1JRSA

Hemiacetal complex between leupeptin and trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Two crystal structures of the leupeptin-trypsin complex.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jrsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jrsA02
3GCTG 1QY6A 2A5IA 2ZF0H 4UDWH 3K6ZA 3ZZ5A 4AG1A 1BRAA 3VB5A 2CMYA 1C1PA 1E37B 3F9GA 2Y5FA 3R3GB 1YCPK 2GMTC 3P6ZB 4MVNA 1Y3WA 3AASA 3GCNA 1BCUH 4X2XA 4WJG2 5DP3A 2FX6A 2ZDMA 2CV3A 5EODA 3O8DA 1ZPCA 1KLJH 1LMWB 1NFUA 3UQOA 1GGDB 1BQYA 3F9EA 8KME2 1C9PA 1GHVH 2BZ6H 1H9IE 3BTEE 3G01A 2BQ6B 4GUXA 2P8OC 1C2FA 1EAXA 3KNXA 3BEUA 4O3UA 3ZZ4A 2WINI 1QB6A 1QBNA 3PMHB 1LPZB 1Y8TA 1LPGB 5HYOA 4Y7AA 1C1RA 1TPSA 4BTUB 5F6MA 5TCAA 3ATMA 3SU1A 1SGQE 3TK6A 3RMLH 1SHHB 1P2KA 1D3PB 1VCPA 1W13U 1C2EA 2HNTF 3ZVEA 1RS0A 1QL7A 2VWNA 4X1PU 2VH6A 1OWHA 1ZMNA 3QTVH 5AVDA 1TGCA 3STJA 3SU4A 4X6MA 3CS7A 1DT2A 3H5CB 1OPHB 4ABGA 3S0NA 1B7XB 2QYIA 3LONA 1F5KU 3A7VA 6CHAB 1TA2A 2GV6A 1ZSLA 2W3IA 1SGTA 4GCHF 3RXHA 1GCTC 3RXJA 3LGWA 2GDEH 1K1MA 2OLGA 2Q1JA 1GBFA 2SGFE 1BTPA 1O5FH 2A1DB 4ZUHA 1WQSA 3ZZDA 1AVXA 4WWYA 1N8OB 1N6XA 2FO9A 2VGCB 1HCGA 2ZPRA 2ZI2H 3RU4T 4B75A 3A84A 3VEQB 1BHXB 2AMDA 1O2XA 2CF8H 5AHGH 1GJ7B 2OBQA 1P3EA 4AG2A 3P17H 2JETB 5IYTA 3MH6A 1C1SA 1VITH 1XKAC 3RXMA 3UR6A 1H8DH 5GCHF 3A7WA 1G3EA 1AUJA 4KTSA 1QL8A 4X8VH 1ZLRA 1W0ZU 3SV2H 3BTFE 2B8OH 1TBRH 1EZXC 2SGQE 3SO3A 4E06H 3LGUA 3WY8A 1HAOH 2WYGA 4NZQA 1KXCA 2AFQB 2FTMA 1XM1A 3LH3A 2CHAC 3T5FH 2WPKS 3MU1A 1TA6A 1NY22 2BZAA 2P95A 4KP0A 1L2EA 3NWUA 4FVBA 5PTPA 3MFJA 1MTUA 3QGNB 1EOLA 1INCA 2GCTB 2PKSB 2UWPA 3UOUA 3ZZCA 2NWNA 2VIWA 1EP6A 1C5UA 2H2ZA 3K9XB 1D3TB 1RTFB 3PTBA 5A2MH 2BDYA 1SGPE 4AGJA 5EGMA 1WYKA 4HTCH 3TJNA 4B2CA 4NWKA 1GMHG 3T28A 4X2YA 2ZCHP 4IMQA 1LHCH 2HVXA 4J2YB 3RXOA 4D7GA 2HWLB 1HFDA 1QL9A 5T6GA 3ZV8A 2RCEA 1P2QA 1DM4B 4B2AA 1RRKA 1SHYA 4SGBE 2ZP0H 1XUHA 1B5GH 3LC3A 3RXQA 1EX3A 1A5GH 4RN6A 1LVBA 3OU0A 2A7CA 4ABEA 5C1XA 6LPRA 1ZMLA 2ZECA 1F0SA 3UWJH 3FZDA 4AX9H 1Y3XA 2TPIZ 3MNCA 2QC2A 2XC0A 1OWDA 1GBBA 3L6PA 1GI6A 1GVLA 2QAAA 1ZTLA 3RMMH 1P57B 2A32A 1F0UA 3GCTF 3HATH 1HUTH 2ZGBH 1AQ7A 4A1TA 1P03A 1MZAA 2NU4E 1MTSA 2J2UA 2PGBB 2ZTXA 1MCVA 1ZTJA 3Q00A 1GHZA 4YTAA 2VU8E 2EI7A 3KEEA 3TJUA 2XW9A 1P0SH 4BAOB 1EXFA 5LPRA 1IQIA 4TWWA 5J4QA 2VINA 2A45B 2EI6A 