1JQZA

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag.
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
b'HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords acidic fibroblast growth factor
publication title Structure and stability effects of mutations designed to increase the primary sequence symmetry within the core region of a beta-trefoil.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1jqzA00
1HWNB 1K5VA 1BLAA 4DEPA 3FGMA 2VLCA 1HCDA 4I4OA 4I7IA 2IWTB 1FQ9A 3V0BB 5JMCA 4IZXA 3ZC8A 3VSFA 1V6VA 3IM6A 4QKRA 3EF2A 3FJEA 3FJJA 4ZFYB 3AH4A 3MPPG 1BLDA 3FJDA 3WO2A 3T8SA 4A7ZA 4LO7B 1BFBA 3VUOA 1G9AA 2Q3NB 3BADA 1FN0A 4OWJA 4P6AA 4AN7B 2NTDA 2ZQNA 4JRAA 4QD2B 1W3FA 4I4RA 4Q9PA 3PG0A 1I1BA 3NBEA 3FUOA 2K8RA 4I96A 1AVUA 1S0EA 3FJHA 4HJJA 5EHAA 3UD9A 6I1BA 3AKGA 1HWOB 2ERMA 4A7YA 4A7KA 1DFCA 2LIEA 1DQGA 1BA7A 1DLLA 1JY0A 1AF9A 5FZZA 4GAIA 4I1EA 3W9TA 4H9WA 2VU9A 3AH2A 2Z48A 3S8KA 1WD4A 2P23A 2D43A 3R4UA 2FFVA 1V6UA 4I4PA 1TFMB 2Y9FA 2D22A 4J2SA 5BXPA 4FVVA 1ISXA 3BAHA 4ZLBB 3O3QA 1YF8B 4H04A 2ZR1B 4I4VA 2Y9XE 3O4CA 3VSZA 2QN4A 4QBVA 3OJMA 2QYIB 3OGGA 1Z0HA 4II0A 3AZWA 1JLYA 4J23B 1T4QA 3CRIA 3BAUA 3BAGA 1V6WA 3IM5A 3TC2A 1EPWA 1F31A 2IHOA 1IRAX 4IZEA 3VT0A 4EFQA 1ABRB 9ILBA 1DJSB 1D0HA 5F90A 3RTJB 5D61A 1RG8A 3N0KA 4G9NA 3IAGC 4G1RA 2ZQOA 3Q7XA 2K43A 1BFGA 5BP5C 2NP0A 2NZ9A 4I6IA 3O5WB 3FJFA 4J2XA 4IYBA 4OWKA 4XFSA 5BP5A 5EC5A 1IJTA 3I2AA 5FNWA 1JT4A 1G9DA 4LO8B 1SR4C 4JQ0A 2ET2A 4D8HA 1W3AA 5DUYA 1Q03A 3BA7A 2VXTI 1VCLA 1IHKA 2K4AB 4L4HA 1PUMB 2D23A 1TOOA 3PUBA 1WD3A 3P6JA 3Q7YA 4GP3A 4XKIA 4LO7C 3JRRA 4QO3A 1ITBA 3MALA 4I4SA 2KI6B 2I1BA 3LTQA 4X37A 4G6JA 3FJBA 1QQKA 2VSEA 4IY8A 4P0KA 1BASA 1SZ6B 2UUSA 4KEJA 3VEQA 3NBDA 3BRGC 1J0SA 2AAIB 4USOA 1NUNA 4Z8SB 2D1ZA 1BFCA 4L4IA 1JT5A 1DFQA 3IIRA 3R4SA 1TIEA 1FWVA 1FWUA 41BIA 4J2YA 3RMYA 1DZDA 1R8OA 3H6RA 4QALA 3CA5A 5BQUC 8I1BA 2X2SA 2GO2A 4AN6A 1YTOA 4DCKC 3B9UA 3P6IA 5BQUA 4Z9WB 5E24E 3CA3A 3O44A 4ISQA 2WRYA 1NZKA 3A22A 5D63A 2R9KB 1IRPA 2NVHA 1PZZA 1YXWA 3HALA 2MLLB 1M16A 3HMYA 2BEAA 2M49A 2L5XA 1II4A 3CRGA 5D62A 1Z2VA 2NM1A 1G82A 4LO3C 2AFGA 4I4QA 4IHZA 1I1EA 1Q04A 3C9ZA 4HR6C 4LO3A 1TP0A 3CA0A 4I1BA 2MC2A 1M2TB 4Q9GA 5F8WA 2VSAA 1FGAA 1BFFA 3KMVA 4GP0A 3VT1A 2FO1A 3O4OA 3RMXA 2BFHA 3F62B 2Q9XA 2D44A 3POKA 1HKNA 3N7JA 3FJ9A 1T9FA 1MD6A 3FFZA 1S0FA 3HSMA 31BIA 3F1RA 1JTCA 5EG6C 2HWMA 3H6SE 4EEEB 2RQ9A 3BB2A 4EKXB 1AFCA 3OJVA 1FMMS 2KLLA 4TLPA 1S0GA 1XYFA 4XFUA 4ZGRB 1ISYA 1E0OA 3ZX7A 2VXRA 5FNXA 1ISZA 3FJKA 4GOYA 2HW9A 3UJ0A 5DZUA 3AH1A 5F8YA 4KBBA 1HWPB 3BAQA 4KEKA 4OW4A 1RZOB 4QC4A 3P53A 2AQZA 2Z49A 4ZA3B 2D20A 4CJMA 4OEEA 3O49A 3V0AA 4X3AA 1S0CA 3RTIB 3K1XA 3FJ8A 1N4KA 4J2KA 1XG6A 5DSSB 4X39A 3FJCA 1S0DA 1G9CA 3BX1C 3WA1A 1MC9A 4G6MA 5B2HA 3BA4A 3H6QA 2KKIA 4QKSA 3HN1A 4JP0A 1BARA 1AVXB 1SR4A 1UPSA 3V0BA 3ILAA 4OEFA 3NJ5A 4R6UB 4ISRA 1Z4SA 3NBCA 3OBTA 5I1BA 4IONA 4D0TA 2FFUA 1EYLA 2RSTA 3A21A 2FDBM 4LO0C 2F2FC 3BA5A 4ENDA 3AKHA 3ZXDA 1A8DA 7I1BA 4LO0A 1ONKB 2DRZA 4JAWA 2F2FA 3AJ5A 4QD2C 1ISWA 1TWMA 1HWMB 1FV2A 21BIA 3ZXGA 1DIWA 2D7IA 3HOMA 3O4DA 4I4UA 3UD7A 1CVSA 3FJAA 3I2XA 3VT2A 3A23A 3ZC9A 3A07A 2HZ9A 3N7MA 3S8JA 4F83A 3PHZA 1ILR1 3CA4A 2DRYA 3WINC 1WBAA 2FGFA 1IILA 1TWEA 3CAHA 3WINA 4I37A 4I4XA 5BXRA 1WBCA 2WBCA 3I29B 3UJ4A 5FZUA 2VUAA 5FZYA 5BXTA 4I2SA 3O4BA 4IY9A 4USPA 1FV3A 1OQLB 3UDAA 1YBIA 4OEGA 3H6RB 4LO1C 3D7WB 3HBWA 4I4YA 1TTUA 1QQLA 3N7LA 3BAVA 3AJ6A 3FUQA 4GOVA 4LO1A 3WO3A 4HA2A 3VWCA 1JLXA 4XFTA 2Y9WC 5BXSA 1JT3A 1AVWB 2KH2A 1AVAC 5BVPI 3WO4A 2BEBA 1RMLA 4PC4A 1Q1UA 4LO2C 3WMUA 4KEIA 1V6XA 2LIQA 1RY7A 4EFRA 4JKQA 5DVHA 4F34A 4I8MA 4LO2A 2AXMA 1PC8B 4JKXB 3RSJA 5HPZA 4OWLA 3SNVA 1YYNA 1S0BA 4JPZA 1EV2A 3CQAA 1IOBA 4P0LA 3CRHA 1JQZA 2J3PA 3OJ2A 4ZKTB 2NYYA 3BRFA 4KC3A 3CA6A 1G9BA 3E8LC 2P39A 4EB2B 4EFPA 1L2HA 1W3GA 4ZFWB 1IT0A 4ZOTA 3FJIA 4X38A 2KI4A 1CE7B 3LLPA 3OGFA 1HCEA 3O4AA 3CU1B 3N7KA 3BRDA 1QXMA 3QYDA 2D24A 2GZBA 5G00A 4ZFUB 4OUJA 5F8SA 1XHBA 3V79C 1S0LA 4P0JA 4D0ZA 1KNMA 4DENA 2D7RA 1XZZA 3PMEA 3BAOA 1R8NA 4QBCA 4G9MA 4GAFA 1PWAA 2E4MC 3AKIA 2MIBA 3UD8A 4ZBVB 3CA1A 2ESUA 3QR5A 1DZCA 3BTAA 4WBCA 2E4MA 5JLVA 2XOAA 3WMVA 3NBNA 1PUUB 5BOWA 4I0YA 3IM7A 2F8XC 1K5UA 1AXMA 1GGPB 1DQOA 3V0AB 2Y9GA 1P63A 4FGFA 1EVTA 1HIBA 2DS0A 5GAQA 4Q91A 3AZVA 2YUGA 1JT7A 2X2TA 1FMZA 3JUTA 4I3NA 3AKFA 4YOLA 3OBRA 1ISVA 3Q7WA 4IQPA 2DREA 2HWAA 2RG9B
