1JRLA

Crystal structure of e. coli lysophospholiase l1/acyl-coa thioesterase i/protease i l109p mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
179
structure length
178
Chain Sequence
ADTLLILGDSLSAGYRMSASAAWPALLNDKWSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRPPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Thioesterase I/Protease I/Lysophospholipase L1: Consensus Sequence Blocks Constitute the Catalytic Center of SGNH-hydrolases through a Conserved Hydrogen Bond Network
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Acyl-CoA Thioesterase I
total genus 57
structure length 178
sequence length 179
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1jrlA00
1ES9A 3DT8A 4TX1A 3RJTA 3DCIA 3SLRA 5BN1A 1Z8HA 4DEVA 1DEXA 4JHLA 3DT9A 4JJ6A 3KVNA 3MILA 1PP4A 1FXWF 4IYJA 3SKVA 4K3UA 1IVNA 1U8UA 3U37A 3BZWA 1ESEA 1VYHA 2W9XA 2Q0SA 5CD9A 4PPYA 2WAOA 1K7CA 4OAPA 4Q7QA 5HOEA 4Q9AA 4RW0A 3DC7A 1BWRA 3DT6A 1VJGA 4JJ4A 4K40A 1YZFA 1J00A 2APJA 1BWPA 1ESDA 2WAAA 4NRDA 3HP4A 5A4AA 4XVHA 1WABA 4S1PA 1ZMBA 2VPTA 1V2GA 1JRLA 4K9SA 1BWQA 3W7VA 2WABA 4RSHA 4M8KA 5B5SA 3P94A 3PT5A 4OAOA 4JGGA 2O14A 2HSJA 2Q0QA 4I8IA 4LHSA 4JKOA 4HYQA 3C1UA 4HF7A 1ESCA 4H08A 5JD3A 4K7JA 1FXWA 1DEOA
chains in the Genus database with same CATH superfamily
5CDSA 4NBKA 2P27A 2ETVA 2QDKA 2WIDA 4RPLA 2G28A 2O3RA 1EEHA 4TN5A 4XWAA 3OT4A 3UANA 5EJ9A 3ROTA 4U2GA 2FN9A 3FPGA 2HTFA 3V6MA 4FYPA 4BNTA 4EI9A 1S89A 2CNLA 4D3SA 2EL7A 2WVGA 2V5AA 3QE3A 4B4KA 4CT0A 4RZ3A 4ZT7A 4ZDIA 3W1VA 4JLPA 2BV3A 3MVEA 1T3HA 2BIFA 1U8XX 2AXNA 1QYCA 1OU4A 2EAUA 3AEYA 4RCYA 3ZK9A 1PV2A 2ZB2A 1TW3A 3CSUA 1H05A 2BFDA 3LBIA 2IDMA 2JG3A 1LLCA 4ZIRB 3C4VA 3ICPA 3BPSA 1T5HX 3IXLA 1D1PA 1JQ3A 3FTDA 2BTQA 3BGSA 3F9IA 3JPWA 3MLEA 2XNKA 3TZHA 4L4YA 4DPMA 3NONA 2PUDA 3G5TA 3HLTA 3SJUA 3B36A 3IR5A 5HE8A 4H0NA 2DSTA 1UKZA 2J3EA 3OCCA 2V6BA 3OFVA 5G2OA 3HDQA 1XPOA 3IPRA 3RVKA 3OF3A 5K0BA 3T9DA 4TQAA 4UC0A 1D6SA 1E94E 3KR9A 4BFWA 5K8UA 4TMTA 3DZCA 1YTLA 3VH4A 1OE0A 3DR5A 2CNNA 4KPFC 3RQSA 2V4ZA 2V98A 2OD2A 5F3RA 2ZB8A 1LKZA 4PYOA 1KEVA 2TMKA 2IV3A 4S0ZA 2XNDD 3NBZC 1R74A 2Z8YM 4K05A 2H52A 3V8QA 4JOCA 1D6JA 5TXGA 3PNPA 4DQKA 1T24A 1I1HA 2CMKA 2NZ8A 1MQ9A 3JVIA 3ETDA 3KNZA 4UEOA 4L22A 1QV9A 1Z74A 2GEJA 2PPVA 2BHNA 5IUKC 1I4WA 2W2PA 3BQMB 2A9VA 3EVNA 5AW2A 2BP7B 3HJRA 3DDZX 4K6FA 4L6IA 5CBPB 3BT7A 1H23A 4AVYA 4F04A 4KN9S 5H7XA 2D1RA 4KAXA 3SZ3A 3UG7A 4ATNA 3V4RA 5SY4A 3CH4B 5FPYA 3RVPA 1RPNA 1DBWA 1NNLA 3AERB 4U7TB 1O95C 4YR9A 4QJ5A 4IINA 5BOSA 1NULA 2RCYA 3A4YA 3LDHA 2JLVA 4UMDA 1E1MA 4QU0A 1YFJA 3B6KA 4MUNA 4JMPA 1FLVA 5G0WA 3WJ7A 3UT0A 4S2EA 1SVSA 1YASA 3RC7A 1AGPA 1T91A 3NBMA 4RF4A 4YAOA 4BGIA 2F4VB 1UBFA 1MB3A 1W85A 3MHPA 3R7FA 3TK1A 3VC7A 4F84A 5BVHA 3AEKB 2Z57A 3PXAA 4MI6A 3LW8A 1T9KA 3SXUA 3WQQA 1E1NA 2LIVA 4PYMA 1E9FA 1PJQA 1Q83A 1XF9A 2YIJA 1B73A 5T4BA 3TFWA 5CDFA 4WXHA 3EX7C 5HS6A 5L4LA 2GZHA 1B8PA 4EI8A 4KMMA 3W3AH 2Q9CA 2Z83A 1RJWA 1TYAE 4JLDA 4YJKA 5ALIA 2O50A 1JU4A 3H8WA 2C4KA 4RKFA 4B4WA 3U3ZA 2GN0A 4OGKA 4Q4JB 4FI3F 2I78A 3CRNA 3E5NA 5KC8A 2NTEA 5LQMA 1DAHA 2XKBA 4UJ3A 4ZVPA 4BVFA 4O4JA 2RI6A 1R4ZA 4LRSB 1USKA 5FT9A 5JLAA 1YTUA 2GZ2A 3MWJA 1TYCA 1WQ3A 1GG5A 3GEEA 2QR3A 4UTNA 1F51E 2BEVA 1XDGA 1Y5MA 2GK6A 1QP7A 1K98A 1PT8A 3T9CA 1XTZA 2ID9A 4UNQA 3V8RA 2NU7A 1XROA 1Z7GA 5IT4A 1B41A 1I0LA 2P7HA 4FFSA 4KGZA 4TLAA 5LA6A 5GINE 3UXYA 2XCTB 3THXB 4LFBB 3HKCB 4HH0A 5AYVA 2I4RA 1OBHA 1I6KA 1W75A 1RHMA 4MP8A 5AM1A 2Q28A 2FJ0A 1ITZA 1U8UA 1KIAA 3L41A 4OMUA 4ZT5A 4D45A 4CUZA 1UC8A 5GADl 3L4SO 1IOVA 5DV9A 4MJ7A 4Q3NA 3RIEA 3A1SA 3D6UA 4L4XA 2C5LA 2ZIXA 1Z13A 2PUWA 4Y6PA 2QR5A 4HAWA 2JFGA 5JSFA 2OMKA 5JS8A 4WDQA 1JJAA 1GFSA 2Y68A 3ED5A 4KGVA 2NVUA 2RGGA 3D8BA 1HFEL 1S3GA 5DK4A 4BGVA 2JFNA 2A5YB 3HU2A 1A98A 2VHJA 1L7XA 2OECA 4QWMA 4YMIA 3LRXA 3NU1A 4IDBA 4JJ4A 1SFRA 3K5HA 2C98A 2OCPA 3DUFA 2EX0A 3ZIAA 3HH8A 5C5DA 4PHCA 1N0IA 1HR0B 3DLTA 4J75A 1RRFA 2XMGA 5JNUA 4FMPA 4EA9A 3CA8A 1M2GA 3N76A 1NLFA 1HT2E 4Z6KA 4TLLB 3I12A 4NJEA 5A62A 2BHLA 3K6RA 3KCNA 4RY0A 1UJBA 3FWYA 4X00A 2PX3A 3K96A 5GIOE 3QFHA 2ZI9A 3D2CA 2C54A 3KSDO 2VXCA 3NXSA 1DRKA 1BXRB 4EF5A 3CX7A 3AI7A 2J9FA 2QIOA 1GPBA 3TTUA 4KIFA 1NRWA 4M8KA 4OMDA 5K6TA 3NHWA 2ZRKA 3ROKA 4GLLA 1D5CA 3RI3A 1O58A 5AP9A 2PANA 1LQTA 1RYFA 4XSHA 1O6GA 1GEEA 2WU1A 4ERXA 2HF2A 4LYFA 4LF6B 4HK4A 2P9YA 3ORQA 3LYLA 2CMDA 2OR3A 4FKMA 4P4SB 5LB2A 2BZ0A 5AVQA 4FDUA 4JBGA 4RHXA 3EEFA 5D3KA 1G5HA 2CJYA 3DBLA 4GT1A 4LYEA 4YAUA 2R47A 2BFCA 5K2OA 1FUUA 1N4DA 4E5UA 4ZVVA 2RI1A 3TJZA 3LLVA 1XHLA 2ZT6A 1KI7A 2DT8A 4E30A 4UFOA 1MOZA 3D8HA 1JS1X 4L6AA 1WSWA 1Z88A 4EHDA 4CMIB 2CHEA 3HO8A 4DVJA 3LP5A 4OGGA 1MABB 5KX5F 3EG9B 1RZVA 4HEA1 1JA9A 3BXOA 3AUTA 3QKSB 3QMMA 1JECA 2D5IA 1MNAA 1OFVA 4ISBA 3RVDA 4EG1A 1FP7A 1YNOA 3T95A 3TOCA 1I51A 1SC6A 3DF7A 1GSOA 3B70A 4G5QA 4GRIA 1KE1A 4F3NA 3KR0A 4F96A 5K4GA 3TTTA 2BMAA 2WE7A 2CEAA 3GEMA 2NT3A 3ELUA 1NXTA 4ZWNA 4TGLA 3HJHA 3PDUA 1K7EB 4LHYA 4RHFA 1U80A 5HUQA 1TU4A 3IBSA 2OT3B 2IH4A 1H93A 4GQAA 2B82A 2YOGA 4HLNA 1NX6A 4XGIA 2R1TA 4D9BA 5JNWA 4TTTS 