1XX9A 4DY7B 1YF4A 1AZZA 3U9AH 1AIXH 1BB0B 1UTQA 2J34A 1HYLA 2ZC9H 3MO3A 1FY5A 2Y81A 3PO1B 7LPRA 2OP9A 2BOKA 2RA3A 1ELGA 1BMMH 3LGTA 4XBDA 3S9AA 5DP8A 1C2DA 2A5KA 1J9CH 1XUFA 2TGPZ 2FOCA 3RXPA 2PTNA 1ELAA 1GI5A 2ESTE 1AB9B 2XBYA 3M61U 3UQVA 4OS7A 2ASUB 1CA0C 1CVWH 1AWFH 3EYDA 4MQAA 4MG3A 1O33A 4ISIH 1O3GA 4ISHH 3EGKH 4FU9A 2OBOA 1IQHA 3PMBB 3F9HA 4VGCB 3A82A 3RXEA 4THNH 1OSSA 3TGIE 5A8XA 5CE1A 2VJ1A 1Y3UA 2FOFA 2B0FA 1UMAH 2W26A 2Y80A 1AY6H 1O5DH 3TNSA 1NTPA 2PWXA 3SJKA 1TOCB 2J38A 1QHRB 5DO4H 1GI4A 4ZHAA 3W94A 1F5LA 1K9OE 1SQOA 3KHVA 2XTTB 4UFEH 3RXDA 1GI8B 1C5QA 1PPGE 1P10A 3FAOA 1X7AC 3MI4A 3VGCB 1GJ9B 5C5OA 3SZNA 1Y3VA 2ALVA 1P04A 1QTFA 1SGYE 1UTNA 2ZHDA 5E2PA 1V2QT 5DPAA 1MTNC 1QCPA 1GDUA 4O97A 3ZZ3A 3UNRA 1O2UA 5FBEA 1ZTKA 2BDAA 2OC0A 4WVPE 2UUKB 3A7ZA 3ZVBA 1N6YA 5E2OA 5F03A 2ZFTA 2BDIA 4Q80A 4KKDA 1O39A 4AYVB 2ZFPH 4NA9H 4I7YH 4FUIA 1GI1A 2HGTH 3VB3A 3P95A 1E35B 1LO6A 1TMTH 4HFPB 1FXYA 5E8EH 2BY9X 1Y5AT 2W5EA 4B2BA 3TPIZ 3SUFA 4X6OA 1YPMH 1CT2E 3MNBA 2WV4A 4XSKU 4AFZA 1BTHH 1IQMA 2C4FH 2VH0A 1GI9B 1TPOA 3RXLA 3SU5A 1GBLA 3RM0H 1GCDA 1PPFE 2P3UB 4ZHLU 4Y76A 5AF9H 2AMQA 3BTGE 7GCHG 3E0NB 1J17T 1H1BA 1GG6C 1FV9A 2XXLA 3NCLA 1GBEA 1PQ8A 4D7FA 2F91A 2ZZUH 3GDVA 3LKWA 1LDTT 1ABIH 3RXCA 3RM2H 5HM2A 1D9IA 3U8TH 2OQ5A 2HNTC 4GCHG 1C1UH 2ZGCA 3MU4A 3A81A 1RIWB 1W7GH 2FODA 1T8NA 2DUCA 4NIXA 3RLWH 2FOHA 2Y7ZA 2F9OA 4JZFH 4ZH8A 1WCZA 1YPHC 4XOJA 3OY6U 5GWZA 2BY7X 4MNYA 1KLIH 2GGVB 5EPYA 1NRSH 1C1QA 1MQ5A 1DITH 3PLBA 1MMJN 3SORA 1D6WA 1HJAB 1SGFG 5JDUB 2ZA5A 3DHKH 1NO9H 2FI4E 2V0BA 1DANH 1YPJH 4KTUA 3RC4A 3KN2A 1MKWH 4AN7A 1A1RA 1HJ9A 2P3TB 1EB2A 4FU7A 1XUKA 1CQQA 4B1TA 2PUQH 2R2MB 1TNLA 2R0LA 4I8LA 1SR5C 4D76A 4K2YA 1BRUP 1V2UT 3RXIA 1VZQH 1FY4A 3IITA 1HRTH 4I8HA 1V2MT 3QZRA 3D62A 2M5TA 1FIWA 2VWLA 1D3DB 1AZ8A 1ZGVA 2OINA 1ZPZA 1ZMJA 2O8UA 4J1YA 3ZZ8A 1ZPBA 5EG4A 2Y5HA 1SC8U 3UFAA 2ANYA 2R3YA 1NC6A 2FP7B 1EZSC 1MKWK 3UWIA 1L1NA 2BLWA 2BY6X 1NFYA 2ZCLP 2BQWB 4GPGA 4ABDA 2B7DH 1O3LA 4H4FA 1IAUA 5HM9A 1UVOA 4Y10E 2FS9A 1AHTH 3UPEA 1H9LB 1CSOE 2KAIA 1EATA 1TQ7B 2WV5A 1TNKA 1KXEA 2Z9JA 1PPCE 3NPSA 2OUAA 1VCQA 2HPQH 3EAJA 3PWBA 2OTVA 3E91A 3VXFH 4TYDA 1GCTB 1O3IA 1SB1H 1GI0A 4OS2A 1O3BA 2PLXA 1GHBF 1ZJKA 4BOHA 1BMAA 3LT3A 4M7GA 3HKIB 1KIGH 2FI3E 5SGAE 2FS8A 4CRCA 2XWBI 1YC0A 