1JRHI

Complex (antibody/antigen)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
SVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY A6
publication title Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (antibody/antigen)
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1997-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhI00
4HKZB 4G8FB 4MNGB 5B39A 2XA3A 1F11A 1IGYB 4LPTA 2OJZL 4CUCA 3MRDB 5E2JA 4LPVA 1ZANL 1ZOXA 1A7OH 2X6MA 5CLTA 3MCLL 3IU3A 5E03A 1DUZA 5IB2A 3C6LB 2YPKA 2A1WH 4YDLC 3U7YH 4FOMA 2MSPA 4XPAL 4L8SB 5T1MA 1JF6A 4NJAL 1KT2B 5J12C 2BSTA 5DMGD 3TV3L 4R90H 5CD5D 4HGWA 4I3RL 3HE7D 1HE7A 5CEZL 3B9AA 5DEZA 5DMJB 3OKKB 2Y07L 3HZVA 1LE9A 5FM8A 1U8NB 5E9DB 2K1MA 2DBLL 5DURB 1KJVA 1KFAL 3TO4C 5GS2H 4PRDB 3MV8A 3OKDA 5CKGA 3UBXG 4NKOA 3BW9B 2CIKA 4GQPH 4RISH 4ONFL 3OG6B 1ZHLB 1KC5H 3QQ4B 5HYSA 1SEQL 5TE4L 5HBBA 4R7NB 2Y6SD 2DQJH 1W8OA 2OCFD 1A3RH 1BWWA 2Y7QA 2I07A 3EW3B 4AM0A 1BBDH 2AJZA 4PD4J 2NR6C 4UV4L 5J06A 2FGWH 2P5WE 3QUMB 4WV1C 5EO0A 1NMBL 1S8DA 5GS0C 3D0VB 2L7JA 5AWNL 3S5LG 4POYA 1DLFL 5FB8A 4G7VL 4X4MA 1UWEH 1YEDB 3RKPA 5HHQB 2CJUH 1OWRM 2VTFA 5IJVA 2G5BB 2GK0A 2FRGP 4IRJC 2R0KH 3L3GB 1AY1L 4ISVA 4TSCH 2DICA 3BQUA 1NDGB 3GSOB 1SY6H 1TITA 4YLQT 4KK8D 4ZSOE 1QSED 2X4UB 3QO1B 4PR5A 4ZQKB 4WW1A 4GBXB 4QOKB 4XCEA 1KBGL 2ITDA 3GRWL 3OKOB 1FQ9C 4NWUH 4H8WC 4OFYD 3O3BA 4UDTA 5C6PB 2FBOJ 2FEDC 1ZHNB 1DDHA 3MC0A 2IMNA 3RUGF 5F6IC 4XVJH 3BFOA 3QI9D 5D2NC 2LQRA 3ZT5A 3U82B 5IK3A 3F7VA 1EEUA 4U1IA 2XNAB 3GMOB 4LSVL 2NXYC 4GAGL 1T0MB 5DEFB 5EZLA 5JXED 5TJWK 5GSVA 5DEGA 3DGGB 5FYJE 5JMOC 1FSKB 4NN5B 1OP3K 4FN0A 3KXFE 2YMXH 3V2AR 1LEGB 3DX8B 2NXZC 2ZUTA 3IS0X 1GYAA 5K9QI 4DKEH 1YMHB 3TYGH 4YFLI 5C07A 4EI6A 3T2PA 2ZG3A 3W11C 4KV5F 4D3CH 3UYOD 5DJ6B 1GGIH 2KKQA 5BW7A 2Y5TA 3B9KB 3GJFB 1CXHA 5D7KD 1QRKA 2IBGA 1NCDH 4M8QB 5F8RC 5E08L 3GMMA 2BVEA 4YHMH 1CIDA 4ZNEE 5FKPB 5GGSY 2WWKT 4QRRA 3MOBL 3ZLQC 2X89A 4CADA 3ARGC 3ZHLA 3DX7B 2EDBA 4LHUA 5GS0L 4OM0H 3DUSA 2Z8WC 4FQCH 2HG5B 2HP4A 3FQTB 3QPQD 1AGEB 2XWBA 2QSCL 3I9GL 1A9BA 2BXYA 2FECL 1HYSC 2IG2H 3TM6A 5DMKA 2F5BH 4XGZA 3U0TB 4J4PD 3TBSA 5K9JH 1EO8L 2NX5D 4K07A 5DJYA 2CKBL 4FXKB 5CEYB 4KTDL 1QA9A 4GQ9H 4PV8A 3BZEA 1EEQA 4QGYA 1W72A 4HS6A 4R7DA 3SDDB 4ALAH 1JVKA 3DXAA 3SGKA 5D7LA 5CEXA 4LNRA 5KSAA 3JV4B 4U05A 3V8CA 4H8WL 4CU6A 3L5JA 2DKUA 2VC2L 4X6CB 2W0PA 5IMMB 3TP4A 4F9PA 4EI5B 5CCKH 2VXTH 4YZFF 5CZVH 2QV2A 3OX8B 5TF1L 2Y4SA 3VWKD 5E0QA 4LLQB 4HKBB 5HHVL 5LGJA 4QGTA 1YPZB 1G7LB 5E5MB 1FYTE 3WNNA 1ZT7B 2EE9A 4HIEA 5D1XA 5H37G 4HH9A 1MQKH 3NIGE 1CFSA 4DKFL 4ZODA 1OGTB 3NPZB 4JB9H 4ENEC 1AXSA 1DN0A 1HN1A 1Q9OA 1R3HA 4JRXA 3TT1H 2DQFB 3LZFL 3CXHK 1I3RB 1ZS8B 3T2NL 5F3BB 1OP5H 3OKNA 4MQTB 3O41B 2Q8BH 4U6TA 4OCYH 3TH4T 4NUJB 3KLAA 4YXHH 1XF5A 5JR1H 4N0FB 3EYOB 5IGXH 3C6LC 4PGDB 3CFIC 1D5MA 1FVDA 3MLUH 2Q6WB 5I16B 4L8SC 1U3ZA 1MIEH 3C5SB 2HN7B 4UOW0 4KKCC 3DIFB 5CBEA 4OZ4A 2W65A 1YNLH 3Q3GB 3SDXF 5DSCB 1O5DT 2OLDA 4L9LB 4Y7MA 4LFHG 5D1QB 3HC0B 4U6YA 4CVUA 4WHCA 1NFDB 4O02H 2ORBH 1T7WA 4D9LL 1KJ3H 5DWUL 3PDOA 4LSQL 2C3HA 1YA5A 4RRPG 2HFFA 1QUNA 2VZ3A 2M26A 4M7ZB 1YECH 3V7MA 1WITA 5LVEA 3PWJB 3O45B 1J5OH 4K94C 4XC3H 4CVXA 4LRIC 1E4XH 2P8MA 3LS4H 1YJDL 4MS8C 4AEHL 3C2SA 3MRBB 2IPKA 3BH8A 1LO4L 1W72H 4J8RA 4ODSH 1IQWH 1DVFC 1WTGT 1HHIA 1G7HA 3QEHB 4UT7L 4EN3C 4AYFA 3P11H 5BS0B 4LLUB 2PXYB 3TO2B 4R3SB 2GAZA 1Z2KA 3HAEB 3P9LA 1YNKH 1RU9L 2VDOH 4HS8H 4HC1L 1S9WB 1I1YB 5I19H 2JJSC 4KJWC 3SE9H 2NY5H 2F5AH 2OTWB 1XGUA 5I8EA 5IW6A 3H42L 2Q8AH 3U4AA 1ZGLA 1CFTB 1IKNA 2VLRB 1UZ8A 1LO3H 4JRYA 1N6QH 1OGAA 2YHGA 3IF1A 1P7KB 1OTUC 4NRZB 5AG8A 1I1FB 1DFBH 1GZPA 2BJML 4ZS7H 5IHUL 4OD3L 5A40E 5EU3B 1KN4H 2N1KA 2QKIB 3S9DB 2VXUL 2A74B 2ED9A 1FP5A 4WJ5B 2UWEA 1C08B 1DQLH 2R0WH 3V7AG 5ID1B 3PGFH 4M48H 4AQ1B 3CX5K 4OV5A 4NQCA 4NO5A 1DQQA 3TVMA 4LLDB 4HUWA 4PGJA 3RPIB 2DB8A 1FSKC 4XI5D 5FUCC 4NN5C 4PBXA 4PRID 4NZDA 1UM4L 1WIUA 1DUYA 5J6HB 4OKVB 5BQ7A 2BHYA 4GAYA 1YEEH 3UJIL 4JJ5B 1IRAY 1MRDL 5CAYB 1XR8A 3FQUB 3RAJL 4U7MA 1UCBH 3MMEB 4JQIL 4K3JL 2PW1A 1ZA6B 1YEFH 1FZOB 2RCSL 4G5ZH 1HSBA 4OSUL 1UXWA 2DQTH 1YN7A 1CZ8L 1FFQA 3SDCB 1G7IA 2IGFH 1MJUH 1FE8L 5FYLH 3CFKB 3B9KC 4BSWB 1L6XA 1WZ1L 4DKAA 3FQNA 4YFLF 5C0AE 1U91B 3ECBB 4JDZA 3F5WB 3S34L 5JDSB 4K94L 3K4DA 3MLSH 1A6AB 1UYWL 1LD9A 4YHZH 2HJFA 3VRLF 1CIUA 2GT9A 3U30C 1S7XB 3Q1SL 3ME0A 4GSDH 1BVLB 3RBSA 1I8IB 1IARB 2GYSA 4CDHA 1FH5H 1QRNA 2J8UE 4FA8A 5D6CA 5FHAH 3PQYA 4C83B 2VE6B 3EO1A 1F42A 1CG9A 1EFQA 1XIWC 2FX9H 5HHOE 3K74B 4N0YH 1N6VA 1R5IB 3BZFB 3OMZA 2AAVA 4QRSB 4JKPH 4JY4B 4XBEL 3PG2A 5M94B 3IKCA 3ZKMD 1TQCB 4X5XA 3RVUC 4DGIL 2FO4A 3BX7C 1FZMB 3SDDC 4ONGL 4P3DB 2UZIH 4JG1H 4QTIL 1CF8H 4P23B 1P7HL 5EU4A 5J3HC 2BMKA 4JN1L 2VZUA 2AXJA 4FFZL 3WNKA 3GMLA 3ULVD 4JFEB 4NZRH 3P0GB 1P7QD 1JGVH 4XC1H 3PWNB 3GSNL 3O4LA 4UBDD 4XPHL 1FLRH 2A6KB 4U1NA 2ARWA 5DD3L 4L8CB 4P2QA 3EFDL 1JHTB 4BUGA 2GQHA 5DJCB 4AQOA 1GZQB 2OZ4L 2VSCA 3JTSB 3MUZ1 1NBZB 3ARBD 4L3AA 4ZUWA 4E41D 1RJCA 5KVGH 4LHQB 3ALXA 4U1MB 4D0DA 1K2DB 4GW5A 3AVEA 4RMRA 