1DBRA 4QDXA 4Z54A 1VCNA 3HCPA 4I1UA 2Z6UA 2F90A 2PH7A 4YJHA 3V8PA 2I54A 2Q3DA 4KJZA 2BF7A 1MAUA 5FUYA 1FK8A 1PJ8A 3EF1A 2AIRA 2O7QA 3B8EA 5CA0A 3QLVA 1A9PA 5TQVA 3UAXA 3F5QA 1JSRA 4RY2A 3U13A 3DD1A 4JU9A 1DDGA 4NE2A 2IWRA 3WIUA 3QUCA 4P7BA 2WLTA 5CM9C 4PN7A 3GP8A 1U3CA 2C5HA 2ZE5A 4R1TA 2Q8NA 1Y4SA 3CH5A 3H4TA 3UMMA 3MJFA 4NAUA 4M8IA 5F1PA 4BQQA 1LK7A 3UAOA 3L79A 4BO6A 3U7JA 2PWPA 5AJYA 1U98A 3GDWA 3WZLA 1RWWA 1LA2A 2WI8A 3QTLA 1X87A 1YKFA 1H0RA 4N4AA 3Q9SA 1UIRA 5E9AA 1NQOA 2GAJA 1VXRA 4ETWA 3H5IA 4F12A 2XDAA 3PRJA 2Q3CA 3HGMA 1ZK0A 3NHJA 3PPVA 2G1KA 1CY4A 2BM0A 2ZWPA 1QG6A 2INGX 1U3WA 3E5RA 4FIDA 4M22A 4C5AA 4ZQGA 4GQBA 1VB3A 4E7OA 4XUCA 5IKEA 1V16B 2WOJA 2GZDA 5BN4A 2Z4SA 5H80A 3W77A 3AXTA 1KZHA 4NJMB 4F3TA 4QQRA 3IB6A 1Z29A 4RTPA 1WXGA 5CXSA 4EJFA 5A1TA 4Q4AA 1WVGA 3EZFA 4BX3A 4YLEA 3SU8A 4G81A 1XEAA 1TQHA 1Z75A 1D4FA 5ALQA 1SVKA 1WXDA 4K9OA 4QBHA 1HBJA 2EIXA 4RA9A 1AXGA 1V41E 1WV0A 1RC0A 2PO7A 2YASA 3O1JC 1PE0A 1KQOA 3EG5A 3SHOA 5L51A 2DKOA 4PZ0A 1OXSC 4AIIA 1J2TA 2YWJA 1IJBA 3PV0A 2DLCX 1T5OA 3LP8A 1QMPA 4IIGA 3FPFA 3HV0A 3R76A 3ZZUA 5JROA 3AHDA 3EF0A 1X80B 3KQHA 3VAZA 1CJSA 1GPAA 2Z8YA 3N5CA 4LV5B 5BR4A 1OREA 5CLHA 2FZWA 1APBA 3JZIA 1R5JA 3PHCA 2O20A 4C2TA 2YYSA 2DRIA 2QAGB 1EZZA 2NV2B 3GR6A 3QUQA 4BBPA 4BYGA 1LNSA 2QYTA 3ZWPA 1SWWA 2EEZA 2R6FA 3MTBA 3VSDA 4F1KA 2G6BA 3KP1A 5ESWA 3QPAA 1O77A 3CJQA 3ANSA 1YQEA 3N07A 3R5TA 4XUEA 4UTVA 2P4SA 1XTSA 3EARA 5HSGA 3ASUA 2H2DA 1T9DA 3DXXA 1S7GA 3OUZA 4G0WA 3ZLUA 3DF9A 3DHNA 4JLNA 3M3HA 1UANA 3O4GA 4YQEA 3ZWAA 1O6CA 2XGSA 3ASYA 3PR3A 5KTMA 5C31A 1U1EA 3FVQA 3PEYA 2BFBB 3ZDEA 4AKIA 5BV1A 4ED9A 2DZDA 4NOJA 1CEEA 2UVDA 1J9ZA 4XPIA 3IPYA 4D4KA 3FZEA 3LMKA 2MYPA 1N78A 1ZVKA 3H2YA 2BEJA 3ZC3A 1A7KA 2GFQA 5I45A 1ZINA 4KX5A 1EUCB 1ZCJA 2PS1A 1X19A 4NK5A 3RUDA 4JI5B 4BRZA 3LT0A 1LBHA 3W4JA 4QEDA 3RSHA 1RQ7A 3O8DA 2OYCA 1C41A 4D42A 3UJAA 2HWWA 2P7IA 3DL4A 1QIIA 1AV7A 2ZJ7A 2VNSA 4E5YA 4Q9KA 5DCWA 4D3DA 4XYEA 4WBNB 1GCAA 3KTFA 3DLAA 1V7CA 3FPHA 1RZRA 3OJWA 1N6PA 3V7UA 2AQIA 4C4SA 4M99A 5JASA 5E6RB 2R00A 3FZQA 1OGYA 4B9EA 1S3FA 4HH3C 4HWSA 3P52A 4KCGA 2QENA 4KV9A 1K8RA 3SOPA 5CT4A 2W9XA 3WYGA 1KYIA 1QVAA 1E5DA 1VBFA 4IILA 5IAKA 4BZWA 4HNQA 4ZYUA 5J4HA 4E5NA 4FCWA 3WL6A 3UMJA 4OKIA 3E0XA 4A6PA 1K4YA 3ZI4A 5LP1A 1NLMA 2C4TA 3T7KA 1WUJS 4BO4A 3GLIB 1JWLA 2GXUA 1W87A 2DUJA 2FVYA 4XX1A 3IAFA 4CR6A 4W1RA 4PC7A 1CF9A 3QE0A 3SF0A 3U2QA 3HCCA 4IDGA 3A4TA 4YLYA 5DSZA 2AN5A 4NV3A 5E3JA 5LQKA 1ZS9A 1E3LA 1E59A 1OX5A 1CJTC 2X1VA 2IODA 3WLPA 2YV5A 5L3SA 2XHEA 3ZIAD 3CX3A 3C3WA 3GP3A 1RBMA 1TO1E 1PGOA 3LG2A 4AQ7A 4JHXA 1GLVA 2GKOA 4E1BA 5H83A 1M2JA 1Y9DA 3ZX4A 1KTVA 2QTVB 3TPCA 4P3NA 3X2SA 1VBNA 2QR2A 2E4ZA 3BWDD 4UBKA 2OAGA 5CHEA 5E9WA 5TGDA 1WCWA 1UOEA 2R68A 1YKSA 4OXYA 1ZKDA 2GEDA 2B4KA 2FSUA 1OYYA 1VE5A 3PQFA 4RFLA 1ML3A 4HDKB 4F9TA 2X8AA 2VYND 2O2IA 2JAOA 4W6QA 3TZLA 4BFCA 3C74A 4BNFA 2GM9A 4YRLA 2V55B 3WBJA 4HUTA 2VAXA 1Y3DE 3A9UA 2PXHA 4CIBA 3LHKA 3N75A 1FPMA 4TLDA 5CM2Z 4F5ZA 1X1RA 2GCNA 1KMCA 3MPOA 1T8PA 2NOAA 2BRUC 3C3XA 3V2IA 3ZDZB 4KX3A 4MW7A 3W7BA 2QLBA 5DWQA 5B4UA 4Y2TA 4CKBA 1XPUA 4IH9A 2JLAA 4S1NA 4ALMA 3ORFA 4M8SA 5ESXA 5DTEA 1Y1TA 2AF3C 2QL6A 2HJWA 1NW5A 4D9IA 4QPCA 3L6DA 4YMUA 4KE7A 5C7YA 3C16C 1LD3A 2WKQA 1B0AA 4OXXA 1U04A 3UK7A 3A1FA 1XYYA 4ID3A 5CLQA 4CG2A 2JF0A 1QVWA 4OHKA 3SICE 5B3LA 9MHTA 4C22A 2I1VB 1PO7A 4FFVA 3RSFA 2PAFA 1I3KA 1GGVA 2X8BA 1A8SA 1SQFA 1ZRMA 1KTIA 2FSFA 3T5GA 3OUTA 3LO8A 2IE8A 2UYOA 1GKLA 3HXTA 4DEXA 2RGRA 4P7JA 4Y3UA 1ODLA 1V1RB 1CBUA 1RXEA 2QAGC 3N39C 3PENA 2X0IA 3QYJA 5JDCC 5JMWA 1UQUA 1TM3E 1WU8A 2IIBA 2LXNA 2P4UA 4FPXA 4TVKA 5CVVA 1WP4A 3AU9A 3LYHA 5T64A 3WQRA 1BA3A 3JR3A 3ZCTA 1FQKA 6LDHA 1EGQA 5CFQA 3GJ3A 1W5AA 3DT9A 3ANNA 1U6IA 4DIDA 5KS2A 3BB4A 3SQXA 2H57A 3DYVA 2JAUA 3GRKA 3LI2A 3QI7A 1QYDA 3LT4A 4MS4A 4QUIA 3GRZA 4C7JA 5E38A 3EW7A 3EZ7A 4V0SA 5JJKA 1J97A 1QQ6A 3EN0A 3REQB 4Z51A 3HN6A 2LGJA 5EL0A 3JCZA 3G8DA 5DNVA 4OX9Y 4P81A 3DBLB 3RABA 5LIPA 4HHEA 1SG6A 1WMDA 2VEOA 5LD2C 1LCIA 1M9NA 3ETHA 1LI7A 3ISJA 5IP5A 2AMFA 2VFAA 5HOEA 1GUAA 4BUJA 1CUVA 1P9LA 4M0LA 1XVAA 1FNSA 2ZXFA 3C5CA 2CFSA 2G67A 3HG7A 3RJ5A 4DIEA 2DY0A 4UXHA 2JLYA 2OV6A 3DV2A 3I42A 3UY4A 3TTYA 1MG5A 1W2HA 3I37X 1XCPA 4KXUA 5FFMA 3RFTA 1IZZA 1UR5A 2O2XA 2QLNA 3U7QB 2R79A 1P1FA 2R751 3HJBA 1VE9A 2CV1A 3AW8A 2FEMA 3MB5A 1PSWA 1T4BA 4CG0A 3UPTA 1J1UA 1XZEA 2G08A 5AXAA 2A2ZA 4LGCA 2C77A 2Q41A 4FYXA 4Q02A 1P1HA 4FU0A 4V0KA 1OU0A 3D8SA 3VYWA 3KVVA 5ADWA 5ICEA 2J5QA 5BV2P 4O2AB 3NHPA 1JEQA 4Q48A 1TIKA 2P62A 1XMXA 3MXTA 4V1CI 3FVTA 5HOQA 2BHTA 3L05A 1LTHR 1QK3A 3IPXA 3EF3A 1H6AA 1YUBA 3AFHA 3P71T 4RF3A 3FM9A 5H59A 3ZGZA 2GNOA 4UHJA 1E2GA 5F9FA 1DFGA 2UYYA 2ZFUA 1AKUA 1PT6A 3H4IA 3E2MA 4PC2A 4PPFA 3WLRA 1J0EA 5SY6A 2OTCA 1MOPA 3HB5X 4H60A 4BMPB 1MC5A 3JWIA 1RJ9A 1LC3A 4NZ9A 3EUWA 3ZNOA 1CU1A 2RHJA 4OH1A 3KDAA 5L95A 3ZDQA 5J47A 4R1SA 3WRXC 2CXXA 3JZFA 5AKLA 4JT9A 5DHTA 5LCXA 1ZH8A 1N7JA 2Q3HA 3CIFA 3U7FB 1RXUA 2IZ7A 1CZOA 2PJZA 1G8SA 4CV1A 2VTDA 3IP9A 2VDOB 3RUPA 2P9GA 5C3UA 2CCJA 4HNSA 1TXGA 4GW3A 4A2PA 4OHYA 1CQPA 1TUGA 