4K5ZA 4UEHH 2C3SA 3A88A 1KTSB 4CBOA 2OC8A 4AORA 4ZAEA 5LH8A 1Z8IB 3EA8A 5DP4A 4Z0KA 1A3EH 2ZHWH 1GBCA 1F0TA 3A8AA 1EB1H 1TX7A 3LIWA 1TOMH 2TGDA 4XBBA 1OS8A 1FMGA 2ZQ1A 4ZMAH 4RKOB 1Y5BT 3PLKA 4BNRA 1CO7E 9ESTA 2RA0A 1HIAB 2BDBA 1HAIH 3SV6A 4TWYA 4WY3A 3SV7A 1FONA 2BVSH 2SNVA 3M35A 1LVYA 2VNTA 1ANEA 5L2YH 5F8TA 1L4ZA 5L30H 2TGTA 4ZKOU 2CHAB 3KCGH 1GHAF 3MYWA 4FUJA 5DJ7A 1ZSKA 2FWWA 1SOTA 4O03A 3CP7A 3URDA 1AMHA 2GP9B 1TX8A 1V2RT 1C2GA 3M5MA 2FZZA 1Z8JB 4R8TB 3PLPA 1EAUA 2H9EH 4DJZB 1BRCE 4YT7H 4UD9H 4NWLA 2BY5X 1LVMA 2H5DA 2J9NA 1NRRH 4Q7XA 1IHTH 3NK8A 5FPYA 3C27B 2W7UA 1V3XA 3D65E 2F9BH 2ZQ2A 2PSYA 2J4IA 2P59A 1BRBE 3ODFA 3QO6A 1DXPA 1QRXA 4QT8C 1ELTA 4BXWA 2VVCA 1QRZA 2CJIA 1C5YB 1Q2WA 3MU0A 5BPEA 4I8KA 5FBIA 1C1OA 2SGPE 5JYIA 7GCHF 3M7QA 2ZIQH 2OC7A 4CRFA 1NU9A 3TIUA 3MO9A 1W8BH 4JZ1A 5JB8S 1V6DA 2R3UA 4BXSA 1IQNA 1GBHA 2BD9A 3U1IB 2ZPSA 5JBCS 1D4PB 1TPPA 3ZVAA 1FQ3A 1ELCA 2BDGA 3SI3H 3SNDA 2QXIA 1FAKH 1VR1H 2ILNA 2BX3A 1EKBB 1ZHRA 2A4RA 4NA8A 2ALPA 4RSPA 3TJOA 5C5NA 1QB9A 3ZZBA 1S0RA 1UTOA 5FPTA 1V2WT 2BVXH 1GL1A 2H1UA 1ESTA 1SG8B 3SU2A 3ESTA 1XUJA 1Z6JH 3M7UA 1KYNA 4CR9A 4K69A 4NA7A 1C2HA 1AE5A 2XBWA 3KL6A 2A0QB 3BTWE 1UVPA 1K1OA 1DWDH 5TCCA 2ZCKP 1DE7H 1BJUA 1C5RA 3RXVA 4ZXYH 5T6FA 1DLKB 2B9LA 2XC5A 3VFEA 4MNVA 1YPGH 4JYVH 3HKJB 2UWLA 3A87A 1K1JA 1A0HB 3M5LA 3Q76A 1WTGH 2WPLS 2PW8H 1P2IA 3EE0B 4BAHB 4Y11E 3KQEA 2VVUA 2PFEA 3RXTA 3FP6E 3PMAB 2QA9E 1A46H 3AW0A 1YPKH 2V35A 1K1LA 3A8CA 2G00A 2VIOA 1SMFE 2D26C 3NKKA 1H4WA 2FLBH 1FJSA 1JMOH 1CHOF 1NM6A 4UFGH 3QZQA 4YM9A 3B8JA 4E05H 8GCHG 3GY8A 1O2GH 1OOKB 1V2PT 1O34A 3VPKA 1T8LA 5ESBA 4AB9A 5L6NH 3ENSB 3KQCA 1GHXH 4WXIA 4LZ4B 2Y7XA 1Z1IA 1JOUB 3SW2B 4DIHH 3L3TA 4Y71A 1IOEA 1A0JA 3M37A 4KGAA 1GGDC 2GD4B 4Z6AH 2P94A 2PSXA 1ZHMA 4NSYA 4CBNA 2GT8A 1MD8A 4IMZA 2YNBA 2AGIX 1DX5M 1LTOA 1ANCA 2ZFSA 3H7TA 1WAYB 1ARCA 2G51A 3GY4A 4OS1A 3QTOH 1FPCH 1BTYA 2Z9IA 4K1SA 1DPOA 2QV1A 1H9HE 1VCWA 5JBTA 2R2WU 5CMXH 4K1EA 1C1TA 1OYQA 3BSQA 2D1JA 2FM2A 3A83A 1UK4A 3GY5A 3MHWU 3P8GA 2Z7FE 1FNIA 3MO6A 3BF6H 3BTTE 1EJAA 4JYTA 1YM0A 3TH3H 3GY7A 1E34B 4FUFA 2AIQA 2ZFRH 1BDAA 1T8MA 3TGJE 3ELAH 2JH6D 2BLVA 1MTWA 1DICA 3FVFB 1MCTA 1VJAU 1SGDE 3MH7A 1SGRE 3BIVH 3R0FA 1LPKB 1W3CA 1G9IE 1JIMA 2GX4A 3QN7A 1LQDB 1DLEA 3OSYA 1WOFA 5DKMA 2UUJB 3FP7E 7ESTE 