1JRHI

Complex (antibody/antigen)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
b'SVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY A6
publication title Neutralizing epitopes on the extracellular interferon gamma receptor (IFNgammaR) alpha-chain characterized by homolog scanning mutagenesis and X-ray crystal structure of the A6 fab-IFNgammaR1-108 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (antibody/antigen)
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 1997-09-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1jrhI00
3NGBB 2EH7L 4G43A 2PXYA 4PJEE 3QUYB 2A6KA 5FHBL 5HI3D 5D96C 3VFVB 4D0BA 4DVRH 3HG1B 4OD2B 4GAYB 4OCRH 1S7SB 4WHYH 3KXFB 2NY1D 43CAA 2YC1B 1G7PA 1BIIB 1FL3A 1KXVC 1SJEA 3JWDL 3BQUA 4XZUA 4I4WB 1OW0A 2H32B 1W0VA 5D1QB 3H0TA 3P11L 1AGDB 1X5IA 4NQTA 3VD3A 3INUH 1NC2B 4JCLA 3RVWD 1B0GA 2VWEC 4K9EH 5JPMA 2PTUA 2BXZA 5D2NA 3RWCB 4TUOB 1W2KT 5CEXA 3LPGA 3QXUA 2GCYB 2Q86A 3I50H 3MRGB 4AQOA 4ZYKB 5DK0A 2HJLB 5HHME 4AIOA 5CZVL 3V5DA 1T7YA 1U58A 4FNLL 1K2DB 4U1LB 4F3FA 1NL0L 1S7TA 1CFTB 1NBQA 4GG8B 1GOFA 1BZQK 4NNPH 5GHWL 4KTDL 2H2PD 3DPBA 4EI6A 1ZANL 2LABA 4XMLH 5IHBA 1JUFB 5DJDA 1M71A 3CH1B 1SYVB 2RAMA 3RL2A 4AENA 3NCJL 4R9HA 3C5ZD 2R69L 4XTRD 5FYKH 3RL1A 2C4FT 1BJMA 2QLVB 2LU7A 2ADFH 5ID0A 3MZGB 3QUXD 5CEYB 5GRVK 3RWJB 3KPPA 4ZDHB 4PJBE 5DEGA 3SDXF 5LGJA 3BW9A 1TZGH 5FYLH 2R0ZH 4GBXD 4DAGL 1BPVA 2UYLB 4XPFL 1HHIB 3FJTA 2NR6D 3G6AB 3R06B 4HIJA 4UAOB 5CIPA 3AREC 5E8PB 2XPGA 4Z7WA 3QDMD 4OLUH 5K59E 3KXFD 3QULB 1XR9A 1MIEH 1HHKA 4L4VE 3ARQA 3RX8A 1DEEA 2GQHA 1R5WB 3ARVA 2NNAB 4XCFH 5HI4D 3O8XD 1A9BB 3Q0HA 2PR4H 5SV4A 5FOBB 2BVOA 4JFOB 1W0YT 5FK9A 4JDZB 3VXNA 3EFFB 5HVHB 5D1QD 1FNGA 1RFDL 3GB7B 1QRKA 4OLWL 1V3JA 5FUZH 4Z7WE 5ACZB 3D39D 2AGJL 4LPYA 3CMGA 4U1IB 2OK0L 1OT2A 5KVDH 2BNRB 1KV3A 4LQFL 2WLZA 4KVCL 1I1FB 3A6BH 1AY1H 1D5MB 4O51B 1LK3H 1TITA 3ZDXE 5TDOB 1CFBA 3IFNL 4LSSL 3V52L 5I1CH 1JK8B 4JG0H 5IF0A 5T1DH 3ULUC 1J0KA 2UVFA 2CUHA 4OSUL 1AC0A 3NIFE 4HWBH 4MCZB 4JFXB 4NWUL 2CRMA 4Q2ZB 1UWGH 1A3RH 3OGCB 1JZ7A 3HMXL 1IQDB 4IRJB 3GIVB 3KJ6L 4PGCA 4PJXB 1UJ3C 4OZIB 2X9WA 4PY7B 1N0XH 2EKSB 5B8CB 3DX7B 2VXSH 3PWUA 4GS7B 2FX8L 5T3XE 3O4LD 5FO9A 1FL5B 2WIMA 1YEHH 4NPYA 4PJ5A 5D71L 3DIFB 3P4MB 4BQBA 3VXMA 3BN9D 4OIIL 3VFOA 4Q9QL 5CJ5A 2OMNA 3GMOB 4I3SL 3T0DA 2OSLB 1KCRL 5D72H 3DOSA 1EHAA 2DLFL 1K4DA 5A3IC 2NY4B 4YHML 1TDQA 3T4AB 4LF3A 5DWUH 4K3DH 4TTDD 2R0KH 2R2HA 5DRWB 2NYYC 5E7FA 3ZT5A 2CLZA 2VZOA 2HP4A 1KC5H 1FAKT 3AY4C 5CWSA 1SY6L 4NSKB 4ZS6D 4DZ8B 3KLSA 5IROA 4HMCA 2XA8H 5JMRA 4M3KB 1OP5K 2JK5B 5E5MB 2VAJA 3MCLL 2BNRD 5E2TL 3ZYIA 4Z78A 4OLXH 3D3VA 1IAOB 2GJZB 4E41B 4LKCA 2DMBA 4LLVA 1G9NH 5FIEA 1YYLL 3MRLB 3VFPA 2VDML 2M2DA 4A6YH 2VZ1A 4G8IB 4LKXA 5CGMA 3G5VA 4UDUB 2H3NA 2PYED 4PJCB 2MQ0A 2A6DB 1VADA 1EGJA 2IPTH 1A1NB 2VN4A 2EDRA 3RDTB 3V0VB 5I71C 2MTPA 3WIFA 3ZE1F 2F54B 1G7IA 1OAXL 4YUEL 2VTFA 1Q1JL 1DN0A 4IRJD 1ZKAA 1OAZH 3DMMB 5IB3B 2FJHB 3ZYJA 2Y07L 2X7LA 1QHOA 1S7VA 1N5AB 4FQ2L 5C8JB 4PD4K 2EH7H 4M7JL 1F97A 1OHQA 3SJVB 5MEOA 3C9NA 3F62A 2NXYC 1MLCA 4X8JA 1S78D 3RTQC 1RHFA 2JCCE 4XRCA 3V5HA 4JZJA 2NY4D 5I73B 2CLVB 4NZJA 1S7RA 3JWDH 2AXGA 3BD5A 1CGVA 4XCCL 3SOBL 1FL6B 3VGAB 1X44A 3JUZA 2V6HA 1TQCC 1PEWA 5FGCB 2UV3A 5SWZA 2JE8A 3RTQA 1VSCA 4QOKB 4EZMA 1OGTB 4PGJA 3LKNA 3RWIB 5CZVH 5I6XB 2XNAB 1VEOA 3G9VA 4FNLH 3PJSA 4MD5A 4ZUUB 5F6IB 4E41D 3QHFL 3EZ8A 5J1SC 4ZFZA 1MCDA 4I8DA 1MSPA 4QEGA 2KDGA 5C6WH 5GHWH 2Y72A 1K4CB 3SDDB 2P8PB 4KTDH 1EXUB 1ZANH 1SJXA 4FFZL 5JW3H 1X4XA 1BGXL 1BVLA 2DIJA 1K85A 5CBEA 3GNML 3PGCA 3NCJH 3RDTD 4BQ8A 1T1WB 4N1EA 2NW3B 1CGSL 2R69H 2F54D 35C8L 3S5LG 4J3SA 4TNVK 2FBJL 5CAYB 2J2ZA 3LAFA 4KWUA 4MA1B 5CKAA 3DMMD 2Y7QA 4WO4A 4TNWK 2B5IC 5IOPA 2XWJB 4X6BA 3DO3A 3FONA 4AQ1B 5BVJA 3ROLA 4DAGH 2ED9A 4P5TB 5H94A 5K9OB 4XPFH 3U2SA 4JFDA 3LKPA 2AQ1A 2HWZL 4X6CF 1BQUA 4JFEA 4O2EA 4GRLB 3OXSB 1JHLL 2W0FB 5D1ZB 5I17A 2V2XB 4H1LG 4M48L 5IG7A 1JPFA 5DYOB 3WS3A 5T5NG 5C0DB 3CX5K 2EIBA 4QRQB 1PG7L 3CLEL 4OJFL 2FZ3A 1MCCA 5I8EB 2JTDA 1Z9SA 5L8LB 2EYRB 3WNOA 3IU4L 2ZKHH 1RFDH 4CKVX 3L7EB 4M7KL 5DK3A 4JFDE 4UU9A 4LCWA 3IJSB 4XAKE 4HKZB 3SO3B 1X5JA 1JVKA 3ZDYF 4DZBB 4XGZA 4EN3B 2VQ1A 4JPVH 3ULVF 1XF5A 5I1EH 5MI0C 2AGJH 3EJZD 4HWZA 3IDGA 3PGDB 3FO1B 2OK0H 4Q6IC 5E6IC 4LQFH 3OHXA 4QOKD 2HFFB 3HE6B 3MBEB 4P46B 4NC2B 4KVCH 3KPMA 4W6WB 4ZG1A 4Y88A 3G5XB 4TUJB 1KSRA 3V52H 4XHQA 5IEKA 4LCWE 4BUGA 3EJYC 2QQKL 4CVZA 5DJCA 3PABB 4MS8C 3SDDD 1SMAA 4OSUH 1HDMB 4HG4K 1MHCA 4LK4A 1H5BA 1R0AL 5E6IA 3UTSA 4NWUH 5HHPA 3VD7A 4D0DB 1YEKL 3IJHA 1DQTA 1RIHL 4HGMA 4ELMB 3HMXH 2EDLA 4WEUD 1G7MA 2BSRB 3KJ6H 5EZJB 1TVDA 2M8XA 3FMGL 1CFQA 2FJGA 2FX8H 1HXMB 1WAAF 2ICWI 1R5IB 3ULUL 3T0BA 4NKMB 2YK1L 4OGZA 3UTSE 4P5TD 3AB0C 5D71H 2QSTA 5GQBA 1FN4A 2YZ1A 2IJ0C 4GRLD 2ERJB 4Q9QH 2IH3A 3B5TA 4I3SH 5D1ZD 4LAQL 2VIRA 4QHNA 4YR6B 3BESR 4YHMH 3QHZL 1FZKA 5TF1L 1NGZA 2QV2A 3BGAA 5D7KD 1DE4B 3K4ZA 4RRPA 1BZ9B 4NKOB 2H6PA 5IMMB 1SY6H 1T4KA 3KYMB 4OV6F 1DUZB 2MCPH 3UX9B 4EN3D 3QUZA 1FZOB 4YHIB 1NDGA 4ETYA 1DSFL 1IJ9A 5F88A 4NUJA 