1JQZA

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability effects of mutations designed to increase the primary sequence symmetry within the core region of a beta-trefoil.
pubmed doi rcsb
molecule keywords acidic fibroblast growth factor
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1jqzA00
3PG0A 3V0BB 1AVAC 4LO0A 2F8XC 3O4BA 2LIEA 1ISYA 2AXMA 3JRRA 4LO1C 3UD7A 4G9NA 1MD6A 4G9MA 4QALA 5HPZA 2D1ZA 3OBRA 1J0SA 8I1BA 4KC3A 4AN7B 1IILA 3OGGA 2J3PA 5BVPI 1E0OA 1KNMA 3VT0A 3N0KA 2FFUA 5FNWA 2M49A 4LO7B 1XG6A 4GAIA 1RY7A 4LO0C 1V6XA 3AZWA 3Q7WA 4ZOTA 6I1BA 1P63A 3ZXDA 3AKHA 2D22A 2P23A 3ZXGA 4ZLBB 3H6RA 3A22A 3BRFA 3UJ4A 3RTIB 1WD3A 2F2FA 2AAIB 3CQAA 4X37A 4ZFWB 1S0FA 2DREA 3B9UA 3OJMA 2Y9GA 3UJ0A 3P53A 1AF9A 4QKRA 2VSAA 3A23A 4EFQA 5BXTA 3RMXA 1Q03A 3FJKA 5EHAA 3O4OA 1I1EA 1S0LA 4I96A 2NM1A 4XFUA 4OWJA 4ENDA 3PUBA 1XHBA 4HR6C 4LO7C 3OBTA 2D7RA 3VT1A 1ISWA 3WMUA 2HWMA 3E8LC 3EF2A 1N4KA 1T4QA 4QD2C 4J2KA 4QKSA 3WO4A 1HCEA 3N7MA 4OEEA 3PMEA 7I1BA 5D61A 4FGFA 3FJDA 3BB2A 3VEQA 2NYYA 1YXWA 5BXPA 2X2SA 2DS0A 4P6AA 1G9DA 3TC2A 2KI4A 1W3GA 2XOAA 1JLXA 3N7JA 4ZKTB 5BP5A 3ZC8A 2GO2A 1AVXB 1PZZA 2VLCA 4ZFUB 1VCLA 1QQLA 1G9BA 1ISXA 1V6WA 1S0CA 3FJ8A 3CA6A 2K4AB 4F83A 1DJSB 4XFSA 2QYIB 3R4UA 1BA7A 3IIRA 3A07A 5FZZA 3WO3A 3CRHA 2ZR1B 3F62B 3V0AA 4IQPA 1TWEA 3RMYA 3QYDA 4I1EA 3AH4A 1DZCA 4HA2A 3R4SA 3OJ2A 3POKA 1CE7B 4XKIA 1TIEA 2KH2A 3S8JA 1WBAA 1RG8A 3AKGA 1XYFA 2BEAA 1EPWA 2AFGA 1PUMB 4J2XA 4JAWA 31BIA 4OWKA 1HWNB 4X38A 2VXTI 5F8SA 4ZFYB 1ISZA 21BIA 3BAGA 3BX1C 1ONKB 3WO2A 3ILAA 5DUYA 4OEFA 3NBNA 4IONA 2RSTA 3CA1A 2Y9XE 1IRAX 2Q9XA 1ITBA 4GAFA 2I1BA 3BA5A 1Q1UA 3BAQA 4I8MA 3H6RB 1DZDA 3I2AA 5BOWA 1FV3A 2P39A 2NVHA 2D20A 4I6IA 4EB2B 3VSZA 4EFPA 3OGFA 1HCDA 3RSJA 1BASA 3O5WB 3UD9A 3AJ5A 3H6QA 5JMCA 1AVWB 1HWPB 4G6MA 2R9KB 4I4PA 1UPSA 4KEIA 3VUOA 1Z0HA 4H9WA 1DQGA 1FMMS 3CA5A 1DIWA 1EVTA 1W3FA 2D23A 4I2SA 4QD2B 2BEBA 4Z8SB 3O3QA 2DRYA 3CA0A 1JT4A 3FJ9A 4D8HA 1SR4A 4D0ZA 2HW9A 1S0GA 3PHZA 4QBVA 2AQZA 2MLLB 1JT3A 2IWTB 3AH1A 1M16A 4Q9PA 1ABRB 5FZYA 9ILBA 1JY0A 1DFCA 4IZEA 2RQ9A 4A7YA 4I7IA 4P0LA 4KEKA 2K8RA 1RMLA 3UD8A 3I2XA 4KEJA 4I0YA 1K5UA 3T8SA 1T9FA 2F2FC 2VUAA 4JP0A 2Y9WC 2D44A 4I1BA 3UDAA 4OW4A 1FWVA 4F34A 1XZZA 4XFTA 3FJIA 3O4AA 4OEGA 2KKIA 1IOBA 2MC2A 3W9TA 1YBIA 4GOYA 4IY8A 1FMZA 4I4XA 3HBWA 2K43A 4I4SA 4GOVA 4JRAA 1PWAA 4J2YA 5DZUA 4J2SA 3NBCA 3Q7XA 1SZ6B 3WINA 1BFBA 4ZA3B 4LO2A 4A7KA 3V0AB 3FGMA 4IHZA 4USPA 2KLLA 3BAUA 4OWLA 3N7KA 2RG9B 1QQKA 1HIBA 2FDBM 2NP0A 2VSEA 3HN1A 3P6JA 4DCKC 3RTJB 3LTQA 3IM6A 4DEPA 3WINC 2DRZA 2ERMA 3FJEA 4LO2C 3VT2A 3C9ZA 3O4DA 4L4IA 3VWCA 3K1XA 2Z48A 4I4QA 4JQ0A 5BP5C 3BRDA 2X2TA 1FN0A 4ISQA 1AVUA 3D7WB 3VSFA 5DSSB 1M2TB 2E4MA 2HZ9A 3WMVA 2LIQA 1AXMA 1DLLA 1HWMB 1ISVA 1TOOA 3BA4A 1YF8B 4Q91A 4WBCA 2NZ9A 1K5VA 3BAOA 4X3AA 3FJFA 5FNXA 4JPZA 5BXSA 2YUGA 1HWOB 3ZX7A 4I3NA 1JTCA 4R6UB 3HOMA 5EG6C 1TFMB 1JT5A 1V6UA 3S8KA 3FJAA 2GZBA 4LO1A 4D0TA 4CJMA 1D0HA 3FJHA 4DENA 4YOLA 2FO1A 4Z9WB 4GP0A 3QR5A 3BAVA 3BRGC 4PC4A 5F8WA 4QBCA 4ZGRB 1OQLB 2Y9FA 4ZBVB 3CA4A 4H04A 5JLVA 1EV2A 4LO8B 3BADA 1EYLA 4EEEB 5DVHA 4FVVA 1ILR1 4I4VA 4I4YA 1RZOB 4A7ZA 3LLPA 2D24A 2Z49A 41BIA 3F1RA 2VU9A 1G9CA 1BLAA 5BXRA 3AZVA 4P0JA 2L5XA 4AN6A 1IRPA 1TWMA 4QC4A 1S0EA 1YTOA 2BFHA 4OUJA 1BFGA 1JT7A 3V0BA 3P6IA 1IJTA 1PUUB 2ZQNA 3NJ5A 3FFZA 4IY9A 1WD4A 5G00A 3CRIA 5F90A 2QN4A 3IAGC 4HJJA 1R8OA 1SR4C 3A21A 3JUTA 1II4A 3HSMA 1NZKA 4X39A 2KI6B 3CRGA 1BARA 5FZUA 1BLDA 1G9AA 5GAQA 4GP3A 5F8YA 1L2HA 1Z4SA 3BTAA 1S0BA 4LO3A 1FV2A 2HWAA 1V6VA 2ZQOA 3AJ6A 3OJVA 3V79C 4J23B 2FFVA 4I37A 3CA3A 3I29B 2D43A 4Q9GA 4JKXB 5BQUA 1MC9A 3N7LA 3BAHA 3CU1B 1JQZA 4I4RA 4I4UA 4LO3C 2VXRA 3Q7YA 3SNVA 3O44A 1GGPB 3HMYA 1IT0A 2MIBA 4IZXA 3MALA 2WRYA 3KMVA 4I4OA 2Q3NB 4L4HA 5E24E 1DFQA 1F31A 1FQ9A 3O49A 5D63A 3IM7A 5BQUC 1JLYA 3HALA 1Z2VA 4IYBA 2ET2A 4EFRA 3AH2A 1BFCA 1IHKA 1S0DA 1Q04A 1PC8B 4G6JA 3AKIA 1FWUA 3FJBA 3NBDA 4ISRA 4EKXB 1FGAA 2FGFA 2D7IA 4G1RA 1AFCA 1QXMA 3NBEA 2WBCA 1G82A 3FJCA 5EC5A 4USOA 1TTUA 4KBBA 5I1BA 2ESUA 3ZC9A 3H6SE 4P0KA 4TLPA 4QO3A 3FJJA 1W3AA 2E4MC 1DQOA 1YYNA 1WBCA 3IM5A 3FUQA 5B2HA 3CAHA 1BFFA 1NUNA 3BA7A 3O4CA 1HKNA 2UUSA 1R8NA 1I1BA 2NTDA 3AKFA 5D62A 1A8DA 4JKQA 4II0A 2IHOA 1CVSA 3WA1A 3FUOA 1TP0A 3MPPG