1P3CA 3D23A 1QQUA 2AMPA 1DY8A 1VITF 1P2OA 1GHWH 3CENA 1PFXC 3KIDU 3HGPA 2ZDKA 1FDPA 6CHAC 4FUCA 4ZKSU 1BTWA 1VGCC 2W7SA 4GAWA 3V3MA 1GI7B 4DURA 1G32B 1THSH 1AVGH 2A2XH 1F5RA 3A7TA 4E7RG 3QDZB 3Q3YA 3SJIA 3BG4B 1N8OC 3SUGA 1DWCH 4DW2U 2WPJS 3SI4H 4OGYA 3BTKE 2XRCA 4A6LA 1HAPH 4GHTA 1A61H 1CHGA 1ORFA 3QGJA 4DGJA 1P2MA 2ZEBA 1J16A 1O2KA 1ETSH 1UTLM 1O2VA 1O3NA 1SGNE 1DS2E 2DE9A 3UNSA 2JETC 1GG6B 1O3HA 4ZHMU 2F83A 4OS5A 1GWAA 5GXPA 4K1TA 2QF0A 4LK4A 4WH6A 4XFQA 4CRDA 1V2VT 1B0FA 1CGHA 4I31A 2PGQB 1MU8B 1RFNA 1Y5UT 3K2UA 3SUDA 1NS3A 5JB9S 3GYLB 4MPXA 1C5NH 2HLCA 1HAGE 1HNEE 3TLOA 3M36A 1GHBG 1JWTA 1C5XB 5C3NA 1O3PB 4JZIA 1AE8H 3SGBE 1E38B 2D2DA 2QXJA 3U8RH 1ZJDA 4MPWA 9LPRA 1K21H 1J8AA 4HZHA 2BY8X 5F8ZA 4CHAC 1THRH 4MNXA 2ZHFH 2ZU4A 4GLYA 2HNTE 1TQ0B 3ZVFA 2UUFB 1UTJA 1S83A 3HGNA 2EA3A 1O31A 2IN2A 2GKVE 3ZZ9A 3U1JB 4Q7YA 1UO6A 2GCTC 1K1NA 1TIOA 4FXGH 1YPHE 3IWMA 2ZDLA 6GCHF 1EUFA 1L4DA 3E3TA 1JXPA 2Z9GA 3SNCA 3ATWA 3GY3A 2BQ7B 3E90B 3RXGA 3S7HB 1JBUH 3E1XB 3SQEE 3RXUA 2F9UA 3CS0A 1OXGA 5EU8A 3A8BA 1C5TA 1GBMA 5AFYH 1SFQB 5DGJA 1GJ5H 8LPRA 1C4V2 2R9PA 2BVRH 3F68H 2ZDVH 4X2VA 3PYHA 1GHAG 2O8WA 4O9VA 2ZFQH 1O5GH 3P8OA 4AZ2B 2EC9H 3QK1A 1HAHH 4SGAE 1NESE 1WBGB 4DOQA 2WUBA 1O0DH 1CE5A 5E0JA 1CGJE 1BJVA 1M9UA 2CXVA 1C1MA 3T25A 1NU7B 3MU5A 2Z3EA 4AFSA 1Z71A 4YESB 3MNSA 1GBDA 1O30A 5ESTE 1S5SA 1QR3E 1C2KA 1O3OA 3ATLA 1OP2A 3GCHC 1ETTH 2IOTA 1W2KH 5I46H 1S0QA 2BHGA 1G3CA 1HB0B 4Y6DA 1H8IH 2FPZA 4D9QA 3T29A 3EA9A 4R0IA 4AFUA 3K65B 4CRAA 2ZNKH 4DIIH 1N1LA 2ANWA 1T4VH 4X1SU 1WV7H 3LDXH 1W11U 1A3BH 1O5CB 1O2HA 1PQAA 3S69A 3A8DA 3EA7A 5LGOA 4D8NA 2C93B 2FDAA 8GCHF 2PKAA 1K1PA 1S84A 2XYAA 3SU0A 1V2LT 1V2NT 1TBQH 3BN9A 1YKTA 4X6PA 2RG3A 3DFJA 1BMLA 1TRNA 3RUOA 2HALA 1P05A 4CH2B 2ZDNA 4O3TA 4IN1A 1O37A 2WPMS 2ZDAH 5FCRA 1WU1A 2QN5T 1EPTC 2NU0E 1TRYA 1S82A 1TMBH 2O8MA 2ZO3H 2P16A 3I78A 2OD3B 4YZUA 2BD5A 1GDQA 1V2OT 3A7YA 5DP6A 3GY2A 2PHBA 1AFQB 5DP5A 3GICB 2XC4A 1LHEH 3QUMP 4HGCA 1L0ZA 2AIPA 1BITA 3RXAA 4IC5A 1MBMA 2CN0H 2C8ZB 2I6SA 1A5HA 5GDSH 4TPIZ 2GMTB 1ELEE 1UJ1A 4ZXXH 1W0YH 3PWCA 1O2QA 1TAWA 3BTHE 4A92A 1G36A 1IQFA 2PUXB 3O8RA 3MWIU 3SNBA 1DXWA 3HK6B 4UFFH 1GMDG 1O5EH 2FOMB 3A80A 1RTLA 1IQLA 1TNIA 1AGJA 2V3OH 2ZTZA 3SN8A 2J92A 2GDDA 1F0RA 2P8OB 1K2I1 1MBQA 1BHXF 2ZU1A 1LKAA 1ZRBA 