3MCLH 1J8KA 1KPUA 4TTGA 5E2TH 2X70A 3HE6D 3MBED 4P46D 5TH2B 5BRZB 5DHYB 2D4FA 2AXJA 5ICYA 3FFCE 5I76B 1XGPA 4AH2B 5DHVH 3QXAB 4U7KA 1YYLH 5JXED 3VMNA 4NKDA 2VDMH 3O9WC 3H6JA 1U41A 3QH3B 5F7UA 2HKFL 4R3SB 3RIAF 1EHLL 3JXAA 5E9DA 1NBZA 4OLYL 1TENA 5JO5B 3DVGA 1ZHLA 1MVUA 2H1PL 1OAXH 5C0AA 4YUEH 5IW3A 1Q1JH 3MRKA 5IW6B 1MAML 3NACL 3QIUA 5LCVL 1YC7A 5T5FH 1YEJL 4L3CB 5JMOC 2CLRA 2Y07H 3SGJA 2WMPA 1J1PL 5DVOA 3SY0A 4WJ5B 1YMHA 5JW4Q 2EXWD 3L3GB 4KJPC 5A2KH 5KAQG 1YNTA 3DV4B 3LMJL 3LV3B 5EOTB 4H25B 4FQCL 3N0PB 2DLHA 4Q74A 5E9DE 3C8KA 4HT1L 5FYJL 3P0GB 4RA3A 2BC4A 4HUWB 4PG9A 4HEME 1J0IA 2IADA 2IAMA 4XP6L 1OWRM 5F93C 3WV0A 4C59B 4DOHB 4YQXL 1QLFB 5I8OL 2WBWB 4WHCA 5TDPB 4AT6A 3JWNC 4XCCH 2YA0A 3SOBH 2GK0B 1KB5L 1U8OB 1VACB 1VPOL 4MVBD 3OAZH 3U36A 3QEHA 2Y5TA 3V6OC 3GM8A 5D7IB 2RJMA 3U48A 4D94A 2M1KA 5FA4A 3C08L 3DX9A 4LSVL 5BRZD 1UQSA 3MX0A 1RK1B 2FL5B 5FCSH 5ENWB 3QHFH 5AZ2H 1PDKA 5DT1H 2GJ6B 3T2PA 1T2JA 5E1AB 1UA6L 2CUMA 3V6OA 1YQVL 5FM8A 1LO0H 2EC9U 3RY4A 4FFZH 4F7CB 5JDJA 3MACH 1BGXH 5F6HI 4R97C 3GNMH 4NFDA 1KGCD 4OZHA 4XC3L 4ODWB 1CGSH 1CCZA 3E1F1 2FBJH 2CSPA 3O45B 4FTVA 3KYOB 2AAVA 3ARFD 4LSPL 1NH6A 1ACZA 2VZUA 5IGXH 4FFVD 1T7WA 2RFXB 3WL9A 4LHUG 4PRAA 3LHPL 4R0LB 1X5YA 4YDVB 1KT2A 2AV7B 1CDHA 5D93B 1B4RA 2WANA 3HLAB 2AK4A 2HWZH 3UBXB 4OZHE 1II4E 1C8PA 3HE7C 1ZA6B 3BZ4A 3FB8A 4X7EC 1JHLH 5CIPH 2EIZA 4ZO6A 3RGVA 5JIPA 1NCCH 4M48H 1MY5A 4M5ZL 1EUUA 1HOCB 1F6AB 1PG7H 3B4NA 3CLEH 4OJFH 4M93C 5KJRH 1D5BB 3CDFA 1YC8A 5EUOF 4QCIB 1ADQA 4NDMB 1T2XA 2D3VA 2AK4E 4FXKA 1J8HA 3CSYA 4HGKC 2W38A 3HE7A 1IM3B 2AJUL 2X44D 1MCBA 3KHOA 5DJXB 2VABA 4Y2DB 2OXHA 5DMJB 3LKSB 5F9JA 3SKOB 4Z7UA 1MJ7H 4BM7A 1NCBL 3T0VA 2EDTA 4KJWD 1NKOA 3BPCA 3B83A 4M43L 4S2SB 1FDLL 4XWOC 5IMLA 1AHWC 4M4RA 4W4OA 4S0SD 2GJ6D 1P7QB 3WFCL 2EEBA 1EEYA 1TZIB 2QQKH 2YN5A 4ORGA 4PGDA 3GBNH 5BOZG 2KZ1B 1R0AH 4WUUA 3U9UA 2LU3A 4YXKL 3U1SL 5IJVB 1YEKH 5FM5O 1GZQB 4NO3B 4YDJB 5IIEA 4Q0XL 2R2BB 5F9OL 5FGBC 2VLME 4IJ3C 2H2SC 1J88A 3FMGH 1F2XK 2W60A 3KYNB 1UZ8A 3P40A 3UPAA 5KSBF 1QSZA 1WFTA 1QO3B 4DK6A 5GS0H 4UBDC 2VR9A 4MA7L 5HHOB 2FEEL 5E7BA 2CRIA 1EERB 3EYFA 5L2KB 2YK1H 5EFIA 4M7ZC 4RAUB 1T66D 4MQ7B 4QF1B 3BRGC 3OX8B 4ISVB 5E1HB 4ODBD 5I1DA 4Y4FA 2YD3A 4LAQH 4DN4L 1RJZA 3BP7A 5DJYA 4KZEL 3PWVB 1IE5A 3QHZH 2JJUA 1TLKA 5TF1H 5FYKD 5B3JF 2UZXB 4IOFD 3VG9B 5GGVY 4MJIB 4JKMA 4OBRA 4NQXB 1D9KB 3TZVA 4KY1H 1RUAL 3PV6B 3GHEH 3V4VL 5GGRY 3NVQA 4ZUTA 5KG9A 1A1MB 1QKZL 3WFEL 3MV8B 4GO6B 4CBPA 1ZWIA 5FYLD 1CR9L 4Y2DD 1MH5A 1SEBB 4OKVA 4L8DB 3W0WA 3EOBA 5HYSA 2BK8A 2VB5A 4JAMA 4KTYA 4Y5YC 2IQAB 3T08A 4P3DA 4FMFA 3F5WB 5E24E 3ZKXC 1NFKA 4Y16A 3L3HA 1M7DA 1S7XB 5AG8A 1TQBC 5BW7A 4IRSC 1ZE3C 4F7TA 2GITB 5CP3H 1F02I 1NEUA 5DZOA 3V5KA 2HKFH 5FO8B 1IARB 2DMCA 4PLKC 1X5AA 1EHLH 2EYTA 3DXAA 5J3HC 4QTIL 3RNKB 3PG2A 3ET9F 2ZCHL 5IVNA 4Y5YA 2EDYA 3TA3B 1BLNA 2H1PH 3CZFA 3RWHA 5ID1A 2YPVL 1IQWL 3V6FB 1MAMH 3NACH 4PBWD 5LCVH 1YEJH 3RVVD 2J7LA 2ORBL 1J1PH 3MLRL 5E5UB 5GS1A 4HIEB 4NN5B 5HHOD 4UUJB 3P2TA 4TRPL 3LMJH 5L2JA 5IWLA 4C58B 3VRLE 4A6YB 4POYA 5L2KD 4U3XA 4HT1H 3STLB 4PG2C 5HTSA 4DUWA 5FYJH 1UXSB 4EKXA 1Z9LA 4BKLA 4K7PY 4HKXB 5EBMB 1BP3B 5A16A 3C5JA 1YPZF 3PHOB 3O2VH 4MXVF 6FABL 2F53B 4XP6H 3HPLB 4E5XB 1X6NA 1KNOA 4PRIA 1VGEH 2QTEA 2BNUB 3QISA 3R0MA 3OJDA 4YQXH 5I8OH 4MJID 4F37K 3OG4B 4HV8B 1D6EB 4M61A 2IALB 3H7BA 5GISL 4EUPB 1KB5H 3STBA 4FQPA 5E00A 4X5WA 4XT1C 1J12A 5IMOB 1FORL 3MV8D 3NZHL 3OKOB 2WUBH 2IGFL 4N0FA 3NN8A 1TIUA 4N0UA 5ESAB 2ED8A 3LS5L 4YDIL 2X6MA 1PGRB 3C08H 1TVHA 4YHNA 2LV4A 1WTGT 4LSVH 3SDXA 3AS1A 2BY1A 4U05A 2DF3A 4KI5F 5ETUB 4YAQA 3ELAT 3VXUE 4GXVL 3WFBL 1MCJA 1RZIA 2QKIB 1F2QA 5EZOH 4KDTC 3DETD 4OCSH 1UA6H 3B6SB 2XN9A 3LN9A 1YQ2A 4AG4L 4WW2F 4Y2OA 4P9HH 2GTWB 1JV5A 5MENA 1FFRA 2O5XL 5J11B 4WV1B 2MMXA 5ESQB 3TVMA 4XC3H 3TA3D 3TN0B 5C07B 3JV4A 3V6ZA 3BJ91 2DBLL 4LSPH 3BI9X 4PJ7F 1IGYB 1X4ZA 4X9BA 4YDKH 3AGVA 3MRNB 2UWEE 1RHHB 3DX8B 4NHCL 1JCKA 5HYFA 3LHPH 4GRWH 5DJ6B 5HPOA 5MENE 2NTSP 4UT9L 1S7QB 4K7FB 3ILQC 3H3PL 4E0RB 2PTVA 1ZOXA 2JIXA 3BH9B 4X8XA 4M5ZH 1ZEAL 1ZA3A 4MXWL 2F53D 2P42B 1JNJA 5F7DB 1PLGH 3HZYB 3BOVA 4WGVB 5EC2A 3I02B 1INQB 1U8KA 5CD5C 1CWVA 2E7MA 1ADQL 4AL8L 4OZ4B 4L3EB 1IGJB 1UC6A 5ALBH 4M02A 4NHUA 2AJUH 3BKJL 4JFFA 1L0QA 5D7LA 2X89A 1QBAA 4QRRA 3IAGC 4ZOEA 3OKKB 4JY6A 3LKQA 2Z31B 1D5XA 3BH8B 5CGYD 5LGKA 2RIKA 3FQRA 1NCBH 4HK3J 5JW4N 3X12A 2YPLD 4M43H 5DK2A 1FDLH 1I3VA 4MNQA 3EIFA 3I75A 2VLRD 2GYSA 3ARPA 1F4AA 5C08B 1VKXB 3EDEA 4HUUA 4W6XB 4KKAC 4JFFE 3L5IA 4ZTPL 5D7LE 3MLZH 1A02N 3FRUA 3V6BR 4JVPA 1X9QA 2FJFA 2JB6B 5HPMB 3BRFA 4NBZB 4YXKH 3U1SH 2M26A 5F9WC 3B9VA 3T2OA 3TN0D 5C07D 1SEQL 3P77B 1JPTL 5DQJA 1EZVX 2P48B 5I1HH 1J86A 4NYLB 1JHKL 1KG0B 2MHAB 4JFHE 4MA7H 1DBML 1ULVA 1WBZB 3H42L 3NMEA 1NCNA 3A0OA 43C9A 4ZUVB 2HFEB 1SVCP 5IVXB 2ZG1A 2DS4A 4XB8A 3TFKC 3W11C 5C0CA 4DN4H 2EEDA 2V5TA 3T2NL 3NPSB 4KZEH 1ZHKB 3L3JA 5IHZB 1HINL 1G9EA 3BUYB 1MIML 1KJ3L 4M5YH 3GMPB 1A22B 3C60A 1IEBB 1A6TB 4CW1A 3V4VH 4NN7C 1Q9LB 3D87B 3LRSA 2BHYA 3JTTB 1QKZH 1LDPL 3BPOB 1X5ZA 4JHWL 2XTJB 3VWKC 