3F2VA 5KOJA 1VE1A 1Z8DA 1ZH4A 3C7TA 5EHXA 4ADSG 5JZSA 1Y6FA 4UVEA 3RGWS 2HXYA 3BL8A 3KPVA 4IG9A 4GPIB 1W5SA 4RD4A 1KDRA 5MGNA 1RWOA 3HLYA 4H59A 1QHIA 1UBCA 4D9CA 5KWJA 1W9HA 3EVBA 4KAJA 3BH7A 3REFA 3UAWA 1SCNE 2R44A 5JQGB 4OQZA 3E22B 3O92A 4DLNA 3WGOA 4HPXB 1J1IA 4XLTA 5TR9A 2PQMA 2AN3A 2DPYA 1QANA 3SFVA 2X9LA 3H18A 1R5OA 3QJGA 3T4EA 2Q4DA 3EGDB 4HVAA 3FPAA 4L7VA 3R75A 3K1TA 5M3BA 1GLGA 5CVDA 1NKTA 1EK6A 1FTNA 5E4YA 2B1RA 4US1R 1IONA 2A30A 1A9RA 4M9CA 4MI9A 5G1NA 4KR6A 4KNYA 1RW4A 3LKDA 5ARDA 1U5BB 3RSOA 5A5GA 4G6ZA 2ZUTA 1NPTO 2QMUA 3FDXA 1BA2A 1X74A 2ZREA 1QYRA 1M2VA 1KDTA 1BYIA 3JWJA 4NCNA 4ES6A 4CKZA 4LOAA 5J4LA 4YV7A 3GOHA 2A35A 5JYEA 1RWNA 5LP6B 1PJSA 3N3BC 2GCGA 2VYVA 5I7VA 4GHWA 1OH7A 3P9RA 3CEAA 1GAJA 5EE5B 4ENUA 1NDQA 4URHA 4PZUA 3ZR4B 3U4QA 1SXGA 4M0DA 1DGQA 2CK3A 4YDSA 4QRHA 3DULA 1DINA 2ZYVX 2AQKA 3MMZA 1Q2UA 3R5SA 1YKGA 1UQRA 5C8YB 1XZQA 3U3RA 3TW8B 3HJFA 3FNBA 3OZTA 3IQWA 3L8FA 1WHTA 3GNSA 3H1TA 2C5AA 2OHOA 3UXMA 5HRAA 4LF9B 1TK3A 1N2XA 4YY3B 1OFGA 1UK9A 3L8MA 4KYUA 3KHKA 1WDLA 1YQTA 5C1IA 1MH1A 2QUKA 4TMXA 2EZUA 3AUSA 1X1AA 2QVBA 3V7NA 3AJDA 3G85A 2W6NA 4HWRA 5IAEA 8GPBA 4AYWA 2P3OA 2G40A 1N9GA 4DLYA 1IUOA 3QXXA 4LRWA 4WEOA 4WZ6A 4IJQA 5KNBD 2I5PO 1GTL1 2BH9A 3H2BA 5DP2A 4F0JA 4GI7A 3ODGA 2FN3A 1BD4A 2EHDA 3KE9A 4QFMA 1TK2A 1Z07A 4FHZA 1YDHA 2XYQA 1Q1QA 1Z39A 4LF5B 5LVAA 1GZUA 3KHUA 3ZS8A 2Q6VA 1NI4B 1YJXA 3K0FB 5EPUA 4G23A 1SIBE 5T4HA 3V34A 2IPMA 1OQAA 2V7QA 4HO1X 1L5KA 2G1AA 1LQ2A 2FTKE 1OI2A 5B6PA 2CFRA 4G4JA 1DO2A 4YRQA 1FY2A 2BM9A 2P8JA 3ZHYA 1DEKA 4R71A 4ZOCA 1PJAA 5IWAB 4XIFA 4RMGA 2JGMA 2B8EA 1G6OA 3W8RA 5CEFA 3IQZA 3S7ZA 2VJOA 1NBME 4HWGA 4DYVA 2QD1A 3DFMA 2QNBA 4AF7A 2AH5A 5DM70 4GWKA 4QICA 3PI6A 1UMDA 4UE6A 4URVR 2W83A 1I5RA 5EZQA 2JFFA 2F3RA 2PGXA 1M6YA 1XEXB 2XH8A 2YV3A 3HNOA 3IAS1 3RSSA 4EKNB 3K71B 4DV3B 1GXSB 4LWPA 3DPSA 5G4LA 3ZJ4A 2IGBA 1C4WA 1Q7TA 4AMVA 3CQ9A 1LS6A 1NR5A 4RC9A 2NYRA 3B85A 1SKBA 1UFQA 2QA5A 3FNIA 2XUOA 3IUSA 4UU7A 4HNVA 1UBOS 4HI0E 4KLZA 3AGPA 4X66B 5KYXA 3D81A 1Q91A 4J1NA 4JX8A 2I6QA 2NPIA 3EW9A 2H1LA 4C6HA 2IPNA 5AVJA 1WCIB 1XZPA 2FOLA 5CD1A 2VP2A 2WPDA 3DDHA 2J7KA 3M7IA 2HFJA 5K0GA 4KN6A 3WOVA 3RADC 1KXJA 1IB0A 1WQ1R 4N8EA 1R8QA 3K9HA 2FDRA 3LKZA 3PP8A 1T6BY 4RHCA 3W0LB 4A6XA 4RU1A 1OI4A 1P61B 1VCOA 4L4SA 1XD2A 3TOSA 5HBRA 3W5HA 2A57A 1F3LA 1NQAO 4LQLA 4DT1A 2NM0A 5EP3A 3HKEB 3R8FA 2J6BA 2Q9UA 2QV7A 3ENKA 2ISQA 1ISMA 2R6HA 1DUVG 3L8EA 3NBYC 4TL8A 5MN4A 1OUMA 4L50A 3T5TA 4BBAA 2R8OA 3AINA 5IG2A 5THXA 4R5MA 3AR5A 3VUEA 3WNQA 3RWMB 5DZSA 2NMVA 1GPNA 2HK9A 1LV7A 1VPDA 5K99A 5KQRA 3IOCA 1Z5WA 3S70A 3T7JA 3UMFA 2OB2A 3KLNA 3MK31 4P1ZA 1USWA 4YPFA 3MS2A 1K89A 5L45A 4DIKA 4N8DA 5K0SA 4OBXA 2PLNA 1RI3A 3EVZA 3KO8A 4L27A 4MQ6A 3SEQA 1UDCA 2CMGA 4UDXX 2EBUA 2GZ3A 3RBAA 4CYMA 2V7VA 2C7QA 4NARA 3KKOA 4BO1A 1MN6A 3DG9A 4PYKA 4V3CA 2DBYA 3IE2A 5EJ2A 2XEXA 1E2FA 1BXZA 2WINI 3IT0A 1V1JA 4EUNA 5CVTA 5IK2D 2H9YA 1BO6A 4O4HA 4MYHA 5CJPA 1E3QA 1G55A 3L0DA 3LC7O 4B9AA 1P4RA 4YQFA 3K5WA 2FZCA 4Q3DA 4K1XA 3DTNA 3R20A 1AKRA 2HN9A 2YY7A 2FZ4A 3L06A 3VYRB 1M7GA 2Q5HA 4DV7B 2AR0A 2Z43A 4EHIA 2W42A 1O6BA 3BJZA 4RKQA 2GJKA 4ROSA 4XYLA 2E4XA 3FWPA 1U2QA 2C97A 2VVTA 1G0NA 5DGDA 2VBFA 4K0KB 4GSLA 2GCEA 2J5KA 1Q0ZA 2XXAB 1II9A 3H13A 3VR1A 3NBAA 2AFRA 2A7QA 2HNBA 1KI4A 4KXQA 1W59A 1YVRA 1GAEO 5CFMA 3ICEA 2AG1A 1HC7A 3RG2A 3CU5A 1LUAA 5GM2A 2ACWA 5D1NA 2CVOA 3NAMA 3DEZA 4N0PA 3VR5A 4MQUA 4BQOA 4P98A 3DV9A 3JVUA 4C43A 2AQ8A 5IVKA 5BSVA 3ZDBA 1ZD3A 1JHQA 3O8OA 4IS2A 4FN4A 4OKNA 3VHRA 4BS9A 5CA0B 2FK7A 1KDZA 1WZNA 4F5YA 2B8TA 3E9ZA 4CM4B 4Q7MB 1RFGE 4LX8A 1YF3A 3QF4B 1MGPA 3H17A 2WBLC 1PL7A 1C3OA 2ZE8A 1NT4A 2FSVC 4G4SO 4P8RA 4PX9A 3M3DA 1A7UA 4MV3A 3IO5A 1U2DC 5HQTA 3OAAD 4LXQA 2Q46A 1HWYA 2JVJA 1L0BA 1R0RE 3GEPA 3LPLA 3ENVA 4MKGA 4PTZA 5JXHA 4XJVA 1AA6A 2M6LA 5A4DA 2WSBA 2PH3A 3I4CA 1N2CE 1UPBA 2JLBA 5IABA 4M8NE 4BMYA 2OZKA 4IUDS 4JQZA 3WB1A 4TMWA 3DOOA 3UT5A 1CJCA 2XF2A 2I91A 4AK9A 4I1OA 5LYJF 1L7OA 1N5OX 1NSYA 1GUBA 1K3UB 2M1ZA 5HW0A 4DV2B 4MWGA 4O2BF 3BQNB 4LZAA 2MINB 4E11A 2QTAA 2PGLA 5ALGA 4UZEA 2QSYA 3VR4D 2A1UB 3CX4A 3PVSA 3G2OA 3O84A 3CMMA 5MGBA 4I3FA 1FZQA 4KWEA 4TQ9A 2WSSD 4RSMA 4UVGA 4CMGA 4X7RA 1NI3A 4E21A 4FC7A 1UZUA 1UMCB 3T06B 4I7EA 5KOIA 3VAYA 3TD9A 2QHXA 2IYAA 5TS2A 1RI1A 1NBAA 4PLFA 4WK4B 3QUSA 3BWBA 5JWHA 3CLUC 3WLFA 1YDGA 3FI9A 3OPYI 5KQSA 3ZLJA 1XZAA 3EDRA 4BKUA 4D9JA 4EY6A 1EQ2A 3EZNA 1KGDA 1A8IA 4FHEA 1GNPA 2BI7A 4MK4A 1QCZA 2XDQA 3CZRA 3DBVO 5IXSA 2D7DA 3JQGB 1AMOA 4IXWA 1Z6AA 2RGWA 4CDRA 1WU7A 1LVUA 1SUSA 2XOKD 1JLLA 1WUTA 4PCVA 5A06A 1VI6A 4MCHA 4I1YA 4M53A 1ZHHA 2D62A 4OXQA 1LGYA 5LZ7A 3ZZ0A 4EZEA 5BYAA 5C1BA 3AL2A 4UUPA 4K6HA 5FOVA 1O54A 4MPDA 3RUHA 5J3JA 2X6RA 4G0OA 2O8BB 1JEAA 3FYSA 2PL3A 2XB6A 3AFMA 1WQ4A 1U7HA 2FU5C 3FDJA 4LX0A 4WOPA 2GDJA 3MTAA 4D97A 2A78A 3UXEA 1UAAA 4G89A 5B57C 5I4CA 1M1NB 4Q7KA 2W6PA 3C3YA 2CZCA 2PTGA 3LDFA 2JCGA 5D1HA 4C9BA 5B55A 5IDQA 5JAIA 1ZUD1 4F92B 2FSHA 3WHKA 4WESB 4EY7A 2TSYB 1L4GA 2B94A 1ZIPA 2G9QA 3I9FA 3LPMA 5ALFA 3WLEA 3T7IA 3SS9X 1BWQA 3K4QA 4NCHA 1D03A 1IHUA 2OGSA 3A2LA 