chains in the Genus database with same CATH superfamily
3PG0A 3V0BB 1AVAC 4LO0A 2F8XC 3O4BA 2LIEA 1ISYA 2AXMA 3JRRA 4LO1C 3UD7A 4G9NA 1MD6A 4G9MA 4QALA 5HPZA 2D1ZA 3OBRA 1J0SA 8I1BA 4KC3A 4AN7B 1IILA 3OGGA 2J3PA 5BVPI 1E0OA 1KNMA 3VT0A 3N0KA 2FFUA 5FNWA 2M49A 4LO7B 1XG6A 4GAIA 1RY7A 4LO0C 1V6XA 3AZWA 3Q7WA 4ZOTA 6I1BA 1P63A 3ZXDA 3AKHA 2D22A 2P23A 3ZXGA 4ZLBB 3H6RA 3A22A 3BRFA 3UJ4A 3RTIB 1WD3A 2F2FA 2AAIB 3CQAA 4X37A 4ZFWB 1S0FA 2DREA 3B9UA 3OJMA 2Y9GA 3UJ0A 3P53A 1AF9A 4QKRA 2VSAA 3A23A 4EFQA 5BXTA 3RMXA 1Q03A 4MZHA 3FJKA 5EHAA 3O4OA 1I1EA 1S0LA 4I96A 2NM1A 4XFUA 4OWJA 4ENDA 3PUBA 1XHBA 4HR6C 4LO7C 3OBTA 2D7RA 3VT1A 1ISWA 3WMUA 2HWMA 3E8LC 3EF2A 1N4KA 1T4QA 4QD2C 4J2KA 4UY4A 4QKSA 3WO4A 1HCEA 3N7MA 4OEEA 3PMEA 7I1BA 5D61A 4FGFA 3FJDA 3BB2A 3VEQA 2NYYA 1YXWA 5BXPA 2X2SA 2DS0A 4P6AA 1G9DA 3TC2A 2KI4A 1W3GA 2XOAA 1JLXA 3N7JA 4ZKTB 5BP5A 3ZC8A 2GO2A 1AVXB 1PZZA 2VLCA 4ZFUB 1VCLA 1QQLA 1G9BA 1ISXA 1V6WA 1S0CA 3FJ8A 3CA6A 2K4AB 4F83A 1DJSB 4XFSA 2QYIB 3R4UA 1BA7A 3IIRA 3A07A 5FZZA 3WO3A 3CRHA 2ZR1B 3F62B 3V0AA 4IQPA 1TWEA 3RMYA 3QYDA 4I1EA 3AH4A 1DZCA 4HA2A 3R4SA 3OJ2A 3POKA 1CE7B 4XKIA 1TIEA 2KH2A 3S8JA 1WBAA 1RG8A 3AKGA 1XYFA 2BEAA 1EPWA 2AFGA 1PUMB 4J2XA 4JAWA 31BIA 4OWKA 1HWNB 4X38A 2VXTI 5F8SA 4ZFYB 1ISZA 21BIA 3BAGA 3BX1C 1ONKB 3WO2A 3ILAA 5DUYA 4OEFA 3NBNA 4IONA 2RSTA 3CA1A 2Y9XE 1IRAX 2Q9XA 1ITBA 4GAFA 2I1BA 3BA5A 1Q1UA 3BAQA 4I8MA 3H6RB 1DZDA 3I2AA 5BOWA 1FV3A 2P39A 2NVHA 2D20A 4I6IA 4EB2B 3VSZA 4EFPA 3OGFA 1HCDA 3RSJA 1BASA 3O5WB 3UD9A 3AJ5A 3H6QA 5JMCA 1AVWB 1HWPB 4G6MA 2R9KB 4I4PA 1UPSA 4KEIA 3VUOA 1Z0HA 4H9WA 1DQGA 1FMMS 3CA5A 1DIWA 1EVTA 1W3FA 2D23A 4I2SA 4QD2B 2BEBA 4Z8SB 3O3QA 2DRYA 3CA0A 1JT4A 3FJ9A 4D8HA 1SR4A 4D0ZA 2HW9A 1S0GA 3PHZA 4QBVA 2AQZA 2MLLB 1JT3A 2IWTB 3AH1A 1M16A 4Q9PA 1ABRB 5FZYA 9ILBA 1JY0A 1DFCA 4IZEA 2RQ9A 4A7YA 4I7IA 4P0LA 4KEKA 2NS2A 2K8RA 1RMLA 3UD8A 3I2XA 4KEJA 4I0YA 1K5UA 3T8SA 1T9FA 2F2FC 2VUAA 4JP0A 2Y9WC 2D44A 4I1BA 3UDAA 4OW4A 1FWVA 4F34A 1XZZA 4XFTA 3FJIA 3O4AA 4OEGA 2KKIA 1IOBA 2MC2A 3W9TA 1YBIA 4GOYA 4IY8A 1FMZA 4I4XA 3HBWA 2K43A 4I4SA 4GOVA 4JRAA 1PWAA 4J2YA 5DZUA 4J2SA 3NBCA 3Q7XA 1SZ6B 3WINA 1BFBA 4ZA3B 4LO2A 4A7KA 3V0AB 3FGMA 4IHZA 4USPA 2KLLA 3BAUA 4OWLA 3N7KA 2RG9B 1QQKA 1HIBA 2FDBM 2NP0A 2VSEA 3HN1A 3P6JA 4DCKC 3RTJB 3LTQA 3IM6A 4DEPA 3WINC 2DRZA 2ERMA 3FJEA 4LO2C 3VT2A 3C9ZA 3O4DA 4L4IA 3VWCA 3K1XA 2Z48A 4I4QA 4JQ0A 5BP5C 3BRDA 2X2TA 1FN0A 4ISQA 1AVUA 3D7WB 3VSFA 5DSSB 1M2TB 2E4MA 2HZ9A 3WMVA 2LIQA 1AXMA 1DLLA 1HWMB 1ISVA 1TOOA 3BA4A 1YF8B 4Q91A 4WBCA 2NZ9A 1K5VA 3BAOA 4X3AA 3FJFA 5FNXA 4JPZA 5BXSA 4MZFB 2YUGA 1HWOB 3ZX7A 4I3NA 1JTCA 4R6UB 3HOMA 5EG6C 1TFMB 1JT5A 1V6UA 3S8KA 3FJAA 2GZBA 4LO1A 4D0TA 4CJMA 1D0HA 3FJHA 4DENA 4YOLA 2FO1A 4Z9WB 4GP0A 3QR5A 3BAVA 3BRGC 4PC4A 5F8WA 4QBCA 4ZGRB 1OQLB 2Y9FA 4ZBVB 3CA4A 4H04A 5JLVA 1EV2A 4LO8B 3BADA 1EYLA 4EEEB 5DVHA 4FVVA 1ILR1 4I4VA 4I4YA 1RZOB 4A7ZA 3LLPA 2D24A 2Z49A 41BIA 3F1RA 2VU9A 1G9CA 1BLAA 5BXRA 3AZVA 4P0JA 2L5XA 4AN6A 1IRPA 1TWMA 4QC4A 1S0EA 1YTOA 2BFHA 4OUJA 1BFGA 1JT7A 3V0BA 3P6IA 1IJTA 1PUUB 2ZQNA 3NJ5A 3FFZA 4IY9A 1WD4A 5G00A 3CRIA 5F90A 2QN4A 4H75A 3IAGC 4HJJA 1R8OA 1SR4C 3A21A 3JUTA 1II4A 3HSMA 1NZKA 4X39A 2KI6B 3CRGA 1BARA 5FZUA 1BLDA 1G9AA 5GAQA 4GP3A 5F8YA 1L2HA 1Z4SA 3BTAA 1S0BA 4LO3A 1FV2A 2HWAA 1V6VA 2ZQOA 3AJ6A 3OJVA 