3N1QC 4H0GA 4YZFE 3HA0A 5KVFH 4DGVL 3RL1A 5FO8B 4IDJL 3G08B 4Y19D 4XCNB 3KPRE 4IRSC 2Z4QB 1EGJL 3DRTB 4S0TD 3VFVB 5D2LE 5EZOH 1HXMA 2YKLH 3V6ZA 4R9HA 3MGOA 4WWKD 2R15A 2W60B 4ORGB 4X6FA 1HK6A 5F1NA 5E2WL 3FFDB 3QAZC 1F6LL 1AE6L 1ZVHA 5GRYA 1AI1H 3UTZA 1C5CL 4L9DA 2XZQH 4P59L 3G6AB 1HQRB 1N5AA 3JV0A 5AZEL 2O5XH 5DUBB 5DHVA 3RDTD 1WWBX 1GVIA 2ZCLH 2QSTA 5I2IA 1CK0L 1Z9SA 2D4FA 2J8OA 3PDDA 4KRPB 2BNQE 4HBQA 4L29A 4NRXA 4OZGA 1Y18B 3O2DL 1BWMA 1DBML 4EUPA 2EEAA 4Z95L 5I8CA 1KEML 4ZXBA 1CGVA 5IMOA 4M7ZC 3SDAC 3O3DB 1DQMH 1I9IH 4LLVB 1FG9C 2GJZA 4Z76A 3ULUD 3V7AE 1KCRL 4AK1A 4HBCL 1NBVH 1UWGH 1P2CA 1NCUA 1RUQL 5C9JA 2MKLC 1AJ7H 4OF5A 5B22A 3O6ML 3V4PH 5GRVK 5F72S 2NW3A 4Q9RH 3EJJX 1KLUA 2H8PA 2HAZA 2XN9E 1MF2L 1F4AA 5KBNC 3JV5A 4Y4KC 1IE5A 3MNZA 3QCUH 4KJYB 1FGVH 1XF1A 3LIZL 4PJDF 1R3IL 5EU7C 3UROR 4F80A 3VXRA 1EZVX 4UQ3B 3SOBL 1LQSR 4F3FB 1QLRB 1TZGL 2WBKA 4JZOA 4Q2ZA 1MVUB 3VI4E 2QHRH 2YRLA 4QXUH 1DCLA 4JPIB 1EEZB 3H3PH 3T77A 1FNGA 3HUJA 4X4XB 1EMTL 4PY8I 1PLGL 4M9OA 1UACH 3O8XA 5T33H 4PJ7B 5L2JA 4Z8FH 1NLBL 4I4WB 2YUZA 5MEOA 4HV8B 4PRHD 1RHHA 1QSEE 4ZTOL 1KPUA 1RK1B 3OB0K 3NA9L 2COQA 1CL7H 5DRWB 1N5YH 2VH5H 3G04A 1KXQE 5F93C 4DVBB 2YA2A 2IALA 2Q7YB 3W5MA 2ZSVB 3D5OF 2ADGB 1EVTC 1T04A 2XI9A 4OFKA 3IDXH 4R0LB 5F7DA 2P42B 1SM3L 3IFOA 3WL9B 4CMHB 1VB9A 2VITB 2Z31B 1I8KB 1ZT1A 4L4TA 1R5VA 4Y2DB 1P4LA 4PUBL 1FZKB 3W2DH 4Z0XA 4GW4A 5DJ2A 5F7EH 2NR6D 1BIIB 4YNYA 5I18H 4NCDA 1KCVH 1CGYA 4QY8A 5CP3H 4J3TA 5GS0D 3TH3T 4MB3A 5ECJE 2ILLA 5DHVH 2PO6C 4MAYA 1TENA 4KMLB 1XH3A 5EC1B 1LK3H 3BMWA 3IETA 4K71C 3GUTA 2VDNL 1PGRB 5JXAL 1FL6B 5L6YL 3FO0L 3SDCC 2HT3C 3AB0B 1Z6JT 4AMKL 4EUPH 3H9HB 5JOPE 3OAUL 3SKMA 5ICYA 4OI8A 3O9WA 3S3PA 1OQXA 3U6RB 4AEEA 2FHBA 3ARQA 5D7KE 2AXHA 4MD0A 5C0DB 2CLRB 5J11C 3HZMB 2EE3A 4KUZH 2FEDD 3P77B 1A7PL 3OXSA 4GO6B 1T83C 43C9A 3X3FH 1CLYH 1LO5A 1AGDA 1ZEAH 1IGMH 3GJFK 5CS7A 5JIPA 1J1PH 1IAII 4MQ7A 3VFNB 1ZWIA 4KGLA 4JN2B 5EPMA 4YIQA 4BZ1L 1X5HA 5IESH 4OQTA 3TWCH 3ULVF 5E5UB 5IR1B 1BFTA 1TQCC 3REWB 3AY4A 4GG6A 4LCWE 3U0PB 1T1ZA 3FO1A 3GM8A 4MJ5B 5DJAB 5L8KB 1C1EL 1ZLUH 1JHLL 3C8HA 1BEYH 3VRLE 3ZDXF 1RSFA 2DS4A 1Q0XL 2WWMC 2NXZD 3GFUA 2VLKA 5FUOH 3QFJB 3L6FA 3MNVB 6FABH 5TDPA 1OT1A 2AEQL 1FC1A 2V2WB 3W11D 1I7TB 4HIJB 1A5FH 1A6VH 3GM0A 2PTVA 4Y5YC 1HHGB 3PWPB 3JVGA 5K9OB 1EIBA 1JGLL 3WFCH 35C8L 3D25A 1A1NA 4GKOA 2WBWB 3BIKB 1CDHA 3NCEB 3HLAA 4AZ8A 5KG9B 3OAZH 1FFOB 5E7FA 5GZND 4XRCB 1RZGA 2CUHA 2QSVA 5B8CB 2HLFC 5E2TL 1AXIB 1XEDA 3MRCA 3HMWH 1QFWM 2AKRA 1I7RB 4MDIA 3JXAA 4LCYB 1IGIH 4XH2B 1CFQA 4NC1C 4WU7A 1MIML 4X98A 1YYMH 3U36A 5BO1L 2Z92B 2AJSL 3CMOH 3MNWB 1ES0B 1JF1B 4RFEA 2E6JA 4JDTH 1OSZB 2XZAH 4Z7NF 3D0LB 3THML 3KPSB 2CD0A 2ZNXA 4W6YB 5JO5B 2DJ4A 1AQDA 5CP7B 3U7AA 3RZWA 2C4FT 4FABH 1T6WA 3MLTA 3O3AB 3QPXH 4XVTL 1WJ3A 3WXWH 4D0CA 3ULUF 1HHKA 3L3JB 3BO8B 3WSQL 4A2LA 2R1YA 5D7SH 1YY8B 2A9ML 3ZT6A 1JYNA 3PXHA 3RGVB 5GISL 2IBBA 1BQSA 2ADFH 4HK0A 4FTVD 4HJ0C 3TEUA 4K23L 2PF6A 3DX9B 3F58H 1YMMB 4OV6F 4YO0B 3VD7A 2JIXB 4OQTH 5HGDA 3WJJC 2HYMA 3CSYB 2Z91A 1JTOA 4JR9L 4BSJA 3RL2B 4ENED 1U8OB 3VXUB 2D9CA 3AXLB 4YDVA 3I3EA 1AKJB 1Y0LA 4AIOA 2C3VA 4P4KC 3GMRA 3GDBA 5J6GB 2BVOA 1S5IH 2EE6A 3DURB 3EOBB 4LDOB 2BVUA 2IC2A 1CE1H 5HGBB 4H88L 4EDWH 2F53D 2AQ2A 2HVJB 3A6CH 2WBJB 3GO1H 1BJ1H 1H0DB 1RZFL 3C6LD 3LPWA 4MA7L 4UNVA 4U7KA 1TJIH 3EDDA 5EU6D 1EBPA 1I8LA 3PGDA 1MY5A 1NC2D 3O81A 1MRCL 2CMRH 4KKCD 3U7WL 5ITFA 3OF6A 5T5NG 3IU4L 3LAFA 3IFNL 5EWIH 5EIIA 2H32H 4PD4K 1KTDA 4TULL 4Z7VA 4XVSH 5SX5H 1NBYA 3KS0H 4F57H 3CFBA 4PJDE 5DJXB 5C09E 5E9DD 5DURD 2A83A 2G2RA 1KGCD 5E00A 2EH7L 5ICZA 4CMMA 1M7IA 4XT1C 1R3LB 3C5JB 2BRRH 2E8YA 4Z77B 5F7NC 2WIMA 1S7QB 2DMBA 2IQAA 4GG8A 3IDIB 3GB7B 3FAWA 4JANA 2Z31C 1SJVA 4EIGB 4IIQC 3VXQA 1WBXB 4G9FA 3EJZC 4WU5B 5T3XL 5C0FA 1IILE 4KKAC 1JWMA 3MUGB 1KEGL 5KAQG 1DVFD 1F45A 5DQJB 1HHHA 3BPOC 1GH7A 1U8IB 3UTTB 1MWAL 1LP9B 2CDFA 2VDKH 3O6LH 5EOTB 2XYCA 5C0BA 1JZ8A 2BSRB 4HEME 4LU5H 4KJWD 3U9UB 4OUUA 4HUMB 3AB0C 4NNYB 3F65A 4ZPTA 1KCUH 1NMCB 2Y36L 1L4IA 3H9SE 4LCCA 1FN4B 2YD9A 4HLZG 5CILH 1INDH 1I85A 4XNXH 1V3MA 4GBXD 4QOKD 1OTUD 5BZWB 2VAAA 4FS0A 5I74C 1RULH 2X4TB 3BJ91 5LBSH 1V7MH 4HFUH 4KUCD 2QR0A 1UM5H 3CFJA 4G43A 2HFEB 3CPLB 4IM8A 1NAML 3GRWA 3TN0B 5JPMA 3QIWC 3AM8C 3X11B 3I75A 2VZSA 4P5MA 2JELH 5DXWA 5FM5O 3MV7B 4H25A 1WZLA 4HK3N 4OGYL 4JKLA 3LEYH 4P5TA 5IMLB 2HFTA 3NFNB 4PV9A 5F89B 3BZDA 1CU4L 5J1TC 4U6VL 1R24A 4HXBL 1WFOA 2CLZB 3BKYH 1WIPA 5TE7L 3MRLA 5GS1C 4JRWA 4YJZL 4OLXH 3G5YA 3BGAA 4JAMB 1T22B 1ZV5A 1GHFH 3EO0A 3IDYB 4HWZA 5FECA 5H35A 4K7PL 3E2HB 4KZEL 1GOHA 3GEWB 4JGMA 4IHOA 3ULVE 3TFKC 1P84J 3B9KD 1FJ1B 3HZYB 4MSWA 1YEIL 1K4CB 4LGSB 3TGXA 4O4YH 4YC2B 3RGHA 4G3YL 1RAMA 3NCBB 2IPTL 3EBAA 1N3NB 4O2CB 5B8CC 3E6HA 3VXPB 4PB9H 2R4SH 3SGEH 4G6ML 3V6OA 5TPWH 3F6IA 2AVGA 5AUMB 4QRPD 5ISZB 1XIWD 3O6FB 4S1RL 1MREL 2X4SA 3PABA 3B83A 4MCZB 4M61A 1G6RB 2JTDA 1GOGA 4JO4L 1NUGA 1E4WH 2XZCL 4PRBA 4OCSL 1OB1A 3RVUD 1UQSA 1QFWL 3WLBA 2DQDH 3WUWA 2IQ9H 4PJAF 3SDDD 3IDJA 1IVLA 1IL1B 3RWFA 4IRJA 