1JR6A

Solution structure of an engineered arginine-rich subdomain 2 of the hepatitis c virus ns3 rna helicase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
138
structure length
138
Chain Sequence
GSVTVPHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIPTNGDVVVVATDALMTGFTGDFDSVIDCNTSDGKPQDAVSRTQRRGRTGRGKPGIYRFVAPGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and backbone dynamics of an engineered arginine-rich subdomain 2 of the hepatitis C virus NS3 RNA helicase.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords Helicase NS3
total genus 27
structure length 138
sequence length 138
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1jr6A00
2XNSA 4OQNA 4EFMA 1R6BX 4UKDA 5EXSA 3ND9A 1IM2A 521PA 4TMWA 1NN1A 4CIDA 4M8NE 1AZSC 2CDNA 5JEDA 1OXTA 1QHNA 2ZR0A 1KSGA 2XXAB 3NDBB 5LD2B 4D6PA 5EQTA 2J0VA 1BYUA 1G8PA 2V55B 4WOPA 3RRNA 1PV4A 1G8GA 4PQRA 1D2NA 1R8QA 1RIFA 2AL7A 5FPYA 4JJKA 4JZKA 1Z08A 2VHQA 4C0KA 1XMIA 1P2SA 3F8TA 3PG5A 4HAUA 3WP0A 3UWOA 1OH6A 4M1WA 5FTJA 1I2DA 1T5LA 1Q12A 3IPYA 2LWIA 5P21A 4WIAA 3RRZA 3MUFA 4ZDKA 1WBBA 3OIWA 1T5IA 4HB0A 2J5XA 4IVPA 1WDTA 4TL7A 5IHPA 1QZXA 1CJVC 1JPJA 1IY0A 3GEEA 3L8ZA 2WWHA 1P75A 1GAJA 2H8KA 3IIMA 5FUVA 1CEEA 3T5DA 2IC5A 4N0EA 2GZAA 4BLPA 4EPXA 1OHHD 1J90A 2WOOA 2ZSAA 3AVYA 1P5ZB 3ZVRA 4DEXA 3QXXA 1CJMA 4DDTA 3IEUA 2HLDD 4JLVA 4AG6A 4DLVA 1P9RA 3QXHA 4LC1A 4URVR 4P0TA 2R2AA 3IILA 3L0OA 5BW8A 4WZBE 1R0XA 1UKYA 4FN5A 4KLZA 1KO1A 2IUUA 1EWQA 1C1YA 3EZ7A 4Z8YA 4PO8A 1VG1A 2MSDB 1SVLA 4B6EA 2Z6VA 5F98A 4FMBB 3RS5A 2QEQA 3DOFA 4IOLA 1ZAKA 3W5JA 3PR1A 2RGNA 3Q9LA 4Q9JA 5FBLB 5DNYB 2PBRA 1J7KA 4KYIB 1G3MA 3MJRA 4JSYA 3QPUA 5G53C 1KK3A 2GKSA 2QU8A 4HAZA 1ZUIA 2Q9BA 3T15A 2W00A 1VDZA 5FL3A 3EIHA 3QF4B 2W6IA 2FSIA 2HYIC 1GTVA 4F4JA 4TYYA 2YZ2A 1E9RA 1P61B 2HEIA 2J1LA 2WJYA 1Z6XA 5IF9A 3NBFA 1LV7A 4L15A 2J0UA 4C2TA 1GNQA 1NSTA 4XD7D 1K5GA 1KI1A 2J7PA 3DMDA 1DAMA 5J40A 3Q3JB 3TNFA 2ZXUA 4NYJR 2WVJA 4II7A 3NBYC 2TMKA 1E2FA 4DSTA 4L16A 4PZLA 4D81A 5M04A 1XEWX 2FPLA 4P32A 1TUIA 4E09A 2W6ID 4NCNA 1G5RA 1YR8A 1ZNXA 3GLGE 1HT2E 1XD2A 3FWYA 1SXJC 1HT1E 3IO3A 1KNXA 3PJRA 1ZUNB 4Q4HB 5IT5A 3GMTA 3RS0A 4DIDA 2O8CA 2PX3A 2CBZA 5B57C 4F92B 3WNDA 2ZJ2A 3UMFA 2NZJA 1KSHA 5FTMA 2Y8EA 4ESVA 3ZZTA 1E2EA 1G4AE 1QRAA 4IDPA 4NCHA 5FOUA 3CZQA 1MV5A 1E96A 1ESNA 3RC3A 3VHXA 4DJTA 5KSZA 3VKGA 3K0FB 2VHJA 4CEHA 4OHYA 3FB4A 3FFAA 4X8LA 1FQKA 1OXUA 3DM9B 4DWJA 4ZKDA 3O8BA 5FR2A 5JHGB 1W4RA 3VR5A 2DYKA 3KKOA 3RS2A 3WP1B 3QEOA 1G19A 2C8VA 1P7CA 3KKMA 3WHKA 1CS4C 4QBIA 4B3GA 1II8A 1NVXQ 3OEEA 4IDNA 5FR1A 2OFWA 4L4UA 3U5ZB 2KBFA 3C7KA 3VX3A 2BM0A 1PUIA 5KU1A 3AF2A 4MA4A 1ODFA 1CR2A 1IOZA 1B23P 2RGAA 2QN6A 4A2PA 1N0VC 2GVDC 4HAWA 1PLLA 4P4UA 2DBYA 3K0SA 4NONA 2O8BA 3B8HA 3A1VA 5AJWA 3L0PA 4LPKA 3CO5A 2ORVA 1G3QA 3PEWA 1JJVA 3FTQA 1GG2A 4Q1DA 5HKKA 3OEHD 5BN3A 2HJVA 4JLJA 2BMFA 2KSQA 4EAQA 1TQ6A 2HXYA 2YC2C 4TZ0A 5SZIA 5DN6D 2OUKA 4V0MA 2ZRCA 2QPTA 1UKEA 1N0WA 3A4MA 2ZJYA 3BGWA 3Q8XB 1BMFA 2F1RA 3U60B 3DO6A 3P4XA 4KAXA 4KSCA 3JZAA 3ZIAA 2JLWA 1ZU5A 2JJ1A 3FGNA 4UNQA 4NL4H 5FOVA 1Q20A 2JATA 1MKYA 4BEJA 2J59A 2VEDA 1HE8B 1JQLB 4TYNA 3BD9A 1RRPA 1U81A 4NTZA 1G8HA 4WA7A 2GJSA 4M1MA 3GFTA 1KI4A 5FUYA 3LQQA 1NMXA 2PH1A 4X8MA 3L82B 2ZR9A 3X1YA 3F5FA 1HV8A 1H65A 4LYFA 4B32A 1XTJA 5AR1A 1AN0A 5EJEA 1H8ED 4BE7B 1CF4A 1IBRA 2ZTSA 3DDCA 2HJGA 3QXSA 1SULA 2A5DA 3MD0A 4F7WA 3U44A 5EP3A 3EXAA 5CYOA 1NI3A 4A4DA 1NJFA 3LLMA 4AD8A 2Z43A 1D2MA 2W2VA 1XWIA 4LJ8A 1GFIA 5E7JA 3TBKA 2VHTA 2BHRA 3BIFA 3X1XA 5EXXA 1DG3A 1IN4A 3SFVA 3SJAA 2BJWA 4B47A 4DDUA 5JCZA 4AYTA 4G5SA 4B74A 4G3XA 2OCYC 2ZR7A 1ELOA 1E4VA 2ATXA 121PA 2CL0X 1VKJA 3RYTC 4WZ6A 3BH6A 2PEZA 1OSNA 1UBGA 2JLRA 4IOMA 4YMTA 1C4OA 1KY3A 2F9MA 1YRBA 1L2TA 4HDOB 4ARZA 3FKQA 1Z3IX 4ZIRA 1Z0FA 1MRNA 2XJ9A 3A1TA 2G9NA 1KI3A 1LY1A 4MQBA 1JNYA 4GP6A 2CEAA 3ZD7A 1YZKA 4PR0A 4AYXA 4QGHA 2AX4A 4LV5B 1QHGA 1U0LA 2IXEA 2UVQA 4D0GA 4GRAA 4Q5IA 5JJIA 4LZZA 4Q1FA 3QKRB 3H86A 2QSYA 3VMFA 1NIPA 4M1OA 2WSSD 2R9VA 1UEJA 3CWQA 1A2BA 1R5OA 3Q7QA 1KI6A 1W0JA 3O47A 4DCTA 5JHHB 5D3MA 2B92A 3LH5A 4QOSA 4WAUA 2C5LA 1GL7A 2ZRGA 5FOSA 4KXFB 1XNJA 4Q02A 2BMDA 2ZUDA 4NYJQ 3IQXA 3MWLA 3KTAB 4WXPA 3GJ0A 1E2NA 3LX8A 3OHMA 1QHHB 2W6JA 3GLHB 1SVWA 2B8WA 1DO0A 4IVQA 2ZJOA 5KDOA 5C46F 5J4HA 4MITA 3R8FA 2WWYA 4Q7JB 4DCNA 1M34E 2IA5A 1WRBA 3CUEF 1UM8A 4OYHA 1T91A 2NOAA 4FCWA 2ZJ5A 4UQOA 4EPYA 3LQRA 2JEOA 4PC7A 5L3VA 2IYRA 4Q4JA 4R9UC 4URZR 3ZH9B 2F43B 4Q00A 5TVKA 4RZUA 3TQFA 2D06A 3QKUA 3TLXA 1NVWQ 2FSHA 2JJ1D 2GJ9A 2CE2X 3TSOA 1TQ4A 3NEJA 1N6LA 1AKYA 5F9FA 2I3BA 1Q21A 4PSVA 3EASA 5HPYB 4M53A 3TSZA 3E70C 2IWRA 3NXSA 2CVFA 2O8FB 2XZPA 3D3QA 1FNMA 3OEHA 2VRWA 5HKKD 2CL6X 3QE0A 4DLWA 1HURA 2J0UB 4PSAA 2ZE6A 3WNCA 2GF9A 3M1IA 4MKHA 3A4NA 5JLJA 4YMWA 2PJRA 2REBA 4DVGA 2CNWD 4PAOA 4Q9KA 1T8UA 1KHTA 2GCOB 2QTFA 4AIIA 1VCNA 4HUQB 2GZDA 2EYUA 2JGNA 3GJ3A 2DCUA 4AYWA 4UJ3A 3AH8A 1ZM3A 2XB2A 4TTQA 1N25A 5AJYA 2JASA 2GCPA 3P26A 4E22A 4WZAE 4XVQA 5EE5B 4RD4A 3C5CA 4H9GA 2AWOA 3N2IA 1KI2A 2QA5A 2HT6A 1G18A 5J4VA 4MDEA 1ONBA 4OHVA 3SJBA 2GHIA 3OF5A 