chains in the Genus database with same CATH superfamily
1HWNB 1K5VA 1BLAA 4DEPA 3FGMA 2VLCA 1HCDA 4I4OA 4I7IA 2IWTB 1FQ9A 3V0BB 5JMCA 4IZXA 4MZGB 3VSFA 3ZC8A 1V6VA 3IM6A 4QKRA 3EF2A 3FJEA 3FJJA 4ZFYB 3AH4A 3MPPG 1BLDA 3FJDA 3WO2A 3T8SA 4A7ZA 4LO7B 1BFBA 3VUOA 1G9AA 2Q3NB 3BADA 1FN0A 4OWJA 4P6AA 4AN7B 2NTDA 2ZQNA 4JRAA 4QD2B 1W3FA 4I4RA 4Q9PA 3PG0A 1I1BA 3NBEA 3FUOA 2K8RA 4I96A 1AVUA 1S0EA 3FJHA 4HJJA 5EHAA 3UD9A 6I1BA 3AKGA 1HWOB 2ERMA 4A7YA 4A7KA 1DFCA 2LIEA 1DQGA 1BA7A 1DLLA 1JY0A 1AF9A 5FZZA 4GAIA 4I1EA 3W9TA 4H9WA 2VU9A 3AH2A 2Z48A 3S8KA 1WD4A 2P23A 2D43A 3R4UA 2FFVA 1V6UA 4I4PA 1TFMB 2Y9FA 2D22A 4J2SA 5BXPA 4FVVA 1ISXA 3BAHA 4ZLBB 3O3QA 1YF8B 4H04A 2ZR1B 4I4VA 2Y9XE 3O4CA 3VSZA 2QN4A 4QBVA 3OJMA 2QYIB 3OGGA 1Z0HA 4II0A 3AZWA 1JLYA 4J23B 1T4QA 3CRIA 3BAUA 3BAGA 1V6WA 3IM5A 3TC2A 1EPWA 1F31A 2IHOA 1IRAX 4IZEA 3VT0A 4EFQA 1ABRB 9ILBA 1DJSB 1D0HA 5F90A 3RTJB 5D61A 1RG8A 3N0KA 4G9NA 3IAGC 4G1RA 2ZQOA 3Q7XA 2K43A 1BFGA 5BP5C 2NP0A 2NZ9A 4I6IA 3O5WB 3FJFA 4J2XA 4IYBA 4OWKA 4XFSA 5BP5A 5EC5A 1IJTA 3I2AA 5FNWA 1JT4A 1G9DA 4LO8B 1SR4C 4JQ0A 2ET2A 4D8HA 1W3AA 5DUYA 1Q03A 3BA7A 2VXTI 1VCLA 1IHKA 2K4AB 4L4HA 1PUMB 2D23A 1TOOA 3PUBA 1WD3A 3P6JA 3Q7YA 4GP3A 4XKIA 4LO7C 3JRRA 4QO3A 1ITBA 2NS2A 3MALA 4I4SA 2KI6B 2I1BA 3LTQA 4X37A 4G6JA 3FJBA 1QQKA 2VSEA 4IY8A 4P0KA 1BASA 1SZ6B 2UUSA 4KEJA 3VEQA 3NBDA 3BRGC 1J0SA 2AAIB 4USOA 1NUNA 4Z8SB 2D1ZA 1BFCA 4L4IA 1JT5A 1DFQA 3IIRA 3R4SA 1TIEA 1FWVA 1FWUA 41BIA 4J2YA 3RMYA 1DZDA 1R8OA 4MZFB 3H6RA 4QALA 3CA5A 5BQUC 8I1BA 2X2SA 2GO2A 4AN6A 1YTOA 4DCKC 3B9UA 3P6IA 5BQUA 4Z9WB 5E24E 3CA3A 3O44A 4ISQA 2WRYA 1NZKA 3A22A 5D63A 2R9KB 1IRPA 2NVHA 1PZZA 1YXWA 3HALA 2MLLB 1M16A 3HMYA 2BEAA 2M49A 2L5XA 1II4A 3CRGA 5D62A 1Z2VA 2NM1A 1G82A 4LO3C 2AFGA 4I4QA 4IHZA 1I1EA 1Q04A 3C9ZA 4HR6C 4LO3A 1TP0A 3CA0A 4I1BA 2MC2A 1M2TB 4Q9GA 5F8WA 2VSAA 1FGAA 1BFFA 3KMVA 4GP0A 3VT1A 2FO1A 3O4OA 3RMXA 2BFHA 3F62B 2Q9XA 2D44A 3POKA 1HKNA 3N7JA 3FJ9A 1T9FA 1MD6A 3FFZA 1S0FA 3HSMA 31BIA 3F1RA 1JTCA 5EG6C 2HWMA 3H6SE 4EEEB 2RQ9A 3BB2A 4EKXB 1AFCA 3OJVA 1FMMS 2KLLA 4TLPA 1S0GA 1XYFA 4XFUA 4ZGRB 1ISYA 1E0OA 3ZX7A 2VXRA 5FNXA 1ISZA 3FJKA 4GOYA 2HW9A 3UJ0A 5DZUA 3AH1A 5F8YA 4KBBA 1HWPB 3BAQA 4KEKA 4OW4A 1RZOB 4QC4A 3P53A 2AQZA 2Z49A 4ZA3B 2D20A 4CJMA 4OEEA 3O49A 3V0AA 4X3AA 1S0CA 3RTIB 3K1XA 3FJ8A 1N4KA 4J2KA 1XG6A 5DSSB 4X39A 3FJCA 1S0DA 1G9CA 3BX1C 3WA1A 1MC9A 4G6MA 5B2HA 3BA4A 3H6QA 2KKIA 4QKSA 3HN1A 4JP0A 1BARA 1AVXB 1SR4A 1UPSA 3V0BA 3ILAA 4OEFA 3NJ5A 4R6UB 4ISRA 1Z4SA 3NBCA 3OBTA 5I1BA 4IONA 4D0TA 2FFUA 1EYLA 2RSTA 3A21A 2FDBM 4LO0C 2F2FC 3BA5A 4ENDA 3AKHA 3ZXDA 1A8DA 7I1BA 4LO0A 1ONKB 2DRZA 4JAWA 2F2FA 3AJ5A 4QD2C 1ISWA 1TWMA 1HWMB 1FV2A 21BIA 3ZXGA 1DIWA 2D7IA 3HOMA 3O4DA 4I4UA 3UD7A 1CVSA 3FJAA 3I2XA 3VT2A 3A23A 3ZC9A 3A07A 2HZ9A 3N7MA 3S8JA 4F83A 3PHZA 1ILR1 3CA4A 2DRYA 3WINC 1WBAA 2FGFA 1IILA 1TWEA 3CAHA 3WINA 4I37A 4I4XA 5BXRA 1WBCA 2WBCA 3I29B 3UJ4A 5FZUA 2VUAA 5FZYA 5BXTA 4I2SA 3O4BA 4IY9A 4USPA 1FV3A 4MZHA 1OQLB 3UDAA 1YBIA 4OEGA 3H6RB 4LO1C 3D7WB 3HBWA 4I4YA 1TTUA 1QQLA 3N7LA 3BAVA 3AJ6A 3FUQA 4GOVA 4LO1A 3WO3A 4HA2A 3VWCA 1JLXA 4XFTA 2Y9WC 5BXSA 1JT3A 1AVWB 2KH2A 1AVAC 5BVPI 3WO4A 2BEBA 1RMLA 4PC4A 1Q1UA 4LO2C 3WMUA 4KEIA 1V6XA 2LIQA 1RY7A 