3WFHB 3WFEH 3CJJA 5J9PA 3EO9L 3MRFA 1CR9H 4X6FA 2Z31D 2J8UF 3U9PL 3GDBA 3VGGA 3KPLB 3CVIL 1NCWH 1Z5LA 5F3BA 1IKNC 1RZJC 2IMNA 4PJIF 3VWKA 4HUKB 3OJ2C 2BMKB 5C08D 1W8OA 1S9YA 2DM2A 1QFWI 5L88L 2ZCHH 4W68A 4LEXH 2NX5B 1Z3GL 5DUPL 5KW9L 4XNZB 5AZEL 2YPVH 1JF5A 3BPLC 1P4IL 3PQYB 1IKNA 3PWPA 4KKCC 4PV9A 5DTFA 1DVFD 2ORBH 1MCIA 2AP2A 2I07A 3MLRH 4Y7MA 1Z2KA 4FP8L 2HT3D 3C09C 3BYYA 5DHVB 5HDBE 2V7NB 2VDNL 1CICC 4TRPH 4CVUA 1PY9A 1IC5L 5F7HA 4J4PA 1GYAA 3BFOA 3MRBA 3OKMA 4G80A 5F7KC 3E6HB 5DD1L 4YHYB 5GGTA 2FYYB 3QNZA 4RGNC 1IRAY 4LCCB 6FABH 4GW5A 1A7BA 4R6UA 5FDYA 4PJEB 3VFUB 2G2RB 4RBPH 3VFTA 4C54A 2GUOB 2XFXA 4J2XA 3L7FB 1T83A 4JDTL 2X4RB 1J87A 1FV1B 3IRZA 1Q9OA 3IB4A 2PO6B 1I7UB 4ZUWB 5EU4A 3NZHH 2XTJD 2IGFH 4KKBD 4BSJA 3LCYA 1V7NL 3AS2A 1AQDB 3LS5H 2VLKB 4G43B 4XMPH 2A6KB 3X11A 4GSDH 4D0BB 4KK6C 4PJFE 3GRWA 4JM4L 2MKWA 4F7EA 43CAB 4EDWL 4GXVH 1G7PB 3MRRA 3TC9A 1Y6MR 2V5RA 5JUEH 2UZIH 1FYTD 2YRLA 4X6CA 1FL3B 1SJEB 2Y1VA 4AG4H 1I9IH 1W0VB 2ADJA 4I1NB 3QXTA 3H0TB 3SE3A 5DD5L 4OUUA 3VXQB 2O5XH 3HNTH 5D96B 2YA2A 1B0GB 1XF2A 5JPMB 5D2NB 2P5WA 3MMEA 2NY0D 5CCKL 5EG6C 4G6AD 4C55A 3PQYD 5MEPA 1ZT7A 5DK0B 4X6CE 1ZLUK 3V5DB 4O2CA 2C3VA 4HFWA 1LQSR 4NHCH 4HF5L 1OM3L 4F3FB 4UIMA 5E8DL 4UT9H 5FKPA 3H3PH 2OJEA 4LDOB 4WWID 3HMWL 2P5WE 3LY6A 3KPSE 4BZ1L 4EI6B 1ZEAH 3T3MF 4MXWH 4RX4D 5DJDB 1M71B 2XWBA 1X5KA 3KNBA 4AENB 3PUCA 2OLDA 3ZDYE 3ULVE 1FFPA 4Y4KC 3MRMA 3RL1B 4K8RC 1MFCL 1A21A 2P24A 2VDLL 5ID0B 1ADQH 3HZVA 3KPPB 4AL8H 4KK8C 1U95A 1FG9C 2PO6D 4MCYA 3VRJB 1M7IB 5DEGB 2V7HB 3BKJH 5CJ8A 3BW9B 5LGJB 3P4OA 5CFHA 5H2BA 1NAMA 3CDCA 1T7ZA 1HNFA 2VLKD 4ODVL 4HIJB 4P2RA 3WMSA 3I3DA 5CIPB 4CRPA 2E7CA 2XPGB 1WAAA 3CU1A 1MAKA 4R2GB 3C2AL 1EBAA 1RJYA 1XR9B 4Y5VC 3SDCC 1RZKH 5FOJA 1JPGA 4PJ9C 3DGCR 2MQ3A 1UKSA 2AJSL 1LE9B 4AIZB 4D9LL 3EFDL 4ZTPH 5FK9B 5ACMA 1FNGB 3J8F7 2GIYA 2D0FA 2K7QA 3BIKB 4TVPL 1IGIL 3MREA 3AREB 1GH7A 3JSSA 5IHLB 4APQA 3Q3GB 3A67H 2G5RA 2B1AL 5JDSB 1TNMA 1SEQH 1JPTH 1E27B 1FG2A 1KB9J 3F12B 1TPXC 5JHDE 1DBMH 3QXVA 1DBKL 3H42H 5GZOD 5T1LA 5DC9B 2WP3T 2A74A 5F1IA 5IF0B 1GVIA 4O02L 1GGYA 2J5LB 2Z35A 4Z77A 3D0LA 4I48A 3T2NH 2HN7B 5TFSL 3ULUE 1HINH 1O5DT 2FD6H 1MIMH 3DUHA 5D2LF 2V17L 1KJ3H 1AXTL 1EJ6A 4X0KA 5I75B 1TTFA 4PGCB 3RRQA 4HCRL 1OTSC 3QIBA 1T20A 3E3QC 4JHWH 1SM3L 1LDPH 2COQA 3PWUB 4DUXA 4FRWA 1XZ0B 3EO9H 2CKNA 3NFSL 1T6WA 4F7MA 3D6GA 4FQHA 1OAUH 4NPYB 4PJ5B 1KN4L 3U9PH 5JPNA 4XX1E 5GGVL 3VXMB 5JTWA 3WDHA 4C56A 3VFOB 1I8LA 1MI5A 5IV2A 1XGRA 2OJZL 4EI5A 4R2GD 3G6JF 4G3YL 4YHKL 4NC0B 4ODTL 4LF3B 1QLEH 4IIQA 3T0AA 2CLZB 1HQRA 3TESA 3QPXL 5CWSB 1KCVL 3LEVL 1NPUA 5DUPH 1Z3GH 3ARED 2BERA 2C3WA 5KW9H 1DQML 3GSQA 5AZEH 2EXYD 4UT6L 1P4IH 4P23A 2ZZUT 1PZUB 4GLRI 3ARGC 3GJEA 3ULSA 4Z78B 1RZJL 2HVKA 1X7QA 1HHJA 3D3VB 5JA9A 4FP8H 1LNUA 4G6JL 4O9HL 1G6RA 2VDNH 3DURA 4MWFA 4LLVB 5DJAA 1ZGLM 1IC5H 3PDOA 4PBXA 4BFBD 4TUKH 3VFPB 3ZE0E 4PJGF 2UUDH 4LKXB 4GG6F 3G5VB 1BM3L 3MLUL 4X6EA 1A2YA 2H3NB 3HUJF 2ZUWA 1OLLA 3ECBA 1VADB 5GGTL 4LPUA 4WHYG 5DMGC 4U1NA 4JPWL 2ZUQC 3WIFB 1HXYA 1B4JL 1ZVSA 1G7IB 4DEPB 1BFSA 4H88H 5C0BA 2XY2A 4JDTH 5KSAA 4RBPK 1DN0B 3F7RA 4F2MA 2IF7A 4NC1E 1EX0A 1ZVHA 1NUDA 5F8QC 4BFEA 4HQQL 5GS0D 2B2XL 1MJ8L 3ARDA 2VL5A 3SN6N 2Q3ZA 4B41A 1S7VB 5F7MC 3KPNB 1MRFL 2FO1A 1CLYL 5C0IA 1V7NH 3R1GL 5TE4L 4LRIC 1FRGL 1IT9L 3BGFC 3MGOA 3VXMD 3DROA 3KLAB 5AYUL 4L3AA 4JM4H 4U1HA 4X8JB 3K80A 3GRWL 2DICA 3V5HB 4XRCB 5CSGA 1KCUL 4JZJB 5SWQA 1S7RB 2AXGB 1FIGL 1ODAA 4S0TD 5KVMC 1DN2A 1UZ6E 3BYTA 5DD5H 1QA9A 3UBXG 4LRIA 3MJ7A 3DVNB 1FPTL 2EDJA 2W9DL 2BDNL 3MC0A 4UNUA 5J89A 5EUOA 5SWZB 5CCKH 4PGEA 3RTQB 1T1YA 4OFVA 2EDOA 5A3ID 3LKNB 4LSDA 1FQ9C 2VKWA 4OV5A 3D3VD 3PJSB 2NYYD 1OM3H 4MD5B 2NMSA 5TE7L 4PJ8A 4TQEL 5E8DH 1XFPA 4ZFZB 1BQSA 2AABL 2DB8A 4NO0D 1G0YR 1TQCB 3HMWH 5EUOE 2G9HA 3C6SA 3SGEI 4RFOL 4RDQG 1OARL 1E4XI 5CBEB 3PGCB 4GRWE 3ZLQC 1RVFL 4R26L 4XP5L 3RI5K 1MFCH 4KK9C 2VDLH 1JF6A 5SV3A 2Y7QB 4WO4B 4UTAL 5IOPB 2AEQH 3QCTL 3UYPA 4X6BB 4HGWA 4XVSH 3FONB 2KQNA 4Y5XA 5BVJB 5BS0D 4ODHL 4LCYA 3ROLB 1KXTB 3DYMA 5GSVA 4G6KL 5H94B 3MRJB 4ODVH 1NAML 2NY3C 4I2XA 5FYJD 4J1UA 3LKPB 3U0WH 3U2SB 4JFEB 4O2EB 3G6DH 5KSBA 3RZCA 2D9CA 2JB5L 3CFKA 1S9VA 1QG3A 5I17B 1A6ZA 1MFDL 5IG7B 1JPFB 4K8RL 1LEKA 3WS3B 1F00I 4YEEA 2FZ3B 1CQKA 2AJSH 2C3HA 1JMZA 4PJDF 4D9LH 3EFDH 4MDJA 4ZXBC 5IUSA 2DQTL 4TVPH 1BAFH 4JPIA 1IGIH 4Y8AA 5E99L 4UU9B 3H9SA 4JRYE 4L8CA 1NEZA 2OBGA 5J4MA 4XGZB 2VQ1B 3WLBA 1XF5B 2DQIH 2B1AH 2NY1C 4GT7A 4PLOB 3C6LA 4HWZB 3IDGB 5FA3A 5SWZD 1V3KA 3RTQD 3TJHD 2APWA 4XNMB 3F65A 3OHXB 5T5NF 2Q87A 2X4PA 3MOQA 3KPMB 1RK0A 2BOCA 1QTYT 1K3ZA 2EYSA 3N50A 3IETA 3CX2A 5IEKB 3VJ6A 5I8CA 3WHXA 4M1DL 5GGSA 5B3JE 4O02H 5BZDA 5JOPE 15C8L 1XT5A 4EVNA 1MHCB 3QHTC 3J7HA 4Q6IB 1H5BB 5E6IB 5TFSH 3PXHA 5HHPB 1JWUA 5F89A 3IJHB 2DQCH 1WZ1H 3CVHA 4K3GA 2V17H 1AXTH 2BJMH 4RISL 1ORSA 4JQXA 3OB0K 4HCRH 4KTEH 2VERN 1YECL 2MNUA 1RJCA 2E3VA 1CFQB 3T04D 2FJGB 2IANE 1CVRA 1EJOL 3QYCA 5DQ9A 3NFSH 3W5NA 5FUOH 4URTB 5EULV 4YNYA 5GGVH 4E42A 4I77H 1FN4B 4JFED 1HZHH 1U8IA 4XTRC 1QLRA 2OJZH 3V9FA 4NCDA 