1MOZA 1OPXA 3JZMA 1FTSA 2OZEA 3CX6A 3A8TA 5C4MA 5FPSA 3H0KA 3VR2A 5BWMA 2PJZA 3SBDA 4C0QC 5JRJA 3LY5A 4H1UA 4Q9IA 1DARA 4BLTA 4JSTA 1OV4A 4GOXA 4KYUA 4ERNA 2XXAA 4EDHA 3CRRA 2JJ8A 1N6NA 4BZPA 2WV9A 2QENA 1S1MA 1AZTA 1VHLA 2E9SA 4M21A 3EX7C 3TRFA 4QFMA 5JSZB 1SHKA 1Z0IA 3FFBA 2WWXA 4BFVA 4HLUA 4IOKA 1R10A 2QM8A 1FZQA 3IBYA 4B35A 5BN5A 3BAFA 4LK2A 2ZRHA 2X2FA 5KUTA 2O8FA 1YVDA 2JA1A 1E79A 2YOHA 3OIVA 2ZROA 5CYPA 3GLIE 1E4YA 2WWWA 2QMUA 2X2EA 5FPKA 1Q1BA 2V7QD 1D8TA 4XSGA 3MAAC 3CR8A 3KUDA 3SDZA 4BECA 1A1VA 3FYHA 3KJHA 4EPWA 3VU9A 1P73A 3PUYA 1E0KA 2O52A 1S2MA 2H7VA 721PA 1E9EA 3LA6A 4KSBA 2F43A 4MKIA 3SYKA 1BYIA 2WZQA 3TUIC 4XWOA 1GIAA 1ZCBA 4TWZA 3K53A 4DT1B 5JZVA 4KV9A 4DCVA 2IS6A 1RZ3A 2ERXA 5JFGA 2J0QA 1PLKA 1YR9A 4P33A 4V0KA 1ZVQA 4BLQA 2YNMA 1QHSA 2VP0A 3L43A 1GM5A 1Q44A 3VR6A 3ND8A 1ZM4A 1E6CA 4MRPA 4A92A 4B73A 4D26A 1TNDA 2YC4C 1JXMA 1QHXA 3A37A 1N6RA 3DKPA 2BV3A 1QBKC 3U7EB 2QBYA 4BGDA 2BWJA 4B48A 4CRWB 3THXB 3IDQA 2F1HA 1CULC 3GEHA 3Q5DA 5B64A 4G5GA 3EWAA 4JYBA 4YC7A 1NBMD 1GSIA 4RY2A 2ZSBA 3U2QA 4RCZA 4KCGA 1SZPA 1U2RA 2C78A 2VSFA 4ACBA 4LBZA 2XTZA 2D2EA 1RVDA 2F3RA 3ZQ6A 3SQWA 4LHWA 5BYKA 1M7BA 4JBWA 1OE0A 4IDQA 4TTPA 4QL3A 2OCPA 4IEEA 4RKEA 2OV2A 1X3SA 3CPEA 4MRNA 4NE2A 1YZQA 2PZFA 1XX6A 1JI0A 4E03A 4TMKA 1CP2A 3CRMA 1SHZA 4M9QA 3KDSE 1N5IA 2DFLA 2G1JA 2Z83A 2Q3MA 3AVUA 1DG1G 1E9BA 3KKQA 5CLQA 1FNNA 2XNDD 1YZGA 3L0IB 1SXJA 3NDPA 2QQ0A 1MABA 3N5CA 2H1LA 4Q4JB 1J70A 5ELXA 2AK3A 2C98A 3R7WA 4C30A 3M4YA 5J4KA 3GLIA 4L8GA 2P67A 3RABA 4JJZA 3ZGXA 1JECA 3VNVA 1D5CA 2HCJB 4BFXA 4ZPXA 2NO9A 3T12A 3L0SA 2BMEA 2A5YB 1QHHA 2XOKA 3BH7A 2IYYA 3GLGA 4KITB 2FF7A 2PX0A 3HU3A 2QMOA 4JLPA 3NWJA 4HLUC 4QXAA 4AWXA 1SVMA 3U4QB 4OHWA 2JLXA 3FE2A 3AF0A 1OFHA 2NZ8A 3BBPA 1G7CA 3FHOA 1N0UA 1VIAA 5JWRA 2VA8A 2EWVA 3QNUA 2ZIAA 4ITRC 2ZE5A 3BB3A 2VL7A 3G0HA 1TF5A 1P72A 1LVGA 1T3SA 2RHMA 4KU4A 5HCNA 4TYQA 4A0RA 3OFND 2OILA 3MMPA 1NG1A 2CVHA 4OKSA 2GCOA 5KYKA 1OKKA 1KOFA 5GJCA 3ADBA 2ZRNA 3RAPR 4IFBA 3KXLA 1AQUA 3U3JA 2BC9A 1OH5A 4PPQA 3VX4A 1A82A 1X6VA 3GEIA 5H8WA 4I1OA 4YQFA 2EYQA 4CF7A 4NBSA 2NQ2C 1HY3A 1UBFA 4Q7MB 3NH9A 4Q4HA 1HQYE 1Z6TA 1FPMA 3FMFA 3RS4A 3NTUA 5CIWA 1YZUA 1L4UA 5EUMA 3U7GA 2JLYA 4NZYA 1RKBA 5A5GA 1LB1B 3GJ7A 1TEXA 3I1FA 4W7SA 4RD2A 4BFUA 1E2IA 2BM1A 1NY6A 1T9HA 2QI9C 2QM7A 1UJ2A 4GZLA 1OIXA 4LDJA 3CX7A 1YR7A 4LBVA 2D4HA 4W5JA 3QQ5A 4HDCA 4NHOA 4QGFA 4EPTA 3QXJA 1YZLA 1SKQA 2P0EA 3EAQA 4N3NA 4PHHA 1MO6A 1XZQA 2WM9B 1KZGB 1Q22A 4D0LB 4QGGA 3AB3A 2FN4A 2NG1A 1E2GA 2QORA 4HSEA 1Z22A 1NBME 3G5UA 5TV2A 3PUXA 2V1UA 2IS2A 6Q21A 2IL1A 5D3MB 3AV0B 2IF0A 1AK2A 3MJHA 1YZTA 1XP8A 2IUTA 4LSGA 3KJGA 1EFHA 3D7MA 1WF3A 1EFRD 3JVVA 1E32A 1JALA 1T8TA 2DR3A 1E0AA 4RZ2A 1F2UB 4NYIQ 3EG5A 1N6IA 1G8YA 4DSUA 4Y0VA 2XJ4A 4LHYA 4MRVA 4PC3A 3AEZA 1X8KA 1DAEA 1Y3AA 1SQ5A 1OH7A 1W4AA 2VH5R 4Q18A 4YLGA 3SZRA 1E94E 5KTYA 3ZS9A 1XRJA 2JCSA 4HLCA 1FX0B 4TLEA 4JL6A 3B13B 1BH2A 1WE2A 1UF9A 3QG1A 1TF7A 2PMDA 3JVUA 1ZM7A 2RGEA 4ZDIA 3CF6R 4U5XA 3GFPA 1JBKA 1B0UA 1Z0KA 621PA 2DWOA 2ODEA 1BO6A 3DZ8A 1RRGA 3LX5A 4ABYA 4B2IA 5KSYA 3X1DA 2VHCA 4C7OB 4LV8B 3GLFA 3P4YA 3KTAA 5FOWA 2ODBA 2IF2A 2IT1A 4Q1CA 3B82A 2RGCA 1T0JB 1KMHA 3KUCA 3TIFA 5EE1A 1YE8A 4P3YA 4M1YA 1AA9A 3Q5EA 5HCIA 4AK9A 2JLZA 2ANCA 2MMGA 5IK2D 2QE7A 2QSZA 2QNRA 2VP5A 3TVDA 3CNLA 4D25A 1XBTA 1XU4A 5CLLA 3AVVA 1XXHE 3K0EA 4GP7A 1U8ZA 1FQJA 2XSZD 2MSEB 2PT5A 3U61B 2F1JA 2NIPA 3AVPA 4URUR 4DZZA 2O8EA 4CEJB 1KK0A 4ARZB 1Z0DA 4RD3A 4OK6A 4US0R 4DHEA 3MGCA 4XIGS 2BBWA 4QHYA 1Z8FA 4KODA 4BZXA 2BEJA 3IIKA 1KK2A 3QSYA 1CJKC 4TSFA 2C9CA 4X8OA 2GCNA 1P2UA 1G6OA 1XTSA 2GK6A 1UAAA 2IEYA 3EPLA 2QPOA 3ZIAD 1XMJA 1GZSA 4OI2A 5EE3A 4P4TA 1P6XA 5HE8A 3SI7A 4UNSA 1NVVQ 2CJWB 3QVVA 3WBKA 2H57A 2QTVB 3MWYW 2NO6A 2OFXA 3BJIC 4LHZA 2G83A 2QGZA 3SS8A 2VBCA 1Z28A 5FI0B 2J41A 1VYTA 4Q7KA 4BFSA 2P6RA 2JJ2A 2WAYA 4PANA 2JDIA 3LWNA 5FBRB 2PEYA 1ZW6A 4R2IA 2OO7A 3VNUA 1AM4D 1K8RA 3CNNA 1VTKA 2XTNA 2W2XA 4G5OA 4HLDA 2GXAA 3UANA 1XJ0A 1Q1ZA 1GP2A 1U99A 1TX4B 3TH5A 1FX0A 2DFTA 3MFYA 1D6JA 3TE6A 4LI0A 4IFEA 4TT3A 1Q1EA 4K8OA 4LCBA 2D62A 2ZJ8A 4HYYA 3QJYA 1QVAA 4IW3B 2ZS9A 1YZNA 3IKJA 4UJ5A 4DUGD 1GRRA 4NMMA 2Q9CA 1X8LA 1E9FA 2R6FA 4BRUA 1XPRA 2KWIA 4NCIA 3P20A 4OJKA 1J99A 4GI7A 4DLSA 2FEMA 1E9SA 3EZ2A 2YHSA 2ZU6A 1JXOA 4RZ3A 5DH9A 1NLYA 3B9PA 1W5SA 1TUEA 3NBXX 4LJ9A 3W8NA 4KO8A 4QHTA 2K5UA 1KO4A 4TN1A 1VCOA 3AKCA 1CR0A 4UNNA 1XXHB 1FP6A 4OQLA 1W7AA 3FMPB 1BMFD 2CXXA 4ZI3A 2WPDD 2REOA 3QF4A 3SHFA 1ZINA 4ASUD 4JKIA 5FPTA 4B2LA 3K0CC 2O8DB 1F6BA 3LO5A 4TYPA 4CT4B 2Q9AA 1PLJA 4K46A 4U02A 1G3RA 4B75A 4N1AA 4P4SB 2GETA 1Q57A 2X19A 2GWHA 4XD7A 2ZI7A 4Q21A 4Q4AA 5DE3A 4GPTA 3GQBA 4KHZA 4LJ6A 3W34A 3HWSA 2AK2A 1M1YE 3WMGA 3I61A 5DGXA 1ESMA 2GRJA 5E4FA 2NMVA 2GTPA 3AF1A 3AP1A 1JB1A 1ZNYA 5EP4A 4QNMA 1X86B 3SBEA 3DMNA 2JAQA 3RSLA 4MYHA 3SYLA 3U3KA 4LHVA 1GNPA 1JAIA 1OXXK 4B3BA 4KI0A 3TGPA 2ZRDA 4KBFA 1TTTA 1QHIA 1RYHA 2W58A 3UMRA 3VFDA 5E95A 2FX3A 1DELA 3HYRA 5AUPB 2R8RA 1MO5A 4MRRA 5J47A 2XGJA 2GVZC 2J87A 2NO1A 4L9WA 1FL9A 4TQAA 2IUSA 3PEUA 5JBQA 4FD2A 5AUNB 2LKCA 