4EFRA 4JKQA 5DVHA 4F34A 4I8MA 4LO2A 2AXMA 1PC8B 4JKXB 3RSJA 5HPZA 4OWLA 3SNVA 1YYNA 1S0BA 4JPZA 1EV2A 3CQAA 1IOBA 4P0LA 3CRHA 1JQZA 2J3PA 3OJ2A 4ZKTB 2NYYA 3BRFA 4KC3A 3CA6A 1G9BA 3E8LC 2P39A 4H75A 4EB2B 1L2HA 1W3GA 4EFPA 4ZFWB 1IT0A 4ZOTA 3FJIA 4X38A 2KI4A 1CE7B 3LLPA 3OGFA 1HCEA 3O4AA 3CU1B 3N7KA 3BRDA 1QXMA 3QYDA 2D24A 2GZBA 5G00A 4ZFUB 4OUJA 5F8SA 1XHBA 3V79C 1S0LA 4P0JA 4D0ZA 1KNMA 4DENA 2D7RA 1XZZA 3PMEA 3BAOA 1R8NA 4QBCA 4G9MA 4GAFA 1PWAA 2E4MC 3AKIA 2MIBA 3UD8A 4ZBVB 3CA1A 2ESUA 3QR5A 1DZCA 3BTAA 4WBCA 2E4MA 5JLVA 2XOAA 3WMVA 3NBNA 1PUUB 5BOWA 4I0YA 3IM7A 2F8XC 1K5UA 1AXMA 1GGPB 1DQOA 3V0AB 4UY4A 2Y9GA 1P63A 4FGFA 1EVTA 1HIBA 2DS0A 5GAQA 4Q91A 3AZVA 2YUGA 1JT7A 2X2TA 1FMZA 3JUTA 4I3NA 3AKFA 4YOLA 3OBRA 1ISVA 3Q7WA 4IQPA 2DREA 2HWAA 2RG9B
chains in the Genus database with same CATH topology
1HWNB 1K5VA 1BLAA 4DEPA 3FGMA 2VLCA 1HCDA 4I4OA 4I7IA 2IWTB 1FQ9A 3V0BB 5JMCA 4IZXA 4MZGB 3VSFA 3ZC8A 1V6VA 3IM6A 4QKRA 3EF2A 3FJEA 3FJJA 4ZFYB 3AH4A 3MPPG 1BLDA 3FJDA 3WO2A 3T8SA 4A7ZA 4LO7B 1BFBA 3VUOA 1G9AA 2Q3NB 3BADA 1FN0A 4OWJA 4P6AA 4AN7B 2NTDA 2ZQNA 4JRAA 4QD2B 1W3FA 4I4RA 4Q9PA 3PG0A 1I1BA 3NBEA 3FUOA 2K8RA 4I96A 1AVUA 1S0EA 3FJHA 4HJJA 5EHAA 3UD9A 6I1BA 3AKGA 1HWOB 2ERMA 4A7YA 4A7KA 1DFCA 2LIEA 1DQGA 1BA7A 1DLLA 1JY0A 1AF9A 5FZZA 4GAIA 4I1EA 3W9TA 4H9WA 2VU9A 3AH2A 2Z48A 3S8KA 1WD4A 2P23A 2D43A 3R4UA 2FFVA 1V6UA 4I4PA 1TFMB 2Y9FA 2D22A 4J2SA 5BXPA 4FVVA 1ISXA 3BAHA 4ZLBB 3O3QA 1YF8B 4H04A 2ZR1B 4I4VA 2Y9XE 3O4CA 3VSZA 2QN4A 4QBVA 3OJMA 2QYIB 3OGGA 1Z0HA 4II0A 3AZWA 1JLYA 4J23B 1T4QA 3CRIA 3BAUA 3BAGA 1V6WA 3IM5A 3TC2A 1EPWA 1F31A 2IHOA 1IRAX 4IZEA 3VT0A 4EFQA 1ABRB 9ILBA 1DJSB 1D0HA 5F90A 3RTJB 5D61A 1RG8A 3N0KA 4G9NA 3IAGC 4G1RA 2ZQOA 3Q7XA 2K43A 1BFGA 5BP5C 2NP0A 2NZ9A 4I6IA 3O5WB 3FJFA 4J2XA 4IYBA 4OWKA 4XFSA 5BP5A 5EC5A 1IJTA 3I2AA 5FNWA 1JT4A 1G9DA 4LO8B 1SR4C 4JQ0A 2ET2A 4D8HA 1W3AA 5DUYA 1Q03A 3BA7A 2VXTI 1VCLA 1IHKA 2K4AB 4L4HA 1PUMB 2D23A 1TOOA 3PUBA 1WD3A 3P6JA 3Q7YA 4GP3A 4XKIA 4LO7C 3JRRA 4QO3A 1ITBA 2NS2A 3MALA 4I4SA 2KI6B 2I1BA 3LTQA 4X37A 4G6JA 3FJBA 1QQKA 2VSEA 4IY8A 4P0KA 1BASA 1SZ6B 2UUSA 4KEJA 3VEQA 3NBDA 3BRGC 1J0SA 2AAIB 4USOA 1NUNA 4Z8SB 2D1ZA 1BFCA 4L4IA 1JT5A 1DFQA 3IIRA 3R4SA 1TIEA 1FWVA 1FWUA 41BIA 4J2YA 3RMYA 1DZDA 1R8OA 4MZFB 3H6RA 4QALA 3CA5A 5BQUC 8I1BA 2X2SA 2GO2A 4AN6A 1YTOA 4DCKC 3B9UA 3P6IA 5BQUA 4Z9WB 5E24E 3CA3A 3O44A 4ISQA 2WRYA 1NZKA 3A22A 5D63A 2R9KB 1IRPA 2NVHA 1PZZA 1YXWA 3HALA 2MLLB 1M16A 3HMYA 2BEAA 2M49A 2L5XA 1II4A 3CRGA 5D62A 1Z2VA 2NM1A 1G82A 4LO3C 2AFGA 4I4QA 4IHZA 1I1EA 1Q04A 3C9ZA 4HR6C 4LO3A 1TP0A 3CA0A 4I1BA 2MC2A 1M2TB 4Q9GA 5F8WA 2VSAA 1FGAA 1BFFA 3KMVA 4GP0A 3VT1A 2FO1A 3O4OA 3RMXA 2BFHA 3F62B 2Q9XA 2D44A 3POKA 1HKNA 3N7JA 3FJ9A 1T9FA 1MD6A 3FFZA 1S0FA 3HSMA 31BIA 3F1RA 1JTCA 5EG6C 2HWMA 3H6SE 4EEEB 2RQ9A 3BB2A 4EKXB 1AFCA 3OJVA 1FMMS 2KLLA 4TLPA 1S0GA 1XYFA 4XFUA 4ZGRB 1ISYA 1E0OA 3ZX7A 2VXRA 5FNXA 1ISZA 3FJKA 4GOYA 2HW9A 3UJ0A 5DZUA 3AH1A 5F8YA 4KBBA 1HWPB 3BAQA 4KEKA 4OW4A 1RZOB 4QC4A 3P53A 2AQZA 2Z49A 4ZA3B 2D20A 4CJMA 4OEEA 3O49A 3V0AA 4X3AA 1S0CA 3RTIB 3K1XA 3FJ8A 1N4KA 4J2KA 1XG6A 5DSSB 4X39A 3FJCA 1S0DA 1G9CA 3BX1C 3WA1A 1MC9A 4G6MA 5B2HA 3BA4A 3H6QA 2KKIA 4QKSA 3HN1A 4JP0A 1BARA 1AVXB 1SR4A 1UPSA 3V0BA 3ILAA 4OEFA 3NJ5A 4R6UB 4ISRA 1Z4SA 3NBCA 3OBTA 5I1BA 4IONA 4D0TA 2FFUA 1EYLA 2RSTA 3A21A 2FDBM 4LO0C 2F2FC 3BA5A 4ENDA 3AKHA 3ZXDA 1A8DA 7I1BA 4LO0A 1ONKB 2DRZA 4JAWA 2F2FA 3AJ5A 4QD2C 1ISWA 1TWMA 1HWMB 1FV2A 21BIA 3ZXGA 1DIWA 2D7IA 3HOMA 3O4DA 4I4UA 3UD7A 1CVSA 3FJAA 3I2XA 3VT2A 3A23A 3ZC9A 3A07A 2HZ9A 3N7MA 3S8JA 4F83A 3PHZA 1ILR1 3CA4A 2DRYA 3WINC 1WBAA 2FGFA 1IILA 1TWEA 3CAHA 3WINA 4I37A 4I4XA 5BXRA 1WBCA 2WBCA 3I29B 3UJ4A 5FZUA 2VUAA 5FZYA 5BXTA 4I2SA 3O4BA 4IY9A 4USPA 1FV3A 4MZHA 1OQLB 3UDAA 1YBIA 4OEGA 3H6RB 