4B0MM 4G3YH 4XH2B 2VIRB 2FBOJ 4YHKH 4H20L 4ODTH 4QHNB 4QY8A 3RVTC 1FZKB 1NGZB 2A9NH 2VZ3A 1YDPA 3IKCA 4KC3B 5BO1L 2Q76B 1YPZA 2FEDD 3QPXH 3NGBC 2H6PB 4MHHG 4X83A 5J6HB 1KCVH 1T4KB 3WKNA 1G7HA 2AV1A 2NR6C 3QUYC 1XH3A 3QBTB 3FQWA 4HJ0C 5FV1L 3QUZB 1A14L 4RMWA 3EGSA 1NDGB 4UT6H 5IB4A 5BV7B 1AGEB 1U2CA 2X05A 4FA8A 5F88B 4XC1L 5HI4C 1KPUB 3CD4A 4OZFH 1T22A 2X70B 1RZJH 3MJ6A 3ZMRA 2BY2A 2DQJL 4G6JH 5ICYB 1XGPB 2R8SL 1AIFA 4HFUL 4MXVE 2FH8A 4IBLT 1F13A 4NKDB 5HYQB 4L29A 3TPUA 2NZ9C 5C0JA 3L95B 1NAKH 1P5UA 2UUDK 5GGTH 3DJ9A 5E6ID 5E9DB 1NBZB 4JPWH 3DVGB 1ZHLB 1B4JH 1MVUB 4WW2A 5C0AB 2CDFA 1PW3A 1XGTA 3QIUB 4WWKA 2CLRB 5DGQA 2DKSA 4WNQA 4K7PH 1H3PH 2B2XH 1MJ8H 3L5WA 2WIIA 3SY0B 4KI5E 1YMHB 4MS8D 1CLYH 1YNTB 1YY9C 3K1DA 3R1GH 5HJ3B 5TE4H 3C8KB 3OPZL 3QQNA 1IT9H 4GMSL 3SE4A 2DLTA 5AYUH 1LMKA 2BC4B 2UY7A 1OTUD 4JE4B 4YXHL 2VLJA 3GRWH 4PG9B 3HNSL 3QR2A 4H8WC 2YPKB 1N6QL 2IADB 1T04A 1EIBA 1MCHA 1FIGH 1A7RH 4AT6B 4U6XA 5D5MF 4AZ8A 1K9TA 1MCFA 5FGSA 5KAQF 3GUTA 2XYCA 4D9RE 3U36B 4HS6A 4PJ7E 1LDSA 1FPTH 3QEHB 1N59A 2BDNH 2W9DH 2Y5TB 3ZTJH 1CD9B 3QUZD 3TEUA 4JB9L 4WVRA 2XRAL 3K2UL 4NQCA 3UBXI 3MNVB 4XCEB 3NCYS 4KI1A 3DHJA 5FA4B 3WNKA 3DX9B 1AO7E 1UQSB 4TTDC 3S3JA 2W65A 2CO6B 5TE7H 3CSBA 3KS0J 4ODUA 1FH5L 5HVHC 1QNZL 4QRPA 5DGRA 2AABH 2AJVL 1ZLVH 4O5LH 1GOGA 2E7BA 3T3PE 3Q6GH 4Y19A 4L9LC 5E94A 5DJ2B 5ELIA 5F1KC 3ZYZA 1OARH 3FL7A 3BP4A 1JHTA 3MLTA 1DL7H 1EV2E 3ARTA 1RVFH 4R26H 4XP5H 5C0AD 1WWAX 2BVUA 2R4SL 2NCMA 4FTVB 3G08B 3DRTA 3KPRE 3QIUD 4QRPE 5F7WC 4UTAH 3QCTH 1BJ1J 3NABH 1RMFL 3TWCL 1ACYL 4MD0A 4Y19E 4L9LA 4PRAB 3WL9B 4ODHH 1KT2B 4G6KH 4HIXL 1I1AA 1NAMH 2E6PA 4BJLA 4WFGE 3RU8L 2XG5A 3BZ4B 3FB8B 2JB5H 2EIZB 3RGVB 4PFEA 1MFDH 3IU3A 3CGTA 4K8RH 2I9TA 1LO5A 1KCKA 4QHMA 5CJXC 3O6FC 4TVSa 4GAGL 5B38G 1BFVL 5B8CC 2XIDA 1TCRA 1RQ5A 4GS7C 4GRMA 3N1GC 2DQTH 3U0TB 3BZFA 1CDCA 3EAKA 3U7WL 5DD3L 5E99H 4FXKB 1J8HB 3CSYB 1J0ZA 3HE7B 3IDJB 1MWAL 4J3VA 5AD0A 4N90D 2VABB 4Z7UB 3O6FA 4H5SA 1JYVA 1FNEA 4G9DA 2Z92A 4LCUB 3BPCB 3B8SA 3O41A 1WGOA 5IMLB 5KTEL 1I1YB 1JJUA 3WJJC 4M1DH 1EEYB 2LFGA 4S1SL 15C8H 2JELL 2FHFA 5D1XA 4ORGB 1BBJA 4PGDB 3CU7A 2WUCL 5DSCA 4WUUB 3U9UB 3WYRA 3FN3A 2VXVL 4PJIA 5DC4B 3VXTA 1KIUA 1A7OL 1QP1A 1K8DA 3QAZB 4P57A 4FTVD 4RISH 2J8UE 3DYPA 4GW1A 4RZCA 4QT5A 2W60B 1UZ8B 1EJOH 2GY7B 3OBAA 4U31A 3SQOL 1DQLH 4Z7QF 1F4YL 1NLBL 5EFIB 4AY0A 3KPRD 4PJIE 3MGTA 4P5KA 3RDTC 3TBSA 3EHBD 4Y4FB 4YFEA 1RJZB 3BP7B 5DJYB 4H20H 4IJ3B 3DMMC 2CKBA 2DLEA 3LRGA 5F97E 1U8JA 5EU6A 3ZHKA 5KVFL 4X7DC 3U83A 5FAAA 3GO1L 4UV4L 3TZVB 3FO0L 5BO1H 2V9RA 4EDXA 4UILH 5A2LH 4M7ZB 5HY9A 4ZUTB 1PKOA 5KG9B 1L0XA 5CS7A 1J8HD 1OB1A 3HE7D 2I5YL 1ZWIB 4B7IA 1N5YH 4A2LA 4MHHI 1MH5B 2RGSA 4FG6D 4OKVB 4PJHE 4XC1H 3EOBB 3SE9L 3W0WB 5HYSB 5I73C 5EU6E 4JAMB 1CI5A 4P3DB 5C09B 1UYWL 4G8EA 4Y16B 4OCWL 3ZSSA 1U8MA 1M7DB 4HFUH 3NIGE 4B53A 5D7JA 4K07A 2RB8A 4N0CC 4L8BA 4QYOA 1RU9H 3V5KB 1OAQL 4POZC 1WWWX 1VESA 2EYTB 3DXAB 4L4TA 3RIFK 2I24N 4WUUD 3OKLB 4U6VL 3TIDA 2K9UA 1MCSA 5I6XC 4Y5YB 1BLNB 4WU5A 5BZWA 3CZFB 3RWHB 1HQ4A 1FHGA 3ZKXB 2P46B 5ID1B 3MFFB 5F6IC 1SVZA 4XWOD 1K6QL 4IRSB 5DUML 4OI9A 2YKLL 4GUPA 1PX4A 1MCPL 5GS1B 3SDDC 2QQNH 2OTUA 5L2JB 3MXWL 3OPZH 4QHKJ 3LKOA 1GC1H 2JF1A 3MV9E 4FN0A 4M62L 4BKLB 4YXHH 3CCHA 4Y4FD 3HNSH 3C5JB 3CZJA 5A16B 5DRZA 1N6QH 4U2YA 4MA1C 4WTZG 3MNZA 3GJFH 4PRIB 2HJFA 4K3HA 3OJDB 4J3WA 4S11A 1XIWA 1UEYA 4UBDD 3TZVD 2XKNA 3H7BB 2EE9A 2E7HA 4P5TC 1HYSC 2A0LC 1AQKL 2J8OA 4X5WB 5E00B 4YE4L 3UAJD 3FT2A 2EDWA 2QQLL 4N0FB 3NN8B 5D1ZC 4JB9H 4N0UB 4ONHA 1ETZA 2RCSL 2XRAH 3QWOA 1OT1A 3TH4T 4FQXC 2BSTA 3W0WD 4H8WL 3VMOA 1RIUL 1TVHB 2CD0A 4R7NA 3SDXB 3BGMA 5C09D 3ZSTA 4I5BA 4I3RH 3H3BC 2HJKB 4YAQB 4PS4L 3SE8L 5FUCC 1FH5H 1QNZH 1RZIB 3ARRA 2AJVH 2XN9B 4EN3C 1XGQA 4L8SC 1OLZA 5FB8A 2BY3A 1LP9E 5CKGA 3UMTA 1JV5B 2V5SA 2Y06L 3MBEC 4OM1H 4RFEA 5L6YL 3JV4B 1WZKA 3V6ZB 1MCNA 1N26A 4HKJB 2ZNWA 4IRSD 4RIRA 5J1TC 2X9XA 1JNHA 1RMFH 4ZS7L 3TWCH 1ACYH 4FQQA 3NFPA 5J6GA 1BMGA 2CK2A 4GH7B 1CT8A 3E0GA 5J3HD 4HZLA 4HIXH 3QJFA 3QPQC 4YGVA 1D3CA 4PJBF 3UC0H 5SX4H 3ARSA 3RU8H 2JIXB 3V7AE 3O6LL 2FDBP 1E6JL 5ESVA 4MA3A 1B0RB 1ZA3B 1NANH 4GAGH 1BFVH 1KIQA 3QO0A 4PRID 3MUGA 1YEGL 2F5BL 2R39A 5E03A 3T0EC 5EC2B 5K59F 4JM2F 1IM9A 4WENB 3U7WH 1Q94A 3TNNA 4PLJC 3UDWA 1MWAH 1DQDL 2ERJC 4JFFB 3FFDA 5D2LA 3WKML 4QRRB 3UTZA 1T5WB 4JY6B 3LKQB 2Z8WC 4KMQA 3VA6A 1D5XB 3FQRB 2FNBA 3CFDA 3GSUA 5DD0L 1BOGB 4OGXL 1R5VA 1S5IL 5DK2B 2ZG3A 4MNQB 3I75B 4E9LA 4MVBC 4LU5H 1T21A 1MHPH 2XN9D 4S1SH 2JELH 4NP4L 3FRUB 3G6JA 2ICWA 3S9DB 2FJFB 3QQ3A 2RR3A 2A83A 2WUCH 4JFPA 1E28A 2VXVH 2ZUTA 1L4IA 1UT9A 3CFJB 1A7OH 5LXGL 5DQJB 4NRXA 5JW5A 4Y1AE 4OZIF 4XX1G 3H8NA 1A5FL 3KWWA 1FGNL 3VXSB 5C1MB 1JWMA 1YEFL 1QSEE 4UTBH 3Q1SL 4JN1L 2O5ZL 3WE6A 43C9B 1NLBH 4OLVL 3R4DA 4GKNB 5IKCA 1IL1A 3VDAA 1QSFA 4YK4B 1ZMYA 4LRNL 5C0CB 1A4JA 1GAFH 2R0WH 3STZA 3X13A 3L3JB 3MV7E 4PJGA 5F72S 5HI5C 5D7SL 5KVFH 4GG6A 1U2HA 1HH6A 4TSAL 4CU8A 4Z7VF 1VFUA 3MA9H 2EDHA 2YXFA 4UV4H 4KRLB 5FV2A 3HUJA 3C60B 3TBTA 4CW1B 2ATPA 2E7LA 4AEHL 5CILL 1QSFE 3UTTE 4GQPH 