5CJOL 4W4OA 4NZUL 1JWSB 3RIAK 1KIPA 1U8PB 2HKFH 1MI5B 3MA9L 5CFHA 3QDMB 4EI5D 2PYED 3UC0H 5I1CH 4TVSa 3WO3B 1OARL 4PGCA 3KXFA 1M05B 4OZIB 3RGVC 3IAGC 1G1YA 2A73B 3T4AA 1KBGH 1R6VA 5E6IB 5MERB 3N1GC 3IDNB 3VH8G 3P2TA 1QEWB 4ONHA 3C9NA 1OLZA 1QVOB 1MHEA 1GGCL 3MBXL 3UP1A 3F7PC 5CGYC 4P2RB 4ZFOA 2YWZA 3ULUE 2AJVL 4NCC1 1JZ6A 4FQXB 3M17A 4LAQH 4TTDC 2N7AA 3ZKXB 2V2XB 5J7CC 5K33A 3D69A 4RAVB 3O11B 1HILB 1JZ7A 4HAGA 2FJFA 3CVIL 4ZNEA 4IRSD 4ZUTA 1EXUB 4F9LA 1P9MC 4DK6A 5DDHA 3BT2L 4DJMA 4UINL 2EKSB 4OFIA 3NCCB 5HYEA 1A6PA 1D6EA 1QSFD 2NW2A 4P4RB 3QFDB 4Y4HB 3T4YA 3L3IA 3U9PL 3QG7L 3LKQA 5IOPA 3VGGA 1E4JA 3STLB 3V52H 1LE5B 4BKLA 1NCWH 3SE4C 2R8SL 2YD3A 3QNXA 4L8DB 2V7HB 4KTEH 1MCOL 1E6OL 2R9HD 4N8VA 5DS8A 1UVQB 2KQMA 3MFFB 1KCSH 3BSZH 4QXGL 1UFUA 2E7MA 3PJSB 5EBLB 1H3VA 2WW8A 3IDMB 3RNQB 3MROA 5LKNA 4PRHE 2DYPA 3ARGA 3ZTJH 2BOCB 4TRPH 1M7XA 3QXDB 4Z7UE 4DN3H 2H6PA 4GMSL 1K8IA 3RWIA 3C60A 4X7CC 4MXWL 4U1SB 4F2MA 3VMOA 3IGAB 3MRIB 4CJ1A 4HGKC 5HI4D 3CZFB 1V8HA 1G7MA 3QJFA 4XNZB 5ALBL 2ESVB 4G8GB 3FB8A 4Q0XH 4XNMB 1C5BL 2J6EL 4LVNB 1RURL 4Y4KD 2AI0L 1B0RA 4N5EC 5BS0D 2OJEA 2XFXA 5F7UA 1EO8H 5C0ND 3CLFH 4HPYH 2AV1A 3QA3A 3W9EB 1KENL 5FYJH 2XKUA 4LPWA 4M03A 2YBRA 1VGEH 3KYOB 1H8OA 4OQ1A 5DUMH 1JN6B 2IADB 1NGWA 3U46B 4G8IB 3DV6B 3WFBH 3FT2B 3MX0A 1NUFA 2VLRD 3JUZA 1OAZL 2W0LA 3L5IA 4HC1A 4F7CB 2VXSL 3HN3A 4FFWD 3GGWA 2NY6B 4OIIL 5GJTL 3PP3K 1RUAL 5FK9A 4PJFA 4S2SA 1N59B 4CNIB 4KQ4L 1RZIA 5BVJB 5HPMA 5I73C 1MLCB 4JFPA 4NQEA 5J1SC 2LU7A 4RGNC 2O93L 2DM3A 4MD5A 3TJEL 4Z7WE 5D7JC 3WNMA 3H7BA 4HXAL 1VFMA 4QRUA 2DQCH 3L1OH 4JREB 1W0VB 3BPLB 2XA8L 1NAKH 3N85H 1JPGA 3T1FA 1JZ4A 5FDWB 5GS3A 4I13B 4AIXA 3ILPB 5ESVB 3C2AH 2FIKB 2P7TA 3F7YB 1NEZB 5C70A 1YEGL 1HEZA 4X6EB 3STZA 5KS9A 3ELAT 2EC9U 2LVCA 1UXSB 2APVA 4P2OB 1QBMH 4U1KA 5KOMC 2MCPL 3E2HC 2D0FA 3VWJB 2F74A 3SDCD 4NN7C 1HCVA 2HT3D 1Q72H 5T5FL 4BELD 3B9EA 1WZKA 1IAOB 2OR9L 3ZE2F 3R0MA 1BVZA 3AU1A 4JZJA 5FGCE 3I2CH 3MV9D 3WIHL 1QBLH 2EDFA 1F3DH 4D9LH 1TCMA 2ZJSL 4GRWF 4KK5C 1BPVA 1OCWH 4IMKA 1IEAB 2VSDA 1X5IA 2WM0A 3KWWB 3BRGC 3BEWB 2HKHL 4XXDB 2A6IB 2UV3A 4ODHL 4AEIH 5A1AA 1JNNL 3SGJA 4FFVC 3HCVB 4NZJA 3NFPB 1YJDH 2CK2A 3ARTA 1CDCA 4G9DA 3ZE0E 1IM9A 3CGTA 3LPGA 4O51A 4N5UA 4PBWD 2CLVB 3DTXB 4M7LT 2X4RA 5E2UL 5C0GB 1MLBB 4UT7H 4K2UH 4KDTC 4QCIA 5BRZB 1RK0B 1KJMA 1PG7W 1YPZF 4MNHA 5CZKA 1XGYL 3MLPA 1J1OH 3KR3H 3S37X 2WWMD 4P23D 1BM3H 2GSGB 2MMXA 4HC1H 4FQJH 4WHDA 1K8DB 2R2EA 3P4NA 2NTSP 3KGRA 2PCPA 1ADQA 5BCAA 3UYRL 4D2NA 5JIIA 1P1ZA 3HR6A 2H9GB 5T1KA 2HRPL 1WIOA 1JRHI 3MRHA 1KLFA 4PYGA 5I0ZA 4BA8A 3JWDC 4JKKA 4XCYA 5EZJB 3LRSB 3RUGA 3RA7L 1L7IL 3IXAB 3GSNA 1NMAL 4FZEL 2FLRT 1IC7H 5I76B 5DJZA 2ICWJ 4FTVE 4H1LA 3EYUL 2HLFD 3WE6A 1I1AB 3RZCB 5E5RB 1CT8A 3T65B 4M6ML 1BHGA 4MAUL 3O6KL 3WFHB 3KPLB 5TDOB 1OTSC 3G6JF 3NABL 3QT2A 5FUZL 1Q38A 4WI7A 2VXQH 3IJYB 4MNGE 4KMTL 2J8HA 1UM4H 3ZDYF 1FL3A 4KHXL 1NFDF 4Y0GA 1S3KH 4NO2A 2ZSWA 1PYWA 2ATKA 5HPOA 5HHOA 4XNUL 1YQVL 4XWGL 4HIXH 1KG0A 5HHNA 2V2TB 4U3CA 3HI5H 4XWOC 5DFVD 3SDYH 4OSUH 3WD5H 5HY9A 5EU6E 1AGBA 2VDRL 1DBAH 5KSVB 1PX4A 5JOFA 2NY2C 4Q9BA 4JFYA 3FO2A 1A6TB 4NO3A 1FVEB 1GJIA 4EOWL 4Y16A 1AIFB 4Q6IB 3BKCL 3S34H 5DJDB 5E9DE 4I2XA 5IT2L 4M1DL 4FRWA 4U6HA 4QRQA 5DRXB 5EA0L 2AERT 2BXZA 1PG7L 1KGCE 4M62H 3V4UL 2Z35B 1CLOH 3LH2L 2KZWA 5TQ2H 2M1KA 3SKOB 3Q6FB 5DVMA 4X5LA 1WF5A 2NLJB 3DMMB 3DVNB 3KJ6H 5JW5A 1WFTA 2YS4A 1JMXA 3OAYH 1AGCA 3GK8L 2EO1A 1CN4A 3FQWA 4LVNC 1Q9WB 2YPVL 4LRNL 3G5VA 1XGRB 3AC0A 1T1WA 3QH3A 5C8JB 5FOBB 4R97B 4OCRH 4K7PY 2C3GA 1GC1C 2OS7A 5MEPB 4HX1B 1ADQH 4ONGH 3JWDL 3G5ZA 1G9NH 4RGMC 5EBMB 4ODWB 4RX4A 4JZNA 1EDQA 1G0YR 1MELA 4JN1H 3KPRA 5DFTA 2BZDA 3NTCL 2PUQT 3HC3L 1KNOA 2V17H 2VB5A 1X44A 3EDEA 4WUKL 1J0HA 5E8OA 4DKDC 2Y9RT 3DARA 4GXVL 3NACL 5F1KC 4XPHH 1R3JB 3CDGA 4X7SL 5C9KA 1MFEL 2VLME 4I77H 4H1LH 5DD3H 5LXGL 4QOKE 5DF0A 4JM4L 4M4RA 2VDLH 5IVXB 1S5HA 1KPVA 3UZEA 3MOQA 1VKXB 1A7BA 2EDHA 1MOEA 5IQ9A 1AHWB 2GTZB 2BNUA 2VIRB 2BNQA 3DYOA 3JTTB 2GJ6B 5AAMA 2QADB 2P49B 5LJYH 4JREC 3BPLC 2Z31D 4GRLA 1T4KB 3QIBA 4Y2DD 3EJZD 2EDEA 4KKAD 3V0WH 4HUVB 1EJOH 4L3EB 4BFIB 1EVUA 1XR9A 1HNFA 3VXMB 4ETQA 4C56A 3L3KA 4NC0B 4Y2OA 3DX6A 3EYSH 4PJBE 3VG0H 4DTGL 5EO9B 4F8QA 3SDXA 5DC9B 2JKXA 1BQLH 4P2OC 2EDNA 1B0GB 3WJLA 1C5CH 2XN9A 3HZKA 4P59H 3VWJC 3FO9B 5C08D 1Y6KR 4IMLA 2YPKB 3ESUF 4JPWH 2GUOA 4ZDHB 4GLRI 4MLSA 1OF2A 4BSVA 3PIQB 4WHYH 2BSTB 4MQXC 4ODXA 4HGWB 4P9HC 4FQIL 5BV7H 4MJIA 3V0AC 1D5IH 4PJGF 3TZVB 3T0WA 1WK0A 4X99A 5HI3C 1Z3GL 4Z95H 2AABH 1KEMH 1LE9B 4NJ9L 1AD9A 2XV6B 4HT1L 4Z5RA 2HT4C 3QIWD 1CFNA 4HBCH 2JLLA 5DQ9B 3OKLA 1RUQH 1QNZH 1VESA 3MRRB 1GC1L 1CFVL 3P3YA 3ZE2E 4HJGA 1FIGH 3H0TB 3N1MC 3QCTH 2JB5L 1HZHH 3E0GA 1NCBH 5FCUH 4RWYL 2I07B 43CAB 5IW1B 2BERA 3SO3C 2EYRA 3SOBH 1NC4D 4L4VD 2HJLA 2IPUK 3QI9A 4KI5F 2ZUVA 3RU8H 4P2CG 3QJHB 2YC1A 5GJSH 3SY0A 3L95A 4XCCL 4FQ2H 1N64L 4YDIL 4WVRA 4YHKH 5IG7B 3KLDA 3WXVH 5IJVB 2GK0B 1CXEA 4X6CE 3U83A 3PWPD 1FZJA 5D93B 3TFKD 3IFPA 2EXYC 2AJYH 4XAWH 3KG5A 3DSNA 3BQUB 4JFDD 4K9EL 4P9MH 3RY5A 