1N6KA 1DAIA 3KKNA 4IRUB 2GESA 4AKIA 5EE9A 3B1WA 2PT7A 4Q47A 2FA9A 3LRPA 2BJVA 4LJYA 3WHLA 5K8UA 1P4SA 4MDFA 5G3ZA 1KTVA 4IHQA 4LJ4A 2NO7A 3AP3A 1KO8A 1OW3B 1XCMA 3MLEA 1KZ7B 2J0SA 2V1XA 3DZDA 3TSWA 3F3YA 4HATA 4BFYA 3SQXA 5BXQC 1OB5A 2HLDA 3D8BA 1EFTA 3EIEA 5FPHA 4CDGA 3N2EA 3P32A 1XTKA 3MWKA 2ZYTX 1XD9A 2G6BA 2BKUA 4LY6A 4PHFA 3R7WB 2V7QA 2ZITA 4C9BA 2C77A 2E1RA 1VG8A 1U94A 1W47A 2VSOA 3U4QA 5GVSA 4DIEA 4Q1EA 4LJ5A 1VIYA 5LB2A 1TEVA 4PSKA 1GUAA 1SVOA 4FWTA 4CEIA 2ZYWX 1NG9A 4Y0AA 1CJUC 3OE7A 3QXCA 4O3MA 1NKTA 4EUNA 1YU9A 4HLQB 1ZYUA 2HT1A 1VHTA 3MWJA 2R6CA 2VP2A 1FFHA 2R6GA 3AUYA 4ON9A 2CLCX 4YDHB 5TMPA 3A6PC 4UXJA 1SKYB 1W4BA 1M74A 4FCVA 2GXSA 4M2LA 1I4DD 3FMIA 3H2YA 3GJ6A 1AS0A 1S0UA 2R6AA 4G5QA 3I72A 1BS1A 3W6PA 2YV5A 4I1VA 4MUBA 4NPHA 2YWHA 3FVQA 1SXJB 4POAA 4RCYA 3KQKA 1GKUB 2YWFA 4MH0R 2JLQA 5JEEA 4MYTA 4DRZA 2VP6A 2C2HA 1RJ9B 2GBLC 1P60A 2YVUA 4LHXA 3THXA 4LWZA 3SN6A 3LLUA 4V0ME 2O0JA 3ETLA 2BBSA 3WMEA 3H84A 3GJ4A 1KI7A 4QC2A 1F3OA 1W46A 3CNOA 1Q1QA 4AG5A 4G5RA 4Q19A 4FMDB 2IYWA 4RFSB 4BFWA 5DISB 2AN9A 2V9PA 3GJ5A 2VPPA 3KX2A 4IKEA 3A58B 4JYCA 1V5WA 4XTRA 2ZRFA 1KI9A 2I1QA 4HB2A 1Z6GA 1O87A 3K0CA 2Z5FA 2WJJA 3LBIA 3T34A 1XPUA 3GLIB 1OIWA 5LD2C 4PZZA 4O2LA 2D74A 3SJCA 1HUQA 1F2TB 2GNOA 2IS4A 2ZVPX 4M4SA 3WNBA 1OFUX 2ZSDA 4HDQB 2VO1A 4V0OA 1DTSA 1CIPA 1KDOA 4C0LA 4G0NA 4CGZA 5F9HA 1HH4A 1KI8A 1UADA 1FMLA 2A3RA 4RSGA 4TL8A 2ZS8A 2AHOA 2JDID 2PZEA 4LC0A 1AKEA 4B3DA 4JLDA 4LRWA 1AS3A 2C03A 3ZJYA 2W2TA 2Q3HA 2WWIA 3RHFA 3VKWA 1Z29A 4AI6A 1E1RD 2ZSEA 4GT1A 1A2KC 2QQEA 5H68A 4JIMA 5IDVA 4EKDA 4LYAA 1W4CA 5A0FA 3B1ZA 4A6PA 5AUOB 2IYSA 3C8UA 5JS8A 2X1VA 4TQ9A 1KSJA 4TL9A 3B6EA 3QKTA 1S9DA 5FUXA 3G82C 3IO5A 3EPJA 1E1QA 4UXIA 3I8XA 1S1CA 2GF0A 2CK3A 1EXMA 4OJQA 1R8SA 3TMKA 1JR3D 2VYFA 1GKYA 1TF2A 3P1JA 4C0HA 2ZEJA 3TQCA 2BVNA 4CT5A 4EJSB 1G7SA 2GBLA 3K1JA 3PV0A 3V4FA 5K8IA 5C1BA 4IXMA 2CHQA 2I1VB 3PEYA 2FSGA 1ZIOA 4HAXA 2G0NA 3TW8B 1R4AA 1SVSA 2F55A 2OBLA 4O2RA 2YWEA 3GJXC 4QBHA 3QPWA 5IK2A 2FFQA 4HUTA 3AGQA 4F4IA 2ASEA 1UDWA 2B7BA 3REFA 4JLNA 5DLQC 1ZU4A 4F4CA 3ASYA 1MRSA 3FMOB 1DADA 1P9WA 4B43A 2GILA 1UBCA 2AD1A 4Q48A 2BDTA 5FBWB 3W90A 3CR7A 1G17A 2I4IA 4PO9A 2RAPA 5E7IA 2OXRA 2QY9A 4LV6A 3PUVA 3Q72A 2GAAA 2AKAB 4QG7A 3FPAA 1UKVY 1Z2AA 3SE0A 2H18A 1NJGA 3A1SA 5DYGA 3I5XA 4HZIA 1CRQA 1D9ZA 3B9QA 3QKRA 2BCGY 1ZD1A 3U44B 1E0JA 4PHGA 2QTHA 1OFIA 2QROA 4WBSA 2BIFA 4CVNA 4DSOA 4D4JA 3ZVLA 1G4UR 1AQYA 2CLSA 1P2TA 2FPKA 3QEJA 4A15A 4A2QA 1XPOA 3IEVA 4ZCIA 1CJTC 2ECKA 1ZD8A 4P31A 5L3RA 1HE1C 2OCBA 4H1VA 2BMJA 3H1TA 2ATVA 2VQSA 2EVWX 1N6OA 3T1OA 3CH5A 1U8AA 1GILA 2PCJA 1H8EA 2V6JA 4Q4AB 4Z8XA 4QM6A 4AC9A 2CLDX 4UNRA 2EFDB 3LXXA 4OL0A 2ZI9A 1Z2CA 5AJXA 3AKYA 2RGDA 2HYDA 1OXVA 4D0NA 3ZS8A 1HA3A 1IN5A 4D4MA 2IBMA 4GZMA 1Z6YA 4Q9HA 3GLFB 1DE0A 2B7CA 2ZYUX 1YR6A 2ZRBA 5FL7D 1OKKD 2NO0A 2Z0MA 4W5HA 1LTQA 2QPAA 1K6MA 1RFLA 2R44A 3K0FA 3EPKA 3AKDA 1EX6A 2JLUA 2IHBA 2IX3A 1E2QA 1L7VC 3HJNA 4C2UA 2J46A 4M9SA 3C14C 5JS7A 2RMKA 1X1SA 5D3QA 2IS1A 2DB3A 4D82A 1NNEA 1K5DA 1E99A 2FGKA 4JLKA 2EU8A 2X77A 1AIPA 4FWIB 4QKQA 4W9MC 4M9XA 1XD2B 3PQCA 1Q3HA 3CPJB 4OQXA 3RLFA 4J0QA 4A0HA 3LFUA 4S2EA 4IVRA 4D4KA 1US8A 2ZRPA 4I4LA 1UFQA 3QG5A 2ORWA 1E2DA 2WIBA 4JT4A 3VAAA 2R6DA 2ZQ5A 3K9NA 3TR0A 1GOTA 1OH8A 2G1KA 3LNCA 1XCPA 4PPGA 3OEED 1ZM9A 4GL2A 1M8PA 3AP2A 4NDZA 2V3CC 4B44A 4KLNA 4CEJA 3SFZA 4B34A 4CW7A 2GEUA 2GJKA 1GRNA 4PO1A 3I32A 3P27A 4E5UA 5CM8B 1KIMA 2HDNB 3GLFE 4QBFA 2EFGA 3W5IA 2IHYA 1OYYA 2EFHB 5CK4A 2G3YA 2OLJA 4IEIA 1XCGB 1XTRA 3C5HA 1WB9A 2E87A 3B1YA 1M7GA 3NHAA 4O25A 4FXPA 1G7TA 4A0GA 1Z0JA 4KFTA 1GVNB 3AF3A 1JAHA 1ZRHA 4Q4LA 1VCIA 4C0JA 3NKVA 5JI3E 3U3OA 1QG4A 2WICA 3QPVA 4BQSA 4NYMQ 4HEJA 2JLSA 4FIDA 2F7SA 5HE9A 3W3ZB 1XEFA 4US1R 4EQ6A 3KJEA 1WMSA 4KFUA 1YQTA 2XEXA 3K0AB 1UEIA 2RHDA 1IXSB 1KDRA 4MKFA 1E69A 4QGAA 1NL3A 2ZU0C 4N0DA 1CRPA 2FOLA 2ZI3A 5B30A 1OB2A 1WXQA 3CF2A 2C96A 4RKFA 3PCRB 2V54A 4YMVA 1QHYA 1U98A 1IJEA 1HTWA 3RWOA 5FOTA 3W3AA 3ZYCA 1NY5A 1R2QA 3C16C 2A78A 1W36C 5FUWA 3VR3A 2D7DA 1ZC4A 1OFTA 1W0KA 2BBTA 3AVOA 4BLSA 4PC1A 1CLUA 1RW4A 2ZRMA 1MO3A 3WBJA 4TMVA 5LBIA 5B2ZA 1W0KD 3I62A 3TAUA 1G6HA 3ZZ0A 3GLGB 4OBEA 3KQHA 2CHVA 3B78A 5H1YA 5FBVB 2EQBA 1NVUQ 3SOPA 4V02A 2Q3FA 2N42A 2DWQA 2KBEA 3CX8A 5EUQB 1E98A 3B2EA 221PA 3Q7PA 4BFTA 2PLFA 3ZQJA 4L5BA 3ZVNA 5KDLA 1NN0A 1U0JA 3OIYA 1F60A 1VYVA 4PX9A 3ICQB 4TLDA 1AGRA 2ORIA 3GLHE 1II8B 2YKGA 2ODWA 3BORA 4EIWA 2NGRA 3OE7D 2QUZA 3W6OA 2WHXA 2MMCA 4PZYA 3NVAA 1Q3TA 1IY2A 1FOEB 2L0XA 2X8AA 2IYUA 2YOGA 2JIZA 5JCPA 1E1RA 1EFUA 3I73A 4JLOA 4QJ4A 2A2ZA 4A2WA 3HR8A 4JBYA 4KJZA 2C99A 4M1TA 4OK5A 4BZQA 3M6AA 3NIBA 4BLOA 5EE0A 2IYVA 3K0AA 5JI2E 3OAAD 4LJ7A 4ZDJA 1KY2A 3TR5A 3PVSA 1Z5ZA 4RD0A 4TLBA 2AR7A 1S3GA 4ACAA 2ZRJA 1E2KA 3TJZA 4LYHA 1KJZA 3LVRE 3R20A 1J8YF 4PC6A 4A8JB 4C0BA 2JIZD 4EJSA 5CDFE 3PFIA 4DDVA 3KQNA 2FNAA 3PIRA 4RFVA 4DLUA 3W9YA 1A7JA 2WPDA 1MT0A 1E2MA 5BN4A 2Z4RA 3AF4A 3SNHA 2ZUCA 2ZI4A 2QBYB 4GMXA 1NMZA 3ONWA 4DLTA 1C9KA 1IHUA 3DHWC 1Z07A 5SZKB 5FTKA 3BFXA 4E07A 2DY1A 1OHHA 2H5EA 4UNPA 3SR0A 3THWB 1DAFA 5JMTA 