4LO1C 3D7WB 3HBWA 4I4YA 1TTUA 1QQLA 3N7LA 3BAVA 3AJ6A 3FUQA 4GOVA 4LO1A 3WO3A 4HA2A 3VWCA 1JLXA 4XFTA 2Y9WC 5BXSA 1JT3A 1AVWB 2KH2A 1AVAC 5BVPI 3WO4A 2BEBA 1RMLA 4PC4A 1Q1UA 4LO2C 3WMUA 4KEIA 1V6XA 2LIQA 1RY7A 4EFRA 4JKQA 5DVHA 4F34A 4I8MA 4LO2A 2AXMA 1PC8B 4JKXB 3RSJA 5HPZA 4OWLA 3SNVA 1YYNA 1S0BA 4JPZA 1EV2A 3CQAA 1IOBA 4P0LA 3CRHA 1JQZA 2J3PA 3OJ2A 4ZKTB 2NYYA 3BRFA 4KC3A 3CA6A 1G9BA 3E8LC 2P39A 4H75A 4EB2B 1L2HA 1W3GA 4EFPA 4ZFWB 1IT0A 4ZOTA 3FJIA 4X38A 2KI4A 1CE7B 3LLPA 3OGFA 1HCEA 3O4AA 3CU1B 3N7KA 3BRDA 1QXMA 3QYDA 2D24A 2GZBA 5G00A 4ZFUB 4OUJA 5F8SA 1XHBA 3V79C 1S0LA 4P0JA 4D0ZA 1KNMA 4DENA 2D7RA 1XZZA 3PMEA 3BAOA 1R8NA 4QBCA 4G9MA 4GAFA 1PWAA 2E4MC 3AKIA 2MIBA 3UD8A 4ZBVB 3CA1A 2ESUA 3QR5A 1DZCA 3BTAA 4WBCA 2E4MA 5JLVA 2XOAA 3WMVA 3NBNA 1PUUB 5BOWA 4I0YA 3IM7A 2F8XC 1K5UA 1AXMA 1GGPB 1DQOA 3V0AB 4UY4A 2Y9GA 1P63A 4FGFA 1EVTA 1HIBA 2DS0A 5GAQA 4Q91A 3AZVA 2YUGA 1JT7A 2X2TA 1FMZA 3JUTA 4I3NA 3AKFA 4YOLA 3OBRA 1ISVA 3Q7WA 4IQPA 2DREA 2HWAA 2RG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HWN B;  1K5V A;  1BLA A;  4DEP A;  3FGM A;  2VLC A;  1HCD A;  4I4O A;  4I7I A;  2IWT B;  1FQ9 A;  3V0B B;  5JMC A;  4IZX A;  3ZC8 A;  3VSF A;  1V6V A;  3IM6 A;  4QKR A;  3EF2 A;  3FJE A;  3FJJ A;  4ZFY B;  3AH4 A;  3MPP G;  1BLD A;  3FJD A;  3WO2 A;  3T8S A;  4A7Z A;  4LO7 B;  1BFB A;  3VUO A;  1G9A A;  2Q3N B;  3BAD A;  1FN0 A;  4OWJ A;  4P6A A;  4AN7 B;  2NTD A;  2ZQN A;  4JRA A;  4QD2 B;  1W3F A;  4I4R A;  4Q9P A;  3PG0 A;  1I1B A;  3NBE A;  3FUO A;  2K8R A;  4I96 A;  1AVU A;  1S0E A;  3FJH A;  4HJJ A;  5EHA A;  3UD9 A;  6I1B A;  3AKG A;  1HWO B;  2ERM A;  4A7Y A;  4A7K A;  1DFC A;  2LIE A;  1DQG A;  1BA7 A;  1DLL A;  1JY0 A;  1AF9 A;  5FZZ A;  4GAI A;  4I1E A;  3W9T A;  4H9W A;  2VU9 A;  3AH2 A;  2Z48 A;  3S8K A;  1WD4 A;  2P23 A;  2D43 A;  3R4U A;  2FFV A;  1V6U A;  4I4P A;  1TFM B;  2Y9F A;  2D22 A;  4J2S A;  5BXP A;  4FVV A;  1ISX A;  3BAH A;  4ZLB B;  3O3Q A;  1YF8 B;  4H04 A;  2ZR1 B;  4I4V A;  2Y9X E;  3O4C A;  3VSZ A;  2QN4 A;  4QBV A;  3OJM A;  2QYI B;  3OGG A;  1Z0H A;  4II0 A;  3AZW A;  1JLY A;  4J23 B;  1T4Q A;  3CRI A;  3BAU A;  3BAG A;  1V6W A;  3IM5 A;  3TC2 A;  1EPW A;  1F31 A;  2IHO A;  1IRA X;  4IZE A;  3VT0 A;  4EFQ A;  1ABR B;  9ILB A;  1DJS B;  1D0H A;  5F90 A;  3RTJ B;  5D61 A;  1RG8 A;  3N0K A;  4G9N A;  3IAG C;  4G1R A;  2ZQO A;  3Q7X A;  2K43 A;  1BFG A;  5BP5 C;  2NP0 A;  2NZ9 A;  4I6I A;  3O5W B;  3FJF A;  4J2X A;  4IYB A;  4OWK A;  4XFS A;  5BP5 A;  5EC5 A;  1IJT A;  3I2A A;  5FNW A;  1JT4 A;  1G9D A;  4LO8 B;  1SR4 C;  4JQ0 A;  2ET2 A;  4D8H A;  1W3A A;  5DUY A;  1Q03 A;  3BA7 A;  2VXT I;  1VCL A;  1IHK A;  2K4A B;  4L4H A;  1PUM B;  2D23 A;  1TOO A;  3PUB A;  1WD3 A;  3P6J A;  3Q7Y A;  4GP3 A;  4XKI A;  4LO7 C;  3JRR A;  4QO3 A;  1ITB A;  3MAL A;  4I4S A;  2KI6 B;  2I1B A;  3LTQ A;  4X37 A;  4G6J A;  3FJB A;  1QQK A;  2VSE A;  4IY8 A;  4P0K A;  1BAS A;  1SZ6 B;  2UUS A;  4KEJ A;  3VEQ A;  3NBD A;  3BRG C;  1J0S A;  2AAI B;  4USO A;  1NUN A;  4Z8S B;  2D1Z A;  1BFC A;  4L4I A;  1JT5 A;  1DFQ A;  3IIR A;  3R4S A;  1TIE A;  1FWV A;  1FWU A;  41BI A;  4J2Y A;  3RMY A;  1DZD A;  1R8O A;  3H6R A;  4QAL A;  3CA5 A;  5BQU C;  8I1B A;  2X2S A;  2GO2 A;  4AN6 A;  1YTO A;  4DCK C;  3B9U A;  3P6I A;  5BQU A;  4Z9W B;  5E24 E;  3CA3 A;  3O44 A;  4ISQ A;  2WRY A;  1NZK A;  3A22 A;  5D63 A;  2R9K B;  1IRP A;  2NVH A;  1PZZ A;  1YXW A;  3HAL A;  2MLL B;  1M16 A;  3HMY A;  2BEA A;  2M49 A;  2L5X A;  1II4 A;  3CRG A;  5D62 A;  1Z2V A;  2NM1 A;  1G82 A;  4LO3 C;  2AFG A;  4I4Q A;  4IHZ A;  1I1E A;  1Q04 A;  3C9Z A;  4HR6 C;  4LO3 A;  1TP0 A;  3CA0 A;  4I1B A;  2MC2 A;  1M2T B;  4Q9G A;  5F8W A;  2VSA A;  1FGA A;  1BFF A;  3KMV A;  4GP0 A;  3VT1 A;  2FO1 A;  3O4O A;  3RMX