2DQHL 4GH7B 1A3LL 3RIAF 2BY2A 1FNEB 2ADJB 1U8MA 2B0SH 2VZOA 4X9HA 3TA3A 4O2EB 5LQBL 3J7HA 5MEND 1I1AC 3RZCC 4UDTB 4YDKH 4WO4C 1A9EA 5DR5L 1DDHB 3C09C 4QF1B 4APQC 3ET9F 2ICWB 3VA2C 1T21A 4WW2C 4KRMB 1HH9A 4R4FH 3B9DA 4MCYA 1TNNA 3ZMRA 2Y1VA 1ZHBA 3F7VB 1QACA 4U1IB 3VGEA 2ZPKL 3S5LB 3VD4A 1OW0A 5GSVB 3MJ6A 5DEGB 2OX5A 3B9VA 3KPSD 1VFOA 3HTLX 4LSUL 4UT9L 2YD2A 5DHXB 1T89C 1QSFE 3LV3B 4P9HL 3VE0A 1ZKAA 1J0YA 4JM2C 3VGDA 2X4QA 5FXCH 3WBDA 1P4IL 2VDNH 3QUYB 4OLUL 1BD2B 1KPRA 1A6WH 1T5WA 5B38A 4LCWA 3UPRB 4XNQA 2R1XA 4ONOA 4P46B 1U8HA 5C07B 4EI6B 2J4WL 1UA6H 4S1DC 5EIVA 3RGVD 3I50L 1JTTA 3U2SA 1YQ2A 3C8KA 1YYLL 1NFDE 2GKIA 4OZFA 2PETA 1H15B 1HXYA 3L9RA 4I5BA 4N0CC 4PJ9B 4P49A 4DWHA 1XGPA 2ZCHH 1YMMD 5INDA 3GMMB 3V6BR 5ILTL 2P46B 1A7PH 2ZUQC 5HTSA 1IAKA 2V7NA 3MCG1 3DMMC 4XP9H 5CGYD 1CDYA 3D18A 1NCAL 4RSVA 3VXUD 1MCLA 2BSSA 5CINL 4CADB 5B3JF 4KRNA 3GHBH 3MLZH 5AD0A 2O5ZH 1AKJD 2ZOKA 1EO5A 3ARDA 5IF0A 1T7VA 3DUSB 5DJ8A 5IB5A 1FNLA 4PJ7F 2EIZA 1C1EH 4G6AC 4R97C 1A9BB 2C9AA 1CICB 5BS0E 2DF3A 3HG1B 3L7FA 5DMKB 4NHUA 4UU9A 5T1DL 3EDKA 5EU7E 3TBSB 4X4ZA 2XKNA 3QDJD 3K4AA 1A7NL 1RIVL 3D2UA 4PV8B 3BZEB 5L0QB 3LOWA 4Y5XA 5FYKL 5IEKB 5IHZA 3DXAB 4NT6A 5KSAB 1WV7T 1UGNA 2YA1A 4OLEA 4PGBA 5A16A 2C3WA 5DJ0A 3MRKA 2VLRE 5F1OB 4PRPA 4DAGL 2YR3A 4PJEF 5SX5K 4XPGL 1GCFA 5DD5H 4OUOA 4BM7A 4UB0H 3I6KA 5AG9A 1XF2B 2RFXB 4V2CB 5DGQA 5ACMA 3CFDA 1BMGA 1IEBB 1KB5L 3CLEH 1KLGA 3BUTA 4HIEB 3HRPA 5D1XB 1TJGH 2X1XR 2FX8L 1CFSB 2DI7A 3RY6A 1AXSB 1DN0B 1Q9OB 4JRXB 4TSAH 1G7QA 4N5ED 4MB5A 3IFLH 1NGQH 5DVOA 1A7OL 1J05A 2P4AB 1NGYA 1S7WB 2A1WL 3THMH 1MH5A 3U7YL 1DJSA 1CQKA 3KLAB 4GXUN 2AXFA 1XF5B 2OI9B 1IGFH 5KSUA 3U79A 1H9VA 4WTZA 4YAQA 2H2PC 4R90L 1D5MB 3V79C 4OZFH 2BVPA 2PYFA 4KRLB 4RFOH 4AG4H 1FFPB 4OZ4B 4PPTA 4PP2B 4MHHI 3ABZA 2NY7L 1XGQA 4MXQC 7FABH 3KHQA 4XTRC 1ED3B 3VJ6A 4J3XA 2XACC 4K23H 4RGND 3TN0D 2X10A 4GXUM 1NLDL 4KJPC 4RISL 1S7SA 4HWEH 3PDOB 5L2KD 1FLTX 1KC5L 5D7JD 1MJ8L 2VRAA 2BVQA 4I18B 4PJ8A 2HFFB 3MV7D 4EBQH 2W1NA 4HKXB 2DQJL 4D9QD 1P84K 3FQXA 3W9DA 2X7LB 5C09A 2Q3AA 1A3RL 1NAMA 3QIUB 1GXEA 1BBDL 5E2VH 2X42A 2MJWA 3MR9B 1G9EA 5D72H 2VERN 1JGEA 4DUXA 5C3LD 1TPXB 4NGHH 2IPKB 5EOCH 4N0RA 5F88A 4ELMF 4LF3A 4E0RA 1G7HB 1UWEL 2CJUL 1I3VA 2GAZB 2Q3ZA 1KIRA 1RJZA 2R0KL 2FEEI 1U92A 1OSPH 3P9LB 3EOAB 1B4JH 2O5YH 3MA7B 3PV6B 3PL6B 2JB6B 2LTQB 2RGSA 2NY4C 4JFEE 1DEDA 1SY6L 2VN4A 4OD1H 5D93C 4B7LA 4OLYH 3R8QA 5E24E 4I9WD 3VXNB 1SVCP 5IW6B 3BQUC 1ZMYA 1ZGLB 5GGRB 3WMSA 3K0WA 3IJSB 1L0QA 4M6OH 3IF1B 2FR4A 4KI5E 2BOBA 3NZHH 1TZHA 4JPKL 5GQBA 4P3CL 1BQHA 3FCTB 3BD3A 2VZTA 3H9SA 3W81A 1NDMA 4WEUD 4R8WL 4EQ2A 2HLAA 3PWUA 4HUXA 2UWEB 3VFPA 5DRNA 1BJ8A 5JZ7D 4FFVD 5EBGA 2VLJA 5C92A 4UZGA 4EQ3A 3PV7A 2QHLA 4ODUA 4KWUA 3ZKQD 1VACB 1D9KA 2FD6H 4NC1E 3X13A 5IIEA 4HUWB 2YMXL 4PFEA 4K7FA 3W0WA 3IVKA 1VFUA 3DVIA 3TBVA 1HQ4A 2Q76B 1DUYB 2NY1B 4DKEL 3TYGL 1MI5D 4GAYB 5I1HH 5ID0B 3QDMD 1XR8B 4D3CL 1ZLVK 1GGIL 4U1HA 3AREA 3F7QA 4JFXA 1SYSB 4Q6YA 1YN7B 5ALCH 3ZL4H 1JGUH 1G7IB 3CDCA 1E28A 1NCDL 3T2OA 3GSUA 3KPQB 5AEAA 1CBVL 2BNRA 4YHML 2VQUA 3FQNB 2PTTA 4U31A 1N8ZA 1JMZA 4JDZB 4C4KO 2C4XA 4RA3A 1NAMH 3GMNB 4P2RD 3RX8A 4Q9CA 4OM0L 2GT9B 4FQXD 4KI1A 4LPCA 4FQCL 1TJHH 4QYOA 5F21B 1QRNB 5D6CB 3PQYB 4PTUA 3EO1B 2Y06H 2IG2L 1OTSD 5E8DL 2F5BL 3KLSA 3B3IA 2FATH 4KDVA 1RV6X 2E7HA 3DJ9A 4ALAL 4X5XB 5L0QC 1CR9H 1YUHA 5ITBH 2LABA 2Y72A 4ZTPH 4EVNA 4XWOD 5CZXC 1PZ5B 1MFDH 3CFEA 3SGKC 5KSAC 5CCKL 1UKQA 5CZVL 1A2YB 5I8KH 4EDXB 2NY2D 4F9PC 2K3TA 4PJ7E 4UDUA 5EUKB 4ODTH 4RMVA 2NY5C 5ANMA 4LIQL 2NY0B 3H6JA 4G3YH 2P45B 3MV01 4U1NB 1EH9A 1IGJA 1MQKL 2IPTH 3BUYB 5ENWA 3ULSA 1HNGA 4PJXA 5D1XC 4JB9L 1MCEA 3LSOB 4BK4A 3NIDF 4ZUWB 5F9JB 2ESVD 3TT1L 4HQQH 1YC8A 4GW5B 5I15H 2BY1A 1JPTH 3TYFA 2JJTA 1MJ7H 2Q8BL 4WFFD 4OCYL 2MQCA 3RL1B 3CVHA 3T0VA 3U0WH 4TUJA 5E8PB 2XQBH 5BJTA 3WFDL 5JR1L 3V0VB 2HJKA 5IGXL 1PD6A 3VRJB 4MNQD 3V6ZB 3D9AH 2OXGA 3MGOB 3MLUL 3FFCD 4X6FB 4ODBD 3TJHC 3ZTNH 1MIEL 1NCTA 5F1NB 1YNLL 3UTZB 4K3DH 4TSBH 1HHJA 1ORSB 1OARH 1N5AB 2YD4A 5GHWH 4O02L 5T3ZL 2ORBL 3BAEH 5I2IB 1KJ3L 2EYSA 3ULVH 2CXGA 2XIDA 1QFPA 1I1CA 4L29B 3VDBA 4YXLH 1J12A 1YECL 1CI5A 5I8CB 2DL2A 3OGCB 4F7PB 5IMOB 1X7QA 4Z76B 3MJ9L 1R3KA 2ZCKH 1C7SA 3LS4L 1P2CB 2J2ZA 4A6YB 2EYTA 4WHTA 4F15B 1W72L 2VR5A 4ODSL 1JNHA 3P11L 1KLUB 2H8PB 4NC2B 2NX5B 1QKZH 5A43C 3HNVL 3BT2H 3FQRA 3MNZB 1YNKL 3LKPB 2X70A 2VDOL 3QZWA 5GGSB 5IB3A 5I19L 2AEIT 3KPOA 1J0JA 2BVYA 2V5MA 3P9MA 4U1GB 3SE9L 2NY5L 1T7ZA 4P2OD 2F5AL 4C57C 3QFJE 1EV2E 3VWJD 4JZOB 2Q8AL 2LTQC 3UTPD 4NOFA 4ELKA 1LO3L 3S36X 1N6QL 1U3HA 3PHSA 1FV1A 3HUJB 5I1LB 1DR9A 1BZQK 3AAZA 3PWPE 1IKNC 1DFBL 4FNLH 4ZS7L 1A1MA 2B1AL 4YXKH 1U93A 2V5YA 2VL5B 5FM4A 2C1PA 1KIQB 1JPST 2DTML 3EZJB 2APBA 3P0YL 5L2JB 2HWZH 4F7EB 5HI3D 3GSVA 1RHHB 1J8HA 1DQLL 1INQB 2R0WL 2V6HA 4PLKC 2HT4D 3SCMA 3PGFL 4HF5H 4M48L 4MXWH 2DLHA 4IOSD 3WIHA 4KDWA 5DVNA 3KYMA 5MENE 2IALB 3MACH 4RDQF 1RMFH 3CVHH 4KKBC 5HYIA 5FKAA 1CGXA 4PB0H 5F7DB 3TVMC 3IJHA 3ULUH 1AR1C 1NEUA 3IFOB 4Z78B 3HKFA 1RI8A 4Q58C 3DRQB 