3V79C 4J23B 2FFVA 4I37A 3CA3A 3I29B 2D43A 4Q9GA 4JKXB 5BQUA 1MC9A 3N7LA 3BAHA 3CU1B 1JQZA 4I4RA 4I4UA 4LO3C 2VXRA 3Q7YA 3SNVA 3O44A 1GGPB 3HMYA 1IT0A 2MIBA 4IZXA 3MALA 2WRYA 3KMVA 4I4OA 2Q3NB 4L4HA 5E24E 1DFQA 1F31A 1FQ9A 3O49A 5D63A 3IM7A 5BQUC 1JLYA 3HALA 1Z2VA 4IYBA 2ET2A 4EFRA 3AH2A 1BFCA 1IHKA 1S0DA 1Q04A 1PC8B 4G6JA 3AKIA 1FWUA 3FJBA 3NBDA 4ISRA 4EKXB 1FGAA 2FGFA 2D7IA 4G1RA 1AFCA 1QXMA 3NBEA 2WBCA 1G82A 3FJCA 5EC5A 4USOA 1TTUA 4KBBA 5I1BA 2ESUA 3ZC9A 3H6SE 4P0KA 4TLPA 4QO3A 3FJJA 1W3AA 2E4MC 1DQOA 1YYNA 1WBCA 3IM5A 3FUQA 5B2HA 3CAHA 1BFFA 1NUNA 3BA7A 3O4CA 1HKNA 2UUSA 1R8NA 1I1BA 2NTDA 4MZGB 3AKFA 5D62A 1A8DA 4JKQA 4II0A 2IHOA 1CVSA 3WA1A 3FUOA 1TP0A 3MPPG
chains in the Genus database with same CATH topology
3PG0A 3V0BB 1AVAC 4LO0A 2F8XC 3O4BA 2LIEA 1ISYA 2AXMA 3JRRA 4LO1C 3UD7A 4G9NA 1MD6A 4G9MA 4QALA 5HPZA 2D1ZA 3OBRA 1J0SA 8I1BA 4KC3A 4AN7B 1IILA 3OGGA 2J3PA 5BVPI 1E0OA 1KNMA 3VT0A 3N0KA 2FFUA 5FNWA 2M49A 4LO7B 1XG6A 4GAIA 1RY7A 4LO0C 1V6XA 3AZWA 3Q7WA 4ZOTA 6I1BA 1P63A 3ZXDA 3AKHA 2D22A 2P23A 3ZXGA 4ZLBB 3H6RA 3A22A 3BRFA 3UJ4A 3RTIB 1WD3A 2F2FA 2AAIB 3CQAA 4X37A 4ZFWB 1S0FA 2DREA 3B9UA 3OJMA 2Y9GA 3UJ0A 3P53A 1AF9A 4QKRA 2VSAA 3A23A 4EFQA 5BXTA 3RMXA 1Q03A 4MZHA 3FJKA 5EHAA 3O4OA 1I1EA 1S0LA 4I96A 2NM1A 4XFUA 4OWJA 4ENDA 3PUBA 1XHBA 4HR6C 4LO7C 3OBTA 2D7RA 3VT1A 1ISWA 3WMUA 2HWMA 3E8LC 3EF2A 1N4KA 1T4QA 4QD2C 4J2KA 4UY4A 4QKSA 3WO4A 1HCEA 3N7MA 4OEEA 3PMEA 7I1BA 5D61A 4FGFA 3FJDA 3BB2A 3VEQA 2NYYA 1YXWA 5BXPA 2X2SA 2DS0A 4P6AA 1G9DA 3TC2A 2KI4A 1W3GA 2XOAA 1JLXA 3N7JA 4ZKTB 5BP5A 3ZC8A 2GO2A 1AVXB 1PZZA 2VLCA 4ZFUB 1VCLA 1QQLA 1G9BA 1ISXA 1V6WA 1S0CA 3FJ8A 3CA6A 2K4AB 4F83A 1DJSB 4XFSA 2QYIB 3R4UA 1BA7A 3IIRA 3A07A 5FZZA 3WO3A 3CRHA 2ZR1B 3F62B 3V0AA 4IQPA 1TWEA 3RMYA 3QYDA 4I1EA 3AH4A 1DZCA 4HA2A 3R4SA 3OJ2A 3POKA 1CE7B 4XKIA 1TIEA 2KH2A 3S8JA 1WBAA 1RG8A 3AKGA 1XYFA 2BEAA 1EPWA 2AFGA 1PUMB 4J2XA 4JAWA 31BIA 4OWKA 1HWNB 4X38A 2VXTI 5F8SA 4ZFYB 1ISZA 21BIA 3BAGA 3BX1C 1ONKB 3WO2A 3ILAA 5DUYA 4OEFA 3NBNA 4IONA 2RSTA 3CA1A 2Y9XE 1IRAX 2Q9XA 1ITBA 4GAFA 2I1BA 3BA5A 1Q1UA 3BAQA 4I8MA 3H6RB 1DZDA 3I2AA 5BOWA 1FV3A 2P39A 2NVHA 2D20A 4I6IA 4EB2B 3VSZA 4EFPA 3OGFA 1HCDA 3RSJA 1BASA 3O5WB 3UD9A 3AJ5A 3H6QA 5JMCA 1AVWB 1HWPB 4G6MA 2R9KB 4I4PA 1UPSA 4KEIA 3VUOA 1Z0HA 4H9WA 1DQGA 1FMMS 3CA5A 1DIWA 1EVTA 1W3FA 2D23A 4I2SA 4QD2B 2BEBA 4Z8SB 3O3QA 2DRYA 3CA0A 1JT4A 3FJ9A 4D8HA 1SR4A 4D0ZA 2HW9A 1S0GA 3PHZA 4QBVA 2AQZA 2MLLB 1JT3A 2IWTB 3AH1A 1M16A 4Q9PA 1ABRB 5FZYA 9ILBA 1JY0A 1DFCA 4IZEA 2RQ9A 4A7YA 4I7IA 4P0LA 4KEKA 2NS2A 2K8RA 1RMLA 3UD8A 3I2XA 4KEJA 4I0YA 1K5UA 3T8SA 1T9FA 2F2FC 2VUAA 4JP0A 2Y9WC 2D44A 4I1BA 3UDAA 4OW4A 1FWVA 4F34A 1XZZA 4XFTA 3FJIA 3O4AA 4OEGA 2KKIA 1IOBA 2MC2A 3W9TA 1YBIA 4GOYA 4IY8A 1FMZA 4I4XA 3HBWA 2K43A 4I4SA 4GOVA 4JRAA 1PWAA 4J2YA 5DZUA 4J2SA 3NBCA 3Q7XA 1SZ6B 3WINA 1BFBA 4ZA3B 4LO2A 4A7KA 3V0AB 3FGMA 4IHZA 4USPA 2KLLA 3BAUA 4OWLA 3N7KA 2RG9B 1QQKA 1HIBA 2FDBM 2NP0A 2VSEA 3HN1A 3P6JA 4DCKC 3RTJB 3LTQA 3IM6A 4DEPA 3WINC 2DRZA 2ERMA 3FJEA 4LO2C 3VT2A 3C9ZA 3O4DA 4L4IA 3VWCA 3K1XA 2Z48A 4I4QA 4JQ0A 5BP5C 3BRDA 2X2TA 1FN0A 4ISQA 1AVUA 3D7WB 3VSFA 5DSSB 1M2TB 2E4MA 2HZ9A 3WMVA 2LIQA 1AXMA 1DLLA 1HWMB 1ISVA 1TOOA 3BA4A 1YF8B 4Q91A 4WBCA 2NZ9A 1K5VA 3BAOA 4X3AA 3FJFA 5FNXA 4JPZA 5BXSA 4MZFB 2YUGA 1HWOB 3ZX7A 4I3NA 1JTCA 4R6UB 3HOMA 5EG6C 1TFMB 1JT5A 1V6UA 3S8KA 3FJAA 2GZBA 4LO1A 4D0TA 4CJMA 1D0HA 3FJHA 4DENA 4YOLA 2FO1A 4Z9WB 4GP0A 3QR5A 3BAVA 3BRGC 4PC4A 5F8WA 4QBCA 4ZGRB 1OQLB 2Y9FA 4ZBVB 3CA4A 4H04A 5JLVA 1EV2A 4LO8B 3BADA 1EYLA 4EEEB 5DVHA 4FVVA 1ILR1 4I4VA 4I4YA 1RZOB 4A7ZA 3LLPA 2D24A 2Z49A 41BIA 3F1RA 2VU9A 1G9CA 1BLAA 5BXRA 3AZVA 4P0JA 2L5XA 4AN6A 1IRPA 1TWMA 4QC4A 1S0EA 1YTOA 2BFHA 4OUJA 1BFGA 1JT7A 3V0BA 3P6IA 1IJTA 1PUUB 2ZQNA 3NJ5A 3FFZA 