1JRFA

Nmr solution structure of the viral receptor domain of tva
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
47
structure length
47
Chain Sequence
GSSRCPPGQFRCSEPPGAHGECYPQDWLCDGHPDCDDGRDEWGCGTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the viral receptor domain of Tva and its implications in viral entry.
pubmed doi rcsb
molecule keywords SUBGROUP A ROUS SARCOMA VIRUS RECEPTORS PG800 AND PG950
molecule tags Signaling protein, membrane protein
source organism Coturnix japonica
total genus 3
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2001-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1jrfA00
1N7DA 1LDRA 2M0PA 1K7BA 2KNYA 1J8EA 1D2JA 2FCWB 1F5YA 1LDLA 1CR8A 2LGPA 2M96A 2JM4A 2M7PA 1JRFA 2I1PA 1D2LA 2FYJA 1XFEA 2FYLB 2KNXA
chains in the Genus database with same CATH superfamily
1N7DA 1LDRA 2M0PA 1K7BA 2KNYA 1J8EA 1D2JA 2FCWB 1F5YA 1LDLA 1CR8A 2LGPA 2M96A 2JM4A 2M7PA 1JRFA 2I1PA 1D2LA 2FYJA 1XFEA 2FYLB 2KNXA
chains in the Genus database with same CATH topology
1N7DA 1LDRA 2M0PA 1K7BA 2KNYA 1J8EA 1D2JA 2FCWB 1F5YA 1LDLA 1CR8A 2LGPA 2M96A 2JM4A 2M7PA 1JRFA 2I1PA 1D2LA 2FYJA 1XFEA 2FYLB 2KNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N7D A;  1LDR A;  2M0P A;  1K7B A;  2KNY A;  1J8E A;  1D2J A;  2FCW B;  1F5Y A;  1LDL A;  1CR8 A;  2LGP A;  2M96 A;  2JM4 A;  2M7P A;  1JRF A;  2I1P A;  1D2L A;  2FYJ A;  1XFE A;  2FYL B;  2KNX A; 
#chains in the Genus database with same CATH topology
 1N7D A;  1LDR A;  2M0P A;  1K7B A;  2KNY A;  1J8E A;  1D2J A;  2FCW B;  1F5Y A;  1LDL A;  1CR8 A;  2LGP A;  2M96 A;  2JM4 A;  2M7P A;  1JRF A;  2I1P A;  1D2L A;  2FYJ A;  1XFE A;  2FYL B;  2KNX A; 
#chains in the Genus database with same CATH homology
 1N7D A;  1LDR A;  2M0P A;  1K7B A;  2KNY A;  1J8E A;  1D2J A;  2FCW B;  1F5Y A;  1LDL A;  1CR8 A;  2LGP A;  2M96 A;  2JM4 A;  2M7P A;  1JRF A;  2I1P A;  1D2L A;  2FYJ A;  1XFE A;  2FYL B;  2KNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...