4JS0A 4XJXA 2ZPTX 1XFAA 2DFKB 4R2HA 1EG7A 1ETUA 3ASZA 3CPHA 3DEFA 2J7KA 4DUGA 3LBHA 5JWOA 1DAKA 3KXKA 3A36A 2GA8A 3QVUA 2DPXA 2P2LA 2ZYVX 4BUJA 1KMQA 1KGDA 1W48A 4B3CA 2VIIA 4HB3A 4NCJA 5FTNA 3RS3A 5C4GB 4DLZA 1G9XA 3I8SA 3VQTA 5CK5A 4GOJA 4RVCA 5DHFA 3PITA 3VU9B 1Z83A 2YYZA 4KFSA 2W83A 5G40A 1JJ7A 5EZ6B 2QRNA 4TYWA 3SJZA 3LW8A 2RKOA 2J9RA 4S35A 2VF7A 3OAAA 4RZXA 2DFNA 5CITA 4DXAA 821PA 4PQYA 2P3SA 1PUJA 3B7GA 1MO4A 2GJ8A 1OF1A 1EFCA 1RRFA 1UDXA 3C4JA 1FMJA 3D6TB 3ZZUA 5TXGA 5HR5A 2WIAA 1HYQA 3UATA 4HZUB 5KHOC 4B3XA 3AM1A 3CF0A 3E5HA 2ZJZA 2IYTA 1G64A 1M6NA 1XJQA 2RH5A 1S3SA 2W6JD 3A1WA 3HDTA 4TSFD 4U00A 3T1QA 3U7FB 2H92A 3UXMA 2J3EA 4LPSA 1IN7A 3KZ1E 4OK3A 3EPHA 2KJQA 4Q7LA 3NEYA 5BQ5A 2VTKA 1IXZA 3IUYA 5DI3B 2MSCB 4EFLA 4URXR 2WSSA 3AVTA 2V4ZA 4KBGA 1G7RA 3AVWA 1G3UA 3CRVA 5TARA 1JR6A 3U3MA 4I99A 3T06B 4BEBA 4ZI2A 1E3MA 2GDJA 1XF9A 4F91B 4DLYA 3T5GA 1Z0AA 3TUJC 3QBTA 3TAHA 4Q1BA 1IXRC 3NC1C 1EESA 2Q21A 2QMEA 1QDEA 2WAXA 3IHLA 1W0JD 4ZDWA 4DSNA 4DT1A 2FFHA 3UKDA 1LF0A 2QL6A 1MABB 2W0MA 4OI1A 2FH5B 3BK7A 4XSHA 2D7CA 1J8MF 4NH0A 2GJAA 2VP9A 1NMYA 1R0ZA 1NLZA 4FW9A 2WKQA 3AKEA 2VHUA 2YJTD 1G5TA 3MCAA 4KVAA 4YDSA 3ICEA 4YONB 1N5LA 1XTQA 1E9AA 1I4TD 3NBZC 4RFSA 1R5BA 3EWSA 5DI3A 4AKHA 3L2OB 3CZPA 2ONJA 4C0AC 2BCJQ 4GBMA 1VMAA 1D2EA 1CKEA 4G1UC 3UK6A 3WYGA 3O8RA 1IN6A 3EC1A 4ZCLA 1RJ9A 3GP8A 4DCSA 3E1SA 1ZC3A 2ZUBA 1WQ1R 2FGJA 1OLOA 1X8JA 5BYJA 4DEYA 3S1AB 4ZCMA 3KJIA 4JVSB 4OI4A 4UXHA 5L3QB 3CRW1 2P5SA 4PC2A 1IQPA 1W2HA 4B2PA 3BXZA 5FL7A 4MGKR 1LNZA 4BLRA 1KAGA 4I81A 5KPJA 5KPDA 1E1QD 1DPFA 5KSOA 2OFOA 3UWKA 1NP6A 5FOXA 1XB2A 3AVQA 2QAGA 5KNCA 3TKLA 1VECA 4NYIR 4D4LA 3QI2A 1GL9B 4YXWA 4DB2A 4EPVA 1E9DA 2FJUA 3S1AA 4BWYA 5K8TA 1VG0B 4Z1MA 5DYIA 3BFVA 3WRXC 2IYQA 4D80A 2GAOA 1W5TA 1U90A 4QM7A 2IYLD 4K81B 4Z1MD 4LOAA 1ZP6A 2ERYA 2FZ4A 3AGPA 5JJLA 1CU1A 4RD6A 2YINC 4PHTA 3NHBA 3IPXA 1JEDA 2KI5A 4TLCA 2ZAOA 4EJSC 4TZ6A 3THOA 2O8DA 1KJYA 2C95A 1D9XA 3RS7A 1FUKA 1TADA 4R98A 2QMHA 3VHLB 4C4PA 1TL7C 2EW1A 2HF9A 3AUXA 1G20E 2OAQ1 3NC0C 2OLKA 4WVFA 1KO5A 1XXHA 2EWWA 1ZD9A 4LGMA 4PPFA 5DO9A 2WBLC 1RRCA 2QT0A 2P65A 2C9YA 2FG5A 2WWGA 4TMTA 3THYB 2PZGA 1KI6B 1F5NA 3V9PA 3ECCA 3CM0A 2F6RA 5CM9C 2OSBA 2FWRA 3ADDA 5C18A 2A5GA 1ZJ6A 4A9AA 4XWKA 3CRQA 2QAGC 3K9LA 4M22A 3U6BA 4MUAA 2G0TA 1N2CE 4JLMA 3QBVA 1COWA 3SHWA 1H8HD 4DBLC 3R9IA 4XVRA 2ZS7A 1W49A 1SVIA 4LJAA 3I4LA 4IXNA 2WMOB 2GXUA 3B85A 2N1BA 2PMKA 3BERA 4NP6A 3K70C 2C9OA 3SEAA 4OI0A 2F3TA 5KNBA 1CXZA 4MGZR 3HYTA 3LAWA 4HUQA 1U9IA 3H4MA 2ZI5A 4V0LA 1T3HA 2FFAA 3GLHA 3T61A 4AY2A 3THWA 3J81k 4A82A 3DM5A 5LDDC 5G41A 2WWFA 1S4QA 1KNQA 5GVRA 2OG2A 2ZREA 4P4SA 1E2PA 3CWZA 3KFVA 5DI9A 3RVBA 4C0SA 1WBDA 2FU5C 5JECA 4FMDF 3SU8A 1E2HA 2RGGA 4WXRA 2IK8A 2J7PD 2PL3A 2VF8A 3RRMA 3T1TA 1A4RA 1E2LA 2A30A 4LX0A 2FFBA 2XSZA 3EIQA 3WRYC 1P2VA 1II0A 1OXSC 2UZ3A 4V0NA 4X8HA 5DN6A 1T4GA 1KDTA 5E7MA 4IDOA 3U6KA 4XWAA 3I5YA 2FV8A 4TL6A 5EP1A 2DWPA 4CEHB 2GZHA 3UPUA 3CW2A 1TAGA 1U0HC 5AJZA 4ZKEA 1TPZA 4MRSA 1QVRA 4GMDA 4URWR 1YHNA 4A0FA 3UMSA 3ADCA 5CJPA 2FMXA 3T1VA 5FBQB 1W44A 1Q0UA 5EXTA 4EQ6B 4JL8A 2OT3B 1KK1A 3BB1A 1NRJB 5AWFC 1XEXA 3MRSA 4O0MA 2CJWA 5JJKA 1EGAA 4JKYA 4V03A 2B6HA 2AXNA 2WKPA 4GOKA 3HU2A 2H16A 3C15C 1ZBDA 3AQ4A 1S96A 4MYCA 1N6HA 1NIJA 2CL7X 3R9XA 1GL6A 1G41A 2XTMA 1UKZA 3WMFA 4PPNA 2CHGA 3SYNA 2ZE7A 3EA5A 3UG6A 1M2OB 4LYJA 2CCKA 2D3WA 2G88A 2V8OA 1RC8A 5CJ2A 4JLAA 3ZDQA 4C7OA 4GDFA 5L3SB 1OIVA 3PENA 2HF8A 3D31A 2BBOA 2A7QA 3HPRA 4MKGA 4MGYR 4HZUA 1G21E 3GJ8A 3B1XA 1KO7A 3E2IA 1HQCA 2SHKA 4PXAA 4M1SA 1FP7A 5IRCD 3WXMA 4RJLA 2WOJA 1XEWY 1KAOA 2ZM5A 1XMSA 3SC3A 2A9KA 4QJ3A 4NKRA 1IJFA 4XVUA 2H17A 3PEVA 4JBXA 2XB4A 1ANKA 2ZAMA 4Z54A 3DPUA 3HU1A 5DHAA 5HZHA 3EA0A 1FW6A 1JEEA 2XZLA 1ZNZA 4KFRA 2EFCB 2IXGA 4NYMR 4W5WA 3UG7A 1ZCAA 1WCV1 3HP1A 3K9GA 2VLIA 1FUUA 4PAQA 3QUSA 3F0TA 2Q6TA 5EXPA 8OHMA 4QNRA 4US2R 1T3LA 4R71A 1I4LD 1NBMA 3RNLA 3O8DA 4ASUA 2WTUA 4M0LA 5CIQA 1EWRA 2IEZA 3BOSA 1NN5A 5G3YA 2QG6A 2WJHA 1CR1A 2AFIE 5CB6A 3QF7A 3RC8A 3IIJA 4HAYA 2FZLA 5CDFA 1N5JA 4IDHA 2OAP1 2EFEB 4MYUA 2XZOA 3FOZA 2ODNA 2J45A 4B6FA 2HCBA 3EZFA 4OQFA 4YMUA 3TW4A 1RE0A 5B58C 1BKDR 2FSFA 2RGBA 5HZKA 1LS6A 3OFNA 4JL5A 4LBWA 5GJVC 3AVXA 5FTLA 4IOJA 2V6IA 4RD1A 2CMKA 3C41J 3DVLA 4JVNA 1TU4A 3WYAA 1ZNWA 3B5JA 3OZXA 5AUQA 4L9SA 1FTNA 1GWNA 4CZ2A 1XEXB 4A36A 4QHSA 3BE4A 3N70A 1JQJC 1G1MA 4FMCB 4TT3D 1EX7A 4FINA 2QGNA 5AJVB 3O8CA 2XOKD 1UBEA 4C3ZA 4JT2A 1GDDA 4Z51A 2Q0HA 1EK0A 5KNDA 3K70D 2P6NA 1VCMA 1F2UA 5LB4A 1R0YA 3QENA 3FHCB 2ZVQX 3DOEA 4ESHA 1J2JA 1P62B 1NSFA 4Q66C 3VKHA 2UKDA 2CNWA 4BPBA 5DIFA 2JJ2D 4HI0E 3QY0A 2Z4SA 1F48A 1L8QA 1X1RA 5JRZA 2QRZA 1O3YA 2B21A 2P5TB 2ZANA 3KB1A 5GJBA 1IONA 2C04A 1SXJD 3V00A 1W1WA 1DO2A 2AXPA 3B1VA 3X1WA 1DVRA 2O8EB 3LV8A 3B60A 1VG9B 2AD5A 5J4LA 3CBQA 5J4YA 3UIEA 1KSFX 3W6NA 1Z47A 5F2EA 4AKGA 1NLFA 3CB4A 4PAMA 1GITA 2LCFA 5SZJA 1VPLA 5EZ5A 5LPNA 2B8TA 2F1IA 3LD9A 4HB4A 2O8CB 2AFHE 4TTRA 1YKSA 1QF9A 2ANBA 2IYXA 2ZJAA 1US8B 2JLVA 1Z6AA 1W36B 3X1ZA 2AWNA 2IYZA 2N46A 1DAGA 2BKEA 3IBGA 2OM2A 2PLRA 3PUZA 3HPQA 4MGIR 