2AGGX 2HOBA 1J15A 1OWEA 3TH2H 4JK6A 3V13A 2FOGA 3E8LA 1GBTA 1CHOG 1TBZH 2ODYB 1SLXB 3VB7A 4HI3A 4ZROA 1RXPA 4IBLH 1KY9A 3P8FA 1PPZA 2OQUA 1CBWC 1F7ZA 1MUEB 1O3KA 4YOIA 2A4QA 1BMNH 3RC5A 1OP8A 1ZGIA 3JZ1B 1KSNA 2PTCE 4TY6A 1MD7A 2LPRA 3U98H 5C1UA 4IC6A 1XUGA 4MLFB 5CHAC 3A89A 1MTVA 3FFGA 4BAMB 3SJ8A 4NG9H 2F3CE 1ACBE 1AUTC 5JBBS 3V0XA 4A1XA 1HV7A 5C67A 5LPFA 1GHYH 1BTZA 2ZGXH 1QJ6B 4CH8B 3HPTB 4ISNA 4MNWA 2A4GA 3BEFB 3DA9B 1RGQA 1P9SA 3S7KB 3E6PH 3BV9B 2BD8A 1GI2A 2V6NA 4I8GA 4U30A 4AOQA 2P93A 4X1QU 2JH5D 1O3JA 1JRSA 1SLVB 4X6NA 2NU1E 4NFFA 4LXBH 1SQTA 2GZ9A 1GMCF 4MPVA 3ZYDA 5L2ZH 2C90B 4I8JA 1CT4E 1ELVA 2UWOA 2VWOA 3PB1E 3MH5A 4I33A 4UFDH 2F9PA 2OCVB 4B76A 1Z6EA 1LHFH 2WPIS 5TJXA 2BMGB 2G55A 4MDSA 2KAIB 1LVOA 2PR3A 2TIOA 4A5TS 1GI3A 1V2JT 1MU6B 4JCNA 3PMJA 1VITG 4WMFA 1J14A 2QXGA 1ZYOA 1W10U 2GV7A 3RXFA 3A86A 5JBAS 3JZ2B 1FZZA 1QJ1B 1SI5H 1W12U 2VWMA 1YCPH 3O8BA 1DFPA 1A2CH 1G30B 1SBWA 2FIRH 2Q6GA 5JPMH 1Z8RA 4GVUA 1AI8H 2K1QA 1DDJA 2H6MA 3TK5A 4H42U 1HXFH 4RKJB 2GCHG 2R0KA 1C1NA 2VIPA 1PYTC 2JH0D 2XBXA 1W14U 3RC6A 5HMAA 1ANBA 3EDXB 5GIBA 5C20A 1NRNH 3UR9A 1ZRKA 1TYNA 3MTYA 3RMOH 2Q6DA 1HJAC 3GYMA 1QBVH 1PPEE 1P2JA 2BOHB 2A31A 1T8OA 3AAUA 4XE4A 1DSTA 2AERH 2FTLE 1BIOA 2FEQH 6ESTA 3F9FA 2ZGJA 1UK2A 2RDLA 1O5BB 3W95A 3ZV9A 1QURH 2QY0B 1YLDA 3MU8A 1FN8A 5T6DA 1CT0E 2STBE 1LHGH 2XWAA 3U69H 3KGPA 1TB6H 2H9HA 3U8OH 3B9FH 1Y59T 2Y5GA 1A7SA 2ZU2A 2H9TH 1XXFA 3SU3A 4U01A 4Y8YA 4WMEA 1L1GA 2BYAX 3M3SA 4D9RA 3GDUA 3VXEH 2H5CA 1OYTH 3P8NA 1TGBA 4IGDA 2SGEE 3SV9A 3SJ9A 3TK9A 2G5NA 3SOSA 2BX4A 1CGIE 1HDTH 1UK3A 3UTUH 6GCHG 1TGTA 1RD3B 2FYRA 2ZU5A 1EQ9A 3LPRA 3BIUH 1NFXA 1G2MA 1UTPA 3ZZ6A 1KDQA 4INKA 1CA8B 1GJBB 4UONA 3A7XA 4DT7B 4BTTB 2GVFA 1C1WH 5C1YA 4U32A 1BT7A 2VVVA 1NZQH 5K7RA 2F9NA 3H7OA 2C8YB 3ITIA 5GPIB 1SGIB 3UUZA 4YOGA 1O3DA 1OWJA 1VGCB 4K8BA 3QX5H 3SHCH 1BZXE 1O2RA 1UTKA 1IHSH 1MAYA 2HRVA 3M7TA 1HAZB 4TPYA 4ASHA 1C2MA 1QJ7B 3B23B 2ODPA 3SUEA 4CRGA 1Q3XA 1KDQB 3S9BA 3EQ0H 1SLUB 4NIWA 1AKSA 3BTQE 1GMDF 2NU3E 1WTHD 1D6RA 3LGIA 1MQ6A 1WUNH 1SGCA 2BD7A 1P9UA 1IQGA 2BLOA 3PTNA 1TE0A 3BG8A 4X2WA 1O2LA 1HLTH 3Q77A 3OY5U 2BLQA 2ZWLH 4NFEA 4TY7A 1RJXB 1VJ9U 1HAXB 4X0WU 1HJ8A 4Y0ZE 4X8UH 1OWIA 4YOJA 1PQ7A 1GDNA 2BD2A 2XBVA 1C5WB 3UIRA 3VB6A 1KXBA 2XNIA 1AD8H 4WMDA 2ZG0H 1YPLH 5J4SA 