3GEDA 1X15A 4PO8A 2PT5A 1VA4A 5I48A 2VN8A 3WFZA 1TD1A 5EQTA 1R8JA 3A1DA 3EXHB 3VKWA 1CK4A 3D6HA 3R3HA 2ORWA 4I4TA 4L1KA 5ALKA 3VX3A 1K7SN 2FFHA 2D13A 1SBTA 1BRMA 3NMUF 2VPQA 3HXMA 4TMZA 3TEMA 5H4GA 4V3BA 1MFPA 3IVXA 2FGJA 1JIUA 1VRCA 2ERYA 2KWIA 2A88A 1W581 2J85A 2OO7A 3AF5A 3K9WA 4RD0A 2DFVA 2YXDA 2F9MA 2NU9A 3FYUC 3NFYA 1GCUA 1PQ4A 1YL5A 2MCFA 1T1IA 2WIBA 4UPVA 4EGSA 4MS1B 4X1IB 1RLIA 5JRZA 1RYDA 2HCJB 3ZTWA 2Q21A 1OV6A 1FTSA 3P7MA 3HCOA 2C1EA 1YDWA 4YJ3B 5CYOA 3IP5A 1XJWA 1FTWA 1I2DA 2BZ1A 1XVUA 3EDCA 3P9CA 2RD2A 1AIPA 4GS5A 4P34A 4WE3A 2JIRA 1CRPA 1ZM3A 5JLJA 3QOXA 2Y77A 3GN1A 2ZCJA 3YASA 2IS4A 2QUIA 4YI3A 3PQ6A 2QRJA 1RQXA 3PBKA 1JN0A 1EAMA 3K09A 4URWR 1J20A 2VAPA 3WKCA 5ILQA 1VHLA 3ETGA 1ZEJA 3E9RA 1EX7A 5AH0A 2B69A 3D7NA 3W9UA 4UBJA 3UM9A 1XFAA 3D1JA 4YP7A 3HVJA 4U7FA 4ZAZA 4BLSA 4JVLA 1MRNA 3L49A 2OD9A 4FFOA 3SXJA 2OM6A 1KPGA 4C0WA 1YIDA 2KHZA 3ASZA 3B1JA 3I45A 4UQOA 1CKEA 3HBLA 3JQ9A 5FNVF 1CQJA 4E09A 3JS5A 1WD5A 1BE8A 2WAXA 5LYJB 1HT0A 2YJNA 3U56A 1FFXB 2OV8A 3DYBA 5B6JA 3TUZC 3DBRA 5FBKA 2BEWA 1GU0A 3GA7A 4HEHA 1A9XB 1KVUA 3PD1A 5DLQC 3HM2A 3BE8A 3VVLA 4H3SA 1TEZA 2FR8C 2G17A 1QV6A 2B21A 3DBHB 4FS8A 3P0EA 1IWBB 1JJ7A 1WMAA 1XFDA 1N3IA 2FN4A 2ZRQA 2ONKA 4I3GA 4GGPA 2OZLB 4AXXA 5A1JA 3IERA 3NG1A 1MOQA 4PLGA 1MCZA 3VI3B 1FNCA 2JH3A 1PBNA 1YIOA 2GYVA 2VIIA 1EXMA 3GJ8A 5GM1A 1QP4A 1E62A 2P90A 1PHRA 4NEGA 1E1CA 1XAGA 2C4NA 3P2KA 5ELXA 4O4JF 4MPRA 3DO5A 3IJ5A 3H5OA 1C8VB 5CT8A 3L82B 1UP7A 2XUHA 1AN0A 4LC9A 4AN1A 5KTYA 3NAGA 1UZNA 3MT0A 2LPMA 4KUHA 2QD4A 1CVRA 2FR1A 2R8YA 5EIOA 4CFSA 1WZCA 3O6VA 2OCDA 2WF6A 2IY9A 5LDDC 4S3MA 4ZO8A 3QVOA 4R1NA 2XCIA 4IFTA 4M0FA 3I61A 5KNLA 1F60A 5EIHA 1XXHB 3OFSA 1TJNA 2XUIA 3KVRA 2D7JA 5AI0A 1QFMA 1ZMBA 3EQ9A 4D9MA 4P33A 3EYWA 4ZOQI 2ZWAA 4ZZ0A 3S1AB 2CN1A 4NH4A 2X7XA 1FDIA 3L9XA 4JUAA 1CY6A 4P3PA 5EHGA 3A8TA 4CDMA 2DHDA 1NX9A 4Z99A 2OILA 3UOWA 2XIJA 1MJHA 1H1LB 3DLHA 1YE3A 1XE3A 2FPRA 2FEAA 2ZVDA 1SG0A 4DG8A 4B3MB 1R0ZA 4QJ3A 2NVBA 4EMBA 3H9JA 4PC6A 3NW9A 1KO1A 3UFXA 3H16A 1ZQ1A 3KTAA 4N6GA 4U8GA 3ZJYA 1Z26A 1QCCA 4MTCA 1OD6A 5F1KA 5TNXA 1QR6A 1E9AA 1T5IA 1IBKB 3JQFA 3ZD7A 1OKKD 1UDWA 5AW0A 4I19A 4KTVE 1IHPA 2H7YA 3R0QA 4LVCA 1F7UA 4MNTA 2YYYA 4XFKA 4CMEA 4XOIA 4B6OA 2VSNA 4FNAA 1FLDA 3M1YA 5LZ5A 5E6SB 1OLXB 3MS4A 3LQ4A 3SJAA 3TXYA 3BRWA 3WTBA 4AZVA 3VR6A 3P8ZA 4G4SP 5DXAA 4NJOA 4A0HA 3GLGA 4KPGA 1JG4A 1NBHA 2O0LA 3FZNA 4YJHB 1X1SA 1XO1A 3LY5A 4R2WA 5B58T 4JI4B 3CNNA 1E79D 3NHFA 2FWAA 1VMDA 3OECA 1ESNA 1VLQA 3CF4A 4RLHA 4UCQA 3U4CA 1RCUA 4YP9A 3WLTA 1YSCA 2FG5A 2FCAA 2DR0A 2Y1WA 4GVXA 3GT4A 3V4PB 5CTJA 3EVTA 3SAJA 3I04M 3QE9Y 3FJOA 4RK7A 4GOOD 4C0XA 3OLCX 2W48A 2EJTA 1A4XA 1Z2OX 3R0XA 1ZIOA 1WDWB 3B9PA 3W6UA 2H1FA 5F98A 4JV5B 4HNAA 4DWVA 1YR7A 3QLEA 3DDUA 1LEHA 2WD8A 2G1JA 2M9MA 4P83A 5CIWA 5SYMA 1II8B 5HIKA 3U16A 3AHGA 1P1IA 2XD9A 1LH0A 3VJLA 2F55A 4MKRA 4PLPA 3HJGA 2VH1A 2NO7A 3G8YA 3WMEA 3G79A 5D5PA 3LPNA 3HRHA 2Y71A 5L3VA 3DVRX 3T35A 2ZJFA 5ADUS 1E3WA 1Q1GA 4K3UA 5CTAA 3AUJB 4LI3X 4X90A 1IEWA 1EDDA 2O1EA 2QD2A 3FHCB 3V3TA 3T7AA 1YA6A 4HPWA 4YRMA 4WY5A 3NHBA 1DTEA 3PQ2A 1ZVVA 1RYBA 1KAHA 1BJKA 5J9FA 1T2DA 2PUTA 2O3SA 4C08A 4TYYA 3R41A 4NU6A 3FF1A 4JLAA 3BCSA 1IVYA 3ZDDA 2VUSA 1IQRA 1WSBA 4ZHSA 5CNIA 3UGTA 4HMQA 1P81A 2OESA 1MHTA 3U9TA 4DDWA 2O8CA 3O7MA 3IODA 1RZUA 4L5YA 2J87A 5FWYB 3DAHA 2ZI4A 2AFHA 3Q3JB 1RPAA 3TMAA 1E3MA 3A6EA 3AR4A 4RGYA 4CEJA 1WMSA 2DVMA 2C3YA 3OP1A 2CLCX 3STXA 4F6LA 4TYWA 5JR3A 4A0GA 1JHAA 3MG9A 1J00A 5IBPA 4B4DA 2FB9A 1JYEA 4CN9A 5CM8B 3RRNA 3JQ7B 5IT9A 2ICAA 3IQHX 4R41A 3R9KA 4N5HX 3TPZA 3CZ9A 3ZVMA 3IEMA 3V32A 1HDXA 1XXHA 4J6FA 5DTJA 4X7MA 2GFHA 4PWZA 1TQ8A 5A05A 1XA0A 2QRMA 4XE5A 3TLKA 1X7GA 4G0UA 5A4AA 2ZTMA 2QZSA 4XVHA 4G1BA 2WWGA 2B0JA 4KQFA 2Q4TA 1XF1A 4ZODA 1YBFA 3UK1A 3DAGA 4PSKA 3GUHA 2D8AA 2R1ZA 5JNSA 2R8PA 1E3SA 1OZHA 1YD7A 2D1QA 1F2DA 3HKDA 4IEEA 2PKYX 1LBSA 4QASA 3J7TA 2JCBA 1IMJA 3A6FA 2Y6VA 4MUGA 4JQYA 3STHA 3CSSA 1Z2NX 2UZ1B 1U3DA 5JDIA 5ALMA 2EJUA 2OGWA 4ZZ3A 4JWKA 3OCYA 1JKJA 2Q7DA 4RGVA 3LBHA 4G84A 5A03A 3ZDXB 5DBEX 4ESVA 3OZFA 4A8HA 3DNFA 5BPFA 3T4PA 1DT3A 2IUYA 4FSHA 2PS3A 2VAVA 2NYAA 3VHLB 5KOHB 3CB4A 3R3ZA 4MVJD 5JJIA 3EVCA 2XQVA 4IUCS 1U3FA 2VJKA 5AK6A 3VNVA 1FJGB 2C9MA 4J3FA 4N3CA 1ZCAA 2H5JA 1YMVA 4RD1A 3F96A 3M89A 1YR8A 3CUKA 3BRQA 4PXAA 4FDAA 3IUEA 2I7DA 4AXBA 2ZJ1A 4KKVA 5IF3A 2DETA 3TNLA 3FWHA 1WVIA 2GPWA 4AB1A 3CT4A 1XUOA 2FX2A 2Y1LA 1P72A 3R6LA 1JKFA 1U28C 5ALOA 1DIOB 2BEVB 5EZYF 1I7QB 3NDRA 4D5EA 2QQFA 1VQ1A 4Y6RA 1C3OB 3MYRA 3P2JA 3PDIA 1NJGA 4PZEA 3WAGA 2Q8QA 2GEVA 3KL4A 3WX0A 5HKKD 1OC4A 2N0SA 3OPVA 1P8JA 3OPMA 4HBGA 5KTKA 1R4MB 2EKLA 1HL3A 3A4NA 3C3JA 3ROEA 1UC5B 1I4OA 3FOFC 1B0ZA 4MRMB 3HADA 3NPAA 1HQKA 1F38A 3MOIA 3KZVA 3WA6A 2CLMB 2OK8A 4DDUA 4W7HA 4Y2RA 4CMKA 1PEKE 1VKOA 3KUUA 1G98A 1PP4A 1T3GA 2XKAA 3B38A 3K09C 3CEHA 4HN4B 5C1OA 3FLBA 3ZY4A 1HQDA 3UB3A 4OM7A 2OHFA 4TV8F 1T29A 5L9AA 2IEBA 2IS6A 1YQDA 1FJHA 3DHYA 4WBXC 4EG8A 3GHHA 1TPZA 3SG0A 1Y7IA 2EJWA 4K9NA 2H18A 2H1IA 4M37A 4WKCA 1ANKA 1KAQA 3TIIA 5CA1A 4LF4B 3H9BA 2BUCA 4HDSA 1T9CA 3Q7PA 