A;  2BFH A;  3F62 B;  2Q9X A;  2D44 A;  3POK A;  1HKN A;  3N7J A;  3FJ9 A;  1T9F A;  1MD6 A;  3FFZ A;  1S0F A;  3HSM A;  31BI A;  3F1R A;  1JTC A;  5EG6 C;  2HWM A;  3H6S E;  4EEE B;  2RQ9 A;  3BB2 A;  4EKX B;  1AFC A;  3OJV A;  1FMM S;  2KLL A;  4TLP A;  1S0G A;  1XYF A;  4XFU A;  4ZGR B;  1ISY A;  1E0O A;  3ZX7 A;  2VXR A;  5FNX A;  1ISZ A;  3FJK A;  4GOY A;  2HW9 A;  3UJ0 A;  5DZU A;  3AH1 A;  5F8Y A;  4KBB A;  1HWP B;  3BAQ A;  4KEK A;  4OW4 A;  1RZO B;  4QC4 A;  3P53 A;  2AQZ A;  2Z49 A;  4ZA3 B;  2D20 A;  4CJM A;  4OEE A;  3O49 A;  3V0A A;  4X3A A;  1S0C A;  3RTI B;  3K1X A;  3FJ8 A;  1N4K A;  4J2K A;  1XG6 A;  5DSS B;  4X39 A;  3FJC A;  1S0D A;  1G9C A;  3BX1 C;  3WA1 A;  1MC9 A;  4G6M A;  5B2H A;  3BA4 A;  3H6Q A;  2KKI A;  4QKS A;  3HN1 A;  4JP0 A;  1BAR A;  1AVX B;  1SR4 A;  1UPS A;  3V0B A;  3ILA A;  4OEF A;  3NJ5 A;  4R6U B;  4ISR A;  1Z4S A;  3NBC A;  3OBT A;  5I1B A;  4ION A;  4D0T A;  2FFU A;  1EYL A;  2RST A;  3A21 A;  2FDB M;  4LO0 C;  2F2F C;  3BA5 A;  4END A;  3AKH A;  3ZXD A;  1A8D A;  7I1B A;  4LO0 A;  1ONK B;  2DRZ A;  4JAW A;  2F2F A;  3AJ5 A;  4QD2 C;  1ISW A;  1TWM A;  1HWM B;  1FV2 A;  21BI A;  3ZXG A;  1DIW A;  2D7I A;  3HOM A;  3O4D A;  4I4U A;  3UD7 A;  1CVS A;  3FJA A;  3I2X A;  3VT2 A;  3A23 A;  3ZC9 A;  3A07 A;  2HZ9 A;  3N7M A;  3S8J A;  4F83 A;  3PHZ A;  1ILR 1;  3CA4 A;  2DRY A;  3WIN C;  1WBA A;  2FGF A;  1IIL A;  1TWE A;  3CAH A;  3WIN A;  4I37 A;  4I4X A;  5BXR A;  1WBC A;  2WBC A;  3I29 B;  3UJ4 A;  5FZU A;  2VUA A;  5FZY A;  5BXT A;  4I2S A;  3O4B A;  4IY9 A;  4USP A;  1FV3 A;  1OQL B;  3UDA A;  1YBI A;  4OEG A;  3H6R B;  4LO1 C;  3D7W B;  3HBW A;  4I4Y A;  1TTU A;  1QQL A;  3N7L A;  3BAV A;  3AJ6 A;  3FUQ A;  4GOV A;  4LO1 A;  3WO3 A;  4HA2 A;  3VWC A;  1JLX A;  4XFT A;  2Y9W C;  5BXS A;  1JT3 A;  1AVW B;  2KH2 A;  1AVA C;  5BVP I;  3WO4 A;  2BEB A;  1RML A;  4PC4 A;  1Q1U A;  4LO2 C;  3WMU A;  4KEI A;  1V6X A;  2LIQ A;  1RY7 A;  4EFR A;  4JKQ A;  5DVH A;  4F34 A;  4I8M A;  4LO2 A;  2AXM A;  1PC8 B;  4JKX B;  3RSJ A;  5HPZ A;  4OWL A;  3SNV A;  1YYN A;  1S0B A;  4JPZ A;  1EV2 A;  3CQA A;  1IOB A;  4P0L A;  3CRH A;  1JQZ A;  2J3P A;  3OJ2 A;  4ZKT B;  2NYY A;  3BRF A;  4KC3 A;  3CA6 A;  1G9B A;  3E8L C;  2P39 A;  4EB2 B;  4EFP A;  1L2H A;  1W3G A;  4ZFW B;  1IT0 A;  4ZOT A;  3FJI A;  4X38 A;  2KI4 A;  1CE7 B;  3LLP A;  3OGF A;  1HCE A;  3O4A A;  3CU1 B;  3N7K A;  3BRD A;  1QXM A;  3QYD A;  2D24 A;  2GZB A;  5G00 A;  4ZFU B;  4OUJ A;  5F8S A;  1XHB A;  3V79 C;  1S0L A;  4P0J A;  4D0Z A;  1KNM A;  4DEN A;  2D7R A;  1XZZ A;  3PME A;  3BAO A;  1R8N A;  4QBC A;  4G9M A;  4GAF A;  1PWA A;  2E4M C;  3AKI A;  2MIB A;  3UD8 A;  4ZBV B;  3CA1 A;  2ESU A;  3QR5 A;  1DZC A;  3BTA A;  4WBC A;  2E4M A;  5JLV A;  2XOA A;  3WMV A;  3NBN A;  1PUU B;  5BOW A;  4I0Y A;  3IM7 A;  2F8X C;  1K5U A;  1AXM A;  1GGP B;  1DQO A;  3V0A B;  2Y9G A;  1P63 A;  4FGF A;  1EVT A;  1HIB A;  2DS0 A;  5GAQ A;  4Q91 A;  3AZV A;  2YUG A;  1JT7 A;  2X2T A;  1FMZ A;  3JUT A;  4I3N A;  3AKF A;  4YOL A;  3OBR A;  1ISV A;  3Q7W A;  4IQP A;  2DRE A;  2HWA A;  2RG9 B; 
#chains in the Genus database with same CATH topology
 1HWN B;  1K5V A;  1BLA A;  4DEP A;  3FGM A;  2VLC A;  1HCD A;  4I4O A;  4I7I A;  2IWT B;  1FQ9 A;  3V0B B;  5JMC A;  4IZX A;  4MZG B;  3VSF A;  3ZC8 A;  1V6V A;  3IM6 A;  4QKR A;  3EF2 A;  3FJE A;  3FJJ A;  4ZFY B;  3AH4 A;  3MPP G;  1BLD A;  3FJD A;  3WO2 A;  3T8S A;  4A7Z A;  4LO7 B;  1BFB A;  3VUO A;  1G9A A;  2Q3N B;  3BAD A;  1FN0 A;  4OWJ A;  4P6A A;  4AN7 B;  2NTD A;  2ZQN A;  4JRA A;  4QD2 B;  1W3F A;  4I4R A;  4Q9P A;  3PG0 A;  1I1B A;  3NBE A;  3FUO A;  2K8R A;  4I96 A;  1AVU A;  1S0E A;  3FJH A;  4HJJ A;  5EHA A;  3UD9 A;  6I1B A;  3AKG A;  1HWO B;  2ERM