2ZHEH 2ZU3A 2C8XB 4F49A 3TGKE 1AU8A 2G4TA 2FYQA 1CA0B 3Q3XA 4ISOA 1C5PA 1GVZA 2SGAA 3RXBA 1ETRH 1QFKH 3M3VA 1P01A 1SQAA 2BD3A 1EOJA 4NGAH 4CHAB 1QA7A 1O2IA 1XVMA 1AKSB 1GBAA 1C5OH 1AVWA 1V2TT 1HAYB 4GHQA 2O9QA 1HXEH 1XUIA 3ZZAA 2ZHQH 1WQVH 5EW2H 7KMEH 5FPSA 1BTXA 1NRQH 4Y7BA 1YBWA 1O2YA 2G52A 5G4BA 2HPPH 3C1KA 1O2SA 5LPEA 3STIA 3K6YA 1BBRE 3RMNH 5HXFA 4K60A 3RXKA 2BM2A 1TONA 2FOEA 5AFZH 2O8LA 1FIZA 3OYPA 4ABHA 4Q2KA 1TWXB 2BXUH 1O2PA 2G4UA 1KLTA 1KXAA 1FN6A 1GBIA 3V12A 3BTME 2THFB 1C2LA 1MTNB 3SNAA 4I32A 3N7OA 4X8SH 3RDZA 1K22H 1NT1A 4ISLA 3T26A 1EAIA 4B71A 3PV4A 1G37A 2SNWA 4Q7ZA 2G81E 1GJAB 4JMYA 1SLWB 1D3QB 2CGAA 1P09A 1PPBH 4DG4A 4FUGA 2ODQA 3A85A 1TNJA 3T62A 1E0FD 1DY9A 5T3HA 2FI5E 2Z3CA 5F8XA 3SV8A 5B6OA 1IQEA 1SVPA 1IQKA 4AFQA 4JZEH 3OTJE 4FVDA 1EJMA 3M5NA 2A7JA 3GCHB 1U6QA 4AB8A 3ATIA 1K1IA 4ABIA 1G3BA 1EPTA 2VIVA 2GTBA 1DUEA 3SHAH 1FI8A 1YLCA 1DWEH 2NU2E 1E36B 1MZDA 8ESTE 2GCHF 2VGCC 3UNQA 4F4OC 4WH8A 5GJ4B 1ZR0A 4KTCA 1KXFA 1TALA 2ANKH 5EXMA 4FUDA 2XCFA 1K28D 1ZSJA 4ESTE 4IW4E 4NCYA 2TGAA 1O5AB 5EQQA 4Y79A 4JK5A 1GPZA 1O38A 1MAXA 1O2TA 1Z7KA 2FLRH 4XBCA 5FAHA 3AAVA 4MTBA 1S6FA 5E0GA 2QGRA 1CU1A 1O2ZA 1W7XH 1P11E 4NIYA 5EPNA 1EPTB 1S6HA 1UVUH 2GZ8A 1TGSZ 4DVAU 2ZFFH 2FXRA 1O35A 1UCYE 2Z6BD 1GMCG 5E0HA 1GBJA 5A0AE 5BRRE 1P12E 1UVTH 3LJJA 1YCPM 4INHA 1ID5H 1XMNB 1TRMA 4CR5A 5A8ZA 3FP8E 1SGFA 1ESAA 4JZDH 2FMJA 2ULLA 3DT0H 1C5VA 1V2KT 5FCKA 1JIRA 4OGXA 1PJPA 3LOXA 3UOPA 2IPHA 2G5VA 4FUBA 2FOAA 3KQBA 5A0CA 3MH4A 2AH4X 2PKSC 1AN1E 3URCA 1GJ8B 3D49H 3F6UH 1BTUA 1F2SE 3KQDA 4NZLA 2BDHA 2BDCA 3P70B 3BEIB 1O2NA 1EZUC 2BD4A 1TGNA 2UUYA 1YPEH 3NZIA 1NRPH 2Q6FA 3ZYEA 1SGEE 3VB4A 2PV9B 5ETXA 2J94A 3LC5A 3MOCA 1A4WH 4WXVA 1A5IA 1G2LA 1ABJH 1JRTA 1DUAA 1PPHE 4MPUA 2AS9A 1FUJA 2ZTYA 5EOKA 4KELA 2FOBA 3RXSA 4JYUH 1OX1A 1DSUA 4A7IB 1DOJA 5IDKA 2AEIH 1TLDA 4A1VA 2D8WA 1SFIA 1FPHH 1CBWB 2A2QH 3FANA 4X1RU 3ATKA 3Q3KA 1O3MA 3RP2A 5EXNA 2P3FH 2IJOB 1AWHB 1RTKA 5EQRA 5CHAB 2V3HH 2Y6TA 3V7TA 2GZ7A 4NSVA 3I29A 5FX5A 2Z94A 4NIVA 4FU8A 3AVZA 3FZZA 3TNTA 1PYTD 1TABE 1DWBH 4GSOA 4DCDA 4BANB 1P06A 1SL3A 1SPJA 1NPMA 2O8TA 3RLYH 3TITA 1ESBA 2ANMH 3ZVDA 2ZPQA 2BXTH 2XCNA 1QNJA 2OXSA 1QBOA 2YNAA 3MNXA 3BG4C 1UTMA 1LKBA 2AYWA 2J95A 1ELBA 4YO9A 1ARBA 1Z8GA 3IG6B 3TU7H 4H6TA 2VIDA 3UREA 3HK3B 