4AURA 4OQMA 2GK7A 2QE7D 2OEPA 2O8BB 3IHWA 4D2IA 1Y63A 3KQUA 1R5NA 1P9NA 1SGWA 1ZM2A 1BIFA 4B3FX 3NH6A 4Q9LA 4HAVA 1GKIA 3RANA 1QG2A 3MG9A 4Q1AA 1KDPA 4TLAA 1WP9A 2HXSA 5L8VA 1I2MA 4TMZA 2OE2A 4GNKA 3ZVMA 3U7HB 1AGPA 2R65A 3TK1A 2FDCA 3RDPA 2XAUA 1KMHB 3BRWD 1E9CA 2WJGA 1TQDA 5TB5A 4BASA 4M9ZA 1H8HA 2P6UA 2XITA 4LBYA 1DEKA 3LDAA 1N3BA 4WW0A 2CE7A 5JWHA 2ZRAA 5KSPA 5ANRB 3WYFA 2IW3A 3BFKA 2QAJA 3A1UA 1CBUA 1NVVR 4M1KA 5L3SA 1AJEA 421PA 4XOIA 5C2JB 1E79D 1U9IC 2WKRA 2BEKA 1N6PA 1VYUA 3LVQE 3T35A 2ONKA 5GADl 2YWGA 4XH9B 5KO2A 1ZMXA 1G16A 3DL0A 3QOFA 2WSMA 3OESA 4EFNA 4I1UA 2ZE8A 4B76A 1S8FA 2QT1A 3K9HA 1RPZA 3MSXA 1TU3A 2OXCA 1XTIA 4YMSA 5GJWC 3BH0A 1JPNA 3M0EA 2QP3A 1SKYE 3EZ6A 1CTQA 4IJMA 5DSZA 4NU0A 3R8CA 4QBGB 5FFMA 1PVOA 2OCAA 3L8YA 3CH4B 3EC2A 3TVTA 1LFDB 3VR4A 1Z06A 2QP4A 2ZRIA 2DHRA 4DC9A 3THYA 1E0SA 1XD8A 5J5CA 4Q01A 2PCLA 3NG1A 1COWD 3R9WA 2UZIR 2GEVA 2QP9X 3RRYA 3DKVA 4JVLA 3REGA 1R0WA 1UPTA 1DOAA 3GFOA 4OHXA 5EP2A 3Q85A 1P3JA 2F9LA 3RSOA 3FHTA 1JR3E 4I1SA 5FI1B 3V4RA 3IGFA 1XMVA 2VP4A 4YXWD 1G5PA 1LF5A 4U7DA 3KXIA 4EPRA 2FEOA 5KOYA 3EARA 1PZNA 3KFXA 2ZETA 2ZI6A 4URYR 3ZLJA 3LW7A 1LW7A 4LUCA 3BS4A 3FKSA 3QKSA 1KKMA 1ZIPA 1A5TA 3HR7A 2R62A 1IAQA 2WJVA 3GD7A 5FH9A 2G77B 4F38A 1NN3A 3FKSD 4DKXA 5UKDA 3BWDD 2D2FA 3KB2A 1N5KA 4NCKA 4TMXA 3K8YA 2IWHA 3CIOA 2QAGB 4ILEA 3FDIA 3U3RA 2YOFA 2O0HA 2FE4A 4R7ZA 3CKLA 2REXB 3X2SA 5CB8A 1T0HB 2O5VA 1OJLA 4KVGA 4DLRA 3A4LA 4A8JC 4ZV4A 2CCJA 3EW9A 2RCNA 4FCTA 4F93B 1G8FA 4QRHA 1HEIA 3K09A 1MH1A 1NF3A 2NTYC 2XX3A 4GFDA 1DBSA 3I3SR 3WY9A 3BB4A 3K70B 3OIUA 4TQUS 4A6XA 1R7RA 3IQWA 1JR3A 3QKSB 3BC1A 2WJIA 2CK3D 4FMCF 5TY0A 2FPMA 4JVMA 1II9A 3PUWA 1W36D 4BRWA 2GEDA 5A4JA 1LS1A 5AK0A 1M7HA 1XDBA 1ZUHA 4PTLA 4JMPA 1G3IA 2HUPA 2XNDA 5SZHB 5JSZA 3W8RA 4A8JA 3RWMB 1XJCA 3GCGA 2RGXA 2IXFA 1S9HA 1V43A 2HV8A 2NPFA 1IN8A 2RGNC 3LBNA 1F2TA 3VR1A 5K8LA 2A5FA 4QJ5A 1YJ5A 2KE5A 2LKDA 1OT3A 2O0KA 3PXGA 2A5JA 1Z63A 4PQFA 1KKLA 1TQ2A 1TMKA 4ZO4A 5KDDA 4JLBA 4G01B 2OHFA 2ZRLA 3KKPA 1XZPA 5L3QA 1MR3F 2GXQA 2OBNA 1IY1A 1NKSA 4XTCS 5E3HA 1DAHA 4FI3C 2WMNB 4Q03A 3TUZC 4CEIB 3CONA 1AS2A 1YRAA 3LXRA 5HTKA 1G291 3QIAA 2KB0A 3K09C 2RB4A 4DDWA 1WA5A 4DLXA 2ZRKA 2QZ4A 5F3WB 2ZSFA 3VTKA 4A1FA 1E2JA 4DCUA 1OYWA 3GPLA 1KYIA 5H70A 1SVKA 2ZJBA 1DS6A 2OBMA 3EZ9A 2BOVA 1KJWA 1T6NA 1PJRA 4CYMA 2NPIA 1GRQA 2AKYA 4B71A 1EFRA 3ZD6A 3CLVA 3I92A 1CR4A 3KQLA 4ZIRB 1BOFA 1GNRA 1RYFA 4B33A 3ADKA 4OHZA 5TDHA 4PFSA 2OESA 1L4YA 2CCGA 4BFZA 2VSXA 2W0SA 1U8YA 4GSYA 3KL4A 1SXJE 4AKEA 1W2GA 4DB4A
chains in the Genus database with same CATH superfamily
4OQNA 3NHJA 2Y1WA 3VM6A 1H5QA 1GPBA 1R6BX 2CNNA 2GJ4A 4NU6A 5TVGA 4EG3A 1G2PA 3AT1A 3ND9A 4ML3A 4N3CA 3OKPA 1S2OA 3KEOA 1V9SA 4YR7A 1CQXA 1ZVVA 1YQXA 2J3JA 3E18A 1YR2A 2FN3A 4M8NE 3L7BA 2JCYA 1KSGA 1KJ9A 1L1RA 4Q39A 1F8XA 4TV9A 4D6PA 5K4GA 3COVA 1OUMA 3KZXA 3DMRA 1BYUA 3RRNA 5AFSA 2IUEA 1SC9A 1J8FA 1PV4A 4D9IA 1AXRA 1Y6RA 3ESZA 3FH0A 2AL7A 3ILYA 3GUCA 2G4CA 2XTJA 4JZKA 1E1NA 1BMTA 2YASA 3IMKA 2I2BA 1X42A 5CFZA 2UYHA 1XMIA 3C3PA 3F8TA 3PPWA 4P93A 4ND6A 3SVZA 3UWOA 3E1GA 3QE9Y 1T5LA 1Q12A 3SWWA 2ZIUB 3EW7A 3SDBA 4ZDKA 1PL8A 1EH5A 1T5IA 3OIWA 4CR7A 3MW8A 1SBNE 5IHPA 3JQBA 3ZCPA 4KN5A 1JPJA 1PX2A 1S2DA 3QM1A 4TS9A 5LNK6 1JMKC 1SMKA 2LXNA 3T5DA 3P52A 2IC5A 4LS3A 5AK4A 3NTOA 2GZAA 4N0EA 5EQDA 1BC5A 2PE5A 2CJXA 1J90A 1GGFA 3QFHA 4AQDA 4BRZA 3AVYA 1FSSA 4FBLA 3AJ9A 4WY8A 1JQEA 2OQIA 4DDTA 1Z3CA 3IEUA 2HLDD 4UHJA 3I6BA 4GR5A 4AG6A 3QFSA 2E7ZA 4CCSA 1KFEB 1P5FA 2JFQA 3ZWDA 4O5OA 4BN4A 5JH7B 5J63A 1FTYA 5BW8A 4WZBE 2Q4BA 4G81A 1H2ZA 4FSXA 2XW6A 1P8JA 5C8YB 3P8ZA 3Q7EA 2IUUA 4LW8A 3VAZA 4G26A 3WO1A 5A5DA 2BDEA 1VG1A 4Q93A 1ZUWA 5F98A 3CUSA 1C0LA 2IPMA 3TX6A 3H83A 1FJGB 1ZAKA 3LQ4A 4PGAA 4WCFA 4DTIA 1C9DB 1T15A 3ORRA 4CKWA 4DV7B 3H2KA 4LZPA 3R76A 3TXXA 5LOVF 3EQ7A 3I9NA 1OFUA 5E6UA 2D54A 3PJGA 4AMYA 3ZDRA 2L17A 2HO4A 4FCCA 2G09A 2WHPB 1Y3FE 4HPWA 4NF2A 1PEYA 1D04A 4FB5A 5JO0A 2BFCB 2XQVA 2C1XA 2W00A 1YZHA 4WCVA 4EA6A 4MI3A 1JFFA 2D1SA 2SICE 4HEQA 2W6IA 2XRYA 2FSIA 3ROEA 4EKIA 3TGLA 1K8QA 3KC2A 4JQOA 4DANA 2XMGA 2EP5A 1F06A 1XRLA 1Z12A 2GZMA 1PDOA 3ADPA 3LX4A 3NBFA 3TD2A 1AK9A 1LV7A 5EHXA 1ORRA 4RWZA 4EECA 1QWOA 4EOGA 2MTBA 2J7PA 3DMDA 3R0IA 5HFNA 2WZDA 1RKXA 1GV0A 2BR3A 5FHRA 5C52B 2JIOA 4B0PA 1W8DA 2YHBA 3OTOB 2FPLA 4I9HA 4XQGA 4E09A 5ULLA 2AR0A 4HWSA 5F7JA 1A5SB 1X9HA 4LX8A 1AHNA 1HT2E 1QO0A 1XD2A 2AQHA 4L8VA 1HT1E 2JFYA 3W9BA 4BP9A 3F73A 5LDHA 2EDAA 2PBZA 2XE8A 2PZJA 3IKVA 4JUBA 3B12A 5E1BA 1MGOA 3PS9A 3UMFA 3HACA 3OETA 3EFOA 2CXRA 3DZIA 4Y1FA 5FTMA 4BGVA 4LFBB 2YN0A 1QU3A 1DWOA 1E2EA 1MVNA 1QRAA 3Q11A 4IDPA 4DJTA 1E96A 1ESNA 4ZXFA 3QWBA 3MCTA 3RYFB 1M83A 5KSZA 4GKKB 4YJ2A 5DF1A 2EZ4A 4Z4QA 3EF1A 4RVSA 1SPBS 4BMDA 4OHYA 3FB4A 5LUBA 2XMRA 2WJPA 2LGJA 2G6TA 3DM9B 4H6PA 1ZGGA 2GNPA 5F64A 4YGYA 3RUCA 4B31A 5ITWA 3FIUA 3U56A 2OK7A 1ZOIA 4E6EA 3VR5A 2DYKA 1D0SA 3WP1B 1G19A 4JJ6A 4EO4A 2PD4A 5FFFA 1P7CA 2Y0BA 3U80A 4QTXA 3WHKA 1XNGA 3L7KA 1I2BA 3NVDA 1TJ3A 2WYOA 5F52A 2JK1A 4M37A 4MARA 5JS2A 4XM0A 3HVUA 4WZBA 3SGLA 1C3EA 3HI4A 1OX6A 