3OPZH 5IROA 1ZT1B 4L4TB 2JF1A 1JZ5A 4OZIF 1R5VB 1FPTH 3FTGA 2VWEC 4NPYB 3H8NA 1P4LB 1KJ2A 1YEEL 2VDQH 4GW4B 4Z0XB 4Z7OF 1A3QA 5F9AC 3HE6A 4UQ2A 3SQBA 1KENH 2XPGB 3RVWC 4HSQA 1UCBL 4QY8B 4WUUA 3P0VH 3KPSE 1YEFL 4G5ZL 3CIQA 5T1LD 2DQTL 1CGUA 3KPTA 4C55A 3FB5A 4OGAD 1G6VK 1XH3B 3RWDB 5JHLL 4QRTA 5FYLL 1K4DB 3GUTB 3FT3A 1OQOA 1ZTXH 1Z0MA 3WO4B 1Q94B 2EXYD 5C7XH 1TZIB 3KYNA 4YWGH 3MO1A 2VL4A 2XQYG 3VD9A 3RTQA 1OOAA 3MLSL 5FYKD 5ICYB 5IFJB 4YHZL 3L3OA 1IC5H 3MJGX 5TGBA 1RVFH 3FL7A 2UYLA 2HT2D 1OAKL 4GSDL 3MLVH 2HVKA 5EN2B 3V6FB 5FHAL 1I1AD 1ROWA 3LKOA 1Q9KA 1YMME 4PJIA 3RZCD 4GKZA 1CGSH 3OXSB 2FX9L 4APQD 4N0YL 1M6OA 5DO2C 1LO5B 1AGDB 4PY7A 4WENB 3VXUE 4LDLB 4GAJH 4JKPL 3I3DA 2VYRE 5D7IB 4MQ7B 1ZWIB 4UMGA 2GTWA 3KPMA 2NPLX 1VENA 3M45A 2FBJH 3BDXA 4GG6B 1T1ZB 2UZIL 3FO1B 4K3EH 4JG1L 1M1SA 2AV7A 5HYFA 3O3EB 4ZUVB 5C0IA 1CF8L 1T2QL 4ZFZA 2FWOB 1ZLSH 1BFSA 5EFIB 3TT3H 2DM4A 3UXFA 1OM3H 1JGVL 2CDEB 4XC1L 4HZLB 3L6FB 5TDPB 3ZHKA 3UJJH 4XPBH 4LSTH 1FLRL 1WEJL 1LEKB 2YPLA 3PXJA 2ATPB 4NDMA 4S1DD 4P57A 3VRIA 3QDAA 3GJEA 3MRQA 1F3JB 5LCVH 3HPJB 1BGXH 3Q5TA 2F8OA 4XPFH 4ZPVA 3WIHH 1TDQA 1B4RA 4HIIA 1NSNH 4XVUC 5KVGL 3PF2A 3D3VD 1LO2L 3L5WB 3HLAB 2CK0H 3VU2A 3DMMD 4KGJA 3OJDB 5KVFL 4PJ5A 4POZC 3T0EA 4GUPB 1PZUB 4HKJA 3NGBB 1NGZA 3MRCB 3H9ZA 2VZVA 2AKRB 4PJAA 1KJ2H 3UTSA 1N0XH 3MOAH 4NQDA 5EZOL 1FL5B 3IDUA 4PRIB 4ZG1A 1CFQB 2YK1H 4G6AD 1YN6B 4WU7B 2AGJH 3DV4A 4X98B 3UTTE 5JORA 3T0DA 1LP9E 1EUUA 2XWJB 1AI1L 1WC7A 4YE4H 4D8PA 2XZQL 4RFEB 3NIDE 25C8H 3GBMH 2O5XL 1CDUA 1G9MH 3REVB 1AQDB 1EHXA 4HHAA 2ZCLL 4HKZA 5I1IL 4K55A 4G8FA 3MLTB 1IGYA 5E1HB 1JNLH 1U8QA 4D0CB 1S9YB 1HHKB 2XOTA 5GZOC 5IBTL 3RA7H 5I1DB 1NBQA 3HR5A 1T20A 1L9NA 3MLXL 4BQ9A 4FZEH 1B6DA 4F7TA 1SJHB 3EHBC 1IAIH 5KSBF 4W70A 4R4BA 5C0CB 3H7LA 1NBVL 4YHNB 1UWGL 1SYVB 3EYUH 1DANU 4ZXBC 1QSVA 1AJ7L 2CR3A 1OLLA 3V4PL 1CDJA 3MV7E 1H3TA 4F15C 3OKKA 4D9QE 3X12A 1WCBA 1PX3A 5E9DA 4L3ED 3QCUL 4FG6D 5FUZH 4YDVB 1FGVL 2XG5A 2VR9A 3VXMD 2H1PH 5I75C 5SWQB 1H8SA 1Y0LB 3GMRB 3N9GL 2BVOB 4YK4B 3CU7A 3BW9A 4QXUL 1ZHLA 2B8OT 1MJJA 3H3PL 1F97A 2PW2A 2VKWA 3HFMH 2H2PD 1ZVSA 2DQGH 3WS3A 1OAYH 1UACL 3R06A 3RHWK 5T33L 4G80B 3UCRA 4Z8FL 1IMHC 4B41A 3EO9H 1MAKA 4MYWB 5F9OH 3T8XB 4I9WE 1T3FA 1O0VA 3O8XC 3P4OA 1RZ8A 4EOWH 5EIIB 3K2UH 3BKCH 1CL7L 3SE3A 4Z7VB 1N5YL 1YEDA 1JPFB 4JY5H 3TBTA 1NBYB 5HHQA 5D1ZC 3CFBB 4MXQD 3VG9B 1F2XK 4XTRD 4KAQH 4Y5VB 4NUGH 2BK8A 4RMTA 2A83B 2G2RB 3ARBB 4MWFA 2YD6A 3L3GA 4E41B 4KJPD 4PGEB 5E00B 3UPAA 5ICZB 4CMMB 4WNQB 4DQOH 1M7IB 1NDGA 3GSOA 4TVPL 5DT1H 1BX2B 4LVHC 5F70A 5ISZE 3GK8H 4QOKA 2KZ1B 4Y19B 3OKOA 3O0RH 3W2DL 2IQAB 2YPVH 4GG8B 3QXVA 5F7EL 4B53A 1WBYB 1F4XH 4JANB 1KCVL 1SEBB 4HD9A 3S4SG 4M4PA 1ZHNA 3UBXI 5C0FB 4G9FB 1U42A 5L7XH 1JWMB 1F00I 5JIHA 1NEZG 1LK3L 3QXAA 2W0KA 4XNYH 5D8JH 2CDFB 1A6ZA 2ICWI 2JE8A 1EK3A 3GMOA 4WI2A 4MAYC 2I25N 5E6YA 1MI5E 1T0MA 4BFGA 3LD8C 3RDTB 3QDME 3ZDZF 3DGGA 3IDGA 3QWRA 4OUUB 3MQIA 1MHPH 3RNKA 5JMRA 3BQUD 5DK2A 4HGMA 3V5HA 3X3GH 4Z7OE 5LXGH 3O9WC 3DX8A 3I6GB 5BVPH 3ZKND 4KUZL 4CJ0A 4G7YH 1YMHA 3X3FL 1ZEAL 1IGML 1EHLH 4Y1AA 3CFJB 1CD9B 4OIAA 5DJ6A 4G43B 1J1PL 3TBWB 3GBNH 4P2RE 2QEJA 3GJFA 1VERA 4KJQD 3I75B 5IESL 3TWCL 1IZKA 4M93C 1YNTB 4M8QA 4FMFA 2DM2A 4MB4A 1CD1A 5HGAA 4PV9B 3GKZA 5FKPA 1BEYL 4FZ8H 1J86A 4D9RD 5EB9A 3ARFA 3AY4C 2EZ0C 4XB8A 2ERJB 2VNCA 4XP5H 4UUJA 1R24B 5FUOL 3B5GA 4GRMB 3NCMA 4N9OB 3MRLB 4MMXC 3W39B 1OP9A 4F33B 1BD2D 1AGEA 3G5YB 4DZ8B 3T0AA 1A5FL 1A6VL 5J12B 1W0WA 3MRFB 5AYQA 4L3CA 5C07D 3HMXA 1FAIH 2E3VA 3WFCL 5FECB 4OI9A 2FO1A 5D96C 4IHOB 4QO1A 2W07A 1X5FA 3OB0H 5I1GL 1FCGA 4MSWB 4RZCA 3LN5A 3S96A 5F7KC 1E4XI 1ULVA 3ARXA 2XRAH 2ARJQ 3TO4B 2D4DA 1G0XA 1S78C 1J0IA 2NNAA 1DEEA 1PKOA 5KVDH 4EI5A 3HMWL 3MUY1 4V1DB 2DOCA 2IAMA 2X89D 1M4KA 3OX8A 1XCQA 4I1NB 3NGBC 4LLQA 4LHUD 4QHNA 4WEBL 2ICCA 4LSSH 1YPZA 3MV11 2ESVE 4XMLH 3ZYJA 2DMCA 3NH7H 2ZUSA 2QQNH 2XXMB 1YYML 1ZT7A 3WDJA 1S9VA 2FJGA 4NFDA 4PLNC 4M61B 3CMOL 2FL5B 2VR4A 3AS2A 2XZAL 3I6LD 3R1GH 4PRBB 3DROB 2ZWLT 1OTTC 1OGTA 3AS0A 5IVXF 3WUWB 4FABL 4QHLA 2BFVL 4OLVH 3QPXL 4IJ3C 4X80H 1FRGH 3J8F7 3WXWL 2DQFA 3DXAD 5CZXD 4IRJB 4LNVA 3RWFB 1I3RA 4NBYB 5D7LD 5KSAD 5DTFB 2ZUYA 4NOBA 2CKBB 3OJMB 3O41A 1UKTA 2ZUWA 4NUJA 3RPKA 2HMIC 2DQHH 3EYOA 4B7IA 1HOCA 2ADFL 4P0DA 4AL8L 3BYYA 4PGDA 4KROC 4WO4A 1UG9A 3T4AB 3F58L 3GJFH 2P5EA 3C5SA 2HN7A 4OQTL 3DIFA 3G6JA 1AO7A 5D1XD 1IGCH 1GPOH 4WW2A 4IOFD 2H2SC 5D2NB 4ONHB 2Q1EA 4HWNA 3BPCA 1UB6A 1MVFA 3C9NB 5DSCA 4L9LA 3ILQC 3K8MA 1FYHB 1G84A 1MHEB 3PHQB 3GSRA 1D5BA 5D1QA 8FABB 4I48A 3HC0A 2DL9A 4JRXD 2NXYB 2B1HH 1S5IL 1CE1L 2VO5A 3D69B 4URTB 2WP3T 3GO1L 3TPKA 2FZ3B 4OGZA 4ZUTB 1TQBC 4JM2A 4O9HL 2Y5EA 1VHPA 3PWJA 3O45A 5DDHB 3DI2B 3S98A 5E99H 12E8H 3VD5A 3B6SA 3S37H 3HMXH 1D6EB 4M00A 2CMRL 3L3IB 2WNGA 4OLUH 4GKSB 3MRBA 4BK5A 3BKMH 3NPSB 5EWIL 4Y4FA 1I8LC 3UTPE 3QEHA 1UCTA 2YUXA 3QNXB 2Y23A 3QRFM 4XVSL 4GMTH 4F57L 1A0QH 2PXYA 3TO2A 4AIZA 4R3SA 1RZKL 5DS8B 2MPAH 3S88H 3HAEA 1D5XA 1S7VB 3VG9C 1S9WA 1I1YA 1I9JH 5FYLD 1UADC 2DRUA 2BRRL 4N90D 