1VPLA 4UU1A 2BAGA 1JEDA 5DM60 1KQGA 4M0CA 3HSKA 3RU3A 2WM8A 5AD1A 3MT8A 1S01A 3L7DA 4OP3A 3WK9A 1UJMA 4GPAA 3T7EA 4LPKA 4B47A 1UMBA 4BHTA 2JFZA 3RWBA 3COJA 4HGPA 3X1WA 1IY8A 5IS2A 2BM8A 4ON9A 4UDNA 1UH5A 4JA0A 2A7XA 3B1XA 1G18A 1XQXA 4YRNA 1IBLB 4L5BA 2JJ2A 4YRKA 4IIBA 1X6VA 2HUNA 2ID7A 1KQNA 5IJZA 5J4YA 5KTPA 4ZVNA 1QRTA 1H3EA 1TL7C 1Q3TA 1NN5A 2H1VA 2WTMA 2A5DA 3C41J 2FPGB 5E95A 1NE7A 5EPOA 1GPLA 3BWEA 5CX1B 3CURA 2R1UA 4MW2A 4PZ9A 1M1ZA 1T5SA 3VX4A 1U0NA 4O1IA 1LBEA 4U2FA 3UWMA 2E4VA 1CZNA 1LW7A 3ZEAA 4ZJYA 1U7XA 4U6QA 2HA3A 1P31A 5EIWA 2OORA 2OCYC 5HBGA 5AIAA 4DLUA 2X7HA 3GFVA 2CF5A 3BXXA 1WXWA 4C04A 2FW6A 2JIBA 2RHLA 4RTJA 4AF6A 2XBLA 2QMYA 3L7MA 2ZDHA 4JJKA 1J9GA 1PJTA 4IMIB 3BORA 2ZYSA 2LE0A 1UKBA 3N2EA 2JFYA 4E0BA 1LDBA 1R3UA 5LFAA 2WFAA 2IIPA 4ER0A 1XP5A 1WKCA 1AB6A 4JIGA 3CNLA 4ARSA 4H15A 4F4HA 2F3PA 3T52A 4ZK2A 4Y30A 4F38A 3BB3A 4YN3A 1RLJA 2PSEA 2DEUA 3HBAA 2MR6A 4MVJI 3AZPA 4EHNA 2HQ1A 3IEXA 4GX5A 4ENWA 1QGUA 3MOSA 1V9SA 5L8VA 1T3TA 3C39A 2XF8A 4XWWA 4HYQA 2G9VA 2AZTA 3EG9A 3TMYA 1KSGA 1L1EA 2ORVA 1P9RA 2QYOA 3LVRE 3HVIA 3HJTA 1Y9ZA 4X6LA 1DC6A 1JR3A 1KC1A 2ZIUB 1E20A 1HXHA 2YZNA 3NHMA 4Q15A 5DO9A 3VSCA 2JIZA 2WTXA 1N7HA 1OWLA 4JVMA 5JS7A 2QZ9A 4A23A 3RROA 1ISSA 1UC9A 1HDYA 3T3IA 3QXJA 1U0SY 1VP3A 2YICA 4S0XA 2ZRNA 3RSZA 3D0KA 4AQDA 2HZBA 4PBRA 1KYYA 2VZ0A 4KDFA 1DTWA 1XDDA 2H65A 2QE7A 1KYQA 3AJ8A 3BJMA 4BEJA 3ZQJA 5H9WA 1Y7PA 1ZW6A 4EDHA 1O97C 1T3LA 3IXQA 4IMPA 3WMGA 5BQOA 1ST2A 3PA8A 1F12A 5IYZF 4DCCA 4EB6A 5J4KA 4C21A 2HIGA 5LJIA 4B0PA 4TZTA 4MB0A 3B48A 3I0ZA 3IQFA 2Q7OE 4EMUA 3PUIA 4WXMA 4NHEA 1C2YA 4LJ7A 3ZD6A 1FLNA 4V0RA 4ENRA 4FBMA 2J09A 1AKVA 3G2PA 2FPOA 4KMSA 4CTJA 4MDHA 2CLEB 1K27A 1ZIXA 4ESOA 4ZHQA 2CJXA 2I67A 2VBGA 4JYPA 1C7QA 1CDEA 4LC0A 4GC9A 4NAVA 2QL7A 1IBSA 5DN6D 1KI6B 4ZDWA 1W4RA 1BEEA 2JK0A 2VBCA 4N39A 3QSGA 4U2BA 4YACA 5JXIA 1MIHA 2QTGA 1XLVA 1G3UA 5HK9A 4EW2A 1CYDA 1D2HA 1E2PA 3UGJA 4L8FA 3O26A 2PZLA 1XMQB 4QO7A 4HDOB 1CR6A 4CLXA 5ICFA 3T8YA 5FTWA 4WWHA 1VDMA 2E5FA 2Z2YA 4EATA 2UYHA 4DQVA 2Q4BA 4MV4A 3V33A 1D7OA 4LPSA 3HYSA 3QQ5A 4MLZA 3VPBA 2VR1A 3NDJA 4RDIA 3EEYA 4LXIA 1T2FA 3O3CA 3OKAA 1W88A 1H3NA 2P11A 4HP8A 3Q7IA 5KNDA 2OHXA 6REQB 2Q2NA 2B6HA 4QUEA 1W1IA 2TMDA 4CCAA 1JU9A 2E2WA 2ZSJA 3LY9A 4HRVA 4L9SA 3U62A 1LK5A 1NVWQ 2PFKA 2O57A 3H3JA 5ALNA 1VA5A 3HJNA 3K5PA 5FR1A 4HC4A 5MFPA 5T67A 3RHSA 4MR7A 4XIJA 2H4FA 1A5BB 2HJVA 2QLJA 1RIFA 3ESZA 3EFOA 4IHJA 1B00A 1GV1A 4R2HA 3AIIA 2KB0A 4LZPA 4FR5A 3BXGA 2XCSB 4FYJA 1IM5A 2LNDA 1I0IA 1OBVA 2EP5A 2V5VA 3WQHA 4G5GA 4BN0A 5JYDA 5EIBD 2VRBA 2Q5CA 2W6IA 3ESYA 3JQPA 4PSDA 2JGIA 2P5UA 4BNJA 5AVVA 1P1RA 4KK3A 1OFIA 3KAJA 5D87A 2ZVJA 3OM0A 1I7NA 1ECLA 4WD3A 1JWAB 2YC2C 2G80A 3RK4A 2G71A 3VQTA 2FR0A 1TYEB 1XP8A 5B58C 1EDEA 2CFTA 2FWRA 1FSGA 4JL5A 4G4GA 3IEUA 4JGBA 2CUZA 5JQGA 2WTNA 4QOSA 1C3EA 3JPYA 4R8LA 3N7TA 1TECE 1K6XA 1OFUX 1KJNA 2RH9B 2R48A 1IB6A 2OCBA 3F2IA 2BGMA 2OVFA 1R5NA 3ICCA 1GQRA 4GPD1 4HWPA 3AVVA 2ZBFA 3WGQA 5F77A 5GMOA 1L5RA 3B5IA 1DC8A 1AK9A 2R2AA 1G38A 3SVZA 1N75A 3QEKA 4NNPA 3BHNA 3VV3A 1F6WA 5GY7A 3L4BC 4TWAA 2ANBA 2H92A 2ZBVA 2GN4A 3I4FA 1C3XA 3M6LA 3R0IA 3LNTA 3P9NA 4MAFA 2JGFA 5G1OA 4XB2A 5AI4A 4AJEA 3SLRA 4X1KA 1EWRA 1B0PA 3UBMA 3R3YA 4DEVA 3EGEA 5E2BA 5CAEB 5M7EA 5KTRA 2NUPA 4O2RA 2H1WA 3CCFA 4V0OA 4GYKA 4DM4A 5CFOA 5C81A 1XVVA 2O2CA 1A88A 1AKWA 4UCWA 5DN9A 3O3MB 2Q4OA 4FQ8A 5CGQB 4KFSA 5BQ5A 1A8QA 3ZVNA 1RRCA 1NVGA 1ISRA 2ZZKA 4UEWA 2VTKA 1M1YB 1G8AA 3FR8A 4BBZA 3QV1A 3WL8A 3ZCSA 4MV6A 3NEJA 1HNWB 1J8MF 4NVRA 1CJVC 1Y1PA 2HLHA 4I9FA 1THGA 1BVRA 2YHBA 2YHIA 2OAQ1 2VYQA 3M1IA 4M9XA 1UJ5A 5BXYA 2VT2A 4GL4A 2F43A 2WWRA 2D59A 4D46A 1CVIA 3NM5A 5IHXA 3OU6A 1QVZA 4P32A 5JFOA 1GTVA 2D5BA 1ECFA 2J9FB 2HIAA 2V7GA 3LKBA 2D5AA 3E48A 4KIJA 4W5HA 2YDYA 1ULSA 3A27A 3GT3A 1UBNA 3VKGA 4NHOA 2IHJA 3T9AA 3G8CA 3RLFA 2DF8A 4DC9A 3ADDA 3KLMX 4JS0A 1JEJA 1P73A 4KHZA 3PWTA 4QT4A 2BKXA 2II6A 3DVLA 1SKUA 2H4XA 1YZFA 2Q2OA 1DJPA 1VM6A 3EDMA 3OY2A 4NBNA 2D06A 1PZMA 1QE3A 2O7RA 3EXEA 1XZGA 2Y99A 1EPUA 1JH9A 1WDKA 2PWYA 4P5DA 3T3EA 3O31A 2KBEA 5I9BA 5L4SA 2VH5R 4MWBA 3OLVA 4C3ZA 4TL6A 2FG6C 3VU9A 2Q6KA 2J41A 4G5XA 1FDTA 4ZOLF 1KEUA 2V7BA 5SICE 4OFWA 1KEWA 1L7AA 4DDMA 3T5DA 3IHWA 4LXHA 3LT5A 4OP1A 4QPDA 4NCIA 1E99A 4G9BA 4Q4HA 1Z0SA 5EJ5A 1OW3B 3MWEB 1AQ6A 4AYTA 4MOWA 5LOVF 4RDHA 2V7TA 3BH0A 3LWZA 4Q19A 1EMDA 4A4DA 1YL6A 4YJ2A 1UM9A 3RUAA 2HNAA 1GZ4A 4Y6QA 1RYZA 1QO7A 1D7AA 4MI1A 4TN1A 1JVBA 3QOWA 2AXPA 1H2EA 1QOPB 4M9SA 2W70A 4ZI2A 2BGLA 2O1WA 3L9WA 3RSQA 4XWOA 1CY0A 1NP3A 1IXZA 1FRQA 2GRUA 3DEKA 3LQ2A 2ZYTX 1EFTA 1RCFA 4MUAA 5J23A 1ZU5A 4D81A 1T4MA 3M6WA 1CQJB 4IBOA 4FLFA 4JC8A 1K06A 2QRKA 3LL4A 3EMVA 4QWWA 5CB4F 1JDUA 4M54A 4O2BB 1M33A 4FZVA 2ORIA 3ZCXA 2CNOA 5ITZB 1KMIY 5KYWB 5LPNA 1JFSA 3FE2A 1CWUA 1KZ4A 4DV0B 1Z4KA 3W9BA 1A9XA 3BE4A 5U4QA 1IBMB 4FLMA 4GBGA 3QFTA 5B1IA 3G23A 2EX4A 3WNBA 1N3LA 4Y6LA 3V4ZA 2C31A 4HLQB 5FOWA 3DFIA 2VNJA 4AJLA 4PQEA 5F4BA 2P79A 1IZYA 1V1RA 1O2DA 2QX6A 3AY6A 3ORRA 1ORRA 5G53C 4PLWA 3CVJA 1EFUA 3AMVA 3R77A 1NL3A 2VQ6A 4MUEA 1D09A 2DYKA 3HUDA 2AKAB 