2NY2B 3BT2L 3MRFB 2X89D 4QRRD 2IBBA 3BEWA 1P6AB 4X6FB 3M17A 1X5XA 4Q9CA 4PTTB 3WN5A 3P73B 3SE9H 4F8TA 2VL4A 5CUSL 4GG6E 1UYWH 3BEVA 4JY5L 3JBG7 1R24A 3HUJE 4B5EA 1HHGA 5F3BB 1UWEL 2CH8A 1G84A 4KQ4L 4MLSA 3EOTH 3VWKB 1MFBL 1ES0B 1OAQH 1S9YB 3I6KA 2R23A 4TVPD 1Q8MA 4HD9A 4BQ6A 5JR1L 3LS4L 2IPKB 3W82A 4Z18A 1HEZA 4CADA 1K8IA 4P49A 1G7JA 1ZS8B 3VA2C 2H32H 3UYRL 3PWPB 4PV9B 1K6QH 2OQJB 1AH1A 5DUMH 2DD8L 2YKLH 3IJYA 1A6WH 1MCPH 2IWGA 3VXSD 2I07B 4U1KA 3AM8A 2IG2L 3CAFA 3BD4A 3LDBB 2AJXL 4OF0A 2FX7H 3QB7C 3L3IA 2K7PA 3HC0A 3MXWH 1I9JL 1I7RA 3D85B 4M62H 2WK2A 3RKPA 3MRBB 2LU4A 3OKMB 2ZJSL 4G80B 1QSED 5C0CD 1F4XL 1IC7L 2EDNA 3MJ8A 4GW5B 1YMMD 4YBHA 3WJLC 3DVIA 5C92A 3L5HA 4K23L 4I18A 3VFTB 1WSST 3QI9A 4MXQD 1FVEA 3QXDA 2L4OA 4YFLI 3C09B 3GJFK 3GKWH 2V2WA 4RGNE 3BZDA 4EOWL 5HBBA 2JCCF 4CDGC 1V3MA 1Q9OB 1AQKH 5C86A 4HH8A 4NQDA 4YE4H 1SHMA 1R3IL 4JANA 2GI7A 2QQLH 3TFKD 2RCSH 3P4NA 3V2AR 1FFNA 4YX2L 3IT8D 4ACPA 1UEMA 4H8WH 1RIUH 1X3DA 4XBPA 4F7EB 2DQHL 5E6ZA 4YJZL 2QHRH 5EIVA 3SE8H 4FXLA 4PS4H 3TO2A 3MRRB 3TO4A 4OIBA 3QFJD 4G6FB 5D6DA 4W81A 4X6CB 4OFYA 4MD4A 4PRPD 3VWKD 4IMKC 4U1GC 2R56L 2ADJB 4LLDA 4Y2DC 2SEBA 5E8EA 4OUUB 4XPGH 5D70L 3VH8G 3IVKA 3BP6A 1XF2B 5INDA 5C3LD 4PJDA 1PG7X 8FABA 4ZO8A 5L6YH 3MMEB 4IOSD 2CQVA 1RIVH 3PWPD 5MEPB 5C6PB 2BX5A 2VDQH 2C3VB 4IMKA 4HFWB 4ZS7H 2V5YA 1A6VL 2MJWA 5B4MC 2HT4D 3K8LA 4H1LA 3PDDA 4UIMB 5FKPB 1X6LA 3FKUS 1LGVA 2A73A 2OJEB 2YEZA 3D85D 4MZ2A 3AU1B 3RKDD 1E6JH 1IILE 1UH2A 3VW3L 1P9MA 2PW2B 4HW6A 2F5BH 3QDGE 5EOCJ 1IAIL 1A6AA 3TGXA 1W8NA 1KB9K 4V1DA 3P4LA 3HHRB 2P24B 5DA0B 1I8IA 4NZDA 3HZVB 2C7UA 1GL4B 3N1FC 3MXVL 4AEIL 4MCYB 1CVSC 3MO1A 1DQDH 3WKMH 1G0XA 2UY6A 3P4OB 4U1JB 2A6IA 5H2BB 1NAMB 2ADGA 1NC4A 2AS5M 4UIKL 4P2RB 3IFLL 5I2IA 1J9CT 5DD0H 3VG9C 4OGXH 1KTLA 1S5IH 1D9KC 4HUVA 2ATKB 5ICZB 5DJZA 1BX2B 3GMNA 2O93L 4NO2A 1JPGB 3LSOA 4ENED 1A3QA 2OMBA 4NP4H 3BWUC 1LO2L 1MFEL 1OSPH 1NMAL 4P5MA 5LKNA 3PHQA 2YOCA 1CFSA 3MREB 2HA1A 2W0KA 2O61B 4KK6D 4APQB 3CPLA 3ARUA 3UJTL 1KTDA 4OFKA 4Y5VB 1CXIA 1W0WA 3SDCB 4BYHA 3FO9A 2NPLX 1A5FH 1EAJA 2FATL 1KEGL 1FG2B 3UTPE 3P0VH 2R2CA 1MCEA 2W1NA 2KL6A 1UKTA 4JFYA 1BD2B 1YEFH 4RRPG 5IP4A 3IDYB 1WBXA 3CC5A 3TT1L 4JN1H 2O5ZH 2PYFB 5I1JL 5T1LB 3MROA 3QXWA 3RQ3A 4OLVH 5CEZE 5F1IB 3SHSA 3SBWC 3TA3C 1QFPA 2Z35B 4Z77B 3D0LB 4I48B 2WAHA 3C8HA 4LRNH 4LLAA 1INEL 2DDQL 3B2UC 4JRXA 2FSEB 3VWJA 4G8GA 4QHUA 1DLHA 3SKNA 4NZTL 3ZL4H 4WI2A 1EHNA 4PIRF 4TSAH 4R8WL 1G9NC 4S1RL 4X0KB 4ALAL 2YD9A 1T20B 3I6LD 4HLZH 5AAMA 4AEHH 1OGAE 5CILH 2JJTC 4M9PA 1YNLL 2I60L 3S88H 3BT2H 4F7MB 1IC4H 4JRXE 4QGTA 4YWGL 4B7LA 4FQHB 3TBVA 3GSNA 4LSQL 4MAYA 4FS0A 5CUSH 1U9KA 2FGWL 4P3CL 4LGSB 4C56B 1MI5B 5IV2B 3UO1H 3F58L 3FT4A 4Y4KD 1CS6A 4NM4L 4K8RD 4JY5H 3B2VL 5ECJE 4P2QA 1UWEH 3SDYL 1BQHA 4KQ4H 4KK8D 4GFTB 1U6AL 2VDOH 5FF6A 4IIQB 4H0GA 2APBA 1HQRB 5ANMA 3AC0A 3F7YB 5JR1H 3QEGH 1P5VA 3QSKB 4F9PC 3GSQB 3OV6A 4X4XA 5D5MA 5KVGL 2OX5A 1LEIA 4WFHE 4P23B 3UYRH 2A77L 4KGJA 3SDCD 3LN5A 2P5EA 1LE5A 2DD8H 3H9HA 4PJ9D 4XXCC 3MYJA 3ULSB 5A2FA 1PQZA 1X7QB 1HHJB 5BMFL 1BD2D 1LNUB 4PRDB 1WIOA 1RZGA 1U8NA 3DURB 4MWFB 5ANME 1XEDA 5T1LD 3PDOB 4O4YH 3FN9A 4JDVA 1I9JH 4WV1C 2F5AH 3TN0C 5FCUH 3CUPA 3NAAH 5A2IH 1F4XH 1IC7H 2XQBL 3ECBB 3OL2A 5HSFA 5DJ0B 1Q9KA 4U1NB 1DEDA 1BECA 4K23H 3QUMA 1AE6L 1ZVSB 4HJJL 4HK0A 3U7YL 3QDJA 5C0BB 1ORQA 3EKCA 3IDMA 3QEQE 5KSAB 4F2MB 3KS0H 5C0RL 3H3KA 4G7VH 3RPIA 3VGHA 2BVQA 5KS9E 3B3IA 2W9EL 1V8HA 2VL5B 3ARDB 5EZIL 5D7IF 1AI1H 4XNYH 2W59A 4YX2H 5C0IB 5IESL 3MGOB 3DROB 3WIHL 1S5HA 4C56D 1MI5D 4U1HB 5IJKC 5SWQB 1BJ1H 3WLWD 5AWNL 4P2OA 3KGRA 4D0CA 2EC9T 1F5WA 1RI8A 2Z31C 3AUVA 4GKOA 5D70H 3MJ7B 1T3FA 3QJHA 1HSAA 1J05A 4OZGE 4J8RA 1FFOA 4PGEB 1T1YB 2OYPA 5IB5A 1T1XA 5DRNB 1VHPA 4OV5B 4D9QD 1A6VH 1IGCL 4PJ8B 2P47B 2PETA 2C9AA 1URLA 5DVLA 3VFSA 2ITCA 1NFDE 3RUGB 2I9LA 4OLUL 4Q7DA 5T3ZL 4LMQI 2G9HB 2FLRT 3C6SB 3VW3H 4TNVF 4ZOAA 1KPVB 3ARGD 5JW4R 4TNWF 2YR3A 4EIZC 1IAIH 2HT3C 5C0BD 3FT3A 4PY8J 5KSAD 1CN4A 5LQBH 3RGHA 2HTKD 3HA0A 1A6PA 3MXVH 4AEIH 4HGWB 5I1LA 4Y5XB 3N85L 5DRXA 1QBBA 4LCYB 4DK3A 5FO7A 3DUSA 3NPSC 5GSVB 1OTTD 3GSWA 5DMGD 4RDQF 4I2XB 1AKJA 3FRPG 4UIKH 3IFLH 3DYOA 3GFUA 5KSBB 3RZCB 1MPAL 5DLML 3LPFA 3CFKB 1S9VB 3FZUC 1LK3L 2WWMC 4PGZA 1LEKB 1CFNA 1RZ8A 4PYHA 2Z93A 1L0YA 5ISZA 5EC1A 3GBLA 3BJLA 2ICCA 5TGBA 3I84A 4NQSB 1LO2H 1MFEH 5DDHA 3RWGA 3VMPA 2NY3B 3B9KC 1MWAB 4L8CB 2FEEI 1DTUA 3H9SB 1OOAA 1ZGLP 3RY5A 3PWJA 1MFAH 1NEZB 3HI5L 3WLBB 3UJTH 3BE1H 4F9LA 2DTSA 5JW4M 3C6LB 1LILA 4HXBL 5FA3B 5TQ0H 3QIWA 1IGML 2FATH 1KEGH 4CL7A 1H8NA 4F58L 2X4PB 3U82B 1RK0B 1T89A 2Z8RA 2DM7A 2EYSB 5E2UL 3TT1H 2FX9H 3NCFB 1GOHA 5I1JH 3GIZL 1F42A 2GSIA 3VJ6B 4NQEE 5I8CB 3WHXB 2VUOA 1ZHBA 3UPRA 2XY1A 1VEMA 5BZDB 4XNZC 1AD0B 2WQRA 1INEH 3VXPA 5HYSG 1SBSL 4EVNB 1ZVYA 2W92A 1R3KA 4NZTH 5F89B 4PRBA 5J7CC 3CVHB 4R8WH 4S1RH 3D25A 2DM4A 4PRHB 4GKSA 3EDJA 4ALAH 1ORSB 4PTUA 3ZE2E 3C5ZA 1ZT1A 5DQ9B 3V79C 1YNLH 1R3JA 1OP3H 2P8MA 5KSUA 4YHYC 4YWGH 3QUXA 1F3DJ 2JJSC 4LCCC 4LSQH 3UZQA 1J1OL 3MTRA 5FXCH 4YNYB 1TJHL 4M8QA 3RWDA 3ZYOA 1PJ9A 