1OWKA 2AGEX 4OS6A 1SSXA 3LGVA 4AGKA 3SU6A 1MKXH 4K8YA 3LU9B 1UVSH 1S85A 3KF2A 1V2ST 3ZVGA 1Q31A 1C5ZB 4YT6H 1BA8B 1O32A 4CREA 2GT7A 2OC1A 4ZKNU 3UY9A 5C2ZA 5FX6A 2A5AA 1C2IA 3PO1C 1O3AA 3DD2H 4B73A 4YLUA 3ZVCA 2WPHS 2LNCA 4U2WA 2CF9H 3GISB 1L1JA 1BBRH 4B74A 4E7NA 5DG6A 1GJDB 4UE7H 2PKAB 3GCOA 1P8VC 1QQ4A 1O2OA 1QA0A 2STAE 1TPAE 3T2NA 1TX6A 1GL0E 1AB9C 1QIXB 1TNHA 1Z1JA 3QWCH 5EXLA 2ZKSA 1FAXA 1YP9A 3GDSA 1EASA 1HPGA 1GMHF 3M3TA 1F92A 1T7CA 1ELFA 3L33A 2VB0A 2Y82A 3MMGA 2I6QA 4IN2A 4H6SB 1MKXK 1G3DA 2F9VA 4X8TH 5A8YA 2ZGHA 1LCYA 4Y8ZA 4VGCC 3TH4H 1DVAH 1FY8E 1O36A 1ELDE 1O2MA 2DE8A 1ZOMA 1EAWA 5HGGA 4XDEA 1NFWA 1B0EA 4BAQB 2QCYA 5DK1A 4ABBA 1YYY1 3DUXH 1BBRK 1UHBA 2QF3A 5GCHG 1IQJA 5FXLA 1P02A 1C2JA 1BOQA 1GJCB 1TFXA 2C8WB 1C9TA 1ZZZA 2TBSA 1C5SA 3LH1A 5DP7A 4BTIB 1O2JA 5EQSA 2Z9LA 3I77A 3VGCC 3BTDE 3SBKA 4Y0YE 3E16B 3TVJB 3RU4D 1AFEH 1C4Y2 3SGAE 1LQEA 1EP5A 4YLQH 3SJOA 1TNGA 1BUIA 3OX7U 1ZHPA 1A0LA 4X1NU 3P92A 1HBTH 1GVKB 1GBKA 1PQ5A 4FUHA 2G8TA 3F1SB 2BTCE 5FHTA 4CRBA 2QIQA 4FUEA 4INLA 1UHBB 1LHDH 1P2NA 1ANDA 3PROA 1S81A 1GJ4H 1C5MD 4Y8XA 1NROH 3T27A 1O3CA 3SNEA 4PROA 2A4OA 1C4U2 4BAKB 1T32A 5H4IB 2W3KA 3ODDA 3SQHE 1FLEE 3LJOA 3PM3A 1TMUH 4AYYB 1C5LH 1QGFA 1UCYH 3SGQE 1Y3YA 2JKHA 5A09A 2SFAA 1XKBC 1EJNA 2Z9KA 1XXDA 2WYJA 1OP0A 3GY6A 1O3EA 5DP9A 2SGDE 1MH0A 4K3JA 3NXPA 2EEKA 3NUMA 1GJ6A 2VIQA 3S9CA 2FESH 2QXHA 1HAVA 4WF8A 3QLPH 2BB4A 3TJVA 1T31A 2WUCA 3GOVB 2FX4A 4LOYH 1HIAA 2A7HA 3E0PB 3ZZ7A 4IS5A 5A0BA 3LGYA 1NN6A 3RXRA 2B5TB 2TRMA 1OKXA 4ABFA 1SOZA 1QB1A 5K0HA 3M5OA 1THPB 2EI8A 1UCYK 1EZQA 1AO5A 3AW1A 1T4UH 1WSSH 1O2WA 4OS4A 1KTTB 4ABAA 4ZKRU 1QRWA 2Z3DA 1RIWC 1YGCH 4ABJA 3O8CA 1HGTH 1FY1A 2YOLA 3DFLA 3RU4E 5ABWA 1KXDA 5EW1H 1FY3A 4LZ1H 1XVOA 1O3FA 1AFQC 5I25A 1C1VH 1HAVB
chains in the Genus database with same CATH superfamily
3GCTG 1QY6A 2A5IA 4Q63A 2ZF0H 4UDWH 3K6ZA 3ZZ5A 4AG1A 1BRAA 3VB5A 2CMYA 1C1PA 2J5UA 1E37B 3F9GA 3F3BA 2Y5FA 3R3GB 1YCPK 2GMTC 3P6ZB 4MVNA 1Y3WA 3AASA 3GCNA 1BCUH 4X2XA 4WJG2 5DP3A 5C94A 2K0QA 2FX6A 2ZDMA 2CV3A 5EODA 3O8DA 1ZPCA 1KLJH 1LMWB 1NFUA 3UQOA 1GGDB 1BQYA 3F9EA 8KME2 1C9PA 1GHVH 2BZ6H 1H9IE 3BTEE 3G01A 2BQ6B 4GUXA 2P8OC 1C2FA 1EAXA 3KNXA 3BEUA 4O3UA 3SYJA 3ZZ4A 2WINI 1QB6A 1QBNA 3PMHB 1LPZB 1Y8TA 1LPGB 5HYOA 4Y7AA 1C1RA 1TPSA 4BTUB 