA 4XIAA 2HVMA 1LTDA 4AIEA 1LBFA 3G1HA 1V93A 2OG9A 3RFAA 3CQIA 3EOSA 3BLEA 2XFFA 4LOCA 4EF9A 4J3UA 3KP0A 4GBUA 1YDNA 4CNNA 2OZ0A 4RW3A 3WLIA 3WF0A 1E0WA 2PB1A 1HKIA 2F61A 2BZNA 1W3IA 4PTWA 4M6PA 3DC8A 3RX3A 4PBGA 1JCTA 2Q3OA 2DIEA 3NDZA 1IEXA 4S3AA 3A21A 1VIZA 1UA7A 3MB9A 3H53A 4EANA 1MZRA 1FH7A 5H91A 4GY0A 1DXFA 4XKYA 1J5SA 3MBDA 2VNCA 1ITUA 1OC6A 1HP4A 1ZCOA 2YXXA 4JIPA 2OCZA 3W7QA 1R2TA 4XSMA 2XSBA 1BYAA 3QW3A 1TTQA 3R0KA 3ANUA 1AW2A 3M44A 5FA5A 2E28A 1K9TA 3TSBA 2OR2A 3S6DA 3TAKA 4LSBA 1R3YA 3FJLA 1EF3A 4N0RA 3WMSA 5MKGA 5DXYA 3L0KA 4LF1A 3DFSA 4I7VA 1KBLA 3QRHA 4XTDA 3RITA 2R9RA 4AD3A 4ATDA 3IGUA 4JDBA 1F76A 3R12A 2ACRA 1A5MC 3AXXA 3EMZA 1V8EA 3DYPA 5AYBA 5LNWA 4FALA 1A3WA 4QBXA 1EGVA 3SCPA 4CLMA 3QZAA 1E4LA 3N9RA 3DG3A 5BRPA 1ZBVA 1VAHA 3SURA 4HK6A 2E1WA 2PBGA 1WP6A 2ZX6A 4WOQA 2Z24A 3VKJA 1XBXA 1IHIA 1CDGA 3CASA 3N12A 4LB4A 1F3XA 4WXZA 4RE3A 3VCNA 3ZR4A 1XFBA 1CTNA 5FKYA 3R11A 2ZZ5A 1UB3A 2ZWYA 4R33A 3U2OA 4Y90A 3UWQA 2V8ZA 1AZ2A 2B4GA 4OKDA 2YL5A 4ZQPA 5FJIA 1XHGA 1VC4A 3GU2A 2CFFA 3PPGA 1YTEA 2CXGA 2BS9A 3V5FA 3EWWA 4XAGA 1FP8A 5M03A 1PE1A 3K8MA 4KEVA 2V5KA 3SCRA 1WPCA 2PWGA 1DJXA 2AOSA 4KWSA 3CH0A 2XVGA 3H21A 1DPMA 3WH5A 4M82A 2TYSA 3LV5A 3SECA 3TN3A 3EPMA 4JDYA 5C5YA 5DANA 3T81A 4UZUA 3MYOA 2E5BA 1W5NA 2XINA 1ZU8A 3WD3A 1X39A 3QTPA 4LY4A 1S2TA 1LQ0A 5F4SA 1WXZA 1E70M 4URIA 1WOAA 1PJ9A 3SAZA 4C6QA 1WZKA 5I00A 2J78A 3CV7A 2O9TA 4YIWA 1VJZA 4HCDA 1GYLA 3C86A 1OHLA 1ZB5A 1XH0A 4GY1A 4UTUA 4GINA 2V2CA 5FI8A 2E0PA 1JDFA 1WDWA 2ZKMX 3POCA 1BG4A 1F3WA 3F2CA 1ADDA 3DCPA 2OZ3A 1IEQA 4WUIA 3BLIA 4F9JA 1W17A 2XG9A 4I8DA 1Z8AA 1TRIA 3KOZA 1SMDA 5I06A 4J7RA 4PBFA 1H60A 1AQHA 4E38A 4PMZA 3OEXA 1A50A 4N02A 2XIJA 3F2DA 1MW2A 4H01A 1UBSA 3AXHA 3PPFA 4TQTA 3PBVA 4PUEA 5AHEA 2ZUVA 1AJ2A 3L4WA 1HIZA 5K9CA 2QDHA 3BE7A 5AVNA 2W66A 3N17A 3KXQA 3WD2A 4ZE4A 3OBKA 1NELA 1H3GA 3QMTA 1JZ6A 3PTKA 3RLHA 4V27A 3AWNA 1U1HA 4GO8A 4RR4A 3VMNA 2QJNA 1KKOA 1O1ZA 5KINA 2BGSA 3NQ6A 2QPUA 3N2BA 4DUVA 4CCDA 4HHPA 1P7TB 3CPRA 4O54A 3DENA 3WQ4A 3U48A 1HGYA 2ZX8A 1XD1A 3A4AA 4H8HA 3TTQA 1CIUA 3RF9A 1GZGA 4ZZ9A 1VHNA 3ZR6A 1UW9A 3U5YA 3W7RA 3MP3A 3U7VA 1M3UA 3MU7A 1P6BA 5CLTA 3BGJA 3IUHA 3SGZA 1W1PA 3T9PA 4AQLA 3M47A 4CQCA 2QKFA 3FXYA 3WDRA 1E4MM 2UY3A 1JPMA 4H9VA 1E0TA 2YLLA 3G8RA 1U1JA 2PUZA 1NH6A 