4OAWB 1I9EA 2DYPB 3ARGB 1MUJB 5C0RH 1E6JH 3DPBA 2GJJA 4IDLA 3RWIB 4AENA 2BY3A 3K80A 1PSKL 1MPAH 3QIUD 1P7KA 4RNRB 5M95B 1G7MB 3TNNA 3LHPH 1DBBH 4MJ6B 5EU3A 3HC4H 3FB8B 4B0MM 4WJ5A 3PGCB 1LDPL 2VDKL 1C08A 1LK2A 2F8XC 5BRZE 5C2BL 2OJEB 3H9YA 5B39G 4LU5L 2OBGA 1A7NH 2DI8A 2AV1B 2X41A 3TH2T 3QA3B 2CQVA 2I9TA 4YDJA 4LLDA 1KCUL 1MRFL 2D7TH 4YHIA 5CILL 2WIIB 1JE6A 4XNXL 4ZNCD 4CN1A 2Q7NA 4OKVA 2YUWA 1KN2H 4JRYD 4LCCC 5IM7B 1RULL 1OGAD 1BREA 4XPGH 1I85C 1V7ML 2AK1H 5LBSL 3GSQA 4HFUL 4JJ5A 3GGWB 1UM5L 3D39A 3FQUA 3OJVC 3GI9L 2MKWA 2Z8SA 4FXGB 5A2JH 5FYKE 4PLJC 1ZA6A 2LAAA 4WCYH 4KK6D 3F12B 4PLKD 1CDBA 2JELL 3D85A 3GI8H 5HPMB 3QO0A 4JFPB 1T5XB 2DN7A 3CFKA 4NQEB 5IB4B 4HMEA 4BSWA 4MD5B 4M5ZH 5FGRA 3LEYL 2X5PA 1U91A 3QG6A 4KKBD 5DI8B 3H7BB 1OY3B 3CUPB 5JDSA 4K3GA 4GS7B 3TVMD 4QRUB 2YD8A 1AR1D 4P5TC 3MJ8B 5HYSG 5CIPB 1KACB 5FGSA 3BKYL 1S7XA 2ERJC 3H3BC 2F53B 4BUHA 3QDGB 4OLXL 5AAWA 2NY1D 2VE6A 3RVWD 4NN6C 4NFBA 1GHFL 2MCG1 3RIFF 1N2RB 3STZB 1HEZB 5KS9B 1R5IA 3BZFA 5EU6B 4NP4H 1NC2B 3BGMB 1PEWA 2R2HB 3HAEH 4PJGA 2JK5A 4BH8A 1U58A 2D7QA 2F74B 4O4YL 2IBZY 2NY7H 2F9BT 4P23A 3NBNA 1ZT4A 4LARH 3OKEA 3AU1B 4JZJB 2N4IA 4PB9L 2R4SL 1P6FA 4JFEA 5E8EB 1NLDH 3PWNA 4XMKH 5TPWL 1MJ8H 4NO0A 1J1XH 5DO2D 1QRND 3PQYD 3V6OC 2A6KA 2LE9A 4L8CA 2RQ8A 1E4WL 4OD2A 4KKLC 2OR8A 4S1SH 5DJCA 1GZQA 1YEHH 4RMSA 1DVFB 4PLOB 1AR2A 4EN3B 2DQDL 3LKRA 1NBZA 4G9DB 1IM9B 2IQ9L 5HYQA 4TQEH 2D7NA 3ES6A 2X4RB 4U1MA 1K2DA 5I0DA 1MFCH 1RPQA 3GIVB 4W4NA 2NZIA 2HKFL 4MNHB 2ZG1A 4ZO9A 4HMCA 1XF3A 4W4OC 3N50A 3G08A 3PWLB 4XCNA 3RRQA 1CXKA 3UC0L 5I1CL 3SPVA 4NRYA 2Z4QA 3VFVA 3EOYG 2FH6A 1JF5A 3O4LD 3VFSB 2W60A 4ORGA 3FFDA 2NY0D 3RUGB 2X40A 1MHCB 1IQDB 5IVXE 4P2QD 5JQ6H 3GSNB 3G6AA 4L5FL 1HQRA 4JPKH 4XVUD 4P3CH 4PRAB 4V2BA 5M7QA 1OHQA 5DJZB 4LAQL 3RY4A 4R8WH 2VUYA 3LQMA 2ED7A 3OL2A 4POZD 2C4FU 3WE6B 1CGTA 2JCCA 5F1IA 2W9EL 1EBAA 2GJ6E 2AJUH 2FNBA 1Y18A 1JV5A 4LHUG 4K3HA 3SJVA 1IT9L 4L3EE 2CO6B 2NTFB 3M8OH 2OQJB 3OR6B 4PJBB 4RMUA 3VXME 3LQAH 4UTAH 4LLVA 4F9LC 5HGHA 2QTEA 3OZ9H 2FHFA 5CGMA 3V52L 3RVVC 1FL3B 1NCWL 2J8UF 4KTEL 4NO2B 2ZSWB 5IFAH 1PYWB 2WANA 4MA3A 3NPSC 2GHWB 1KCSL 1KG0B 3BSZL 5HY9B 4DUWA 5GZOD 1AGBB 4Q7DA 4UQ3A 2GIYA 5KTEL 4F3FA 2UZXB 5JOFB 3A67H 3NFSH 1CBVH 4TRPL 1MFBH 5JLZA 1MVUA 3MGTB 4JFYB 5D5MB 4NZTH 3FO2B 3EHBD 4NO3B 4DN3L 1U6AH 3VDCA 2IWGA 4Y16B 1EEZA 3MBEA 3MRNB 5I71C 1YEKH 3U30B 4X4XA 3RHWF 1ZXQA 2GITB 4I2XB 2VLLB 4ZXBD 2EDJA 4LVEA 1FBIH 3C60C 5CSGA 5BV7B 4QRPB 4K8RH 1XIWB 4Q0XL 5EULV 3PNWB 2J88L 5JW5B 1RK1A 5E8DH 1FDLL 3MJ9A 3FQWB 3FOLA 1ETZA 4OM1L 3CLFL 4HPYL 2Q7YA 2ZSVA 2ADGA 2ENSA 5FYJL 4ZFFA 4M7JL 3VXRD 3TCLA 3CSPA 1VGEL 1YJDC 5GGUA 4R0LA 3L3DB 1H5BA 5DUML 5HDLA 1KYOJ 4PJEA 3WFBL 3NA4A 1I8KA 2VAJA 2HFGH 5HHXL 4HIHA 4X4ME 4JZNB 1DSFH 1FZKA 2WWKO 5DD1L 4DCQB 2PYEB 1JZ2A 4HCRA 2D31B 5E8OB 5MI0C 4YHLH 2MNUA 1QYGH 2OR7A 4M43H 5D2LF 4ZFOL 3CDGB 3Q5YA 4LIQH 1HINH 5DVKA 5FDYA 2OK0H 1RZ7L 1U8LB 3WFEH 2EECA 1FL6A 5CMAA 4G8EB 1X5JA 2AP2A 5INCB 4HDIB 3OQ3B 1NCNA 4LPXA 2DQCL 5IQ9B 3L1OL 1NAKL 3N85L 4HG4J 3KJ4C 3U6RA 4GS7C 1ZAGA 3KHOA 4JEGB 3C8DA 5HI5D 3S7GA 2ARJA 4IRSB 3C2AL 3HZMA 4GRLB 4L4TD 3QIBB 1FCCA 4H0HB 3WFDH 3MREA 1DANT 4D9RE 5B3NA 1QSFB 2QLVB 3QAZB 2CUMA 4HS3A 4C56B 3L3KB 2R56H 3CH1A 3QWOB 3UJTH 5EZIH 4JO1H 1QBML 3WV0A 1QO3B 3VFNA 1F8TH 3JWOH 4MAYD 4Z0BH 3WDIA 3SDXB 1Q72L 2BP3A 1CVSC 1BD2E 5IR1A 3REWA 2A9NH 3ROLA 3HZKB 1AFVH 2DKMA 3VCLB 1KELH 1DN2A 3MLYH 5C07E 1CDGA 3BH9B 2GUOB 3I2CL 5EUOB 5T3ZH 4BSVB 1QBLL 5DQDH 5CWSB 4GT7A 2QL1A 1OCWL 3QFJA 3MNVA 4JZJC 1CFBA 1TNMA 1VSCA 4MJIB 2V2WA 3SDAB 1I7TA 3VI4F 3N0PB 4HIJA 5DGRA 3LMJH 4IMKC 4AEIL 1HHGA 1AD9B 5SWZA 4Z5RB 3MJ9H 4PG2A 1CFNB 3VFRA 4J12A 4ELMA 1F4WH 4P99A 5JW4R 5D9SB 1TVBB 3RWEB 3BIKA 1LEIB 3ALWA 4Y4KB 3SGJC 1BFVH 4K2UL 1FFOA 4HJGB 4O2FB 3E1F1 1NL0H 4M1CC 1AGFA 1J1OL 2EZ0D 3HNVH 3KR3L 5C0JA 3FB7B 2A38A 3HG1E 1BM3L 3LPFA 2QQLL 4WY7H 3I6LE 4FQJL 2AEPH 2EYRB 1QLEH 1WFUA 3BMVA 3QUKB 1V5JA 4HCRH 1UENA 3QUZA 4LCYA 4PP1C 4YPJA 1ONQA 2VLKD 2HJLB 4RCAA 4XH2A 5E70A 4X8JB 4XXCA 1CVRA 3DXAE 2YC1B 1OAUH 3CK0H 3KYKL 3PP3H 1G9NC 4P5KB 2DLFH 2G60H 1EFXA 4LP4A 1ES0A 1JF1A 1WBZB 3RVXC 1FZJB 2B1AH 1S7UB 1OSZA 3IFPB 1EPFA 5JO5A 2V5SA 2DTMH 4W81A 3P0YH 1IC7L 5CP7A 4DW2H 2DWEA 4PS4H 5J9PA 5KANG 4BQCA 3TLRA 3O3AA 4XP6L 2DD8H 3B2VL 3E8UH 4JFOA 5BMFH 3BO8A 3KLHC 1YY8A 3MUJA 2H26B 2X4OA 1RUMH 1PKQA 2VXQL 1T21B 3CAFA 4UAOC 1LVEA 1D5ZB 4JRXE 4WFHD 4LBEB 1FNHA 1ZHBB 4KFZC 4CN6A 3GIZH 1S3KL 1FNSH 2JIXA 2V9QA 1F6AA 1RQ5A 2FSEA 1OTTD 4HIXL 3QB7C 3CSYA 2PO6B 4GLRH 4LAJH 3RL2A 5EC2A 3MSPA 3HI5L 3SDYL 4K71B 2QQKH 3DLQR 5GGVH 3WD5L 1VDGA 3HI6H 1EX0A 1DBAL 3VE0B 5JHLH 5J6GA 3QUXA 5KZCD 4OF3A 3C5ZC 3B5HA 1KPRB 4JDVA 5B38B 2DWDA 5BOPA 2HVJA 4ZYKA 5HVFB 2WBJA 1C16A 1MCKA 4DFIA 1U8HB 4QHKJ 2HMID 2AW2A 3MV9B 2F54A 5J11B 2HRLA 4NNPH 4M62L 4Y16C 5C0CD 1CLOL 1OAKH 3WUZA 5TQ2L 3L9RB 4I5BB 5FYLE 1JFQH 4N90E 5IMKA 4NSKB 3KJ6L 2H2SD 5INDB 5BV7C 3ILQD 1IAKB 1MSPA 4JPVH 1UM6H 4I8DA 3VFUB 1BF8A 1K6QH 3D18B 1ZHKB 4X6BB 1Z5LA 2EICA 3UDWC 5AD0B 