1OA0A 4L8FA 2HK6A 5MGNA 1OT5A 3GFFA 4ZYUA 2R2GA 4MA4A 1HG1A 1CR2A 4WNAB 4CDNA 2QN6A 3IESA 3E3LA 4HY3A 1SFRA 2FYTA 2XCTB 4LCJA 4ER6A 4UCQA 1RI4A 4ZVRA 1PLLA 4WESA 5E3IA 1EK1A 3K0SA 2EBHX 2XBLA 2NT4A 2CVOA 2IEAA 2VJDA 4H7JA 2ZR8A 4CLRA 4AUNA 3MGGA 2A58A 2NZWA 1NOIA 3L0PA 5BV2P 1UKBA 1G3QA 3JQPA 1QVZA 1GG2A 3R7BA 3QK7A 4YRAA 1J56A 3OEHD 4TV9F 1L3CA 2HJVA 4GC5A 4JLJA 4DEVA 2BMFA 3KLBA 4EK9A 2KSQA 4EAQA 1QU2A 1R0CA 2YC2C 4TZ0A 3VYTB 4TMFA 5M34A 3B38A 3G9QA 2H59A 2QPTA 4OIMA 3IT2A 3V2IA 1WHSA 1E1CB 3BVPA 3FAKA 3MUOA 4AF6A 3EXHC 5DWDA 3U60B 1C3OB 2C3MA 3P4XA 4IIJA 3X1KA 4KSCA 3JZAA 1RQ7A 4FHDA 4ZVUA 2W4MA 2POCA 5REQA 4G8CA 5HK9A 4QXPA 2WIJA 3I9MA 4NEHB 4UVHA 3PJEA 2HLNA 1E61A 1KETA 4WCFC 5J1TB 3T3IA 3VRHA 3FOFC 1VI2A 1RRPA 1DKLA 4JB2A 3EGDB 4EZBA 5BR1A 3MCVA 3PRHA 1WZNA 2JGJA 2REQA 4M1MA 4RL6A 2RI1A 5EIAA 3ABSB 2B1QA 2ZPAA 3KOMA 3L6CA 1NMXA 5GM1A 1IXYA 3RG8A 5IBCA 3MPOA 3TB4A 4WN9A 1ODIA 3SX0A 3ZCUA 5HWSA 5AQEA 5EJEA 1VPDA 1H8ED 2RC5A 2WF7A 3A31A 1X92A 3I58A 3L7MA 3VZQA 4BE7B 1G38A 2AC7A 5BOSB 1MC8A 4J3JA 1TJNA 1GQOA 2A5DA 1LFAA 2DGDA 2Z8YA 3MD0A 3PE6A 1WCIB 5EAIA 2PQ0A 2PV7A 5EP3A 1R3UA 3VISA 2UZ4A 3UUFA 2A3NA 1XEAA 4BWGA 3FZEA 4CMJA 4NQZA 1B6RA 2DF8A 3HI6A 1B14A 3IAM6 3WGLA 1QPZA 1JILA 2QW0X 3HKCB 1D2MA 1SCDA 3EMBA 5EY5B 3BIFA 2BHRA 3X1XA 4BJ1A 5EXXA 1Q17A 1W9MA 3SFVA 4EIWA 6GPBA 5JCZA 3OICA 4JP8A 1N3IA 4B74A 3RSHA 1SELA 1Z2PX 4FOOA 4YV2A 3DYVA 3D81A 4NV3A 1JA1A 5ALQA 4YUZA 3GG2A 1ELOA 1E4VA 2QLLA 2Q07A 2Y6VA 4DRYA 2CL0X 121PA 2GAJA 3S2GA 5C5DA 4KN8A 3LQ1A 1U31A 1A9XB 3BXGA 3N0RA 4IJQA 4HVLA 1HNXB 1XCBA 2PEZA 2VDUE 2DPMA 2BP7B 4FYIA 2VJLA 4JP2A 3LOUA 2C2KA 1C4OA 4B79A 2F9MA 2C29D 3D43A 1L2TA 3SKVA 5IFKA 2PKQP 1KMCA 4HDOB 2YX1A 1Z3IX 3A1TA 3DDZX 3I9KA 1J8QA 2FW9A 3ZD7A 4PR0A 4QGHA 1PYDA 1CRWG 1QHGA 4GM0A 4D3YA 2B8NA 1U0LA 5T4HA 4YP1A 3LY9A 1SOAA 4MV5A 2XDQA 4LZZA 3EXHB 4FEEA 1P5JA 4Z86A 4DCGA 5J3JA 5JJIA 3W5VA 4PBRA 1Q0SA 1VJDA 2FEPA 1VI5A 3DEZA 3B7PA 3TM5A 5IC4A 2R9VA 2HR1A 3CWQA 1A2BA 1CX9B 1KKUA 2F3UA 2WJ4A 1G5FA 1U7OA 2EBWA 1KI6A 1W0JA 3AFOA 3BFJA 3U7IA 3V8RA 4AJ9A 4DCTA 5E2AA 1GA6A 1U0NA 2QZ9A 3KVRA 3LH5A 4J0GA 4M8SA 3UXYA 5L51A 1TK2A 1JG6A 2FQXA 4DC1A 1UBHS 2YNMC 4Q02A 5JZ9A 2V0NA 1BD3A 1BGXT 3EEYA 3IQXA 3FHOA 3NWBA 3P2OA 1QHHB 2W6JA 3GLHB 3COPA 3KQWA 3MGKA 2D2VA 2B8WA 4IVQA 5ELMA 1QO0D 5KDOA 1D7OA 1P0FA 1FRQA 1KGSA 3OPXA 3R8FA 3DLCA 4UDYX 4DCNA 3CF4G 2ZATA 2IA5A 1WRBA 4YDQA 2V59A 3PB3A 2QMYA 3CKYA 1ENZA 3OTGA 4UQOA 5C53B 3LQRA 5HYVA 1V2GA 4CLOB 3ZH9B 1FYEA 2F43B 2VF5X 4Q00A 2HF7A 2R751 3USCS 4EX7A 4ZOEA 3FVWA 2X76A 4XI9A 3KS9A 2DFVA 4UFNA 5AHXA 2FSHA 2GJ9A 1LUAA 1Q5PA 3QLUC 1N6LA 2PZKA 2CMDA 1CUSA 3GJZA 4AXXA 1Q21A 3H2IA 4MIEA 3KZMA 4PSVA 3GLKA 2B4RO 3K4PA 3TSZA 3V8NA 3NXSA 3GI1A 3DQQA 2CVFA 2EOAA 3KOYA 4FOLA 4OUDA 2VRWA 3QE0A 3T7RA 2Q1TA 1F5SA 2J0UB 2AG5A 3DEKA 5CH8A 4QNNA 2GF9A 3PNOA 2C61A 2XCSB 5B7NA 3FVVA 4KGVA 2REBA 4YMWA 2CNWD 2IOQA 4PAOA 2PJRA 1T8UA 3D7NA 4GG1A 3A6EA 1KHTA 3ZNOA 4RJ2A 4RJKA 1T1JA 2VPYA 1H1TA 3AXTA 4F8YA 4IJ5A 1Q3KA 1RWPA 1U7PA 2NNWB 5AVVA 1L7DA 2Q4TA 1ZHHA 3OT1A 4BQOA 4IY1A 2DAPA 2ORYA 4OXXA 4UC0A 2QRMA 1J21A 1BWSA 5GMOA 2XB2A 1FXUA 1X9GA 2IDZA 1D0VA 4TVOA 1V95A 5EL0A 5G0TA 2Y2VA 3QEAZ 1PWYE 2JASA 5AK3A 2YRWA 2GCPA 1DG9A 4B80A 4DY6A 3QSGA 4LXXA 2F8TA 1Y81A 4KAJA 4RU1A 4XVQA 5EE5B 3JWJA 4H9GA 1RLMA 2AWOA 1KERA 1KI2A 3KCQA 1U7XA 2XVMA 1T29A 2P9FA 1G18A 3PEEA 4HWGA 5J4VA 3JQ8B 3NHPA 4BNWA 2JGFA 4MDEA 1ONBA 3Q1KA 5JY1A 3L92A 1CHDA 3DF9A 1YO6A 2QRQA 3LP5A 3OE1A 3IE0A 3DAFA 3TEJA 3SR4A 4BX8A 1CT9A 2VQEB 5TQ2A 3EQ8A 3BMQA 5KYGA 4OGLA 1TK3A 1U2QA 2AMFA 4ZQGA 3H0KA 4ZC1A 3SBDA 1VMEA 1Z5GA 3UFXB 5CCEA 3IP9A 1OJ7A 2Z4TA 3LY5A 2B99A 1JYFA 2F3QA 4Q9IA 1OV4A 5LP6B 3OUZA 1I7QB 1IMOA 3DE0X 4TVKA 2O0LA 1N6NA 2WV9A 2QENA 2QRKA 3Q87B 1S1MA 1YJXA 1VHLA 4H6WA 2WNHA 2I67A 2JD1A 3TRFA 2R84A 2QQ5A 4S0ZA 2XVXA 2Y6UA 3QYAA 1Z0IA 3N0WA 1W93A 5P8WA 4RE5A 1Z8HA 4PSDA 3A14A 3HVIA 3LUKA 5AI0A 3ZX4A 1R10A 3IBYA 1E1KA 1JQKA 3K5WA 1UAYA 1AX9A 3AHDA 4NSNA 2GTHA 1YVDA 4J6FA 1BROA 2JA1A 1ENYA 3OIVA 2PUBA 1QYXA 3D3JA 3CISA 1E4YA 3EUWA 2WWWA 4EENA 3GLIE 5BORA 3B1JA 2QMUA 1U6JA 3OCCA 4GKVA 2O2HA 2GYYA 5JZBA 1A1VA 2XYVA 2P75A 3DXZA 2IPOA 4BECA 3FYHA 1HL7A 3FOBA 2IJGX 2PTGA 2LP4Y 3D6JA 4P36A 4ZAVA 4UM9D 3L3BA 3T94A 4INZA 3SQMA 3IJPA 4KSBA 4XWOA 4J2OA 5K1ZA 4MVJI 5DU2A 5JZVA 1R0LA 3N2YA 4DT1B 2QD1A 1OX4B 5L7YA 2HSDA 5G4LA 1J0CA 4DCVA 5LOVA 2G82A 5JFGA 3HSKA 2BELA 4X93A 1LNQA 4ENRA 5F2NA 4UFOA 4V3BA 2NAPA 4UTZA 5LQUA 1A5ZA 3GCDA 1NSYA 3C3BA 1F12A 1ZVQA 2ZUUA 1E7WA 1SPXA 3W06A 2RJOA 1L0BA 3I52A 2ZUSA 4CQLA 1NW6A 2AEJA 1Z6ZA 4A92A 1WMDA 2GYWA 1PSZA 1I7PA 2UAGA 3PLAE 1P1JA 5AICA 2Q5FA 1QGUB 3EMKA 2V7EA 1CUUA 4W1QA 1E8DA 2BV3A 2ONYA 3U7EB 4F5ZA 4JLWA 5ESDA 1Q1NA 1ZWLA 2WNIA 4QUAA 2BWJA 3DLPX 1E8NA 2OHIA 3THXB 4H31A 3NUZA 1BWRA 1U0FA 1MNAA 2F1HA 3AI2A 1RJFA 1GPAA 2QPLA 4F4UA 1F38A 4EH1A 4JYBA 4PBSA 4MVWA 1P1HA 1Y6QA 2ZSBA 3IC5A 4FIZA 5IEJA 1SZPA 2C78A 4HNQA 4P5EA 2HU2A 2FOXA 2XTZA 3EHEA 1E77A 4P4LA 2NZVG 3ZQ6A 2CYBA 2GD1O 5AHKA 1LSJA 1UC5B 4F04A 3RHSA 1OASA 1X0VA 4EY3A 1XHEA 