4IY9A 1WD4A 5G00A 3CRIA 5F90A 2QN4A 4H75A 3IAGC 4HJJA 1R8OA 1SR4C 3A21A 3JUTA 1II4A 3HSMA 1NZKA 4X39A 2KI6B 3CRGA 1BARA 5FZUA 1BLDA 1G9AA 5GAQA 4GP3A 5F8YA 1L2HA 1Z4SA 3BTAA 1S0BA 4LO3A 1FV2A 2HWAA 1V6VA 2ZQOA 3AJ6A 3OJVA 3V79C 4J23B 2FFVA 4I37A 3CA3A 3I29B 2D43A 4Q9GA 4JKXB 5BQUA 1MC9A 3N7LA 3BAHA 3CU1B 1JQZA 4I4RA 4I4UA 4LO3C 2VXRA 3Q7YA 3SNVA 3O44A 1GGPB 3HMYA 1IT0A 2MIBA 4IZXA 3MALA 2WRYA 3KMVA 4I4OA 2Q3NB 4L4HA 5E24E 1DFQA 1F31A 1FQ9A 3O49A 5D63A 3IM7A 5BQUC 1JLYA 3HALA 1Z2VA 4IYBA 2ET2A 4EFRA 3AH2A 1BFCA 1IHKA 1S0DA 1Q04A 1PC8B 4G6JA 3AKIA 1FWUA 3FJBA 3NBDA 4ISRA 4EKXB 1FGAA 2FGFA 2D7IA 4G1RA 1AFCA 1QXMA 3NBEA 2WBCA 1G82A 3FJCA 5EC5A 4USOA 1TTUA 4KBBA 5I1BA 2ESUA 3ZC9A 3H6SE 4P0KA 4TLPA 4QO3A 3FJJA 1W3AA 2E4MC 1DQOA 1YYNA 1WBCA 3IM5A 3FUQA 5B2HA 3CAHA 1BFFA 1NUNA 3BA7A 3O4CA 1HKNA 2UUSA 1R8NA 1I1BA 2NTDA 4MZGB 3AKFA 5D62A 1A8DA 4JKQA 4II0A 2IHOA 1CVSA 3WA1A 3FUOA 1TP0A 3MPPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG0 A;  3V0B B;  1AVA C;  4LO0 A;  2F8X C;  3O4B A;  2LIE A;  1ISY A;  2AXM A;  3JRR A;  4LO1 C;  3UD7 A;  4G9N A;  1MD6 A;  4G9M A;  4QAL A;  5HPZ A;  2D1Z A;  3OBR A;  1J0S A;  8I1B A;  4KC3 A;  4AN7 B;  1IIL A;  3OGG A;  2J3P A;  5BVP I;  1E0O A;  1KNM A;  3VT0 A;  3N0K A;  2FFU A;  5FNW A;  2M49 A;  4LO7 B;  1XG6 A;  4GAI A;  1RY7 A;  4LO0 C;  1V6X A;  3AZW A;  3Q7W A;  4ZOT A;  6I1B A;  1P63 A;  3ZXD A;  3AKH A;  2D22 A;  2P23 A;  3ZXG A;  4ZLB B;  3H6R A;  3A22 A;  3BRF A;  3UJ4 A;  3RTI B;  1WD3 A;  2F2F A;  2AAI B;  3CQA A;  4X37 A;  4ZFW B;  1S0F A;  2DRE A;  3B9U A;  3OJM A;  2Y9G A;  3UJ0 A;  3P53 A;  1AF9 A;  4QKR A;  2VSA A;  3A23 A;  4EFQ A;  5BXT A;  3RMX A;  1Q03 A;  3FJK A;  5EHA A;  3O4O A;  1I1E A;  1S0L A;  4I96 A;  2NM1 A;  4XFU A;  4OWJ A;  4END A;  3PUB A;  1XHB A;  4HR6 C;  4LO7 C;  3OBT A;  2D7R A;  3VT1 A;  1ISW A;  3WMU A;  2HWM A;  3E8L C;  3EF2 A;  1N4K A;  1T4Q A;  4QD2 C;  4J2K A;  4QKS A;  3WO4 A;  1HCE A;  3N7M A;  4OEE A;  3PME A;  7I1B A;  5D61 A;  4FGF A;  3FJD A;  3BB2 A;  3VEQ A;  2NYY A;  1YXW A;  5BXP A;  2X2S A;  2DS0 A;  4P6A A;  1G9D A;  3TC2 A;  2KI4 A;  1W3G A;  2XOA A;  1JLX A;  3N7J A;  4ZKT B;  5BP5 A;  3ZC8 A;  2GO2 A;  1AVX B;  1PZZ A;  2VLC A;  4ZFU B;  1VCL A;  1QQL A;  1G9B A;  1ISX A;  1V6W A;  1S0C A;  3FJ8 A;  3CA6 A;  2K4A B;  4F83 A;  1DJS B;  4XFS A;  2QYI B;  3R4U A;  1BA7 A;  3IIR A;  3A07 A;  5FZZ A;  3WO3 A;  3CRH A;  2ZR1 B;  3F62 B;  3V0A A;  4IQP A;  1TWE A;  3RMY A;  3QYD A;  4I1E A;  3AH4 A;  1DZC A;  4HA2 A;  3R4S A;  3OJ2 A;  3POK A;  1CE7 B;  4XKI A;  1TIE A;  2KH2 A;  3S8J A;  1WBA A;  1RG8 A;  3AKG A;  1XYF A;  2BEA A;  1EPW A;  2AFG A;  1PUM B;  4J2X A;  4JAW A;  31BI A;  4OWK A;  1HWN B;  4X38 A;  2VXT I;  5F8S A;  4ZFY B;  1ISZ A;  21BI A;  3BAG A;  3BX1 C;  1ONK B;  3WO2 A;  3ILA A;  5DUY A;  4OEF A;  3NBN A;  4ION A;  2RST A;  3CA1 A;  2Y9X E;  1IRA X;  2Q9X A;  1ITB A;  4GAF A;  2I1B A;  3BA5 A;  1Q1U A;  3BAQ A;  4I8M A;  3H6R B;  1DZD A;  3I2A A;  5BOW A;  1FV3 A;  2P39 A;  2NVH A;  2D20 A;  4I6I A;  4EB2 B;  3VSZ A;  4EFP A;  3OGF A;  1HCD A;  3RSJ A;  1BAS A;  3O5W B;  3UD9 A;  3AJ5 A;  3H6Q A;  5JMC A;  1AVW B;  1HWP B;  4G6M A;  2R9K B;  4I4P A;  1UPS A;  4KEI A;  3VUO A;  1Z0H A;  4H9W A;  1DQG A;  1FMM S;  3CA5 A;  1DIW A;  1EVT A;  1W3F A;  2D23 A;  4I2S A;  4QD2 B;  2BEB A;  4Z8S B;  3O3Q A;  2DRY A;  3CA0 A;  1JT4 A;  3FJ9 A;  4D8H A;  1SR4 A;  4D0Z A;  2HW9 A;  1S0G A;  3PHZ A;  4QBV A;  2AQZ A;  2MLL B;  1JT3 A;  2IWT B;  3AH1 A;  1M16 A;  4Q9P A;  1ABR B;  5FZY A;  9ILB A;  1JY0 A;  1DFC A;  4IZE A;  2RQ9 A;  4A7Y A;  4I7I A;  4P0L A;  4KEK A;  2K8R A;  1RML A;  3UD8 A;  3I2X A;  4KEJ A;  4I0Y A;  1K5U A;  3T8S A;  1T9F A;  2F2F C;  2VUA A;  4JP0 A;  