1IJ9A 3EFFB 4HWBH 3WEXA 3ARDB 2OYPA 4OCRL 1R3LA 5IF0B 3S35X 3V8OA 3C5JA 3KAAA 1J88A 4UILH 1VADA 2L4OA 4X4YB 1ADQL 5DJ8B 3FKUS 1G9NL 1LDSA 1S7QA 2OMNA 3ZYOA 1T2QH 2AS5M 2ZKHH 5CSZA 3GB7A 2V17L 4MZ2A 4ZAKA 3D2UB 4KMQA 3SO5A 3MUGA 4U1JB 2WLZA 4Y5YB 3DI3B 1WEJH 2H45A 4NT6B 2UUDK 3OF6D 3RI5K 3UTTA 4I77L 1EAPA 4PGBB 2Q86A 2LU4A 4NM8L 2VDLL 4PRPB 1EEYB 1XGTA 3UAJC 2PR4H 1ZE3C 2E9IA 5ESAB 1HKFA 1A4JA 2C1OA 3QHFH 5F7FA 3VGHA 5CEZD 1LO2H 5HHMB 4G6JH 4EUPG 1JPSH 1FN4A 4YQXH 4H26A 3OGOE 2UWEE 3RWGA 3I85A 5LG1A 3V0WL 3HE7C 1EJOL 4GRLC 5LGKA 3QIBC 3OKYA 1YZZA 4G9FD 5F3HA 2DMKA 5EBWA 1RJLB 3CPLA 3EYSL 3HB3C 4OLWH 3UO1H 3D87B 3NAAL 3TNMA 3VG0L 4AJ0A 3X11A 5KVEH 3OKMB 1BQLL 5CP3A 5C0BD 3GSXB 4PREB 5F89A 1K5NB 5HXMA 4JPWL 3RFZC 5TH2B 4M6AA 3WJLC 5I1IH 2PNDA 1MWAB 3I02B 3M07A 1DQDH 2XG4A 3HNSH 1QOKA 1RUPH 4YAQB 4YHPA 2CLZA 3BEVB 3AMLA 4UOW1 1V05A 1QFUL 2IPUG 4L1HA 5BV7L 5I1KH 2NYYD 5IBTH 1D5IL 5D7IF 5D6DA 4PJHB 4XMPH 1W2KT 5HYJA 2AABL 3MLXH 2FJHB 1DBKH 3EYFA 2ZOLB 4PLJD 3VXSA 1XGQB 3RWHA 5IEHB 1R5WA 2RAMA 3QNZA 1QNZL 4M9PA 3VJ6B 1RIUH 1XMWA 2YEZA 4B5EA 4AH2A 2FHCA 4XAKD 2IANA 1S7SB 1K4CA 2I5YH 1FIGL 1QRNE 2BVQB 3QCTL 3PQYE 4P4KB 5I1JL 1HZHL 4P5TD 1NCBL 1NAMB 5FCUL 4BH7B 1N3NA 4KH2A 2DIJA 3N9GH 4YFDB 4FHBD 1MFAH 3QEQA 1FHGA 4N1EA 3RU8L 5GJSL 5F88B 5HVHC 4LF3B 5ISZA 1X6NA 4FQ2L 3O6FA 2HTKC 4YHKL 3QI9C 4MCZA 1BFOA 1G6RA 2XWTA 4X9GA 3WXVL 3MRPB 4ODVH 1RJZB 5D71H 1X4YA 2HTLC 2AJYL 4XAWL 4P9ML 4NQXA 5HHPA 1FGNH 4OLZH 5D1ZA 1V3LA 1HYRC 3O3UN 2B0SL 1KB9J 3UMTA 3TO4D 2YRPA 4U49A 3BE1H 1JWSA 3QYCA 2FECI 4YDKL 4N0UB 1TXKA 3MLRL 4V1DD 5F71A 2CKNA 3TA3C 5F7MC 1TZHB 4TVPH 5ESQB 3DUHA 3DO7B 1P6AB 1IBGL 3NCFB 4OZIA 2GSIA 4R4FL 3E3QE 1NDMB 1LILA 4X8XA 1F58L 4IIQB 3BWAA 2ICEA 4HUXB 3VFPB 5E6IA 5MERA 3IDNA 4KKLD 1YC7A 5HVWA 1KTLB 1QEWA 3BPOB 2VLJB 4YUEH 1QVOA 1D9KB 4WFED 5J57B 1WGOA 1OW0C 5CJXC 5FCSH 4K7FB 1M7DB 3W0WB 2V2XA 3TC9A 2OMBA 1QFHA 4Q74A 1J9CT 1HH6B 2EDRA 4IRJD 1A6WL 1UH3A 1NJ9B 5C08B 4RAVA 3O11A 1F13A 4X7DC 4ZO7A 4HW6A 3T08A 1UA6L 3IXTA 5JPNA 1AH1A 5FYJD 3AREB 2EKSA 3NCYP 4Q9QH 2GI7A 4JFXB 3KXFD 4ZUSB 4P4RA 5I74B 3QFDA 4Y4HA 5FO7B 4QKXB 2ZCHL 1LE5A 4CL7A 3GSUB 1Z9LA 2BNRB 3KDMA 4LLYB 4L8DA 2V7HA 2PTTB 4XP9L 1N8ZB 3QIWB 2NQCA 1UVQA 3MFFA 4PJCA 2DM7A 4KVNH 4LK4A 3GHBL 3MLZL 3A6OA 1FFNB 5I30L 2O5ZL 4NFCA 3CMGA 5K93A 1U8JA 2NXYD 5EBLA 1FG2B 3RNQA 2XT1B 5I1AA 3DOSA 1BOGB 4QYOB 2BOCA 4JFFB 3ARDC 4PTUB 3DO3A 4XZUB 3EGSA 4YGAB 3B3IB 3PWVA 2NX5E 3VD3A 4U1SA 1G6RH 5GS1B 1NC4B 3IGAA 2G75A 4L4VB 5CHNB 3IB4A 4WGVB 3RVVD 2DJSA 1HDMA 2AK4A 4G8GA 1I8MB 3T3ME 4F7MB 3LRGA 5SWSA 1F4HA 1RUKH 1YUHB 4Y5XC 2GK2A 1JBJA 4WTXA 4EVNB 1IEHA 4U2ZA 4KHTH 2KPNA 2X09A 3K8LA 3U48A 3HUJE 3V5KB 2X1PA 4JFDB 5DD5L 5JHDA 3HRZA 3W9EA 4UB0L 4LPUA 5I1GH 5IP4A 3RQ3A 1R0AH 1DL7L 2H32A 4UDUB 5LWYH 3KYOA 1T7XA 5ANMB 4I0CC 1JN6A 2BRQA 2IADA 3L5XH 3INUH 4WI6A 5C2UB 1BF2A 1XCTB 2DYPD 3ARGD 3U46A 3CLEL 3NZ8B 5MENB 3FT2A 4OKDA 3MLWH 1H3GA 1DBJL 1TJGL 1BZ7B 5LAXB 3GHEH 5T5NF 3MRGA 4PJXB 3KPPB 2P47B 4O5LH 4WEBH 4TSAL 5IKCB 1HYSD 5FM5M 3T04D 4CNIA 3CC5B 4DN4H 4OCNC 1OVZA 3IFLL 4M3JA 1NGQL 3RY6C 4KVCH 4JHZA 4NWTH 5BVJA 1MLCA 3QQ3A 4OF8A 2Z93A 3R0NA 4L4TE 1BZ9B 4KPHH 1INEH 4TUJB 1UWXH 4LKCB 1V3JA 4LVOB 1IGFL 2HJKB 4LLWA 3OBAA 3BZ4B 2BFVH 2ED8A 5HDQL 1D6VH 5CJQH 3CXDH 3ILPA 5ESVA 4RFOL 1PDKA 4AG4L 5KSBA 2FIKA 5DMYA 3F7YA 5KAQF 3MODH 4X6EA 1ACYH 4J1UA 2RIKA 4AL8H 2EXWC 7FABL 1O7SA 15C8L 3HI1B 1MCFA 1G7PB 2NMSA 5TQ0L 4HWEL 3WN5A 4NQED 4OCWH 4EBQL 1CQYA 2D0HA 1JNJA 1IAOA 4NQVB 5IB1A 1X4XA 4PJ8C 2M8XA 5E2VL 2DDQL 5D72L 4OF6A 5D7IE 5TE6H 5HVGB 3P30L 5EH1A 2EYTB 4WHTB 4NGHL 5GIRA 5EOCL 4MDJB 1NGXB 3ZE1F 3QDGD 4G6KL 3U4BH 1JNHB 4GG6E 4O9HH 3QDJB 2A6IA 4Z7UF 3FQRB 2QQQA 1OSPL 1B4JL 2O5YL 3HCVA 4L1DA 3KPOB 3NFPA 4OD1L 3ETBF 4OLYL 1U95A 5C0GA 1MLBA 1B2WH 5BRZA 1RK0A 1RZKH 3BP7A 2GCYA 4YEEA 1FV1B 3S8WA 4XP4H 4M6OL 4R6UA 3AAZB 5MHSD 2GSGA 3U4EB 5SX4I 3NZHL 4I0PA 1U93B 3ALPA 3ESVF 4JG0L 1K8DA 4PBVC 4X6DB 3TCXA 3GSVB 4JJHA 3BPNC 1J8HB 1U2CA 2H9GA 3F8UB 3S3SA 4M1GH 3TIDB 3FOMA 4E5XB 5EZJA 1PSKH 3LRSA 4CAGA 4MS8D 2BY0A 3KYMB 3IXAA 1S7RB 2K9UA 3G9AB 5ICXA 2WAHA 2FD6L 5DD6A 4YGVA 3MZGB 4EN3D 2DIBA 4OB5H 2WQ8A 5I76A 4YX2H 5GGQL 1IM9D 1JL8A 4PRIE 4WFHE 2P44B 3IJHB 1LDPH 1D9KC 2I9LA 3TIEA 5JIKA 5GRWA 5C2BH 3FTGB 1DP0A 3K3QA 3T65A 5I1HL 1KJ2B 1A64A 5LGHL 3FN3A 4PP1D 3EOTL 4KU1A 4UQ2B 5I66B 4Z7WF 3KPLA 1MRFH 1JGDB 2H3NB 4U0QB 4RBPH 1WT5A 5DLMH 3IJYA 2FYYA 5ALCL 1PFCA 3ZL4L 1JGUL 3AREC 1KTRL 5GSRB 5T1KD 3RVXD 3WCYA 5DYOB 3VFOA 1TTFA 3MO1B 3GI9H 4RMWA 2V2TA 5I73B 4N9GA 3C6SA 3WIFA 4RGNB 3FN0L 2B4CH 5C0CE 5L2KB 5D7JB 1E4KA 1TJHL 5KSVA 5FA3A 3UTQB 2HVKB 1Q1JH 3ULVC 1JJUA 4GW1B 1Q9KB 4PJIB 1GAFL 5L8LB 2Y06L 1A6TA 3FB6B 4MX7A 2EEDA 1AIFA 2FATL 1M6OB 4LDEB 3ZTJG 2ICES 4PY7B 4NM4H 3SE8H 2D3VA 3E6FA 1CLCA 4LSRH 2Z35A 2WUBH 3SKNB 3Q6FA 1WZMA 2NLJA 1CR9L 3L7EB 3D6GA 5ITBL 2P8PA 4ZTPL 3CU1A 1BBJB 1NFIB 3VFMB 3FRUA 1MCCA 1MFDL 3SBWA 2AV7B 3WUWG 2DLEA 1VGKA 3NIFF 1Q9WA 4NN7B 2P5WA 5I8KL 2EIDA 3DYPA 4QHUB 1IC4H 2HH0L 1XGRA 