2FGWH 3MNWA 4P3CH 1U8IB 4LLYA 2FR4A 3RZCD 3F58H 1QLRB 4NM4H 5D9SA 4GBXA 4UZGA 3D2UD 2VJXA 2X1WL 3B2VH 4ZSOA 4ZFOA 2Q7NA 3SDYH 2PUQT 4G9FA 4M6NL 4QY8B 3BRDA 5EU7C 1U6AH 4A6YL 2PO6C 4OD2A 3Q5YA 4OCYL 1LO4H 3QDMA 1YDPB 1S7SA 2B20A 3IKCB 3R0NA 5T33H 1WC7B 1YPZB 5J56B 4WCYH 3O8XA 2VDPL 4L1DA 5E2JA 1G7HB 2AV1B 2PXYC 2NY3D 2C3XA 3H9SD 1JGUL 3HC4L 4I4WA 4NWTH 3EGSB 5KVGH 5IB4B 3C6LD 2ZUVA 1F3RB 4ZSOE 3U0PB 4QO1A 4UV7L 3O6ML 2A77H 1T22B 3HG1E 4QLRA 3RWCA 2YD4A 3BQUC 4TUOA 5BMFH 3D39A 3KXFE 4JPKH 5LGHL 1OW0C 3DUUA 4ZXBD 1AIFB 3LOWA 6CGTA 3ZT7A 5I15L 4XBEH 4L29B 3KPOA 1ITCA 1K2DA 1OQOA 5D2NC 2YUVA 1XGUA 2XWTA 1UWXH 2XQBH 1CFTA 3VRLF 2YRPA 3S8WA 4NQED 1ND0B 5FYKU 5JIIA 1AE6H 2OZ4L 4HJJH 4WW2B 3U7YH 3D39E 2CDFB 2DWEA 1XGTB 5GZOC 4PRHD 2APXA 1AXSA 5C0RH 4WNQB 1K3IA 2W9EH 2WIIB 5EZIH 2DTMH 1M05B 4JRWA 3ZO0A 5EH1A 5CEYA 3RWJA 1QBLL 1BF8A 5IESH 4WW1A 1NBVL 3QCUL 3WIHH 3O4LA 2IEPA 1EFXA 4C57C 2VLJB 2UZYB 3G6AA 5KOVC 2WQ8A 4PJBA 3RY6A 5AWNH 2BP3A 1GGIH 3BKCH 3PIQA 4U6XB 3Q48A 5IB1A 4F7PA 5E08L 2XKUA 5JW3L 3GUTB 3CXHJ 4KROC 2OTWA 4F80A 3AS0A 3OAUL 4HS6B 3O4LE 5IFHL 5DQDH 4HJGA 4ERSL 4JM2A 4R2GC 2VC2L 3DLQR 1FFQA 4NQCB 4L4VA 1I3UA 4NOBA 5DMIL 4YXLH 3RVTD 1U93A 3V7AG 1XCTA 4NCC2 5EOCL 2W65B 4JGUA 1IGCH 2BNRA 4QRPB 3QUYD 1EFQA 4YIQB 4HJ0D 3HG1D 2EXYC 2UWEF 4M9OA 4OI7A 2DYPA 5E94B 5T3ZH 5GXBB 2IH1B 1I85A 1JK8A 3VI3F 1E4WL 2HLAB 1NJ9A 3BP4B 5DS8A 1JHTB 3MLTB 1ZSDA 3EBAA 4UB0L 2PYEA 4XMKL 5IBLD 1I8KA 1MEXL 2ZKHL 2BNRE 3DRTB 1EPFA 1NC2D 3T4YA 4M6OL 2AW2A 2D7MA 3I9GL 5F9DC 2NZ9D 2J5LC 4TN9A 3K0WA 4JPVL 1WZLA 2XICA 5I1EL 4MD0B 3G04A 1A1OA 1PZ5A 3N85H 4L9LB 1IQDA 4IRJA 3M45A 1I1AB 4TPRH 1R3HB 3IDUA 1MPAH 5DLMH 1BVZA 2PYEE 3U4EA 2VLJD 2I9TB 1LO5B 4QHMB 1M6OA 5I75C 5TJWK 3DVFA 1KIPB 1F3JA 4HKBA 1TCRB 5GS0C 2KPNA 4GRMB 2R1YA 3D9AH 1JP5A 4OZIE 1YY9D 3BZFB 3IFPA 4CJ0A 3HI5H 4OGAD 5DRWA 4Z7VA 4JJ5B 5AD0B 4NJ9L 4HXBH 4NQCD 1IGMH 5IEHA 4I0PA 3O6FB 4H5SB 1H0DA 3T1FA 4ESKA 5ADPL 4F58H 3BO8A 4G9DB 4G6MH 4PB9L 2G75A 5E2UH 3O41B 3GIZH 4Z5RA 1JGEA 4WFED 5E4IA 1I3RA 4BK5A 5IR1B 1IAOA 2GJZA 2ILLA 4UQ3B 4UQ2A 4Z7VE 5D1XB 5EIIA 2AJZA 5IROC 1BBJB 1MREL 1SBSH 3MLVH 4LLQA 4ZNCD 1O7VA 3OKDA 3VXTB 1WWBX 5GRYA 3PGFH 4X4YA 1HCVA 5LBSL 4J7RA 3NCCB 3ESUF 3MLWL 1K8DB 4M03A 4P57B 2ICEA 3AVEA 1A1NA 4GW1B 4K3JL 4RZCB 1RD6A 4QT5B 3ABZA 4DFHA 2MCPL 3M8OH 2WINA 4E41E 4XP4L 1OP3K 5IB3A 1J1OH 3VXRB 2B1HH 1TJHH 1I1AD 3GSNH 3MGTB 4HH9A 3TM6A 2AXHA 3TBSB 1IEAB 5MEQB 1P1ZA 3WO4C 4OZFG 4BSWA 4DEPC 5FM4A 4PJCE 2XI9A 4ODXA 4RWYL 4M6NH 2LAGB 1KENL 2CKBB 1C5DA 1U8JB 5EU6B 2F54E 4OCYH 4NRYA 2E9IA 3FB6A 5DEFB 4JO4L 4WFFD 4EDXB 4YHPB 4HEPG 3MOBL 3TYGL 2VDPH 4G8FA 5HY9B 2VN7A 5AAWA 3ARYA 5EO9B 1OB1B 4FXGA 1JGUH 2J6EL 3KLDA 2X4NA 3HC4H 1D6VL 4UV7H 3O6MH 5E8NA 1QPXA 1IMHC 5T5FL 2JCCA 3GSRA 4LNRA 4EUPH 3O6FD 4JZJC 3SJVE 2QSCL 5LGHH 4Z7NF 1VFBA 4Z0XA 1G6VK 4G8EB 3L3OB 5KVEL 1U8MB 3IFOA 4QOKA 5I15H 4L8BB 1QOKA 4QYOB 4ZUUA 4ONOA 5D1XD 3ZTNL 5HDBF 5HVWA 3OG6B 4L4TB 3TJHC 4OD3L 3TIDB 5F7LB 4WU5B 2FH6A 2OZ4H 5FGCE 4N8VA 5BZWB 1KYOJ 1HQ4B 3HPJA 4JHAH 1EXUA 1X4YA 4MB4A 5F9AC 4QOKE 1MHEA 3FOLB 4GUPB 4P9HC 3VXOA 4YEFA 4KK5C 4LHJB 3S35H 4NGHL 4ZO7A 3H9YA 2F8OA 3ZTJG 1QBLH 3C5SA 1WF5A 3VXRD 3LKOB 1NBVH 3PE9A 3QCUH 2GAZA 5BOPA 4IOIA 3CCHB 4LLUA 4F37F 4DQOL 5AZ2L 5DRZB 5DT1L 4GAFB 3MNZB 4WO4C 1QZ1A 4EQ3A 3I3BA 2HJFB 3ALWA 3PWLA 4X5LA 4R4NC 4PJFF 3IKKA 1LO0L 2Y9RT 2XKNB 4FQLH 5E08H 4N1HB 3MACL 4QRQA 1YJDC 3E2HC 3OAUH 3WFDH 5IFHH 3FT2B 1FVDA 1QSVA 3VFNB 4ERSH 1JTTA 2APFA 4ONHB 1ETZB 2VC2H 4YFLF 5SWSB 5DMIH 3QWOB 3WSQH 5L0QC 5GZNC 1HKFA 4KDVA 2BSTB 4R7NB 4M7LT 2F74A 1GHFH 3BPNB 3BGMB 5IGXL 4I5BB 5EOCH 3MLPA 1CXEA 2FEDC 4WRLA 4K71B 1MCOL 3ZHDA 3QNXB 4P46A 2YWZA 3SJVD 5D7KE 2R15A 5LG1A 3JTSA 1XGQB 2D7OA 5FB8B 4LDEB 1G7LA 5FUCE 4ZOBA 1CLOL 1NCCL 1KUMA 4FQXB 3SKMA 3G5YA 1E4WH 4ZMAT 3E8UL 2NTFA 5KJRL 1ONQA 4RFEB 3IGAA 3PABA 4UB0H 4XMKH 2EDBA 1QFWM 1MEXH 1JIBA 1WFUA 2P8LA 3RWEA 1RULL 2BVYA 4M6OH 4N0CD 3I9GH 4L8SB 3NA4A 4FQQB 4POZD 3NFPB 2D7NA 1MJJA 2LVCA 4JKPL 4IDLA 4X99B 5J6GB 5B22A 1CT8B 4HZLB 1H5BC 3QJFB 4YGVB 1H15A 5CLWA 1MJ7L 3UJIL 5EPMA 5C9KA 1NQBA 2EH8L 5ESVB 4JO2L 3SPVA 5KN5A 5MHSD 4MA3B 4NKMA 3GMLA 3DO7A 1XF3A 1U8QA 3KR3L 4HUMB 1QRNB 2QSQA 1KIQB 4M8VA 3QO0B 3MUGB 4OAWB 3IYLW 4ELME 4BFGA 5T3XL 1M7XA 4WTWA 3GBNL 1CDGA 3DBXA 1EVUA 1IM9B 1MJUL 3WBDA 4LCIL 3TNNB 1OCWL 3KDMB 5D2LB 1OTUC 2NY7L 4NJ9H 4KFZC 3UTZB 3L3KA 2CDGA 5SWSD 1YEDB 3KYMA 4ZTOL 3C2SA 5ADPH 3CFDB 3GSUB 4PB9H 1FZOA 3T0EB 1F4WL 1P69B 2D03L 1R5VB 4LVHB 5GS0L 5HYJB 1GGBL 2YN3A 5DVNA 4QRUA 1HYSD 4F8QA 2A0LD 3GK8L 5DUBA 1T21B 2Q8AL 1JN6A 4UDTB 3QUZC 3RBGA 5B39A 1MCRA 3G6JB 1MREH 3W2DL 2ICWB 5BV7C 3QQ3B 2A83B 4FQXD 2QEJA 3BZEA 4JFPB 4JY4A 4DTGL 2BVPA 3FO2B 3MCG1 4OQTA 3E6FA 5LBSH 4R3SA 3FFCA 3MLWH 4KY1L 5D4QA 4NRXB 5JW5B 4K3JH 3GHEL 3TBYA 3KWWB 5BRZE 3ULUF 3S4SG 1JWMB 4IHOA 1ZHNA 3HRZA 3ARFA 3WE6B 2YXMA 4XP4H 1P4LB 4Z0BH 1C1EL 5IKCB 1IL1B 3FTGA 4LASL 1UJTA 1CL7L 1QSFB 1A4JB 3DV4A 4QWWC 3LV3A 4RWYH 1S9XA 3QIUC 3STZB 2HYMA 3X13B 1CDYA 1KENH 1J0JA 1QRND 1KGCE 4PJGB 3SGJC 