2Y9W C;  2D44 A;  4I1B A;  3UDA A;  4OW4 A;  1FWV A;  4F34 A;  1XZZ A;  4XFT A;  3FJI A;  3O4A A;  4OEG A;  2KKI A;  1IOB A;  2MC2 A;  3W9T A;  1YBI A;  4GOY A;  4IY8 A;  1FMZ A;  4I4X A;  3HBW A;  2K43 A;  4I4S A;  4GOV A;  4JRA A;  1PWA A;  4J2Y A;  5DZU A;  4J2S A;  3NBC A;  3Q7X A;  1SZ6 B;  3WIN A;  1BFB A;  4ZA3 B;  4LO2 A;  4A7K A;  3V0A B;  3FGM A;  4IHZ A;  4USP A;  2KLL A;  3BAU A;  4OWL A;  3N7K A;  2RG9 B;  1QQK A;  1HIB A;  2FDB M;  2NP0 A;  2VSE A;  3HN1 A;  3P6J A;  4DCK C;  3RTJ B;  3LTQ A;  3IM6 A;  4DEP A;  3WIN C;  2DRZ A;  2ERM A;  3FJE A;  4LO2 C;  3VT2 A;  3C9Z A;  3O4D A;  4L4I A;  3VWC A;  3K1X A;  2Z48 A;  4I4Q A;  4JQ0 A;  5BP5 C;  3BRD A;  2X2T A;  1FN0 A;  4ISQ A;  1AVU A;  3D7W B;  3VSF A;  5DSS B;  1M2T B;  2E4M A;  2HZ9 A;  3WMV A;  2LIQ A;  1AXM A;  1DLL A;  1HWM B;  1ISV A;  1TOO A;  3BA4 A;  1YF8 B;  4Q91 A;  4WBC A;  2NZ9 A;  1K5V A;  3BAO A;  4X3A A;  3FJF A;  5FNX A;  4JPZ A;  5BXS A;  2YUG A;  1HWO B;  3ZX7 A;  4I3N A;  1JTC A;  4R6U B;  3HOM A;  5EG6 C;  1TFM B;  1JT5 A;  1V6U A;  3S8K A;  3FJA A;  2GZB A;  4LO1 A;  4D0T A;  4CJM A;  1D0H A;  3FJH A;  4DEN A;  4YOL A;  2FO1 A;  4Z9W B;  4GP0 A;  3QR5 A;  3BAV A;  3BRG C;  4PC4 A;  5F8W A;  4QBC A;  4ZGR B;  1OQL B;  2Y9F A;  4ZBV B;  3CA4 A;  4H04 A;  5JLV A;  1EV2 A;  4LO8 B;  3BAD A;  1EYL A;  4EEE B;  5DVH A;  4FVV A;  1ILR 1;  4I4V A;  4I4Y A;  1RZO B;  4A7Z A;  3LLP A;  2D24 A;  2Z49 A;  41BI A;  3F1R A;  2VU9 A;  1G9C A;  1BLA A;  5BXR A;  3AZV A;  4P0J A;  2L5X A;  4AN6 A;  1IRP A;  1TWM A;  4QC4 A;  1S0E A;  1YTO A;  2BFH A;  4OUJ A;  1BFG A;  1JT7 A;  3V0B A;  3P6I A;  1IJT A;  1PUU B;  2ZQN A;  3NJ5 A;  3FFZ A;  4IY9 A;  1WD4 A;  5G00 A;  3CRI A;  5F90 A;  2QN4 A;  3IAG C;  4HJJ A;  1R8O A;  1SR4 C;  3A21 A;  3JUT A;  1II4 A;  3HSM A;  1NZK A;  4X39 A;  2KI6 B;  3CRG A;  1BAR A;  5FZU A;  1BLD A;  1G9A A;  5GAQ A;  4GP3 A;  5F8Y A;  1L2H A;  1Z4S A;  3BTA A;  1S0B A;  4LO3 A;  1FV2 A;  2HWA A;  1V6V A;  2ZQO A;  3AJ6 A;  3OJV A;  3V79 C;  4J23 B;  2FFV A;  4I37 A;  3CA3 A;  3I29 B;  2D43 A;  4Q9G A;  4JKX B;  5BQU A;  1MC9 A;  3N7L A;  3BAH A;  3CU1 B;  1JQZ A;  4I4R A;  4I4U A;  4LO3 C;  2VXR A;  3Q7Y A;  3SNV A;  3O44 A;  1GGP B;  3HMY A;  1IT0 A;  2MIB A;  4IZX A;  3MAL A;  2WRY A;  3KMV A;  4I4O A;  2Q3N B;  4L4H A;  5E24 E;  1DFQ A;  1F31 A;  1FQ9 A;  3O49 A;  5D63 A;  3IM7 A;  5BQU C;  1JLY A;  3HAL A;  1Z2V A;  4IYB A;  2ET2 A;  4EFR A;  3AH2 A;  1BFC A;  1IHK A;  1S0D A;  1Q04 A;  1PC8 B;  4G6J A;  3AKI A;  1FWU A;  3FJB A;  3NBD A;  4ISR A;  4EKX B;  1FGA A;  2FGF A;  2D7I A;  4G1R A;  1AFC A;  1QXM A;  3NBE A;  2WBC A;  1G82 A;  3FJC A;  5EC5 A;  4USO A;  1TTU A;  4KBB A;  5I1B A;  2ESU A;  3ZC9 A;  3H6S E;  4P0K A;  4TLP A;  4QO3 A;  3FJJ A;  1W3A A;  2E4M C;  1DQO A;  1YYN A;  1WBC A;  3IM5 A;  3FUQ A;  5B2H A;  3CAH A;  1BFF A;  1NUN A;  3BA7 A;  3O4C A;  1HKN A;  2UUS A;  1R8N A;  1I1B A;  2NTD A;  3AKF A;  5D62 A;  1A8D A;  4JKQ A;  4II0 A;  2IHO A;  1CVS A;  3WA1 A;  3FUO A;  1TP0 A;  3MPP G; 
#chains in the Genus database with same CATH topology
 3PG0 A;  3V0B B;  1AVA C;  4LO0 A;  2F8X C;  3O4B A;  2LIE A;  1ISY A;  2AXM A;  3JRR A;  4LO1 C;  3UD7 A;  4G9N A;  1MD6 A;  4G9M A;  4QAL A;  5HPZ A;  2D1Z A;  3OBR A;  1J0S A;  8I1B A;  4KC3 A;  4AN7 B;  1IIL A;  3OGG A;  2J3P A;  5BVP I;  1E0O A;  1KNM A;  3VT0 A;  3N0K A;  2FFU A;  5FNW A;  2M49 A;  4LO7 B;  1XG6 A;  4GAI A;  1RY7 A;  4LO0 C;  1V6X A;  3AZW A;  3Q7W A;  4ZOT A;  6I1B A;  1P63 A;  3ZXD A;  3AKH A;  2D22 A;  2P23 A;  3ZXG A;  4ZLB B;  3H6R A;  3A22 A;  3BRF A;  3UJ4 A;  3RTI B;  1WD3 A;  2F2F A;  2AAI B;  3CQA A;  4X37 A;  4ZFW B;  1S0F A;  2DRE A;  3B9U A;  3OJM A;  2Y9G A;  3UJ0 A;  3P53 