3G0XA 1EX1A 4A3UA 4PMOA 1SFJA 2BXVA 1LQ2A 4ILSA 2JIWA 2O4MA 2UV8G 4Z2GA 1NIUA 2F8QA 2WZHA 1EWEA 5U4NA 5D2VA 3VZZA 3GXDA 1C90A 1G94A 4NKCA 4AMAA 4PODA 1V6YA 1RCQA 3T8LA 4W89A 2FKPA 2ISVA 4LUSB 3HQOA 2OOGA 4TIMA 2BOEX 2YYUA 4D6EA 1W8SA 3P5YA 4KESA 2OSYA 4MKNA 4W86A 2D24A 3QFWA 5H8MA 3HPSA 3I7RA 3GTNA 3A3XA 3TC6A 1E9LA 2JBMA 2I14A 4V28A 3VC6A 2VEMA 1N55A 5BROA 2ESCA 3UXKA 1UCWA 3VOCA 3GXMA 4LW7A 4H9UA 2VQTA 3B04A 1OCBA 1TR1A 3W1PA 2FZNA 1HP5A 2E4TA 2PDCA 3V1PA 3LQGA 2HPIA 1TWDA 1MRQA 3POHA 5AC7A 2QV5A 4B2DD 3THAA 4FXFA 6XIAA 3D46A 3F4WA 1E40A 2GYIA 3ENLA 4RZ5A 2JEPA 3TXZA 3CMGA 1SW3A 1OFQA 2NVCA 2Z1BA 1HXJA 4JTIA 3NQFA 4MIMA 4F0RA 1XISA 2Z27A 2WZTA 1X96A 5C6MA 3S4TA 5CGTA 2GQ9A 1BRLB 3FYPA 2G3FA 2V6AA 5KITA 5TBOA 3GXNA 2V3GA 1JEZA 2Y61A 1QHOA 4HU3A 4UIOA 4DWSD 2ASHA 1R2SA 1S5VA 1HNYA 4MFEA 4GIYA 1TZ7A 1EOKA 3LGDA 4J35A 3LN3A 2A3BA 2QULA 3AS2A 1G4TA 3CM4A 2XH0A 3WLTA 3GTXA 7REQB 1KD0A 5F2IA 2X1SA 2Y4SA 5KETA 3VILA 1JL8A 1EP1A 4OIFA 3VDCA 3BC9A 4WGXA 5AYZA 2GJLA 3QR0A 4IPPA 3MW7A 4ZQNA 4D6CA 2BB0A 1Q7MA 4IUOA 2WWCA 3U2ZA 4OGZA 5I3HA 2IXUA 1KRCC 1S1RA 2D2HA 4YS1A 1R47A 1M53A 3CV1A 3H2EA 2QF7A 1PTGA 3VVGA 2Y7FA 3U6WA 1GCYA 1J0HA 2OYLA 4KFOA 3R25A 1K8XA 2QCDB 3GAKA 3NQAA 3BSGA 3GH4A 3A3HA 5AHMA 3CQKA 4GVHA 3UWEA 1GKRA 1DYSA 3UT0A 3G2GA 4NYYA 2J8TA 3GG7A 1QAPA 5FACA 1GOKA 3SQSA 1DE5A 1TCMA 4MYAA 4UTWC 4PMYA 3LA4A 1VBGA 4XX6A 4DYKA 1T5AA 5ECVA 3W71A 1P43A 4H4IA 1NP0A 4DQWA 4LBRA 4L1WA 5BMXA 3W53A 1P7TA 3TCSA 2VX6A 3O07A 2GGGA 1YDVA 2HJPA 1TPC1 4W7VA 3CQHA 3T7VA 1ELSA 2AGTA 1K8YA 1RP9A 1RLDA 3CAVA 4P7NA 4ZSUA 1PUDA 1XGZA 3GY1A 4FXRA 2Y7DA 3G1SA 4A2SA 5DMYA 2PWHA 4R9OA 3A5FA 3WQWA 1TCDA 3HQNA 2XHYA 5HJXA 2FHFA 3KM8A 4MZYA 4NZ1A 1GONA 1XCXA 4OBSA 2V38A 1VLIA 3NQ8A 1MW1A 2R1MA 2PDWA 2RJGA 4H41A 4JNZA 2NQ9A 3CHEA 4F3HA 1PX3A 1FHUA 1H7XA 3AIQA 1U5VA 2A7PA 3EX2A 4DF0A 1BYDA 4LYRA 4W8AA 4EK7A 5FD0A 4L7ZA 3QHNA 1BWLA 3I6EA 3MC5A 3M0LA 3S2JA 4RXGA 3N29A 4H1ZA 3TX9A 2AAMA 1LOQA 2NX9A 3H6OA 4JCLA 2VZOA 2X40A 4UTWA 4N9EA 3TTYA 2NUWA 5DFAA 3HIJA 1E15A 2PU0A 2Q02A 5E70A 4TV6A 5REQB 3WDPP 3LCGA 1P1MA 3F4VA 3ECQA 1V6VA 2DP3A 3M0VA 2EGZA 3THQA 1A0DA 1KM0A 1B3WA 3NR0A 4JTLA 4O13A 4D9PA 4JZ5A 4DZ5A 1W9UA 4XD5A 3LXAA 4GYPC 4HN8A 4ENLA 4H8UA 2ZE3A 4RDYA 2P8BA 1LL7A 1L6WA 4JPGA 3BLFA 3W37A 3CT7A