2NY6C 5GRXG 4GG6B 1HH6B 4K55A 4LL9A 2B7DT 4JO4H 3MOBH 3TYGH 2PCPA 3TBTB 1IM9D 3QPQD 2ATPB 3MR9A 5K9QG 1EGJL 1UM5H 4DKDC 2ARJA 2J6EH 1D6VH 3HR6A 5C0ND 1V05A 1U8OA 3IS1X 3M17B 3WN5B 4G5ZH 4V2CB 2IAMC 3RA7L 3QQ9C 5EORL 2KQMA 5D7IA 2QSCH 3T0ED 4K7PX 5HYJD 1OVZA 2QL1A 5KVEH 1R24B 1V7MH 4X98A 2VR5A 1GGCL 4DOHE 1B90A 1T0NA 4PLJD 4ELKB 4Y4HA 3ZTNH 3I6KB 4WUKH 2R23B 2X5PA 1NGPL 2GJ6A 3O2VL 1G1CA 1TZHA 4OD3H 4UOW0 1FNAA 5E1AA 1AGFB 3ZE0F 1C08B 1VGEL 4X7SL 1HEZB 5HGAB 2VAAA 4CADB 1K8IB 5D7IE 4P9MH 3SCMA 1G7JB 1H8SA 2DQFB 4OCXL 3FAWA 4RAHA 3IJYB 1P6FA 4U1KB 3RHWF 2WUBL 4OBSA 2X4TA 4NGHH 2GJ6E 4Z95H 3L3IB 5E2WL 3HC0B 3U46A 1J1XL 1I7RB 1XCQA 5HVFB 4R0LA 3AMLA 5GRZA 5IFAH 4DQOH 2AV7A 3MJ8B 5EZOL 4QTHA 2DJUA 1F58L 4OCSL 4U7MA 4I18B 2CUIA 3QI9B 4NCC1 3X14A 3LN4A 3QXDB 3FQUA 4P9HL 3V0WH 2QR0A 1PSKH 3MRDA 4PJAB 1Q38A 3GMMA 5K9JH 4NQDB 3FN0L 5I30L 3K7UA 3EHBC 3IS0X 1XF4A 5F96L 3TLRA 2YWYA 4HAGA 3RGVC 5I74B 1PY4A 3P4NB 1UZ6F 1FFNB 4XBPB 5HI5D 4ZNEE 4YDKL 1Z9MA 3SGKA 3TO2B 3TCLA 3TO4B 1I7TA 32C2A 4LP4A 5FYKE 1MCOH 4MNGB 4MD4B 1YJDL 4HIIB 4ZODA 3EYUL 1CLOH 5I19L 4LLDB 2J88H 4FG6C 4LPWA 5KBNC 2SEBB 3S6CA 5E8EB 7CGTA 3O4OB 3E8UH 5IBUB 3BP6B 4OF6A 1PLGL 1SMOA 3O6KL 1P2CA 4PJDB 4UMGA 1RPQA 5FYLE 8FABB 3REVA 2CDEA 1EBPA 1RZKC 4W4OC 1ED3A 1RULH 4X4ME 4J3TA 3QDAA 1GZQA 1NMCC 1WT5A 4GRWF 5HVGB 5ALBL 4U1GB 1FZJA 4JKPH 1KLGA 5L9DL 1NEZG 2A73B 2EDKA 2YEZB 3TP4A 3UJIH 2EH8H 4WDIA 4JO2H 3QAZC 3ARBA 4DW2L 1NGQL 3CLFH 3KR3H 4MQ7A 2X2YA 4OF8A 4QF1A 4ISVA 2AEWA 3QI9D 1A6AB 5T3XH 3MLZL 4UNTA 4V1DB 4JKWA 1JE6A 1I8IB 2GEEA 1MJUH 5F7YC 2C7UB 2DKUA 3PWNB 4LCIH 4NQDD 5EO0A 1OCWH 3MO1B 1OD9A 4NQXA 3ZDZF 1UB5A 2NY7H 5HHOE 3R8QA 4Y4FC 3LVEA 2BSED 2A6IB 5L2KE 1IAMA 2ADGB 3HFML 4R4BA 4ZTOH 1NC4B 5KANG 2DAVA 4JG1L 1IZJA 4X5XA 5I1HL 4N8PA 2AKRA 1F4WH 2D03H 1KTLB 4Q9RH 1GGBH 3TZVC 4HUVB 1C16A 2HVJB 1SEBA 1JGLL 1F8TL 5DJZB 2CK0L 3TO4D 3GMNB 1WIPA 2R1XA 4NO2B 1D5ZA 4R96B 3GK8H 3LSOB 5E8OA 2Q8AH 4MJIE 3UAJC 1INDL 5ITFA 3WHE0 3WUWA 3W2DH 1KJVA 2FGZA 5I16A 1F3DH 4HS3A 4P5MB 1BBDL 2EIEA 3PHQB 4DTGH 3MV8E 1CF8H 4ZO9A 1JF1A 1B6DA 3CPLB 1KTDB 1GCFA 4KH2A 4M5YL 1W0WB 4Y16C 3RNKA 3FO9B 5JQ6H 5BW7C 1EHXA 5FFLA 1JZ3A 4JFYB 2A38A 4IMLA 1WBXB 3N1PC 4RFNC 3CC5B 3OMZA 1BEYL 3RJQB 4BFIA 1D5IL 3MROB 2R0LL 5BV7L 2O5YL 1C1EH 2MKLC 4RMVA 5FYJU 5C2UB 2ED7A 4LASH 3VDBA 3EO0A 4GAJL 1CL7H 5T3ZD 5IK3A 1NCWL 4HIEA 4FFWC 4JRXB 1U36A 3VWJB 4G8GB 2CGRH 4QHUB 1DLHB 3SKNB 1DANT 1UXSA 4OT1H 1ZK9A 1P7QD 3MRQB 5GS1C 3B8YA 3DARA 5B4MD 3VD4A 3EYSL 1T6VN 5GIRA 4JQVA 4V1DD 4DKAA 5IWLC 3G5ZB 2P4AB 3PDGA 4XI5C 4JN2A 1EGJH 4LEXL 1H3TA 1CFVL 4P4KC 4N8CL 3TBVB 3RNQA 3GSNB 1Q9WA 4MAYB 1YZZA 5K9QI 2F58L 3RA7H 2VQUA 2ZPKH 3LB6C 1CZ8L 5EORH 3F7VA 5CBAA 3FT4B 5ESAA 1WQVT 4DGIL 2F53E 4P2QB 3OJMB 4WHTA 1BQHB 1A6UL 3WNPA 5HXMA 4KU1A 3WS6A 1VERA 1GGCH 3B43A 3JV5A 2YPLA 5FF6B 4P4KA 3QFDA 4MQXC 4EIGB 2X4UA 1NGPH 1AP2A 2PN5A 2VLRA 1OSZA 4IRZH 3EYQC 1G7QA 3QNYA 4M1CC 3QG6B 4X7SH 5GGQL 4Y89A 4X4XB 4KV5F 4I9WD 5D5MB 1D9KD 3VXUA 4TSBH 3LN5B 4OCXH 2P5EB 5ESQA 1LE5B 3H9HB 1YYML 3MYJB 1PQZB 3VE0A 3HN3A 2YPLE 1L6ZA 4X9GA 3OAZK 2ENYA 1RZGB 1U8NB 5JNYA 1UB6A 2VLRE 5E2WH 2P7TA 4XMPL 5IMKA 1J1XH 4JDVB 1N8ZB 4GXUN 1JZ2A 3TVMC 4GSDL 4ONGL 1JYXA 1B0WA 1RHHA 2QADC 4S1QL 3CUPB 3UPCA 5I0ZA 3VWJD 4G8GD 5JUEL 2UZIL 4E0RA 5F7NC 1F58H 4LEOA 5C07E 4HK0B 3QDJB 2AXFA 1I9IL 1ORQB 2UWEA 3IDMB 4JQIL 5DD6A 5FDWA 1QUNA 4MAUL 3HNTL 3SDAA 4AM0B 3RPIB 3A6OA 3HZYA 3FN0H 5I30H 3B3IB 1HYRC 2GFBB 5F96H 3FQNA 3RWFA 3B2UD 3D69A 3GSVA 3HS0A 4YDLB 3P9LA 3FOMA 4YHOL 3IDIB 2HRPL 4AEFA 1IGJA 1YY8A 1S5HB 4HXAL 1N6VA 4EXPX 3K1KC 3VI3E 4P2QD 4U6HA 3DHMA 4QKXB 1YJDH 3MYZA 4P2OB 4D0CB 1ZLSH 5F1SA 3EYUH 3NTCL 5I19H 3L5XL 3RAJL 1T3FB 2PF6A 4L3EE 1U3HA 2C4XA 3QJHB 1VKXA 3DRQA 4BZ2L 3O6KH 1ZGLA 1FJ1A 2Q3AA 1BHGA 3T3PF 1J05B 5SX4I 1F45A 1FFOB 4J8RB 1E4KA 2W91A 4C83A 4CVWA 3NCBB 2ZG2A 5DFVD 4X9IA 5IB5B 1T1XB 3ALXA 1NANI 3AAZA 2CXKA 3BP5A 3V8CA 2J4WH 3TBWA 3TF7C 1DVFA 5L9DH 2PKDA 3HNVL 5C08E 2ITCB 5B38A 1CD8A 2X09A 2FO4A 1BIHA 4XVJH 1T7VA 3RI5F 4DW2H 1NGQH 5BXFB 2VXTH 1PKQA 1RZKL 2HFEA 3OF6D 3VRIA 5M94B 5HHXL 3QDJD 2V5MA 2V9QA 3FT3B 4XPHL 4YFDB 3VCLA 1N64L 5IHZA 1KPRA 2WWKO 1T1ZA 1NMBH 1UADC 3HMXA 3BUYA 2WP3O 4HWNA 2EDXA 3A67L 3TT3L 4YK4C 3KJ4B 5DRXB 5FO7B 3DUSB 4JZOB 3HFMH 1PKQE 3GSWB 4JG1H 5IVOA 3DTXA 1AKJB 5IVXE 3D0VA 3TH3T 4MXQC 5I18H 5F21B 2NW2A 3BDXA 1Q0XL 1N0LA 4LAJH 1JGLH 1F8TH 2CK0H 5KANI 3C60C 1CFNB 1RZ8B 2Z93B 5ISZB 1INDH 5J06A 5EC1B 4P2OD 1BFOA 2NY2C 5E95B 3BWAA 1FYTA 4XPBL 3RWGB 5C0FA 1BBDH 2ZNXA 3VFRB 2XTJE 3LQAC 1CE6A 1QVOB 3MODL 2FD6L 4HK3N 1SY6A 1CLCA 1LK2B 2FECL 3QIWB 5FEBA 1NCAL 1UXWA 1OP5H 2ESVB 1MUJA 2ITDA 4HX1B 4L3ED 3GGWA 3WEXA 2DJ4A 1DR9A 4HLZG 1BEYH 3BXNB 1CLZH 5DI8A 5GPRA 1D5IH 3VG0L 2R0LH 1FYTE 1OAUL 2GSIB 5BV7H 2CJUH 1KTRL 1EEUA 3B9KB 5JIKA 2O5YH 1ZHBB 1FC2D 3UPRB 4BH7A 5EU5A 4GAJH 4OB5L 3KVQA 4Y8DC 4NBXB 2JKXA 2GY5A 2A6JA 1R3KB 4Z8FH 4PRBB 1QLEL 3LDBC 2HT4C 3D25B 3EYSH 4GKSB 1WLHA 3PQYE 4LFHD 4PTUB 2HKHL 1VENA 4J4PC 3C5ZB 3HZMB 4L5FL 1CFVH 1R3JB 3RKDC 4Z7NE 4CU6A 