A;  4A7Y A;  4A7K A;  1DFC A;  2LIE A;  1DQG A;  1BA7 A;  1DLL A;  1JY0 A;  1AF9 A;  5FZZ A;  4GAI A;  4I1E A;  3W9T A;  4H9W A;  2VU9 A;  3AH2 A;  2Z48 A;  3S8K A;  1WD4 A;  2P23 A;  2D43 A;  3R4U A;  2FFV A;  1V6U A;  4I4P A;  1TFM B;  2Y9F A;  2D22 A;  4J2S A;  5BXP A;  4FVV A;  1ISX A;  3BAH A;  4ZLB B;  3O3Q A;  1YF8 B;  4H04 A;  2ZR1 B;  4I4V A;  2Y9X E;  3O4C A;  3VSZ A;  2QN4 A;  4QBV A;  3OJM A;  2QYI B;  3OGG A;  1Z0H A;  4II0 A;  3AZW A;  1JLY A;  4J23 B;  1T4Q A;  3CRI A;  3BAU A;  3BAG A;  1V6W A;  3IM5 A;  3TC2 A;  1EPW A;  1F31 A;  2IHO A;  1IRA X;  4IZE A;  3VT0 A;  4EFQ A;  1ABR B;  9ILB A;  1DJS B;  1D0H A;  5F90 A;  3RTJ B;  5D61 A;  1RG8 A;  3N0K A;  4G9N A;  3IAG C;  4G1R A;  2ZQO A;  3Q7X A;  2K43 A;  1BFG A;  5BP5 C;  2NP0 A;  2NZ9 A;  4I6I A;  3O5W B;  3FJF A;  4J2X A;  4IYB A;  4OWK A;  4XFS A;  5BP5 A;  5EC5 A;  1IJT A;  3I2A A;  5FNW A;  1JT4 A;  1G9D A;  4LO8 B;  1SR4 C;  4JQ0 A;  2ET2 A;  4D8H A;  1W3A A;  5DUY A;  1Q03 A;  3BA7 A;  2VXT I;  1VCL A;  1IHK A;  2K4A B;  4L4H A;  1PUM B;  2D23 A;  1TOO A;  3PUB A;  1WD3 A;  3P6J A;  3Q7Y A;  4GP3 A;  4XKI A;  4LO7 C;  3JRR A;  4QO3 A;  1ITB A;  2NS2 A;  3MAL A;  4I4S A;  2KI6 B;  2I1B A;  3LTQ A;  4X37 A;  4G6J A;  3FJB A;  1QQK A;  2VSE A;  4IY8 A;  4P0K A;  1BAS A;  1SZ6 B;  2UUS A;  4KEJ A;  3VEQ A;  3NBD A;  3BRG C;  1J0S A;  2AAI B;  4USO A;  1NUN A;  4Z8S B;  2D1Z A;  1BFC A;  4L4I A;  1JT5 A;  1DFQ A;  3IIR A;  3R4S A;  1TIE A;  1FWV A;  1FWU A;  41BI A;  4J2Y A;  3RMY A;  1DZD A;  1R8O A;  4MZF B;  3H6R A;  4QAL A;  3CA5 A;  5BQU C;  8I1B A;  2X2S A;  2GO2 A;  4AN6 A;  1YTO A;  4DCK C;  3B9U A;  3P6I A;  5BQU A;  4Z9W B;  5E24 E;  3CA3 A;  3O44 A;  4ISQ A;  2WRY A;  1NZK A;  3A22 A;  5D63 A;  2R9K B;  1IRP A;  2NVH A;  1PZZ A;  1YXW A;  3HAL A;  2MLL B;  1M16 A;  3HMY A;  2BEA A;  2M49 A;  2L5X A;  1II4 A;  3CRG A;  5D62 A;  1Z2V A;  2NM1 A;  1G82 A;  4LO3 C;  2AFG A;  4I4Q A;  4IHZ A;  1I1E A;  1Q04 A;  3C9Z A;  4HR6 C;  4LO3 A;  1TP0 A;  3CA0 A;  4I1B A;  2MC2 A;  1M2T B;  4Q9G A;  5F8W A;  2VSA A;  1FGA A;  1BFF A;  3KMV A;  4GP0 A;  3VT1 A;  2FO1 A;  3O4O A;  3RMX A;  2BFH A;  3F62 B;  2Q9X A;  2D44 A;  3POK A;  1HKN A;  3N7J A;  3FJ9 A;  1T9F A;  1MD6 A;  3FFZ A;  1S0F A;  3HSM A;  31BI A;  3F1R A;  1JTC A;  5EG6 C;  2HWM A;  3H6S E;  4EEE B;  2RQ9 A;  3BB2 A;  4EKX B;  1AFC A;  3OJV A;  1FMM S;  2KLL A;  4TLP A;  1S0G A;  1XYF A;  4XFU A;  4ZGR B;  1ISY A;  1E0O A;  3ZX7 A;  2VXR A;  5FNX A;  1ISZ A;  3FJK A;  4GOY A;  2HW9 A;  3UJ0 A;  5DZU A;  3AH1 A;  5F8Y A;  4KBB A;  1HWP B;  3BAQ A;  4KEK A;  4OW4 A;  1RZO B;  4QC4 A;  3P53 A;  2AQZ A;  2Z49 A;  4ZA3 B;  2D20 A;  4CJM A;  4OEE A;  3O49 A;  3V0A A;  4X3A A;  1S0C A;  3RTI B;  3K1X A;  3FJ8 A;  1N4K A;  4J2K A;  1XG6 A;  5DSS B;  4X39 A;  3FJC A;  1S0D A;  1G9C A;  3BX1 C;  3WA1 A;  1MC9 A;  4G6M A;  5B2H A;  3BA4 A;  3H6Q A;  2KKI A;  4QKS A;  3HN1 A;  4JP0 A;  1BAR A;  1AVX B;  1SR4 A;  1UPS A;  3V0B A;  3ILA A;  4OEF A;  3NJ5 A;  4R6U B;  4ISR A;  1Z4S A;  3NBC A;  3OBT A;  5I1B A;  4ION A;  4D0T A;  2FFU A;  1EYL A;  2RST A;  3A21 A;  2FDB M;  4LO0 C;  2F2F C;  3BA5 A;  4END A;  3AKH A;  3ZXD A;  1A8D A;  7I1B A;  4LO0 A;  1ONK B;  2DRZ A;  4JAW A;  2F2F A;  3AJ5 A;  4QD2 C;  1ISW A;  1TWM A;  1HWM B;  1FV2 A;  21BI A;  3ZXG A;  1DIW A;  2D7I A;  3HOM A;  3O4D A;  4I4U A;  3UD7 A;  1CVS A;  3FJA A;  3I2X A;  3VT2 A;  3A23 A;  3ZC9 A;  3A07 A;  2HZ9 A;  3N7M A;  3S8J A;  4F83 A;  3PHZ A;  1ILR 1;  3CA4 A;  2DRY A;  3WIN C;  1WBA A;  2FGF A;  1IIL A;  1TWE A;  3CAH A;  3WIN A;  4I37 A;  4I4X A;  5BXR A;  1WBC A;  2WBC A;  3I29 B;  3UJ4 A;  5FZU A;  2VUA A;  5FZY A;  5BXT A;  4I2S A;  3O4B A;  4IY9 A;  4USP A;  1FV3 A;  4MZH A;  1OQL B;  