A;  1AF9 A;  4QKR A;  2VSA A;  3A23 A;  4EFQ A;  5BXT A;  3RMX A;  1Q03 A;  4MZH A;  3FJK A;  5EHA A;  3O4O A;  1I1E A;  1S0L A;  4I96 A;  2NM1 A;  4XFU A;  4OWJ A;  4END A;  3PUB A;  1XHB A;  4HR6 C;  4LO7 C;  3OBT A;  2D7R A;  3VT1 A;  1ISW A;  3WMU A;  2HWM A;  3E8L C;  3EF2 A;  1N4K A;  1T4Q A;  4QD2 C;  4J2K A;  4UY4 A;  4QKS A;  3WO4 A;  1HCE A;  3N7M A;  4OEE A;  3PME A;  7I1B A;  5D61 A;  4FGF A;  3FJD A;  3BB2 A;  3VEQ A;  2NYY A;  1YXW A;  5BXP A;  2X2S A;  2DS0 A;  4P6A A;  1G9D A;  3TC2 A;  2KI4 A;  1W3G A;  2XOA A;  1JLX A;  3N7J A;  4ZKT B;  5BP5 A;  3ZC8 A;  2GO2 A;  1AVX B;  1PZZ A;  2VLC A;  4ZFU B;  1VCL A;  1QQL A;  1G9B A;  1ISX A;  1V6W A;  1S0C A;  3FJ8 A;  3CA6 A;  2K4A B;  4F83 A;  1DJS B;  4XFS A;  2QYI B;  3R4U A;  1BA7 A;  3IIR A;  3A07 A;  5FZZ A;  3WO3 A;  3CRH A;  2ZR1 B;  3F62 B;  3V0A A;  4IQP A;  1TWE A;  3RMY A;  3QYD A;  4I1E A;  3AH4 A;  1DZC A;  4HA2 A;  3R4S A;  3OJ2 A;  3POK A;  1CE7 B;  4XKI A;  1TIE A;  2KH2 A;  3S8J A;  1WBA A;  1RG8 A;  3AKG A;  1XYF A;  2BEA A;  1EPW A;  2AFG A;  1PUM B;  4J2X A;  4JAW A;  31BI A;  4OWK A;  1HWN B;  4X38 A;  2VXT I;  5F8S A;  4ZFY B;  1ISZ A;  21BI A;  3BAG A;  3BX1 C;  1ONK B;  3WO2 A;  3ILA A;  5DUY A;  4OEF A;  3NBN A;  4ION A;  2RST A;  3CA1 A;  2Y9X E;  1IRA X;  2Q9X A;  1ITB A;  4GAF A;  2I1B A;  3BA5 A;  1Q1U A;  3BAQ A;  4I8M A;  3H6R B;  1DZD A;  3I2A A;  5BOW A;  1FV3 A;  2P39 A;  2NVH A;  2D20 A;  4I6I A;  4EB2 B;  3VSZ A;  4EFP A;  3OGF A;  1HCD A;  3RSJ A;  1BAS A;  3O5W B;  3UD9 A;  3AJ5 A;  3H6Q A;  5JMC A;  1AVW B;  1HWP B;  4G6M A;  2R9K B;  4I4P A;  1UPS A;  4KEI A;  3VUO A;  1Z0H A;  4H9W A;  1DQG A;  1FMM S;  3CA5 A;  1DIW A;  1EVT A;  1W3F A;  2D23 A;  4I2S A;  4QD2 B;  2BEB A;  4Z8S B;  3O3Q A;  2DRY A;  3CA0 A;  1JT4 A;  3FJ9 A;  4D8H A;  1SR4 A;  4D0Z A;  2HW9 A;  1S0G A;  3PHZ A;  4QBV A;  2AQZ A;  2MLL B;  1JT3 A;  2IWT B;  3AH1 A;  1M16 A;  4Q9P A;  1ABR B;  5FZY A;  9ILB A;  1JY0 A;  1DFC A;  4IZE A;  2RQ9 A;  4A7Y A;  4I7I A;  4P0L A;  4KEK A;  2NS2 A;  2K8R A;  1RML A;  3UD8 A;  3I2X A;  4KEJ A;  4I0Y A;  1K5U A;  3T8S A;  1T9F A;  2F2F C;  2VUA A;  4JP0 A;  2Y9W C;  2D44 A;  4I1B A;  3UDA A;  4OW4 A;  1FWV A;  4F34 A;  1XZZ A;  4XFT A;  3FJI A;  3O4A A;  4OEG A;  2KKI A;  1IOB A;  2MC2 A;  3W9T A;  1YBI A;  4GOY A;  4IY8 A;  1FMZ A;  4I4X A;  3HBW A;  2K43 A;  4I4S A;  4GOV A;  4JRA A;  1PWA A;  4J2Y A;  5DZU A;  4J2S A;  3NBC A;  3Q7X A;  1SZ6 B;  3WIN A;  1BFB A;  4ZA3 B;  4LO2 A;  4A7K A;  3V0A B;  3FGM A;  4IHZ A;  4USP A;  2KLL A;  3BAU A;  4OWL A;  3N7K A;  2RG9 B;  1QQK A;  1HIB A;  2FDB M;  2NP0 A;  2VSE A;  3HN1 A;  3P6J A;  4DCK C;  3RTJ B;  3LTQ A;  3IM6 A;  4DEP A;  3WIN C;  2DRZ A;  2ERM A;  3FJE A;  4LO2 C;  3VT2 A;  3C9Z A;  3O4D A;  4L4I A;  3VWC A;  3K1X A;  2Z48 A;  4I4Q A;  4JQ0 A;  5BP5 C;  3BRD A;  2X2T A;  1FN0 A;  4ISQ A;  1AVU A;  3D7W B;  3VSF A;  5DSS B;  1M2T B;  2E4M A;  2HZ9 A;  3WMV A;  2LIQ A;  1AXM A;  1DLL A;  1HWM B;  1ISV A;  1TOO A;  3BA4 A;  1YF8 B;  4Q91 A;  4WBC A;  2NZ9 A;  1K5V A;  3BAO A;  4X3A A;  3FJF A;  5FNX A;  4JPZ A;  5BXS A;  4MZF B;  2YUG A;  1HWO B;  3ZX7 A;  4I3N A;  1JTC A;  4R6U B;  3HOM A;  5EG6 C;  1TFM B;  1JT5 A;  1V6U A;  3S8K A;  3FJA A;  2GZB A;  4LO1 A;  4D0T A;  4CJM A;  1D0H A;  3FJH A;  4DEN A;  4YOL A;  2FO1 A;  4Z9W B;  4GP0 A;  3QR5 A;  3BAV A;  3BRG C;  4PC4 A;  5F8W A;  4QBC A;  4ZGR B;  1OQL B;  2Y9F A;  4ZBV B;  3CA4 A;  4H04 A;  5JLV A;  1EV2 A;  4LO8 B;  3BAD A;  1EYL A;  4EEE B;  5DVH A;  4FVV A;  1ILR 1;  4I4V A;  4I4Y A;  1RZO B;  4A7Z A;  3LLP A;  2D24 A;  2Z49 A;  41BI A;  3F1R A;  2VU9 A;  1G9C A;  1BLA A;  5BXR A;  3AZV A;  4P0J A;  2L5X A;  4AN6 A;  1IRP A;  1TWM A;  4QC4 A;  1S0E