4MR9A 5HUJA 4KR2A 3D4NA 1GQQA 3T3GA 4RKEA 2G4LA 2OV2A 3BHNA 1J0AA 3CPEA 1U04A 4C4RA 3L8MA 3T9EA 1XX6A 3UAOA 2OCLA 4CMGA 4EEZA 4K86A 4TMKA 1MXFA 3VKFA 1Y34E 4IDBA 5EG5A 1RVV1 3IPRA 4RJTA 1HFWA 3BKXA 2IITA 2Z83A 1DG1G 4IIXA 1E9BA 4Z1OA 3KKQA 1W1UA 3LOPA 2XNDD 1TZCA 1YZGA 1SXJA 4C7MA 4ZK2A 2H00A 3MRTA 4Y2SA 4WBNF 3N5CA 3IR7A 4OOEA 3HK2A 1J70A 1CUVA 1W4ZA 5AVXA 1V4BA 2AK3A 4IM7A 1BWQA 3R7WA 5J4KA 4L8GA 1MDBA 1O96A 1SN7A 3W2IA 1V5IA 4DPLA 5C34B 3LKDA 3VNVA 4M89A 1F8YA 2ZUVA 5JV5A 4BFXA 2XE4A 1T8PA 4Y67A 2OC9A 4FXOA 1E63A 1Y6GA 4ZEMA 5A9TA 1YACA 3T12A 4G1MB 1EP3B 3F7OA 2A9PA 3BH7A 3RV3A 4Z49A 4GW3A 2FF7A 2H4HA 2PX0A 3N2LA 4JLPA 3P9PA 1QK3A 1SVMA 1UP6A 2JLXA 3FE2A 3AF0A 2Z2IA 3FKJA 4B8YA 1SQSA 3TGWA 3BBPA 4NBNA 2GFIA 4DUPA 3IR5A 5BPHA 3H3XA 5JWRA 2Q1SA 3B6ZA 4K6GA 2WD7A 1QZUA 3QNUA 1E2UA 2EJUA 2WYIA 4L73A 2ZIAA 4ITRC 4LGYA 4UCWA 5IVIA 3S2IA 2C83A 2DUMA 3D7LA 5FBHA 2XDQB 1LVGA 1AN9A 3BZUA 1MDFA 3ESDA 3JAKB 2HA7A 3PTZA 1GFSA 4NECA 3RJZA 5F2OA 4D3XA 4DNQA 3MMPA 2E5WA 1GTG1 3BMCB 4JD5A 4GHWA 5IZCA 3FF4A 3NDJA 2VTDA 2ZRNA 1JHMA 3G5AA 4K6OA 3RAPR 4N9QA 3N8NA 2D3TA 4IIFA 3FX2A 5BNZA 4K0KB 1O5TA 1AQUA 3UY4A 2VLBA 4PPQA 1U2GC 3RBAA 4OX9Y 1RS0A 4I1OA 1RWWA 3PQFA 1J1IA 1Z73A 4NBLA 3EK2A 1UBFA 1PO7A 1MENA 1TU0A 4MVXA 1ILEA 1HQYE 1OPRA 1QUEA 1YIAA 4BQPA 3NTUA 4TLMB 3CVOA 4MQEA 2JLYA 4RH0A 2HXGA 4JKOA 2NU7B 5HDBB 1TEZA 1RKBA 2AJTA 1AKRA 3N74A 1QMPA 4W7SA 2YZ7A 4RD2A 3PGJA 4BFUA 4X24A 1ND6A 1Q19A 1SC4A 2EQ5A 3AESB 1NY6A 2QI9C 3HKCA 2PY6A 5K09A 5TPWB 1DKQA 3HS3A 3QP9A 1F6WA 1FUEA 2H9AA 3R5HA 4U6NA 5B1HA 3UMJA 2K7FA 3GBPA 4EKNB 4LBVA 4R2WA 3S29A 4QGFA 4E5YA 5B6IA 1INLA 3PWSA 8MHTA 1SKQA 1Y8RB 3TKAA 4PHHA 1V7PC 1MO6A 1DBQA 3H0EA 4NJEA 4OJTA 5MGBA 2P9CA 2WM9B 1KZGB 3QFFA 2JVKA 3B3GA 2FN4A 3NYQA 4ZOCA 5IXYA 1H0HA 2QORA 3O92A 1NBME 4Q3NA 1DDGA 3UJHA 2V1UA 3IBTA 4A26A 2IL1A 5CB4B 3MS7A 2ZOSA 1C7ZA 2B1GA 1ADJA 1K9SA 3C3EA 3KJGA 1EFHA 1WSBA 2ZAGA 3DOOA 2Q8PA 1R3DA 1WF3A 4FHZA 4GAEA 5CFMA 1JALA 3O74A 3V2HA 4BNDB 4RZ2A 4NYIQ 5BMOA 4QSHA 2UYCA 1N6IA 1G8YA 2C88A 1MC1A 4PZDA 3D7RA 5CLIA 3MT8A 4ZEOA 3HC7A 4OYRA 3SK0A 1TECE 2CV0A 3EPRA 4JN6B 1A88A 1J9ZA 3KBOA 3VPFA 1SQ5A 3DLAA 4Q18A 2VK1A 1VGVA 1A8SA 5H5JA 4GGOA 1CY1A 2JCSA 1FNDA 3M6LA 4RPKA 3DV0A 3QG1A 1BH2A 1GZHB 1UF9A 4Q3LA 4CLRB 1ZM7A 4TKUA 4ZDIA 1NXXA 4XCXA 1JBKA 1B0UA 1ZXXA 3FNQA 5DM60 621PA 4IJWA 1GTZA 3LX5A 1SCQA 3OQVA 2XCQA 3QVKA 2BZ0A 3W7BA 2VHCA 2CMHA 3H9UA 4LTDA 1C30B 2Z09A 3NQ41 3P4YA 4KIUA 3KTAA 4KRXA 2IF2A 4I50B 3GOHA 3M8KA 5BUQA 2IT1A 4YNBA 2Q2VA 2RGCA 3CV3A 5CT6A 2O2CA 1TAHA 3DTVA 5HCIA 4AK9A 4B2YA 2P5UA 2JLZA 3LS2A 2Y4NA 1DWPA 1KHHA 3TWOA 5IK2D 3SC6A 2JI6A 1FTGA 2QSZA 2Z3WA 1YUMA 2VP5A 3TVDA 3SIRA 4HVCA 3NTQA 4FEYA 2G40A 4OSOA 2H7CA 1LLCA 1XU4A 4BBZA 4JUDX 1D2RA 1NWHA 1D2AA 2GPNA 1P33A 1SC3A 1WV0A 5HQTA 3K0EA 2C3YA 4GP7A 2Y1LA 3KZKA 4QDTA 2XQIA 1PG5A 3PNLA 3PHJA 2UU9B 3AO0B 3WYEA 2H1OA 2BISA 4BVBA 1L4LA 1SG9A 4DR2B 2O8EA 1TFRA 2AZTA 3HY4A 3MQ2A 3TPFA 1BSVA 4L3WA 2PKYX 3Q3GE 4ARZB 5IZCC 4YAIA 2BBWA 1Z8FA 4KODA 1LBEA 4AJLA 5C8YF 1AF4A 1KK2A 2EIXA 4X8OA 2C9CA 2QX6A 5CNKA 1P2UA 1G6OA 2VEOA 5IJ9A 1FNBA 1WVMA 4AY6A 4AMBA 1V37A 2IV7A 3T0GA 3JAKA 2IEYA 1XK6A 3DQPA 4OHFA 4Y9TA 4COOA 3V1NA 5EE3A 1X7GA 1P6XA 3U16A 4YMGA 4ICIA 5AKGA 3QVVA 4H0NA 2H57A 1EEXB 2DJIA 4W5RA 4MW5A 4I5DA 4PWZA 2FG7C 1Y1QA 4XAQA 1IOLA 1NNLA 3DTYA 3I04A 1J9GA 2VBCA 3SS8A 5K6TA 4YJKA 3V48A 2H63A 1VYTA 5BQPA 1YRLA 2P6RA 3GUVA 1JR4A 4H7PA 5IKEA 4FHCA 4A6EA 2F9FA 1VDMA 1TPYA 4CTNA 3KQOA 1NDHA 1AM4D 1EP9A 3ODGA 1RKQA 4EP1A 1VTKA 3MJCA 2XTNA 2W2XA 1KH1A 4G41A 4N3AA 3DR5A 3GLRA 4P3NA 5E38A 5JD5A 1VE6A 2QNBA 2WHPA 3VR3A 1QXSA 1QVVA 2Q5EA 4FZVA 1KFBB 3O1LA 3QVMA 1WU7A 2AXEA 2KQUA 3CUTA 2AF4C 3IUEA 3MFYA 5IM5A 3LPCA 3TE6A 4IFEA 5CFOA 3SSNA 4TT3A 1Q1EA 4K8OA 4LCBA 1NR5A 3QV1A 3K1AB 1MRZA 3PF8A 3ZE2B 5F77A 3SX4A 3EGOA 3OC0A 1HZZC 3QJYA 2ZS9A 2AVDA 3RUIA 2I1LA 5DYYA 3T54A 4DIKA 2D6FA 3GDGA 4E6PA 1DL5A 3FJYA 3RIGA 3A6ZA 1XPRA 5FKJA 4NCIA 3P20A 3HCPA 4DGQA 1DB3A 1E9SA 3T4UA 2YHSA 2ZU6A 3PD1A 4RFLA 4UPVA 2VDMB 1FMCA 2B30A 3RREA 2Q3EA 3NBXX 4KO8A 3HA7A 4IJVA 4BLVA 3PTAA 3L7OA 4QHTA 3G2HA 1KO4A 2IKQA 2RCYA 2QF7A 1EXWA 1VCOA 1FP6A 2DM6A 2R8PA 4I1YA 4OQLA 3PHIA 1O0SA 2Y9MB 3FMPB 4GYYA 4FGKA 4UFPA 4RVUA 2WHEA 2REOA 2ZWMA 3I09A 1F8GA 2HTFA 3FUUA 3VDRA 5JDIA 3OQMA 3R7NA 3ID6C 1YXMA 4KZPA 4G8DA 2RHCA 1UBOS 1K3FA 2ICAA 3K0CC 1GGEA 4TYPA 1Z4OA 2ALJA 2OC4A 4CT4B 4QG3A 1UK9A 2BUBA 2Q9AA 1EFVA 3V33A 4C04A 2B34A 1J2RA 1SIUA 4MPJA 4KZKA 4C4TA 1YC5A 1IWOA 1MQAA 2H2AA 3DBVO 1Q57A 4N1AA 1KAQA 2W6OA 1XZJA 4P4SB 5ALRA 2GWHA 2ZKLA 1P4RA 1ULBA 3H5NA 3PPYA 1S6YA 4P4GA 1J0XO 3DTTA 4XD7A 3EGXA 4GPTA 2W2PA 4KDEA 1L5LA 2QN2A 2Q2WA 1VGQA 3D8TA 3EH2A 3OM8A 4CETA 2Q4DA 5DGXA 1ESMA 4RHFA 1NMEA 2GRJA 2B20A 3ULKA 4FDVA 1LI7A 1O89A 1ZNYA 4CR8A 2FSUA 4J91A 1WB6A 4M55A 3TQHA 2JAQA 1I3LA 2I91A 2BEUA 4BMSA 1JHYA 3E8MA 3D6MA 4XDGA 1GNPA 1JAIA 4K6FA 4X7RA 2W2QA 2INGX 3F6EX 2ZRDA 1D1TA 4KBFA 4KI0A 5C1DA 4EHIA 4BDSA 3VFDA 5E95A 4JR0A 3R9XB 3SEFA 4DA7A 2IIVA 5AUPB 4LEIA 5FP0A 4QDUA 1CC1S 4LIPD 1CF2O 2J87A 2X3YA 