3UDA A;  1YBI A;  4OEG A;  3H6R B;  4LO1 C;  3D7W B;  3HBW A;  4I4Y A;  1TTU A;  1QQL A;  3N7L A;  3BAV A;  3AJ6 A;  3FUQ A;  4GOV A;  4LO1 A;  3WO3 A;  4HA2 A;  3VWC A;  1JLX A;  4XFT A;  2Y9W C;  5BXS A;  1JT3 A;  1AVW B;  2KH2 A;  1AVA C;  5BVP I;  3WO4 A;  2BEB A;  1RML A;  4PC4 A;  1Q1U A;  4LO2 C;  3WMU A;  4KEI A;  1V6X A;  2LIQ A;  1RY7 A;  4EFR A;  4JKQ A;  5DVH A;  4F34 A;  4I8M A;  4LO2 A;  2AXM A;  1PC8 B;  4JKX B;  3RSJ A;  5HPZ A;  4OWL A;  3SNV A;  1YYN A;  1S0B A;  4JPZ A;  1EV2 A;  3CQA A;  1IOB A;  4P0L A;  3CRH A;  1JQZ A;  2J3P A;  3OJ2 A;  4ZKT B;  2NYY A;  3BRF A;  4KC3 A;  3CA6 A;  1G9B A;  3E8L C;  2P39 A;  4H75 A;  4EB2 B;  1L2H A;  1W3G A;  4EFP A;  4ZFW B;  1IT0 A;  4ZOT A;  3FJI A;  4X38 A;  2KI4 A;  1CE7 B;  3LLP A;  3OGF A;  1HCE A;  3O4A A;  3CU1 B;  3N7K A;  3BRD A;  1QXM A;  3QYD A;  2D24 A;  2GZB A;  5G00 A;  4ZFU B;  4OUJ A;  5F8S A;  1XHB A;  3V79 C;  1S0L A;  4P0J A;  4D0Z A;  1KNM A;  4DEN A;  2D7R A;  1XZZ A;  3PME A;  3BAO A;  1R8N A;  4QBC A;  4G9M A;  4GAF A;  1PWA A;  2E4M C;  3AKI A;  2MIB A;  3UD8 A;  4ZBV B;  3CA1 A;  2ESU A;  3QR5 A;  1DZC A;  3BTA A;  4WBC A;  2E4M A;  5JLV A;  2XOA A;  3WMV A;  3NBN A;  1PUU B;  5BOW A;  4I0Y A;  3IM7 A;  2F8X C;  1K5U A;  1AXM A;  1GGP B;  1DQO A;  3V0A B;  4UY4 A;  2Y9G A;  1P63 A;  4FGF A;  1EVT A;  1HIB A;  2DS0 A;  5GAQ A;  4Q91 A;  3AZV A;  2YUG A;  1JT7 A;  2X2T A;  1FMZ A;  3JUT A;  4I3N A;  3AKF A;  4YOL A;  3OBR A;  1ISV A;  3Q7W A;  4IQP A;  2DRE A;  2HWA A;  2RG9 B; 
#chains in the Genus database with same CATH homology
 1HWN B;  1K5V A;  1BLA A;  4DEP A;  3FGM A;  2VLC A;  1HCD A;  4I4O A;  4I7I A;  2IWT B;  1FQ9 A;  3V0B B;  5JMC A;  4IZX A;  4MZG B;  3VSF A;  3ZC8 A;  1V6V A;  3IM6 A;  4QKR A;  3EF2 A;  3FJE A;  3FJJ A;  4ZFY B;  3AH4 A;  3MPP G;  1BLD A;  3FJD A;  3WO2 A;  3T8S A;  4A7Z A;  4LO7 B;  1BFB A;  3VUO A;  1G9A A;  2Q3N B;  3BAD A;  1FN0 A;  4OWJ A;  4P6A A;  4AN7 B;  2NTD A;  2ZQN A;  4JRA A;  4QD2 B;  1W3F A;  4I4R A;  4Q9P A;  3PG0 A;  1I1B A;  3NBE A;  3FUO A;  2K8R A;  4I96 A;  1AVU A;  1S0E A;  3FJH A;  4HJJ A;  5EHA A;  3UD9 A;  6I1B A;  3AKG A;  1HWO B;  2ERM A;  4A7Y A;  4A7K A;  1DFC A;  2LIE A;  1DQG A;  1BA7 A;  1DLL A;  1JY0 A;  1AF9 A;  5FZZ A;  4GAI A;  4I1E A;  3W9T A;  4H9W A;  2VU9 A;  3AH2 A;  2Z48 A;  3S8K A;  1WD4 A;  2P23 A;  2D43 A;  3R4U A;  2FFV A;  1V6U A;  4I4P A;  1TFM B;  2Y9F A;  2D22 A;  4J2S A;  5BXP A;  4FVV A;  1ISX A;  3BAH A;  4ZLB B;  3O3Q A;  1YF8 B;  4H04 A;  2ZR1 B;  4I4V A;  2Y9X E;  3O4C A;  3VSZ A;  2QN4 A;  4QBV A;  3OJM A;  2QYI B;  3OGG A;  1Z0H A;  4II0 A;  3AZW A;  1JLY A;  4J23 B;  1T4Q A;  3CRI A;  3BAU A;  3BAG A;  1V6W A;  3IM5 A;  3TC2 A;  1EPW A;  1F31 A;  2IHO A;  1IRA X;  4IZE A;  3VT0 A;  4EFQ A;  1ABR B;  9ILB A;  1DJS B;  1D0H A;  5F90 A;  3RTJ B;  5D61 A;  1RG8 A;  3N0K A;  4G9N A;  3IAG C;  4G1R A;  2ZQO A;  3Q7X A;  2K43 A;  1BFG A;  5BP5 C;  2NP0 A;  2NZ9 A;  4I6I A;  3O5W B;  3FJF A;  4J2X A;  4IYB A;  4OWK A;  4XFS A;  5BP5 A;  5EC5 A;  1IJT A;  3I2A A;  5FNW A;  1JT4 A;  1G9D A;  4LO8 B;  1SR4 C;  4JQ0 A;  2ET2 A;  4D8H A;  1W3A A;  5DUY A;  1Q03 A;  3BA7 A;  2VXT I;  1VCL A;  1IHK A;  2K4A B;  4L4H A;  1PUM B;  2D23 A;  1TOO A;  3PUB A;  1WD3 A;  3P6J A;  3Q7Y A;  4GP3 A;  4XKI A;  4LO7 C;  3JRR A;  4QO3 A;  1ITB A;  2NS2 A;  3MAL A;  4I4S A;  2KI6 B;  2I1B A;  3LTQ A;  4X37 A;  4G6J A;  3FJB A;  1QQK A;  2VSE A;  4IY8 A;  4P0K A;  1BAS A;  1SZ6 B;  2UUS A;  4KEJ A;  3VEQ A;  3NBD A;  3BRG C;  1J0S A;  2AAI B;  4USO A;  1NUN A;  4Z8S B;  2D1Z A;  1BFC A;  4L4I A;  1JT5 A;  1DFQ A;  3IIR A;  3R4S A;  1TIE A;  1FWV A;  1FWU A;  41BI A;  4J2Y A;  3RMY A;  1DZD A;  1R8O A;  4MZF B;  3H6R A;  4QAL A;  3CA5 A;  