A;  1YTO A;  2BFH A;  4OUJ A;  1BFG A;  1JT7 A;  3V0B A;  3P6I A;  1IJT A;  1PUU B;  2ZQN A;  3NJ5 A;  3FFZ A;  4IY9 A;  1WD4 A;  5G00 A;  3CRI A;  5F90 A;  2QN4 A;  4H75 A;  3IAG C;  4HJJ A;  1R8O A;  1SR4 C;  3A21 A;  3JUT A;  1II4 A;  3HSM A;  1NZK A;  4X39 A;  2KI6 B;  3CRG A;  1BAR A;  5FZU A;  1BLD A;  1G9A A;  5GAQ A;  4GP3 A;  5F8Y A;  1L2H A;  1Z4S A;  3BTA A;  1S0B A;  4LO3 A;  1FV2 A;  2HWA A;  1V6V A;  2ZQO A;  3AJ6 A;  3OJV A;  3V79 C;  4J23 B;  2FFV A;  4I37 A;  3CA3 A;  3I29 B;  2D43 A;  4Q9G A;  4JKX B;  5BQU A;  1MC9 A;  3N7L A;  3BAH A;  3CU1 B;  1JQZ A;  4I4R A;  4I4U A;  4LO3 C;  2VXR A;  3Q7Y A;  3SNV A;  3O44 A;  1GGP B;  3HMY A;  1IT0 A;  2MIB A;  4IZX A;  3MAL A;  2WRY A;  3KMV A;  4I4O A;  2Q3N B;  4L4H A;  5E24 E;  1DFQ A;  1F31 A;  1FQ9 A;  3O49 A;  5D63 A;  3IM7 A;  5BQU C;  1JLY A;  3HAL A;  1Z2V A;  4IYB A;  2ET2 A;  4EFR A;  3AH2 A;  1BFC A;  1IHK A;  1S0D A;  1Q04 A;  1PC8 B;  4G6J A;  3AKI A;  1FWU A;  3FJB A;  3NBD A;  4ISR A;  4EKX B;  1FGA A;  2FGF A;  2D7I A;  4G1R A;  1AFC A;  1QXM A;  3NBE A;  2WBC A;  1G82 A;  3FJC A;  5EC5 A;  4USO A;  1TTU A;  4KBB A;  5I1B A;  2ESU A;  3ZC9 A;  3H6S E;  4P0K A;  4TLP A;  4QO3 A;  3FJJ A;  1W3A A;  2E4M C;  1DQO A;  1YYN A;  1WBC A;  3IM5 A;  3FUQ A;  5B2H A;  3CAH A;  1BFF A;  1NUN A;  3BA7 A;  3O4C A;  1HKN A;  2UUS A;  1R8N A;  1I1B A;  2NTD A;  4MZG B;  3AKF A;  5D62 A;  1A8D A;  4JKQ A;  4II0 A;  2IHO A;  1CVS A;  3WA1 A;  3FUO A;  1TP0 A;  3MPP G; 
#chains in the Genus database with same CATH homology
 3PG0 A;  3V0B B;  1AVA C;  4LO0 A;  2F8X C;  3O4B A;  2LIE A;  1ISY A;  2AXM A;  3JRR A;  4LO1 C;  3UD7 A;  4G9N A;  1MD6 A;  4G9M A;  4QAL A;  5HPZ A;  2D1Z A;  3OBR A;  1J0S A;  8I1B A;  4KC3 A;  4AN7 B;  1IIL A;  3OGG A;  2J3P A;  5BVP I;  1E0O A;  1KNM A;  3VT0 A;  3N0K A;  2FFU A;  5FNW A;  2M49 A;  4LO7 B;  1XG6 A;  4GAI A;  1RY7 A;  4LO0 C;  1V6X A;  3AZW A;  3Q7W A;  4ZOT A;  6I1B A;  1P63 A;  3ZXD A;  3AKH A;  2D22 A;  2P23 A;  3ZXG A;  4ZLB B;  3H6R A;  3A22 A;  3BRF A;  3UJ4 A;  3RTI B;  1WD3 A;  2F2F A;  2AAI B;  3CQA A;  4X37 A;  4ZFW B;  1S0F A;  2DRE A;  3B9U A;  3OJM A;  2Y9G A;  3UJ0 A;  3P53 A;  1AF9 A;  4QKR A;  2VSA A;  3A23 A;  4EFQ A;  5BXT A;  3RMX A;  1Q03 A;  4MZH A;  3FJK A;  5EHA A;  3O4O A;  1I1E A;  1S0L A;  4I96 A;  2NM1 A;  4XFU A;  4OWJ A;  4END A;  3PUB A;  1XHB A;  4HR6 C;  4LO7 C;  3OBT A;  2D7R A;  3VT1 A;  1ISW A;  3WMU A;  2HWM A;  3E8L C;  3EF2 A;  1N4K A;  1T4Q A;  4QD2 C;  4J2K A;  4UY4 A;  4QKS A;  3WO4 A;  1HCE A;  3N7M A;  4OEE A;  3PME A;  7I1B A;  5D61 A;  4FGF A;  3FJD A;  3BB2 A;  3VEQ A;  2NYY A;  1YXW A;  5BXP A;  2X2S A;  2DS0 A;  4P6A A;  1G9D A;  3TC2 A;  2KI4 A;  1W3G A;  2XOA A;  1JLX A;  3N7J A;  4ZKT B;  5BP5 A;  3ZC8 A;  2GO2 A;  1AVX B;  1PZZ A;  2VLC A;  4ZFU B;  1VCL A;  1QQL A;  1G9B A;  1ISX A;  1V6W A;  1S0C A;  3FJ8 A;  3CA6 A;  2K4A B;  4F83 A;  1DJS B;  4XFS A;  2QYI B;  3R4U A;  1BA7 A;  3IIR A;  3A07 A;  5FZZ A;  3WO3 A;  3CRH A;  2ZR1 B;  3F62 B;  3V0A A;  4IQP A;  1TWE A;  3RMY A;  3QYD A;  4I1E A;  3AH4 A;  1DZC A;  4HA2 A;  3R4S A;  3OJ2 A;  3POK A;  1CE7 B;  4XKI A;  1TIE A;  2KH2 A;  3S8J A;  1WBA A;  1RG8 A;  3AKG A;  1XYF A;  2BEA A;  1EPW A;  2AFG A;  1PUM B;  4J2X A;  4JAW A;  31BI A;  4OWK A;  1HWN B;  4X38 A;  2VXT I;  5F8S A;  4ZFY B;  1ISZ A;  21BI A;  3BAG A;  3BX1 C;  1ONK B;  3WO2 A;  3ILA A;  5DUY A;  4OEF A;  3NBN A;  4ION A;  2RST A;  3CA1 A;  2Y9X E;  1IRA X;  2Q9X A;  1ITB A;  4GAF A;  2I1B A;  3BA5 A;  1Q1U A;  3BAQ A;  4I8M A;  3H6R B;  1DZD A;  3I2A A;  5BOW A;  1FV3 A;  2P39 A;  2NVH A;  2D20 A;  4I6I A;  4EB2 B;  3VSZ A;  4EFP A;  3OGF A;  1HCD A;  3RSJ A;  1BAS A;  3O5W B;  3UD9 A;  3AJ5 A;  