2NO1A 3FLBA 4N6NA 3NBQA 5JBQA 4X00A 1YRQA 1FP2A 2LKCA 5TF0A 5AUNB 4JI8B 4FGJA 2LCIA 4AKIA 4GYWA 2WB4A 4OX9B 1ULHA 2FA9A 2I0FA 2BJVA 1EUCB 2H2FA 1NRXA 3I37X 3IUJA 4LJ4A 1NJSA 2HN9A 4P1ZA 1V8BA 1KO8A 1XCMA 4DCOA 1ADCA 3MT0A 1KZ7B 3ZHZA 2J0SA 1K6EA 3DZDA 1MGPA 3OU7A 4WNIA 5EWLB 1CWUA 3OEYA 1OB5A 3NEPX 4KNVA 1ZISA 3D8BA 2H85A 1FUIA 2FRDA 4OFWA 5FPHA 3N2EA 3P32A 1W5FA 3FNEA 1XD9A 4WECA 1R27A 3OIGA 1R1DA 2G6BA 5I8ZA 2D1QA 5I7FA 3V8BA 4J2HA 3DONA 5DW0A 1WULS 3ZD9A 2C92A 1C1HA 2WIKA 2CZQA 3ESBA 4JJIA 1YIDA 3TDNA 1SXQA 4XWWA 3CKMA 1U94A 2L69A 2VSOA 1IEWA 5F5XA 1H9BA 4LRXA 5JQGF 3HXLA 2WP0A 1GUAA 1D6NA 4Y0AA 3EVFA 5ADWA 1CEYA 2Q9UA 3IV9A 1MA3A 1U3VA 2EZTA 1RHKA 1NKTA 2LR0A 2YUIA 4GZ3A 2E37A 4UHDA 4UU0A 2B69A 1FYXA 3UA4A 1ECCA 4YDHB 2R6CA 3A6GA 3W2FA 5TMPA 4ON9A 2CLCX 1W30A 2VKTA 1EK6A 1M74A 5FB3A 1MOPA 4JLUA 5IPFA 1T9KA 2EFJA 2I7XA 4MAFA 1I4DD 1ZIXA 1ZBQA 2BM9A 2PMWB 2WM8A 1S0UA 3BXXA 3K96A 1M2HA 1BS1A 2HI0A 2YV5A 4S24A 1ZZGA 2O7NA 1QRUA 3FVQA 4L4ZA 2EP7A 2NUAA 2ZIWB 4POAA 1FCJA 3O90A 3ZI7A 3KR2A 3D4OA 2YWFA 4MYTA 1JLRA 2VP6A 4IILA 4EHKA 1M75A 1P60A 3LWDA 3W78A 1I5OA 1R0SA 3E7WA 4QU0A 5AK6A 1VHQA 1J22A 2O0JA 5BQFA 1ZN7A 3R4CA 1GEEA 1D1PA 1I9GA 2BBSA 1ZKMA 2C9ZA 4GSYA 5I4CA 3GJ4A 2WSBA 1NXQA 3II6X 4XDHA 2FWMX 1Q1QA 1U8FO 4W9RA 2BLLA 1B26A 4OHMA 1TUBA 4G0OA 2OV6A 3P9SA 3CZ5A 4BFWA 5DISB 1RYYA 1A4XA 3P5SA 4X61A 3DS8A 3WL8A 3ZWKA 4LOKA 5EINA 2WA2A 1L4BA 5F73A 5KOIA 3A58B 5AKEA 1Q84A 1V5WA 4OGWA 5DGCA 3AONB 1KI9A 2I1QA 1Z62A 3NGLA 4QUGA 5BSTA 1T9GS 3LBIA 2A92A 2W6QA 2WJJA 3E84A 1IIBA 2GN1A 4KXNA 3UC9A 1JHOA 3B70A 3ZN2A 2HRBA 1JA0A 4JDPA 4CG3A 5FX2A 2FETA 1N0IA 3JQEA 1N8NA 5JZOA 2O3QA 2VDWA 4GICA 3DXFA 4J1QA 4YYEA 3WKDA 4E4YA 1O97D 1I1OA 4F84A 3KFLA 2G72A 3AEKA 3FRHA 4C29A 3H7IA 1ZR2A 3ZV3A 2AOTA 4CM4A 3O5AA 2OVBA 1I13A 4F6LA 3AIIA 1UADA 3PWTA 1FMLA 4G56A 4LF8B 4E2WA 3KR9A 5E0KB 2H2HA 2V0CA 1W581 2C8LA 2JDID 1D3AA 2HA3A 2WTAA 2NYUA 1C0EA 2OXEA 2QTWB 3A2NA 1AMOA 2YQ4A 1TLTA 2Q3HA 2W2TA 4FC7A 4FW8A 4MGHA 4Y30A 1ZK4A 1C8KA 2O4CA 5AOBA 2D5LA 1WY7A 1A2KC 5H68A 1E5DA 1T0UA 1S8NA 3RBVA 3V7FA 5ERYA 4A6PA 2PT9A 4UDOA 2D2IA 3JATA 4UQLA 5JS8A 3MB5A 5AKLA 1ORIA 4ZK6A 2PUCA 5JTTA 4ZI7A 2M32A 5SYAA 3K7EA 3ZGYA 3G82C 1OZGA 4IQ0A 5IANA 2BGWA 5KTKA 1XZLA 2HMTA 1E1QA 2RHOA 3N2KA 4UAUA 4EVRA 1JU3A 2J0EA 3WFJA 1A9XA 4I19A 2WQ6A 4S0XA 3VO9A 4DV3B 2NVWA 3ANSA 4OJQA 4KI7A 3V1KA 1JR3D 2OZKA 2GR9A 2QN8A 3KKZA 5SICE 3P1JA 2G80A 1K2VN 3BA1A 3T99A 3T3MB 1RPAA 1G7SA 1CZNA 2GBLA 3BEOA 3IODA 2QE6A 3IALA 5K8IA 4JI0B 4OM8A 4DJFC 2CHQA 4D9FA 3PXDA 4NE9A 2FSGA 4J0CA 4HAXA 2N47A 4HT3B 1M2WA 4EF4A 3ZGZA 1VRVA 2HBRA 3CNEA 5GONF 2Y1CA 3WNVA 4XEHA 4O2RA 1KH3A 4G0PA 1K68A 1V1RB 1DLIA 2DPYA 3AGQA 5ALFA 8ABPA 3REFA 5DLQC 3BMQB 1RJEA 2HRDA 1E7QA 3AZQA 2M98A 3B48A 2V5AA 2C5HA 3SZMA 5ECWA 3MLAA 3IEXA 4N3GA 3QMVA 5E9QA 3OCVA 3FLMA 3IUBA 2WJ6A 4YB8A 1X39A 1B1AA 5JSKA 2AG8A 4YYZA 2GFHA 5E7IA 3VC2A 4LRSB 1W8IA 4LV6A 1K8YB 1V48A 1DU4A 3NHMA 3Q72A 2GAAA 5KHAA 3WLHA 3ZDEA 4FILA 2QD4A 3OM9A 4PZPA 4RANA 1NJGA 4YJ3F 1USVA 4R1UA 1NQXA 4LZNA 3I5XA 1TMGE 4G4IA 2B25A 4QQNA 1KPIA 1GYQA 4HNUA 1JXAA 4LE1A 3WSVA 1ZD1A 3D0OA 4I0WB 1E0JA 1OU4A 1P0QA 2JFWA 3OOHA 1KE2A 3ZJTA 2M6LA 2VZ9A 3MINB 2KLHA 2QTHA 1OFIA 2QROA 4CVNA 2BIFA 4CQMB 4DSOA 2AF3C 4U7TB 3OCXA 1G4UR 4GL4A 3UV7A 2FPKA 4FYPA 2C2OA 3FOWA 3PEFA 4TRJA 4EYQA 2A0FA 1ISPA 3H13A 4MLCA 3Q3CA 5FJJA 3ZNQA 1CJTC 4ZCIA 2PS0A 3DHYA 1E4OA 1TRKA 4MB6A 4P5PA 2WD9A 3NJ8A 4PLPA 3UJCA 4P31A 4X45A 1YNOA 4EBBA 2J67A 1UQTA 3EFHA 1PQ4A 4H1VA 1HYEA 2BMJA 2QR2A 3H1TA 4NFHA 2F48A 4AKTA 3E9QA 2GS9A 1OCEA 5BSHA 1E64A 3DG9A 1EDOA 2CLDX 4UUQA 1LI4A 1PDWA 1B3BA 1R16A 3EFBA 4IDCA 5DOZA 3FYSA 2ZI9A 2A0UA 2FZCA 3H1GA 1CUGA 1Q2XA 3Q41A 1JMVA 4J7AA 4JBHA 1OXMA 4D4MA 4RK7A 4L02A 3KYDA 4P58A 2BFBA 3ET4A 4KO1S 1DE0A 1P1IA 2QUAA 1TGVA 3GYBA 3LZDA 3N7TA 4KQKA 3NM5A 4CL0A 4EHDA 1I94B 2NO0A 2GZSA 4W5HA 1Y8QB 3FCOA 4KACA 2MT9A 3MB8A 1K6MA 1POXA 4BTEA 5BYBA 1GQSA 3GRUA 1EX6A 2JLUA 2IHBA 1A8QA 5J2UB 4UDNA 3QEMA 4GGMX 2HKIA 2CJYA 2P2DA 2V7BA 4AUKA 3P71T 2PH7A 1X1SA 5D3QA 5FAXA 3RU2A 4M1EA 2OORC 4C6HA 4B6OA 5FXMA 3D0KA 4D82A 3ZXYA 1NNEA 1ODKA 1QONA 2QG9A 4BKUA 1E99A 2BHSA 5SY4A 3PFFA 4RHYA 2DLNA 3O8OA 3VJKA 4CHGA 3K8OE 1YVEI 4HNGA 1GPLA 4WOCA 2VCEA 3LFUA 4L28A 4IVRA 4D4KA 1UFQA 1X77A 3QG5A 4BO4A 3R6WA 4JT4A 1E2DA 3TDMA 3OP1A 5IAKA 1Y9AA 5LYJB 4BYMA 1G2IA 1IJBA 4KQFA 3VHXB 1N8SA 3ZDDA 1XCPA 2YVQA 4IIGA 4I14A 4DYVA 3HMKA 3EZYA 4Y2RA 4HEA1 1SOVA 4MP8A 4GL2A 1PVDA 2YMMA 1N5RA 4KIWA 4S1WA 4AICA 4B44A 2VF4X 3LZ6A 5FLXA 1JDJA 4KTTE 4ZAGA 3AYZB 3FYTA 5CIYA 4P7FA 4E5UA 1QP8A 5CM8B 3D6VA 3AW8A 1CB7A 1P0PA 2EFGA 2IHYA 1L7EA 3W5IA 1VBKA 4FZJA 2EFHB 2UUBB 1KEUA 4JXKA 3IXLA 4KP7A 2I8AA 1CDEA 1GT6A 2ACVA 4ND5A 1ZUD1 4Y6PA 1HDCA 1SCBA 5CT5A 1L6RA 3I0MA 5TEWA 1JZTA 3WMRA 3OMXA 1G60A 3NHAA 1Y8AA 3CEAA 4XSVA 4U2CA 5EXEA 1GVNB 5KQSA 2I3ZA 1RIIA 1VCIA 4C0JA 5JI3E 2DH6A 1ML3A 3E53A 2JLSA 3Q8LA 2DUNA 4G4SP 4H6XA 1WW2A 2KYRA 3H2HA 2DBVO 4L22A 3K92A 4CL8A 5I7RA 1IRXA 1DFGA 2UZAA 4KFUA 4RE6A 1YQTA 1AXGA 3K0AB 3WDLA 7YASA 4FDMA 5MFPA 1DJMA 4L08A