4N9OB 4N8CH 3QUXB 2BNQB 1ZAGA 3JUYA 3EO1A 2R29L 3RWDB 1P84J 4M8QB 4MJ6A 2F58H 1AKJD 3MZTA 1CZ8H 2VXQL 3MNWB 4LLYB 2FR4B 2E9WA 2CRZA 1UFUA 5D9SB 4GBXB 1T83C 4DGIH 1JWSA 4ZSOB 4ZFOB 3D18B 1AQDA 2VLKA 4PJHF 2E9JA 4G9FB 1A6UH 4AIXA 4M00A 4TUKL 4UT7L 5MP6H 3RHWK 3QDMB 5ISZD 4DKEL 1FZMA 4KMTL 2N56A 3O8XB 3NIGF 1MNUL 5EU7E 3PNWA 3VFWB 5GGQH 4PJFA 1DZBA 4H88L 3LZFL 7FABL 4EJ1C 3FZUD 3FQTA 3HZKA 2WWMD 4YZFE 2VLKE 2BVEA 3QIWD 3VXQA 2H8PB 4W70A 5INCA 1YYMH 4ENEC 2ESVD 5I66A 3D39B 1PFCA 3DUUB 3WUZA 3SE3C 2CR3A 2PXYB 2H9GA 4X7FC 3B9KD 4WTZA 4JREC 4ONGH 3KPOB 5J12B 3ALPA 4JZNA 2HMIC 4S1QH 3CXHK 1O0VA 1XGUB 2XWTB 3U30B 3KAAA 4LGRB 4LPXA 5HHQA 5LAXA 5DF0A 5HHMB 1FP5A 3BQUB 5D2NE 4XZUB 3ULVC 3ZHLA 3JWOC 3QG7L 1D7FA 4JQIH 2DWEB 4M3JA 1S9WA 5CJOL 1H3GA 1QQDA 1AXSB 4CVXA 4KMLB 4MAUH 3GMQA 2NX5D 1WZMA 3KPSA 3UTQA 2ID5A 4HHAA 5CEXB 1N7ML 2BNQD 2Q86B 4YHOH 2HRPH 3HI6H 3RP1A 4S1DC 4WW1B 2VWEE 5FM5M 3VRJA 1M7IA 2Q8BL 3O4LB 2V7HA 1U58B 4HXAH 1HSBA 4V2BA 5EBWA 1RZ7L 1EFXB 1S7TB 3B9AA 4G9FD 4PJBB 3S98A 4GMTL 5IBTL 1U92A 4EQ2A 3PIQB 5ITBL 3NTCH 4G42A 5IB1B 3IXAA 3L5XH 1JNLL 4F7PB 3RAJH 4K94C 4F33A 1DQJA 2OTWB 2B8OT 2DJSA 2DRUA 4OM0L 3RL2B 1HWHB 4BZ2H 1LE9A 2ZUYA 4AIZA 3T65A 4CU7A 4AYFA 4HJGB 1LP9F 4JM2B 5D6CA 4JJHA 4L4VB 3BIKA 3AREA 4KRNA 1U93B 2AEQL 4NO5A 3Q3GA 1B6UA 1XCTB 4BH8A 4XVSL 5JDSA 4KHXL 4W6YB 3LH2L 1E27A 4ZUSA 4N1CA 4KROB 3OXRA 3T1WA 1PBYA 2PXYD 1VB9A 2EEAA 3F12A 3U0WL 3HNVH 4XHJC 3G6DL 4APQC 4Z7WB 1TNNA 2DYPB 2VXUL 3P9MA 3VDCA 1HHKB 1DEEB 1NJ9B 5DS8B 4TOYL 5HHMD 1ZSDB 2D7PA 3BQUD 2X1PA 5JHDA 2CRYA 2BVOB 4ZPTA 3WCYA 2PYEB 5HHXH 2AK1L 3IDYC 1SQ2N 5HGHA 4XNQA 1I8KB 1DQQA 2HN7A 4XPHH 3VXNB 1N64H 5BVPL 1B88A 1BAFL 4NQVA 3T4YB 2Y25A 1F4HA 3TT3H 2HFGL 2P44B 2DQIL 3G04B 1A1OB 1PZ5B 5CJBA 2GKIA 5GGSY 4NNXA 2XZQL 1UENA 1I1CA 2EO1A 4PRNA 2O26U 1SYSA 1XZ0A 3RX7A 4D8PA 1EUTA 2X4OA 1Q0XH 2AERT 3U4EB 1EFXD 5E5RB 4NZRL 5DR5L 2WWKT 1M6OB 1B2WH 1F3JB 3QIBC 1GPOL 4HKBB 4LVNB 3O2WL 2VH5H 3T0XA 3BHBA 2R1YB 1UJ3A 5IM7A 4S10A 3MRHA 4XPBH 1OPGL 1KFAL 2YD8A 2VITA 3IFPB 2DQCL 3MODH 3WIIL 1WZ1L 3EDKA 1I8LC 4Z7VB 4EI5C 4JM2D 3IXTA 2BJML 4L4VD 4PJ5E 5GJSL 5IEHB 4I0PB 3VXME 1H0DB 1NCAH 2R2EA 4KTEL 3T1FB 4UNVA 2MFNA 3BO8B 3WLWC 5TQ2H 2FIRT 4IIQC 2G75B 5FO9B 2D31A 5FUOL 3VG0H 4Z5RB 1JGEB 4KROD 1I3RB 5A2JH 3QA3A 1MCKA 4I77L 1HZHL 4OB5H 4UQ2B 1FVCA 5EIIB 2AJZB 3LQAL 4JLRA 5GJTL 2DYPD 3AY4A 5C7XL 4LLQB 1C5CH 1K4DB 1BREA 4P23C 1LEGA 1N3NA 5CP3A 2Z9TA 2HT2C 4NFCA 4NO0A 2A9NL 3OKDB 4HULB 4MMZC 4X4YB 2R2HB 1GIGL 2Q6WA 2ICEB 4LSUH 4NC1C 4NOFA 1CXLA 2HKHH 3OZ9L 3D3VE 4LLMA 1CIDA 4L5FH 4U1SA 3BX7C 2WINB 4YBQC 3WDIA 1KN2L 2Z8VC 1VEPA 4LVOB 2R29H 2C1PA 4LNVA 4X6DF 4HH9B 2VXQH 1P1ZB 3KPNA 5BS0A 4BSWB 3CDGA 2OS7A 3DNKA 4LKCB 4ODXB 4YBLC 5KSAC 2HTKC 5FHBH 1KYOK 1Z0MA 1C5DB 3KLAA 4UT7H 3O3EA 2D0GA 5T3XD 3ARDC 4NRYB 4DKEH 1E6OL 3FB6B 4KMTH 1NAKL 1F11A 1RUPL 5JXAL 4G8FB 1MNUH 1OTTC 1GC1C 4FOMA 3NFNA 1UM6L 2E6QA 4FXGB 2X4NB 3KHQA 3WO4B 5BS0E 1KB5A 1CBVL 3UJJL 3LZFH 7FABH 3K3QA 2LVEA 3P11H 3QZWA 3MCKA 3GSOA 5E8NB 1CU4L 1JPSL 5FYJE 2JCCB 3GSRB 4LNRB 4I0PD 3S36L 3DVNA 4KXZH 1Z9OA 2X7LB 4K7PL 1H3PL 3WXVL 3ARZA 1VFBB 4Z0XB 1J0HA 1OQXA 3IFOB 5FKAA 4JKKA 1MOEA 5TE6L 4PJ5D 1HCFX 3RIFF 5MEOB 4FQJL 4TULL 3C9NB 1MLCB 1NL0H 1RSFA 5BCAA 4MA8L 4U6YA 5DXWA 2B0SL 4JGJA 3N1QC 4N8VB 1A7RL 3QG7H 3HPJB 5SWZE 5CZKA 2VNCA 4PJ8C 1JMXA 5CJOH 5FECA 1P7HL 5IT2L 1MHEB 3ORJA 3UCRA 1U8PA 3VXOB 4GOSA 3U4BL 2F9BT 2BVTA 1QR1A 1AXIB 5IBUG 1N7MH 3C8DA 3C5SB 2Q8BH 2QHLA 1MVFA 2GAZB 3V0AC 1I7ZA 3OR6A 4BUHA 4LQ1A 1RZ7H 4IOIB 3ULVL 2VDRL 3JWOL 4LLUB 5EBGA 3RPKA 1TVBA 5ICXA 1OAKL 3MRJA 5CINL 3PWLB 3VH8A 4O00A 2FCBA 4GMTH 4O5LL 5IBTH 4BQCA 3Q6GL 5ITBH 4Y5XC 1PG7W 1JNLH 2QQQA 4X7CC 2DMKA 3EYOA 3CFEA 3MJ9A 1BVLB 5IQ9A 4OM0H 1DL7L 3RZCC 1FVDB 1AFVL 4OTXL 3HAEA 1HE7A 2H45A 2YBRA 3HI1A 2DQEL 4JFEE 4OLWH 4CUCA 1NBYA 2F74B 2MSPA 3NABL 2V2TA 4KHXH 1WUNT 2IBGA 3CK0L 3LH2H 4HPOL 3AS3A 2G5BA 1IAII 4XNMA 3E2HB 4JFDB 4F15C 1CGTA 4JRYA 4K94L 4YHLL 2H41A 3JTSB 1G7LB 3BSZL 5L8JB 2VXUH 3C6LC 3IFNH 2XOTA 3DI3B 4LSSH 5L0QB 3SKMB 3G5YB 4LMQE 4CNIA 1SJVA 2NXZC 2NTFB 4TOYH 4Q97A 1WEJL 2L0DA 4H26A 1ONQB 4I0KA 3IGAB 1S8DA 3ZDZE 2AK1H 3BVNA 3PHSA 5A1AA 3ZKSD 4Q6IA 2P8LB 3RWEB 2DQGL 5BVPH 4LSRL 4OF7A 4LCWB 3D1MC 2VR4A 1WV7T 1DLFL 2HFGH 1MJJB 3HB3C 2XZQH 3NCEB 5E70A 1G9MC 1H15B 1JTOA 3V4PL 5EPMB 3ROOA 2BY0A 4QNPF 3S37L 4NZRH 5DR5H 3SPVB 5KN5B 1A9EA 3GMLB 3U7AA 3DO7B 1XF3B 1U8QB 5DO2C 4JQXC 3LEXA 3PL6C 1GPOH 4OIIH 4ETQA 3O2WH 2IANA 4JHZA 4KK5D 4OFIA 4CVZB 1KCRH 4XH2A 5DJCB 2DLFH 2Y36L 3DBXB 2N7AA 4CDHA 5T1MA 3GBML 1TXKA 1OPGH 3UTSB 1KFAH 2EZ0D 1S7UA 3WIIH 2ZOLA 3WO3B 2Q76A 4QHLA 1R6VA 3L3KB 1G7MB 2CDGB 4LPCA 5J6HA 2X9YA 5GJSH 3PL6A 4WO4D 5C3TA 4R4ND 1X5HA 4Y0GA 1AGEA 1DQLL 1WITA 4QRUB 2OR8A 5IVZA 1X5FA 4LPTA 4JFDD 4C4KO 5DUBB 1ZTXL 3SEPA 1JN6B 4XAKD 3LQAH 2YRZA 4NFBA 2IH3B 5B39B 2PW1A 5GJTH 4EEEA 4JHBA 5C7XH 1DJSA 5GZND 2AVGA 3BZEB 5HYQA 4JY4B 1WISA 1DANU 3CDYA 2BVPB 1EEZA 2CPCA 3E6FB 3L95A 1GIGH 1JTPA 2BRQA 3FFCB 1BQHG 4LPVA 2X1OA 3O11A 4JCMA 4PR5A 5MERA 4UILL 2GTZA