3H6Q A;  5JMC A;  1AVW B;  1HWP B;  4G6M A;  2R9K B;  4I4P A;  1UPS A;  4KEI A;  3VUO A;  1Z0H A;  4H9W A;  1DQG A;  1FMM S;  3CA5 A;  1DIW A;  1EVT A;  1W3F A;  2D23 A;  4I2S A;  4QD2 B;  2BEB A;  4Z8S B;  3O3Q A;  2DRY A;  3CA0 A;  1JT4 A;  3FJ9 A;  4D8H A;  1SR4 A;  4D0Z A;  2HW9 A;  1S0G A;  3PHZ A;  4QBV A;  2AQZ A;  2MLL B;  1JT3 A;  2IWT B;  3AH1 A;  1M16 A;  4Q9P A;  1ABR B;  5FZY A;  9ILB A;  1JY0 A;  1DFC A;  4IZE A;  2RQ9 A;  4A7Y A;  4I7I A;  4P0L A;  4KEK A;  2NS2 A;  2K8R A;  1RML A;  3UD8 A;  3I2X A;  4KEJ A;  4I0Y A;  1K5U A;  3T8S A;  1T9F A;  2F2F C;  2VUA A;  4JP0 A;  2Y9W C;  2D44 A;  4I1B A;  3UDA A;  4OW4 A;  1FWV A;  4F34 A;  1XZZ A;  4XFT A;  3FJI A;  3O4A A;  4OEG A;  2KKI A;  1IOB A;  2MC2 A;  3W9T A;  1YBI A;  4GOY A;  4IY8 A;  1FMZ A;  4I4X A;  3HBW A;  2K43 A;  4I4S A;  4GOV A;  4JRA A;  1PWA A;  4J2Y A;  5DZU A;  4J2S A;  3NBC A;  3Q7X A;  1SZ6 B;  3WIN A;  1BFB A;  4ZA3 B;  4LO2 A;  4A7K A;  3V0A B;  3FGM A;  4IHZ A;  4USP A;  2KLL A;  3BAU A;  4OWL A;  3N7K A;  2RG9 B;  1QQK A;  1HIB A;  2FDB M;  2NP0 A;  2VSE A;  3HN1 A;  3P6J A;  4DCK C;  3RTJ B;  3LTQ A;  3IM6 A;  4DEP A;  3WIN C;  2DRZ A;  2ERM A;  3FJE A;  4LO2 C;  3VT2 A;  3C9Z A;  3O4D A;  4L4I A;  3VWC A;  3K1X A;  2Z48 A;  4I4Q A;  4JQ0 A;  5BP5 C;  3BRD A;  2X2T A;  1FN0 A;  4ISQ A;  1AVU A;  3D7W B;  3VSF A;  5DSS B;  1M2T B;  2E4M A;  2HZ9 A;  3WMV A;  2LIQ A;  1AXM A;  1DLL A;  1HWM B;  1ISV A;  1TOO A;  3BA4 A;  1YF8 B;  4Q91 A;  4WBC A;  2NZ9 A;  1K5V A;  3BAO A;  4X3A A;  3FJF A;  5FNX A;  4JPZ A;  5BXS A;  4MZF B;  2YUG A;  1HWO B;  3ZX7 A;  4I3N A;  1JTC A;  4R6U B;  3HOM A;  5EG6 C;  1TFM B;  1JT5 A;  1V6U A;  3S8K A;  3FJA A;  2GZB A;  4LO1 A;  4D0T A;  4CJM A;  1D0H A;  3FJH A;  4DEN A;  4YOL A;  2FO1 A;  4Z9W B;  4GP0 A;  3QR5 A;  3BAV A;  3BRG C;  4PC4 A;  5F8W A;  4QBC A;  4ZGR B;  1OQL B;  2Y9F A;  4ZBV B;  3CA4 A;  4H04 A;  5JLV A;  1EV2 A;  4LO8 B;  3BAD A;  1EYL A;  4EEE B;  5DVH A;  4FVV A;  1ILR 1;  4I4V A;  4I4Y A;  1RZO B;  4A7Z A;  3LLP A;  2D24 A;  2Z49 A;  41BI A;  3F1R A;  2VU9 A;  1G9C A;  1BLA A;  5BXR A;  3AZV A;  4P0J A;  2L5X A;  4AN6 A;  1IRP A;  1TWM A;  4QC4 A;  1S0E A;  1YTO A;  2BFH A;  4OUJ A;  1BFG A;  1JT7 A;  3V0B A;  3P6I A;  1IJT A;  1PUU B;  2ZQN A;  3NJ5 A;  3FFZ A;  4IY9 A;  1WD4 A;  5G00 A;  3CRI A;  5F90 A;  2QN4 A;  4H75 A;  3IAG C;  4HJJ A;  1R8O A;  1SR4 C;  3A21 A;  3JUT A;  1II4 A;  3HSM A;  1NZK A;  4X39 A;  2KI6 B;  3CRG A;  1BAR A;  5FZU A;  1BLD A;  1G9A A;  5GAQ A;  4GP3 A;  5F8Y A;  1L2H A;  1Z4S A;  3BTA A;  1S0B A;  4LO3 A;  1FV2 A;  2HWA A;  1V6V A;  2ZQO A;  3AJ6 A;  3OJV A;  3V79 C;  4J23 B;  2FFV A;  4I37 A;  3CA3 A;  3I29 B;  2D43 A;  4Q9G A;  4JKX B;  5BQU A;  1MC9 A;  3N7L A;  3BAH A;  3CU1 B;  1JQZ A;  4I4R A;  4I4U A;  4LO3 C;  2VXR A;  3Q7Y A;  3SNV A;  3O44 A;  1GGP B;  3HMY A;  1IT0 A;  2MIB A;  4IZX A;  3MAL A;  2WRY A;  3KMV A;  4I4O A;  2Q3N B;  4L4H A;  5E24 E;  1DFQ A;  1F31 A;  1FQ9 A;  3O49 A;  5D63 A;  3IM7 A;  5BQU C;  1JLY A;  3HAL A;  1Z2V A;  4IYB A;  2ET2 A;  4EFR A;  3AH2 A;  1BFC A;  1IHK A;  1S0D A;  1Q04 A;  1PC8 B;  4G6J A;  3AKI A;  1FWU A;  3FJB A;  3NBD A;  4ISR A;  4EKX B;  1FGA A;  2FGF A;  2D7I A;  4G1R A;  1AFC A;  1QXM A;  3NBE A;  2WBC A;  1G82 A;  3FJC A;  5EC5 A;  4USO A;  1TTU A;  4KBB A;  5I1B A;  2ESU A;  3ZC9 A;  3H6S E;  4P0K A;  4TLP A;  4QO3 A;  3FJJ A;  1W3A A;  2E4M C;  1DQO A;  1YYN A;  1WBC A;  3IM5 A;  3FUQ A;  5B2H A;  3CAH A;  1BFF A;  1NUN A;  3BA7 A;  3O4C A;  1HKN A;  2UUS A;  1R8N A;  1I1B A;  2NTD A;  4MZG B;  3AKF A;  5D62 A;  1A8D A;  4JKQ A;  4II0 A;  2IHO A;  1CVS A;  3WA1 A;  3FUO A;  1TP0 A;  3MPP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...