4RGBA 4LTMA 1FVHA 2AEFA 4KACA 1EA5A 3SD7A 4GLFA 1PJBA 2PXXA 2X5OA 5H3LA 1DWPA 2HMSA 2GYUA 2KJQA 2VJYA 4LV6A 1OJLA 2PKQO 3HU5A 3T1QA 4IDPA 3L7KA 4JLVA 4ILEA 3WIEA 4ABTA 1KR2A 1R9MA 4PO1A 2XJ4A 5A71A 1RADA 3V8NA 4LZWA 1ENOA 2WMYA 3ANLA 5KOJB 2H9IA 4TXJA 4CR8A 3SLKA 2Y67A 3TJMA 3BM5A 4KE8A 1HLFA 1NN3A 1XEWY 3M82A 4H4DA 1B7GO 1SU4A 4PLTA 4TM8A 4JBNA 5AWFC 4AKEA 2ZLBA 3L0OA 4OEHA 3MTQA 1IJKA 1EXDA 4RETA 4QM6A 4K8OA 1KO4A 3NAZA 1DRVA 1CE8B 3BWCA 3L77A 4FEGA 4OK5A 3PFIA 4OLFA 4ZCQA 2B4AA 1Z4JA 1KZ1A 3MWLA 2A9KA 3IIJA 3MGCA 4D0SA 5LWQA 2PMBA 4YYEA 1RXVA 3LQRA 4TT8A 1JKJB 1FEZA 1DSSG 3LUFA 2GN6A 4HEQA 4FYHA 3EHDA 4XLLA 1MB0A 2XE8A 4URYR 1R64A 2BISA 1NBIA 4IHKA 5EKXA 1PFUA 1SCQA 1M2OA 2C4MA 3WNDA 4QGAA 3ZNQA 3HI6A 4CIXA 3BGIA 1PFYA 5EE0A 2XCRB 1TCUA 2RJNA 4IIYA 1Z0KA 1XTJA 3HB7A 3K9BA 3M9WA 4K6KA 1X7XA 4U7HA 4Q4CA 4ZJUA 2I2BA 2LCIA 3Q8WA 4O2AA 3X1KA 1NYQA 1WZEA 1NKSA 1Z4PX 1AKYA 1BZYA 4IOMA 3V8VA 4B3HA 1DCFA 4DXDA 2VP4A 5BRNA 5A4FS 1TADA 2RHGB 2OPBA 2X0RA 3DZ8A 3GHYA 3ZXXA 3EA5A 4GX2A 4N48A 1CEYA 4F4JA 1QRSA 1ENPA 1VSVA 3LUCA 3ILVA 2I22A 5IDXA 4HUQB 3TLJA 5JCOC 3H9EO 3OOSA 1BMQA 1D4ZA 2I3DA 3AC0A 4AULA 3N6VA 3C8UA 4FYMA 2PUBA 1SK9A 3HCDA 5KVCA 5I8PA 5D3MA 3U1TA 1NI5A 1ORDA 1U6KA 2WZDA 2EQAA 3O0DA 3O2QB 4FD3A 4HQKA 4ARBA 3TG8A 1EFLA 3EULA 3P94A 4ZRMA 4AS3A 4KR9A 2NLOA 1JMKC 2O0MA 1MQSA 1S8AA 2IYQA 4RV4A 2OGUA 2EG9A 4S1OA 5DBGA 4CQMB 1FFYA 4DF3A 1FFCA 1LBTA 2Z4RA 3FPSA 1OFUA 3FI0A 3ZK7A 1KJ8A 2FNAA 1BE6A 3BAZA 4H3KB 1T43A 2QUZA 5HDQA 1QHYA 3QEBZ 3H5WA 2W00A 4MUYA 1DEAA 2EJVA 4TOIA 2I7TA 1HK7A 1HTTA 1W9MA 3AZOA 3MQFA 3WOHA 5HS4A 1AOXA 5TMBA 4CW7A 3KXPA 4F93B 2GWHA 3A25A 1UEJA 1C14A 2ILVA 4OHUA 3KQUA 1CUFA 4IJ5A 4C0SA 1QWOA 2A1UA 2IV2X 1MD9A 3SXPA 2NACA 2JIZD 4M6WA 1Q0QA 2GTPA 2KYRA 4V24A 2BE7A 4Q3AA 2VSXA 4A0SA 2V1UA 1E8MA 3BS4A 5KWEA 1DAPA 3W2FA 2O8CB 3GOQA 4G01B 4NATA 2ZJ5A 1LI4A 4EEXA 4IUBS 4DLSA 5BNZA 3HUUA 4RAQA 5G0UA 5CLJA 3BA1A 1TTQB 4RENA 5ECYA 5IH3A 1L5GB 2QVCA 4YP5A 4NE7A 2QU8A 2ZE6A 3Q5GA 1MX3A 1CS4C 1ETHA 1MU0A 2FUG6 2G25A 3DHWC 4EG7A 3IE1A 1VG1A 4U00A 1B2RA 4GKKB 4YT8A 4KOAA 1NBWB 2JJ1A 3D6MA 3G9QA 5AM5A 3ZV3A 1SGWA 3RRJA 1Q17A 4G37A 4MCAA 4C4XA 4D99A 3D3WA 3GZ4A 4LZNA 1V4NA 4WUTA 1PZNA 3ODPA 3L4BA 3OJLA 2EQBA 3DVAB 5AESA 1F2UA 1RI4A 2IL1A 3D2LA 3BZWA 3LX5A 5DEIA 4F4IA 1SVLA 2ENUA 3BWXA 1UOPA 2JGNA 3KT6A 3ONNA 4MV7A 2OE2A 4K28A 3IDAA 3Q3VA 4IHAA 1Z8NA 3DKVA 1TA9A 3OEWA 4L28A 3TSCA 4BY9E 5DHFA 1F5SA 2AFIB 2FK8A 1YOVB 2FOIA 1EGMB 2PMFA 3ZHBA 3D02A 3NTLA 2M6KA 2H1OA 5ANRB 1W5TA 3AEKA 2A9RA 4ZQFA 2JAXA 1JSCA 4LDRA 5HGXA 1TAHA 2JI8A 1JAIA 2W2QA 2XZPA 2JAWA 2AK2A 2YHAA 3KSBC 4QPNA 4ACBA 1T4CA 2P5SA 5JSHA 3WGKA 4CPDA 1N6OA 3RKSA 1SR8A 3RKRA 2C7VA 3MTJA 2MSLA 2GARA 4BO8A 2G8NA 1N2CA 4OQFA 1BMTA 1CS0B 3OZUA 3PF9A 2XAAA 5F5XA 2CF6A 1KKLA 1MW9X 3OQBA 1KFCB 4ENQA 2AOUB 1Z0UA 2C5BA 4Q5IA 1SVUA 1Z22A 3JQFC 3LLMA 2QYSA 5ES3A 2V0CA 2EP8A 3H5VA 3PLAE 2NXWA 1US8B 3QG5A 2V4MA 4YBZA 4AUEA 4EMSA 3T1HB 3JZDA 1A8UA 3GNLA 3I6MA 4J7XA 5JH7F 1YQWA 3G6KA 4JNCA 1ZD9A 1YRYE 3PXGA 3OOEA 5TPWB 3EXG2 2EL9A 4DL9A 4LJYA 3IKTA 4PCUA 1IUNA 2WV9A 2GYYA 3A06A 4P38A 3UTCA 1C9YA 3DLIA 3QLUC 3VYSB 3OT5A 3PWSA 3DPIA 3LUHA 3PITA 4G1CA 4V1CA 2J5BA 4GMXA 4E15A 2I6SA 4BKPA 3AB3A 2I8AA 5AUQA 5FWYA 3FTQA 4UU0A 1P74A 3I1JA 2QMQA 3SHQA 1OI7A 1Y37A 4FZ5A 2I2XB 2SCUB 3N8DA 4YRDA 2FPLA 2IF0A 3R2JA 4G2TA 1L5LA 4C30A 4OV6B 2O7VA 1M1UA 1SKAA 1YQXA 2HRDA 2VP5A 3JTEA 4FGWA 4KXYA 4U1RA 4BWFB 4EPRA 7YASA 2EATA 3PYMA 2EW1A 2WFZA 5BW6B 5DTIA 3FCOA 1JE0A 3SZMA 4KWCA 4DTCA 1K5DA 2HZ7A 4UD2A 3NUQA 3IPAA 5DYGA 1X92A 3X1JA 3DE0X 4TRJA 5LBIA 1YRWA 3PQ5A 4JKOA 1FTQA 3WGUA 4FKZA 4DLWA 4NJMA 4FTWA 2AN4A 3AP2A 1OPRA 3HL4A 1GDHA 5KWIA 2J67A 3MAAC 4DUPA 2ADMA 1AMUA 4WVLA 1R9GA 4NOMA 2E4AA 1T6XA 3TRIA 5EIEA 5BYJA 1AXEA 3OCZA 3B3JA 3DLPX 3K1AB 2PSJA 3FPKA 3O2SB 2XCOA 5EKUA 1CR2A 5FD8A 3WWCA 4EZBA 2IZ0A 2SICE 2GZAA 1WPXA 3ESBA 3I6YA 3DOJA 3LQYA 5CGZA 3HFJA 1WHSB 3ENNA 1KQFA 2O9JA 5JS2A 4DR5B 3OLWA 4W7IA 3R6WA 5E1BA 1V3UA 4KRFA 5L7WA 3MIZA 3QA9A 3N2ZB 3ZOKA 3H5TA 3A6GA 4QODA 1B74A 3JQ6A 5IAAA 3SS7X 1U7OA 3CVXA 1E5VA 3KOZA 4RF5A 2WDPA 2FCRA 4YALA 1DX4A 1TT5A 1I1NA 2WTAA 3VU1A 3DS8A 7MHTA 3IHKA 3K53A 4YXWD 1A8HA 2JL1A 4EY5A 2IXTA 2ZUVA 4HMPA 5B1SA 3UAGA 3LU1A 2WZCA 3R5HA 1DDIA 3MNFA 4JJ6A 2PIAA 2YWDA 4WFIA 1SQGA 1Z36A 1SQ0A 3IQDB 3ZWMA 4YP0A 3TTSA 1QIFA 1JSXA 4GXQA 4XQGA 4FGSA 1JDPA 2ZWVA 2PZEA 3SKVA 4F9GA 4AP6A 3ES9A 3P9SA 2GBPA 5UKDA 2Y6UA 4JDPA 4L74A 3GLFA 2XRZA 5JFGA 2QLFA 2V7PA 1VMIA 5JPCA 2PD4A 4GOXA 2CY0A 2IPLA 2ZWOA 3B7PA 2W43A 2IW1A 2XQJA 3EAQA 1D1QA 4YB8A 5FJIA 3E53A 1UXGA 5GONF 3KKKA 4Z0HO 2BC9A 3OHPA 5IVIA 3N2IA 4DLZA 2K2WA 3V48A 3AXSA 2EVWX 3OE5A 3R6DA 4JI8B 1L8OA 1DJMA 2RHBA 1E6UA 2HBYA 2V54A 1XZBA 4H4EA 1EB8A 3AESA 1G4UR 1E2QA 1T13A 4ME6A 4FFLA 4NKRA 3TQTA 3TOZA 1A27A 2WFLB 3F47A 3CKYA 4Y2JA 3OEHA 5FNZA 1YK0A 1N9GB 3ZWXA 2O1SA 4EARA 3K30A 1JIKA 3OZDA 2VSYA 1KEPA 1VJDA 5ERGB 1UPFA 3AHIA 1CIVA 2DBZA 2Z8ZA 2G3YA 3C98A 3L8GA 5GTDA 2RJOA 1IATA 1HOXA 1PJCA 4BJ3A 3L6RA 1AUQA 2P0YA 1NVMB 4KRXA 4RIIA 5JAPA 3IURA 1X86B 