4D0BB 2B2XH 2RHEA 4ODTL 3ZE0F 3CDFA 3DECA 5MEPA 2YPLB 4R26H 4NDMB 4P57B 3VRIB 1A1OB 4Z7VE 3DGCR 4Y16D 5GXBB 2O61A 4AEFA 3SN6N 1Q0YH 4H0IA 3S97C 1KYOK 3MTRA 1ZSDA 4ZO8A 4E41E 3RI5F 4ZSOA 4HIIB 5CEZE 4JFZH 4HQQL 5I15L 2C7UA 4NBZB 1JPTL 3BESR 4UT6H 1P4BH 1MJ7L 4JY6A 4PJ5B 3T0EB 5ABDE 4HKJB 3MYJA 4Y19E 3U0WL 5IVXA 1NGZB 2XQBL 2DQEH 3P73B 4PJAB 2JJTC 3UTSB 4NQSB 5BZDB 4G9FE 1TCRA 4P3WA 5J4MA 1AHWA 3D9AL 1I9RH 2EH8L 4LVOC 2VIRA 5GRXG 3ZTNL 5J3HD 3ULUC 2OTUB 1HI6A 1WQVT 3JTTA 2GJ6A 1ZLVH 1T4KA 1JWUB 5AYUH 2X05A 4RX4D 1IAIM 4D8PB 4K3DL 4HG4K 4TSBL 5EG6C 4L3EA 3KPRD 1QSZA 1I3UA 4HUUA 3VXMA 4WDIB 5GHWL 4XPTL 1VFBA 4M6NH 2I60H 4HHAB 1L9MA 5I17B 3BAEL 2UY6A 5ADPH 3ULVL 1K3IA 3QEUB 5EO9A 4N8VG 1U8QB 4I3SH 3BHBA 3QRGH 3UAJD 4PRNB 3O2VH 1QQDA 5GRUH 4YXLL 1QHPA 1B0GA 3HR5B 1T20B 3FO9A 4L5FH 1MY7A 4F7TB 3Q48A 4ZDHA 3WNOA 1U8KA 3VXTA 4R4BB 2ZCKL 5IV2A 3PIQA 3WFZA 3ZZ1A 5KS9F 2EO9A 4XB7A 3T3PE 2BNQD 4XAKE 1X9QA 2W9EH 3ZKSD 5ACZA 3TZVA 4GRLD 4NYLB 3QIBD 1MNUH 1T66C 2LV4A 1IT9H 1QKZL 2MTPA 3X12B 1WCBB 4F58H 2VQ1A 3HB3D 3LEVH 1N7ML 1T0NA 5DQ9A 4LCIL 4C56D 4OIBA 1H3PH 3W82A 1I7ZB 3MRRA 4X7TB 2W38A 4NKDA 1BAFH 3H0TA 3P40A 1MJJB 1PQZB 2XN9D 4MXVF 2PW2B 4N8CH 3OB8A 4LSPH 2NY2B 1I7UA 3GNMH 4LEXH 3V4VH 1ZVSB 4FNLL 3WS3B 43CAA 5IW1A 4YXKL 3R06B 3PHOA 4BFBD 1U3HC 3LQZB 4O00A 3ZE1E 5KTEH 3GMQA 2HWZL 5I6XB 2CIIA 3QJHA 1T3FB 4MJID 1DQJB 3P4OB 1RZ8B 4Q97A 3SDAD 1DQTA 2XXCB 4QT5B 5IG7A 4HF5L 3TBTB 4JVWA 1OAXH 3MACL 2WINA 4NKIH 4V1DE 1RMFL 4MWFB 3CVHL 4XBGA 1SJEA 3SCMC 2QSQA 1FYTA 3BD5A 4PB0L 2J88H 3ULUL 5DHYB 3V6OE 1FNEA 2ADJA 3OPZL 4G42A 1FDLH 4FXLA 3UBXA 1FPTL 4OM1H 2VDQL 4O2EA 5IROC 2WV3A 4LLAA 4MNQB 3P0VL 4M7JH 4HLJA 4RGMB 3CFCH 4QF1A 4WFEE 4KUCF 5E4EB 3FFCB 3MCKA 1QLFA 2ICWA 3HE6C 1QR4A 1SMAA 2HTKD 4RQQB 4KXZI 3QXAB 4GKNB 2YN5A 3IAQA 1VFAB 1VPOH 4UIMA 5HHXH 1A6ZB 3QNYB 1ZTXL 3SQOH 5DD1H 5C7XL 2HTLD 4YWGL 3S5LA 4Y89A 3X17A 2J5LB 3IDGB 1G9MC 3RNKB 3FT4B 1IC5L 2BCKB 5DK2B 1RVFL 3LV3A 1NGPH 3RTQC 3V5HB 1RZ7H 3MLVL 2WUCH 4CW1A 4PJBF 3QUYA 2OTPA 1BD2A 5L88L 3UPRA 1CGSL 4MVBC 4P46A 3TA3D 4UI2A 4W6XB 5D2NE 5FIEA 4GAJL 4Y1AB 5JOPD 4JQVA 4U1LB 3S4SB 3VFGL 3EJYC 1QTYT 4MD4A 4NHCH 1H15A 1V7NH 2ZP0T 4PJ9A 1Q9LB 4EEEA 2FBJL 3LN4A 4K3EL 3BKJL 3EKCA 1CD1B 5HGAB 4AY0A 4YEFA 2XY2A 1IKFH 2PO6D 5GZNC 1QPXA 4OCXH 5D5MF 3ARFB 1ZLSL 2CH8A 2WQRA 4R96B 3TT3L 4WFGD 4LQ1A 2XICA 4UUJB 1OM3L 3MRJB 3UJJL 4XPBL 4LSTL 1KV3A 3DUUB 4LCWD 2X4PA 1CICA 1W0WB 3HG1A 2E27H 4L3CB 5LCVL 4GRWB 1BGXL 4XPFL 4LPYA 1QD0A 2R0LL 1FO0L 2YXFA 3VFTA 1NSNL 3QHZH 5IEKA 4RZCB 3LN5B 3S96B 1I4FA 2CK0L 1T0PB 4U2YA 3NIFE 1NKRA 4CVZB 2NNAB 1DEEB 2FB4H 4KY1H 5TDNA 5JUEH 4FQHB 3VGFA 4ETYA 4J6RL 2IAMB 1KJ2L 4H1LG 3T0EC 4X6CF 1XCQB 4S10A 4OZHB 1N0XL 3MOAL 4PG9A 4QHNB 2YK1L 3ARDD 3BVNB 5IBUB 1Z9OA 2RFXA 1XF2A 3EYVA 1MAML 2AGJL 4OF0A 1DE4A 3SO3B 1IEBA 1L7TH 1S9VB 2FJGB 3DSFH 3T0XA 4YE4L 1MCQA 2QQLH 1L0XA 25C8L 3GBML 4FQLH 4ERSH 1G9ML 5T1LB 2EDKA 2BDNH 3D2UD 4QHLB 3NCJH 1JNLL 3KYKH 5DFWH 4JFQA 3JV6A 1YDPA 4BZ2H 2Y25A 2OL3L 5DMIH 4PRPD 1S7WA 3KPNB 1J8KA 1IAIL 1HCFX 1BVKB 4ESKA 2R29H 1HOCB 4PJFE 2EEBA 4XP6H 5HHMD 3B2VH 2W59A 3Q6GH 1XAUA 4R4NC 4WO4B 4X9FA 5F7WC 2F19H 1PJ9A 5C0AA 3V5DA 3C09B 2P5EB 4TPRH 4AT6B 4WHYG 4APQB 5CBAB 4LHJB 4NQEE 3FHQA 3KNBA 1FFPA 3G6JB 1AO7B 5TFSH 1F4YL 4OJFH 4PP2A 5EU5B 4WW2B 1X4ZA 3HS0A 1EZVY 4NKMA 3BPCB 1UB6B 1QR1B 2OSLB 2H1PL 3GSRB 1D5BB 4I48B 4QTHB 2WMPA 2V5RA 3T09A 2VDPL 4JVPA 4EKXA 1KB5B 1ED3A 1MHHA 1C5DB 3QCVH 2J8UA 3LKSA 5F1SA 4TUKH 1MCWM 2D7OA 5EUOF 2F53E 3QDGE 1RIHL 4LOUC 4I18A 4HKXA 5T3XD 4OTXH 4JM2B 2X7LA 3C5ZA 3QIUA 3HFML 4QLRA 2DQGL 5KS9E 1OAYL 3B6SB 1XF4A 5F97E 1SQ2N 3EO9L 2A6JB 3MR9A 1IGTB 3MXWH 5F9OL 2W0FB 5A2LH 1ND0A 4Y4FB 3RWCB 3LB6C 3DNKA 1T03H 3K2UL 1TETH 5I6XC 4JY5L 1OWWA 1HWHB 5I8OH 4AIZB 1IM3B 2EXWD 1G0DA 4HJ0D 4RIRA 4KAQL 4NUGL 1DLHA 5MHSE 4XBPA 3SE3C 3EOAA 2YD5A 1ZA3A 3BXNA 1D5XB 2ZUQB 3MA7A 4DQOL 3D3VB 3PV6A 3PL6A 2JB6A 5DT1L 3VXNA 4MXVE 3UDWA 5GGRA 4PJ8D 2E9JA 3O0RL 4P4KD 2P43B 3IJSA 4AENB 1F4XL 1LNUB 4RRPA 5C09D 4GBXC 3IKKA 1KB9K 1KXTB 2VISB 3F62A 5L7XL 3TNNB 3UZQA 1OAQH 1ORQB 3DVGA 3FCTA 4I3GA 3O2WH 2G9HA 5E4EC 3PDGA 4XNYL 4M7LL 1OL0A 5D8JL 2R4RH 1LK2B 1Y6NR 3DBXA 2X44D 4ZO6A 5DD0H 4FQ1H 1MEXH 2W9DH 5D2LA 4JO3H 4L8BA 4GJTB 2D03H 1N4XH 1VACA 3BP6B 1MHPL 2I9TB 4S1QL 4MMZC 1I75A 4YDJB 4LEOB 2OM5A 2J5LC 4YHIB 1I1RA 3X3GL 4E9LA 1MQ8A 5BVPL 4LASH 4NM8H 5MEQB 1H3XA 1F6FB 2Q76A 4G7YL 3VGAB 3RUGE 5ID0A 3GSQB 1EA9C 1EHLL 3D39B 4JHWH 1M71B 3GBNL 3P4MB 4K9EC 1S9XB 4JCLA 1QFWI 5GRVL 3MRMA 5H37H 3HE7A 1SYSA 3H9SD 1CE6A 3M1BA 3D85B 3QO0B 3CSBA 1FIEA 3KPQA 4IOIA 3QG6B 4FZ8L 3Q5OA 2VLJD 3B43A 5FUCE 4ZD3H 2GFBA 5B39B 4XP5L 2IH3A 1F11B 1D9KD 4JVUA 4QHKI 2D2OA 3GMNA 3NAAH 4OGXH 3ARFC 4LCUA 3W0WD 3HPLA 3QUML 2DBJA 1C12A 3IU3B 2MHAA 32C2A 2RR3A 2VUOA 5HJ3A 1DUZB 5IB2B 2NZ9C 4KV5E 5T1MB 1FAIL 5J1AA 4IBLT 4QHMA 3ARED 1WWAX 4PJGB 2JK5B 4QXWA 1QFUH 4BH8B 1U58B 2XRAL 3CCHA 4LGRB 2KL6A 2A77H 2YA0A 1EAJA 3HZVB 5D5ME 4GOSA 2BNRD 1PZ5A 5KVDL 1AQKH 1KJVB 2XQYK 2FH8A 2X1OA 1ZT4B