5BQU C;  8I1B A;  2X2S A;  2GO2 A;  4AN6 A;  1YTO A;  4DCK C;  3B9U A;  3P6I A;  5BQU A;  4Z9W B;  5E24 E;  3CA3 A;  3O44 A;  4ISQ A;  2WRY A;  1NZK A;  3A22 A;  5D63 A;  2R9K B;  1IRP A;  2NVH A;  1PZZ A;  1YXW A;  3HAL A;  2MLL B;  1M16 A;  3HMY A;  2BEA A;  2M49 A;  2L5X A;  1II4 A;  3CRG A;  5D62 A;  1Z2V A;  2NM1 A;  1G82 A;  4LO3 C;  2AFG A;  4I4Q A;  4IHZ A;  1I1E A;  1Q04 A;  3C9Z A;  4HR6 C;  4LO3 A;  1TP0 A;  3CA0 A;  4I1B A;  2MC2 A;  1M2T B;  4Q9G A;  5F8W A;  2VSA A;  1FGA A;  1BFF A;  3KMV A;  4GP0 A;  3VT1 A;  2FO1 A;  3O4O A;  3RMX A;  2BFH A;  3F62 B;  2Q9X A;  2D44 A;  3POK A;  1HKN A;  3N7J A;  3FJ9 A;  1T9F A;  1MD6 A;  3FFZ A;  1S0F A;  3HSM A;  31BI A;  3F1R A;  1JTC A;  5EG6 C;  2HWM A;  3H6S E;  4EEE B;  2RQ9 A;  3BB2 A;  4EKX B;  1AFC A;  3OJV A;  1FMM S;  2KLL A;  4TLP A;  1S0G A;  1XYF A;  4XFU A;  4ZGR B;  1ISY A;  1E0O A;  3ZX7 A;  2VXR A;  5FNX A;  1ISZ A;  3FJK A;  4GOY A;  2HW9 A;  3UJ0 A;  5DZU A;  3AH1 A;  5F8Y A;  4KBB A;  1HWP B;  3BAQ A;  4KEK A;  4OW4 A;  1RZO B;  4QC4 A;  3P53 A;  2AQZ A;  2Z49 A;  4ZA3 B;  2D20 A;  4CJM A;  4OEE A;  3O49 A;  3V0A A;  4X3A A;  1S0C A;  3RTI B;  3K1X A;  3FJ8 A;  1N4K A;  4J2K A;  1XG6 A;  5DSS B;  4X39 A;  3FJC A;  1S0D A;  1G9C A;  3BX1 C;  3WA1 A;  1MC9 A;  4G6M A;  5B2H A;  3BA4 A;  3H6Q A;  2KKI A;  4QKS A;  3HN1 A;  4JP0 A;  1BAR A;  1AVX B;  1SR4 A;  1UPS A;  3V0B A;  3ILA A;  4OEF A;  3NJ5 A;  4R6U B;  4ISR A;  1Z4S A;  3NBC A;  3OBT A;  5I1B A;  4ION A;  4D0T A;  2FFU A;  1EYL A;  2RST A;  3A21 A;  2FDB M;  4LO0 C;  2F2F C;  3BA5 A;  4END A;  3AKH A;  3ZXD A;  1A8D A;  7I1B A;  4LO0 A;  1ONK B;  2DRZ A;  4JAW A;  2F2F A;  3AJ5 A;  4QD2 C;  1ISW A;  1TWM A;  1HWM B;  1FV2 A;  21BI A;  3ZXG A;  1DIW A;  2D7I A;  3HOM A;  3O4D A;  4I4U A;  3UD7 A;  1CVS A;  3FJA A;  3I2X A;  3VT2 A;  3A23 A;  3ZC9 A;  3A07 A;  2HZ9 A;  3N7M A;  3S8J A;  4F83 A;  3PHZ A;  1ILR 1;  3CA4 A;  2DRY A;  3WIN C;  1WBA A;  2FGF A;  1IIL A;  1TWE A;  3CAH A;  3WIN A;  4I37 A;  4I4X A;  5BXR A;  1WBC A;  2WBC A;  3I29 B;  3UJ4 A;  5FZU A;  2VUA A;  5FZY A;  5BXT A;  4I2S A;  3O4B A;  4IY9 A;  4USP A;  1FV3 A;  4MZH A;  1OQL B;  3UDA A;  1YBI A;  4OEG A;  3H6R B;  4LO1 C;  3D7W B;  3HBW A;  4I4Y A;  1TTU A;  1QQL A;  3N7L A;  3BAV A;  3AJ6 A;  3FUQ A;  4GOV A;  4LO1 A;  3WO3 A;  4HA2 A;  3VWC A;  1JLX A;  4XFT A;  2Y9W C;  5BXS A;  1JT3 A;  1AVW B;  2KH2 A;  1AVA C;  5BVP I;  3WO4 A;  2BEB A;  1RML A;  4PC4 A;  1Q1U A;  4LO2 C;  3WMU A;  4KEI A;  1V6X A;  2LIQ A;  1RY7 A;  4EFR A;  4JKQ A;  5DVH A;  4F34 A;  4I8M A;  4LO2 A;  2AXM A;  1PC8 B;  4JKX B;  3RSJ A;  5HPZ A;  4OWL A;  3SNV A;  1YYN A;  1S0B A;  4JPZ A;  1EV2 A;  3CQA A;  1IOB A;  4P0L A;  3CRH A;  1JQZ A;  2J3P A;  3OJ2 A;  4ZKT B;  2NYY A;  3BRF A;  4KC3 A;  3CA6 A;  1G9B A;  3E8L C;  2P39 A;  4H75 A;  4EB2 B;  1L2H A;  1W3G A;  4EFP A;  4ZFW B;  1IT0 A;  4ZOT A;  3FJI A;  4X38 A;  2KI4 A;  1CE7 B;  3LLP A;  3OGF A;  1HCE A;  3O4A A;  3CU1 B;  3N7K A;  3BRD A;  1QXM A;  3QYD A;  2D24 A;  2GZB A;  5G00 A;  4ZFU B;  4OUJ A;  5F8S A;  1XHB A;  3V79 C;  1S0L A;  4P0J A;  4D0Z A;  1KNM A;  4DEN A;  2D7R A;  1XZZ A;  3PME A;  3BAO A;  1R8N A;  4QBC A;  4G9M A;  4GAF A;  1PWA A;  2E4M C;  3AKI A;  2MIB A;  3UD8 A;  4ZBV B;  3CA1 A;  2ESU A;  3QR5 A;  1DZC A;  3BTA A;  4WBC A;  2E4M A;  5JLV A;  2XOA A;  3WMV A;  3NBN A;  1PUU B;  5BOW A;  4I0Y A;  3IM7 A;  2F8X C;  1K5U A;  1AXM A;  1GGP B;  1DQO A;  3V0A B;  4UY4 A;  2Y9G A;  1P63 A;  4FGF A;  1EVT A;  1HIB A;  2DS0 A;  5GAQ A;  4Q91 A;  3AZV A;  2YUG A;  1JT7 A;  2X2T A;  1FMZ A;  3JUT A;  4I3N A;  3AKF A;  4YOL A;  3OBR A;  1ISV A;  3Q7W A;  4IQP A;  2DRE A;  2HWA A;  2RG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...