4X8MA 4YJ2F 3UXHA 2R7NA 3PHGA 5L3RA 4WV3A 4HNRA 1XK7A 1U8AA 3ZWDA 3GJ7A 3E9DA 2FMXA 2CKDA 3ACCA 2B4YA 1Z18A 2B0CA 3KKNA 5DGXA 1CPYA 1D2GA 3I5AA 1NATA 2C3MA 2O8VA 1I2MA 1JXOA 2BHSA 4X71A 5CLGA 3DWEX 3ZE1B 4F91B 3DTYA 1CQXA 1GAQA 2HEGA 4TVBA 1IN1A 4O4IB 2GJAA 4GMGA 1OPXA 3L3BA 5KKCA 1SCBA 5JSZA 1OKKA 2Y2VA 1PFVA 1QHGA 4ND4A 1CQZA 1XIVA 4EJSA 1IHOA 1N5DA 4YHHB 4JXXA 1NDUA 3EFHA 3UAYA 2O2ZA 3GDOA 2D1FA 3HC7A 3F71A 3JYQA 3RWOA 4MDEA 5H9VA 1O7JA 3KQYA 2VXBA 1LWOA 1FCJA 4IJ6A 4C4YA 1T0UA 1X8XA 5LZ8A 2FKAA 3NYWA 2C9ZA 2CMHA 5KBYA 4FB5A 4IP0A 1JFLA 3GRCA 5DBOA 4JLMA 1OYOA 2XWSA 1YB5A 3T5AA 3WGIA 5SYNA 4M38A 5HDBB 2HRCA 2ET6A 3GGPA 5ILGA 3M4XA 3L0YA 4XTCS 5GAJA 4F11A 1ZJWA 2ZB4A 1SBYA 4H1VA 3CW2A 2MMGA 2IP2A 1SIOA 1STOA 2GKSA 4YUWA 1IDN1 1M83A 1FDUA 3FUCA 4OYLA 1R4NB 4ZT2A 1WV1A 2PV7A 3KBBA 4LWOA 1A4IA 1HYBA 2G06A 2CFCA 1O4VA 4R31A 2NU9B 4MA0A 5IU6A 1NRXA 7AT1A 1E7QA 3FMGA 2IUFA 1QXSA 1ZW1A 2WMNB 3FFAA 4LA4A 3UQZA 4CM4A 1X1EA 4LI0A 5F35A 1FFDA 3MLAA 1DKNA 1I3OA 5DRYA 1T9BA 3D59A 2N9UA 2V3CC 4QUGA 4PYNA 4PQGA 3IAS6 5FO1A 5A9SB 3Q2KA 2PN1A 4KQ1A 3QTBA 3FN4A 4G5RA 2Q0XA 3HZZA 2QTMA 3BRSA 3GIWA 3THXA 2O7NA 4F7WA 3SJCA 4L2IA 3M9XA 1QIMA 3EGXA 2XCLA 1I1OA 2NADA 4L0QA 3TR5A 3AK4A 2FZLA 3JSXA 3NC0C 2ZJYA 1ZC4A 4FFBB 3SYLA 3EFOB 4IHJB 4BLOA 2ZW9A 1BH2A 4QUJA 2X4GA 4CWAA 3V4VB 5JNRA 3JZAA 1UOOA 1XA4A 5AXCA 2YV4A 5TSDA 5KSZA 2AZDA 1DI0A 2P9BA 2J3MA 4BKMA 1KPHA 2BTOA 3MRSA 2QTTA 2Z2XA 4I9HA 4EH1A 4EJ0A 2YR0A 1GADO 4JCCA 3U3MA 3BFVA 1REQB 4A0FA 1MFZA 4J43A 4EGJA 5ERXA 4BO9A 2LR0A 2YIVX 4EHKA 4MKXA 3RVJA 2XMDA 3GLQA 1K88A 4J6EA 4N54A 1FNBA 5FNVB 4BNDA 4CTMA 1A76A 1ABBA 2DB3A 2X9GA 2F1IA 3D3JA 4ENVA 2FPPA 1DCKA 2UZ1A 3E8XA 3IEKA 4DS3A 3AILA 5CMLA 5HK8A 1R0LA 5ITZA 2MTBA 4H17A 4G86A 4LOJA 2CXNA 4E5MA 4YAKA 3AX6A 3ORHA 5KHOC 2WTUA 1NFFA 3IVAA 4HQLA 1G8FA 1ULZA 2AD5A 3BAFA 4CF5A 1BXGA 3ITKA 4S1PA 5TS3A 1NC3A 1NVAA 3EXHA 4L8VA 3WLSA 3WWZA 2V7EA 4B6GA 2O8EA 3L7AA 5LXTF 1MXFA 2F2TA 4EFLA 2P2LA 3IDZA 5LP6A 3K70B 1RKVA 2PBRA 2WT9A 3C8MA 4NBWA 2WABA 3G7SA 3R3VA 4Q18A 5BOSB 5IJWA 3AERA 2OV1A 3FTNA 4FMCF 2FSGA 1E2IA 3EDOA 3M8KA 4X97A 2DULA 3AF4A 3ET5A 1L9XA 2PVCA 1BHJA 4O33A 4IFBA 3UWOA 3UYLA 1LB1B 4O1MA 4J76A 5EIAA 1OWPA 1ADBA 4FE4A 2WOOA 4J07A 4EG0A 4DNXA 2EGHA 3C3PA 4AG5A 4BJHB 2H2HA 2XB2A 5I7WA 3L6BA 4ZT6A 1WCIA 2GFIA 3JWHA 3MUEA 3F3MA 2VDMB 4PC1A 2AQHA 4Y2VA 5J2UB 4LDZA 5TPZA 1ZHOA 1II8A 4WW0A 1YB7A 1NQVA 2PY6A 2REBA 2VCEA 1T6YA 3KSMA 1GRVA 1URPA 1Z47A 4P4UA 1ODTC 3CZMA 3UJDA 3L7JA 5D00A 3M81A 4INJA 5ECGC 5H70A 4XCVA 1J09A 1YZQA 1E3WB 1EDZA 1Z6QA 2PMCA 3OQIB 1F8XA 4F5DA 3E05A 2R5WA 1YR3A 3KL2A 4L8WB 4LC1A 4MW1A 4MGEA 4WGFA 2IXGA 2PL5A 3E5MA 2PR7A 1QDEA 3IDQA 3OT1B 5ALYA 5PNTA 4CKCA 1IOWA 1BJTA 1QBGA 2EFEB 2OQRA 3PGA1 1DMSA 1IMOA 3E7DA 3U9SA 5I9SA 2H31A 5I51A 1L8XA 4IXDA 3O21A 1L5VA 3Q87B 1YHNA 3WICA 2VUUA 1CYEA 3LUKA 4OBBA 2WA1A 3CBGA 1QKKA 2I76A 4EFNA 2QM3A 1T3ZA 3I8OA 4WNYA 3UVEA 2XXAA 4A8JB 5HHTA 1IRIA 4G97A 4HEA6 3VI4B 1L6RA 3DJFA 1XQ9A 1V25A 2R1TB 2QT0A 4JHLA 1H2RS 2EBFX 3PQ3A 3QWIA 2FKNA 3VOTA 5ADHA 5JAOA 3B7GA 4UAVA 3WSTA 4DSNA 4H27A 4PM4A 1HO3A 4WBNA 3DZJA 3EXIB 3JQAA 4K87A 3S44A 2H6EA 2VAWA 2PGNA 1JWBB 1ZJZA 3EEBA 4GP9A 4Q3BA 4Z2YA 4BTVA 1GU1A 2GPJA 1YOBA 4MVYA 3SI7A 2C2OA 3O9VA 4EB6B 2BBTA 1VLVA 5EVJA 3O74A 3OURA 3G0DA 5DLDA 1W0KA 1QORA 4X45A 3RUCA 3OWHA 3GWZA 1G6KA 3MF4A 3ONDA 5AM4A 5IAJA 5K0ZA 5CB8A 2BDEA 1N36B 1OH5A 1FSPA 3ABRB 2H0AA 5FOUA 4DCMA 4KU4A 4BMNA 1O97D 4UEQA 3GV0A 4QFDA 1ARZA 1O4WA 1YR6A 2H16A 3O47A 3RS7A 3CBQA 1XCMA 2WNIA 2FDCA 5I3ZA 1B15A 3D4PA 4JQOA 4DZRA 5EIXA 5I01A 3GH1A 4J0EA 2XZDA 1Z4OA 2QQ0A 2FPPB 2VRCD 4Z5XA 1VIVA 5EXSA 5JH7A 4R7TA 2C03A 2PRJA 3H6KA 1T36A 3PNBA 2DERA 4WKBA 1WAMA 2K7FA 3HI4A 3KJNA 1W7AA 3PC8A 2GXAA 2C96A 3JYOA 3RC2A 1UKEA 4NJEB 2BBSA 4OU5A 3O95A 1CD5A 3FDZB 4DILA 4I4TF 2XEDA 4LJSA 1WL8A 4QTUB 2AWOA 4R9VA 2WD7B 3RS3A 4DM7A 5C1PA 6REQA 1KRXA 2X1MA 3I2IA 3AFIA 1K7FB 2JI4A 1SWVA 3BC1A 2NU8B 1GZSA 4B2LA 3DOCA 3I6IA 3LOPA 3QE4A 4Z9XA 2NZUG 2P69A 3ESDA 1FPQA 3NGMA 4IZ6A 5AVOA 1RYMA 4FOTA 5D85A 1G7TA 4KZKA 4QYTA 5H3CA 4C0KA 5CAEA 3FCAA 4C06A 3PT5A 4P3KA 1PWZA 3BIXA 4DB4A 2IVZA 2O14A 3T41A 2BGRA 2Q9AA 5LQRA 3WXBA 4L9RA 2PKXA 3QU9A 4CLRB 3RVLA 1Z15A 1FIUA 1J33A 3F4BA 4C4TA 4Q9LA 3SSNA 2IZ6A 4C20A 5KYYB 3TYXA 3VDRA 3KPWA 1PQPA 2CK3D 4NSNA 3ZG6A 4O4LB 4CGZA 3AVYA 2A33A 4E4TA 4HFMA 5AUNB 4DCVA 1ZN9A 1EZ1A 1HFKA 5FNVA 2IZ1A 2A0FA 2WWIA 3F67A 4PBSA 5I5EA 1SZDA 3LZCA 2WUGA 3GEBA 2MR5A 3LV8A 3Q3IA 3HDJA 3WGNA 4Z1MD 2Z08A 1RJDA 3WKBA 5J59A 1V2HE 2V5UA 1EHCA 3G2IA 2VQDA 4U6NA 3VDQA 4PR0A 4YMVA 3PGXA 3PICA 1KC3A 3D5QA 4MUJA 3SVLA 2HT6A 2PYDA 1VJTA 2IYVA 3FYUA 3IA2A 4IDNA 4LZZA 1RAFA 3F5MA 5AOCA 2NNWB 1ZKMA 5B2ZA 3HNPA 4EK9A 1IN4A 2EERA 4G4IA 4KLAA 3ZDAA 2PG3A 3ST7A 1CJUC 3KOWA 4LBYA 3NKLA 1TGYA 4BNZA 5JNLA 2H51A 4H9GA 4TYMA 2GLUA 1E69A 1ILEA 1EQUA 1QTIA 3R23A 2WVJA 3NHKA 3ZHRA 1G4AE 3W04A 3IFSA 4TS1A 1ESEA 4ZGBA 1SD5A 2JAQA 2KW5A 3FB1A 3P9ZA 3UHFA 3BXHA 2I55A 2Y0BA 3BMOA 2VA8A 1OC2A 4Q9JA 4W9NC 3RF6A 1UCFA 4K9MA 1T5TA 3VZQA 5BN3B 2NVOA 3JYLA 1VL2A 5BW5A 2P6NA 2OSBA 3M4YA 4OXNA 3EZYA 4X0EA 2CV2A 3TJRA 2D0OB 2IKQA 4OYHA 2XYGA 5J1TB 3FFWA 2L17A 1CCWA 1PJRA 2IBSA 1P7ZA 1A2BA 3B12A 3FUWA 2PQ2A 1EXNA 3NVAA 4UM5A 1P2FA 4OHZA 1CUZA 1LNQA 1P7CA 1EBBA 3KIPA 4JJ8A 1TKAA 4KZPA 5AJHA 1Z68A 2YS7A 4IM7A 1JEQB 1S2LA 3FHOA 3LUGA 2ZRIA 4GNRA 4I5IA 3NJ4A 4J4BA 3WLJA 2LZ0A 4OL9A 2DQYA 3IGFA 4RJ2A 4X6UA 4U7DA 3CVOA 4K6GA 4UDOA 5DVZA 2XMQA 3ROPA 1OFHA 3G5AA 3OX3A 4R1MA 4EB3A 4CM6A 3AESB 4XQ0A 4D8XA 4DYHA 2JHPA 1QUEA 3FDZA 3IAM1 1PG2A 5G0VA 3WK6A 4NONA 10MHA 4BEVA 5KNDH 1SOWA 1UINA 1LRJA 4MR9B 4ALNA 4U2DA 4P82A 2BCEA 4YP1A 2V3VA 2X9VA 4M46A 4RD6A 5SZHB 5I7FA 5E4FA 1T9ZA 4BWVA 4QULA 4H18A 3DDOA 4TLMB 2DQKA 1G5FA 4WASA 3AKDA 2UVQA 3ZZTA 1G4HA 2JD0A 1K97A 5I7UA 1GILA 3B1YA 3COYA 1UL1X 3ZWBA 3M34A 4ZXPA 3PXUA 4CNBA 2NW6A 2DKNA 1AF7A 1AQUA 1Z5OA 3Q98A 4D8VA 3PJEA 2Z1MA 4ZYWA 4MHTA 3ZOZA 4MICA 3BRCA 4GR4A 4CL0A 5ALEA 1HA3A 1RPTA 4V0QA 4XWGA 3QNUA 1NW3A 2QM7A 1J7JA 2DUMA 2R6JA 2RGBA 4EPYA 1VPTA 2I2CA 1LVHA 2JGEA 3AL3A 4F21A 1NHWA 2Y1FA 4U4AA 1KRWA 1ZJ5A 4LYGA 2EW2A 4DKJA 2B61A 2L2QA 3ZK8A 3ZCPA 3JALB 1GZ5A 4ZAVA 3DMHA 3RIMA 1GXSA 4PO3X 4C7OA 4KO2S 1E1RD 3GYBA 4HZIA 2G9ZA 2HK8A 3OC0A 4DIBA 1JT2A 1VE6A 3U61B 2P2DA 1G20E 3HWSA 5TPZD 4I6GA 2P0AA 1TCVA 4BYMA 4M0KA 4F8EA 2ID8A 4RANA 4CL8A 3GX1A 2YN0A 3B3GA 1A5TA 1E2UA 1JLKA 4BWGA 1HQCA 1ZH0A 4IJWA 3C97A 4R69A 1J23A 3RLIA 3F8TA 3W6ZA 3LFTA 3UUWA 4KR7A 5BYBA 1IG0A 2P75A 1EP1B 1WUYA 3AR6A 5IHPA 1YXMA 4QHSA 4XD2A 4RTMA 3C14C 3MGAA 1WVMA 2FAXA 4YAJA 5BSRA 1MAHA 2AZ4A 4M1SA 2FN8A 1DKRA 1YVDA 4LK3A 2HR1A 3N59A 2F00A 2KQUA 3F5DA 2BZSA 4PYJA 3R7DA 4ZZ2A 2B8WA 3HSSA 4ZO7A 4A91A 2MSCB 1Q7CA 2J0QA 2P9ZA 1H9CA 4MS1A 3DMDA 2L19A 4YNBA 3TZKA 1MO2A 3CIOA 4GH5A 3U37A 2B1GA 3HUEA 3PNSA 2C2KA 1ZCBA 1RFLA 2HCBA 4B4OA 1B23P 4UFNA 5BNFA 4HTAA 1L1FA 1COWA 5BURA 4MO9A 4J7AA 3RS8A 2HHCA 3VPAA 4YJ3A 2IP4A 3OZEA 2RGYA 5GJWC 2PBZA 3VJKA 4F7DA 3U44B 1U2PA 5T41A 1SU6A 2VXOA 4M3NA 5KKNB 1YE8A 5GV7A 4ZPJA 3WR5A 2I1LA 5DNCA 5IVPA 5AOAA 4Z4IA 1O95A 1CHDA 1RE1A 3AEUA 3LBNA 1R66A 2GETA 2CJWB 2FJUA 2ZS7A 1JR3E 2AI3A 3C2QA 2JLXA 1YB2A 5SY9A 1T0JB 3GGSA 4MP6A 1VHTA 2WW8A 3JW8A 1WXHA 2JA2A 4TQGA 4XYMA 3TNJA 3U4DA 3VGJA 3A1UA 4ALIA 4Y1GA 1SD2A 2FRDA 1XQWA 2F64A 2AE2A 2YJ4A 1GA1A 1JDBC 2XITA 4WT7A 3L4EA 2Z56A 2ZUSA 4II7A 4P35A 3KDPA 4D9FA 3UGQA 2PT7A 4F2HA 2AOTB 3UBTA 4FYWA 1JPVA 2D54A 1YOVA 4PGAA 1T3SA 1IAVA 3BB1A 2A3NA 2ZYIA 4JX9A 3V7FA 4M9QA 1JXAA 4JLBA 3WBKA 1XLWA 1WW3A 2FQQA 4TUYB 5JD4A 3PA6A 4BMVA 4OQXA 1U2DA 4WAUA 4BV8A 2GOYA 2VJAA 2BEWB 2BSAA 4WN3A 4DMHA 4IR7A 2WSLA 4MP3A 3SVTA 3RVNA 1L6IA 4AF8A 3CPEA 3G1UA 3LUDA 2UZ0A 3QKWA 4I9UA 4TTVA 4N82A 4TMKA 3AIMA 1E2KA 5FI0B 1E9CA 4FR2A 1C0PA 3TE7A 2BLLA 2H7XA 4KQ2A 4Q7JB 1U7TA 3ELWA 4TWJA 1GTSA 1V6CA 3FVRA 3V3KA 3R4VA 3VU0A 2L69A 4MW4A 3A3NA 4WFQA 4Q37A 1QFZA 5FUBA 4OQNA 4NESA 1VE3A 1W4ZA 2YFHA 4PRKA 4LRXA 4MQ5A 4BFUA 4J2TA 5JC1A 1BVHA 1SPXA 3HHPA 1ZJJA 4FBLA 5EZYA 5K0LA 1RTTA 3ORSA 3NAQA 1FP4B 3LCUA 3O8QA 3TE6A 1EFAA 2HUPA 3D4LA 4LGMA 3S2SA 1S0UA 2Y8EA 1H2YA 2UDPA 2IA5A 4DMUB 4G0MA 5BQFA 4DQXA 4B5KA 3C8DA 4OLHA 2XYHA 1Z3IX 1M8JA 2IPXA 2WE8A 3BH6A 3GUYA 4BC0A 4C0JA 2ACKA 2R9VA 3HZRA 1EWTA 1QGUB 4N0MA 3V8MA 4I4NA 2A5LA 3P5SA 4Y1FA 4NOLA 2QM8A 1XJQA 3IVGA 4G5OA 1R0YA 4H7FA 4MYUA 4NZPA 3KT8A 3H4MA 5ICSA 1M67A 2L18A 2WTBA 3I32A 1ZESA 1TQ4A 3QH4A 4G0QA 5JCJD 1NY5A 3DKPA 2QV0A 4RHEA 3BK2A 4ND3A 1W0CA 1Z3CA 3JQCA 4NS4A 1MX9A 2BELA 2O2EA 1MT0A 4A6EA 1E4OA 1MR3F 2JD1A 1U8FO 5KYNA 4NXMB 2JANA 3LRPA 2WR8A 4TT3D 4S05A 2IBTA 2GNPA 2H85A 4QU8A 2A59A 4YC7A 3WQBA 3SF8A 4LW8A 2OV2A 3PFBA 3L1VA 3OZSA 1XN4A 2NXEA 2JZCA 1TU0A 3RT7A 1GG9A 1CR1A 1EVYA 3ZWCA 3WKDA 5FF9A 3VR0A 1XMVA 1UKAA 2NO1A 5D6NA 1ZC3A 4WIAA 2PUVA 4WCFA 2OA0A 1JHDA 4B2PA 2B98A 1K9VF 2HPAA 2PZ8A 3G9ZA 3LSTA 5IWCA 5HKAA 2C4VA 4YAIA 1RPJA 3MERA 3LO5A 2VUTA 4EEKA 3CISA 3U4GA 3J81k 5EY5B 5TLSA 4PPNA 2Q2QA 621PA 4PGGA 1VLHA 3U39A 4YYZA 3LXMA 4KRGA 2QI9F 1G9XA 2B1JA 2V45A 3HHEA 3IESA 4KQEA 5DM1A 3ROMA 3PFNA 3PR2B 5EP1A 1PGPA 3SBEA 4J1TC 4TKUB 4RNDB 4URFA 1GGHA 2VHUA 1BN6A 4MZDA 4MVXA 3K0AA 3OMXA 2V6GA 4JT2A 1DG1G 2WUWE 2Z9CA 3HKBA 5KU7A 3PQ8A 4UNIA 1MG0A 4HT3B 4RK1A 4HXGA 2ZULA 3FOWA 2P6MA 3IAM6 3V42A 3NR2A 5CXXA 1DTSA 2R4TA 4X7PA 4X3OA 2UZAA 1ECPA 3CM0A 4IJMA 2CCGA 4B44A 1JILA 2AN9A 1JYSA 2FVXA 1EU1A 1DC7A 3FOBA 3V9AA 4BWYA 4OQMA 4R3WA 5EP4A 1KQPA 2AJDA 3VA7A 2JBAB 2XSZD 3LFUA 5IW8A 3W7VA 1RQ2A 3GFTA 1EXWA 4ZOLB 2CXPA 4Z8YA 5F73A 1DG9A 2ROQA 3SZLA 1O96B 3DOHA 4FZ3A 4MR8B 4RPCA 4BTEA 2JGAA 3A4VA 2J3JA 4LHZA 1M10A 4TZ0A 1NV9A 4ZICA 3I0NA 2AB0A 4RIHA 4GLOA 2IXFA 5CNJA 3TINA 1T0PA 2D3WA 1Q50A 5H02A 4P7FA 4BJ6A 3QITA 1QWSA 1RWKA 3N5KA 4ISCA 4PAQA 3RH0A 3R7WA 421PA 4LSWA 1HE1C 1J2JA 1IZ0A 1YQQA 2XADA 1DLJA 4FEEA 4AKSA 2NXCA 4OHXA 3IUPA 5KC9A 3MQ4A 1R0SA 1QVRA 1UFVA 3HL0A 4ZYLA 2UUOA 3LT2A 3QKIA 4Q9DA 3SEFA 1I2AA 3IT1A 1YMUA 2HAEA 3BN3A 3HB1A 3OQHA 4HJRA 5FUXA 5FTKA 2X14A 5DPMA 4Z1MA 2DG2A 1TZKA 2QRZA 1GO2A 1JAXA 2Y92A 2OWDA 3RV3A 2JIDA 4M8LA 4TYPA 3U09A 3NV7A 2WKRA 2Y4OA 5D8DA 2E37A 3NOQA 2PYIA 16PKA 2HU7A 3K20A 2HADA 2C3UA 1RAGA 1VFNA<