1S6LA 5F6MA 5TCAA 3ATMA 3SU1A 1SGQE 3TK6A 3RMLH 1SHHB 1P2KA 1D3PB 1VCPA 1W13U 1C2EA 2HNTF 3ZVEA 2LP6A 1RS0A 1QL7A 2VWNA 4X1PU 4XRNA 2VH6A 1OWHA 1ZMNA 1WDIA 3QTVH 4YXWD 5AVDA 1TGCA 3STJA 3SU4A 4X6MA 3CS7A 1DT2A 3H5CB 1OPHB 4ABGA 3S0NA 1B7XB 2QYIA 3LONA 1F5KU 3A7VA 6CHAB 1TA2A 2GV6A 1ZSLA 2W3IA 1SGTA 4GCHF 3RXHA 1GCTC 3RXJA 3LGWA 2GDEH 1K1MA 2OLGA 2Q1JA 1GBFA 2SGFE 1BTPA 1O5FH 2A1DB 4ZUHA 1WQSA 3ZZDA 1AVXA 4WWYA 1N8OB 1N6XA 2FO9A 2VGCB 1HCGA 2ZPRA 2ZI2H 3RU4T 4B75A 3A84A 3VEQB 1BHXB 4ACAA 2AMDA 1O2XA 2CF8H 5AHGH 1GJ7B 2RFKC 2OBQA 1P3EA 4AG2A 3P17H 2JETB 5IYTA 3DSPA 3MH6A 1C1SA 1VITH 1XKAC 3RXMA 3UR6A 1H8DH 5GCHF 3A7WA 1G3EA 1AUJA 4KTSA 1QL8A 4X8VH 1ZLRA 1W0ZU 3SV2H 3BTFE 2B8OH 1TBRH 1EZXC 2SGQE 3SO3A 4E06H 3LGUA 3WY8A 1HAOH 2WYGA 4NZQA 1KXCA 2AFQB 2FTMA 1XM1A 3LH3A 2CHAC 3T5FH 2WPKS 3MU1A 1TA6A 3N7EA 1NY22 2BZAA 2P95A 4KP0A 1L2EA 3NWUA 4FVBA 5PTPA 3MFJA 1MTUA 3QGNB 1EOLA 1INCA 2GCTB 2PKSB 2UWPA 3UOUA 3ZZCA 2NWNA 2VIWA 1EP6A 1C5UA 2H2ZA 3K9XB 1D3TB 1RTFB 1H8HD 3PTBA 5A2MH 2BDYA 1SGPE 2WV9A 4AGJA 5EGMA 1WYKA 4HTCH 3TJNA 4B2CA 4NWKA 2JDID 1GMHG 3T28A 4X2YA 2ZCHP 4Q4LA 4IMQA 1LHCH 2HVXA 4J2YB 3RXOA 4D7GA 2HWLB 1HFDA 1QL9A 5T6GA 3ZV8A 2RCEA 1P2QA 1DM4B 4B2AA 1RRKA 1SHYA 4SGBE 2ZP0H 1XUHA 1B5GH 3LC3A 3RXQA 1EX3A 1A5GH 4RN6A 1LVBA 3OU0A 2A7CA 4ABEA 2JIZD 3KYFA 5C1XA 6LPRA 1ZMLA 2ZECA 1F0SA 3UWJH 3FZDA 4AX9H 1Y3XA 2TPIZ 3MNCA 2QC2A 2XC0A 1OWDA 1GBBA 3L6PA 1GI6A 1GVLA 2QAAA 1ZTLA 3RMMH 1P57B 2A32A 1F0UA 3GCTF 3HATH 1HUTH 2ZGBH 1AQ7A 4A1TA 1P03A 1MZAA 2NU4E 1MTSA 3W1EA 2J2UA 2PGBB 2ZTXA 1MCVA 1ZTJA 3Q00A 1GHZA 4YTAA 2VU8E 2EI7A 3KEEA 3TJUA 4DT4A 2XW9A 1P0SH 4BAOB 1EXFA 5LPRA 1IQIA 4TWWA 5J4QA 2VINA 4B6EA 2A45B 2EI6A 1E1QD 1XX9A 4DY7B 1YF4A 1AZZA 3U9AH 1AIXH 1BB0B 1UTQA 2J34A 1HYLA 2ZC9H 3MO3A 1FY5A 2Y81A 2WHXA 3PO1B 7LPRA 2OP9A 2BOKA 2RA3A 1ELGA 1BMMH 3LGTA 4XBDA 3S9AA 5DP8A 1C2DA 2A5KA 1J9CH 1XUFA 2TGPZ 2FOCA 3RXPA 4I86A 2PTNA 1ELAA 1GI5A 2ESTE 1AB9B 2XBYA 3M61U 3UQVA 4OS7A 2ASUB 1CA0C 1CVWH 1AWFH 3EYDA 4MQAA 4MG3A 1O33A 4ISIH 1O3GA 4ISHH 3EGKH 4FU9A 2OBOA 5HIZA 1IQHA 3PMBB 3F9HA 4VGCB 3A82A 3RXEA 4THNH 1OSSA 3TGIE 5A8XA 5CE1A 2VJ1A 1Y3UA 2FOFA 2B0FA 1UMAH 2W26A 2Y80A 1AY6H 3NRLA 1O5DH 3TNSA 1NTPA 2PWXA 3SJKA 1TOCB 2J38A 1QHRB 5DO4H 1GI4A 4ZHAA 3W94A 1F5LA 1K9OE 1SQOA 3KHVA 3VG8A 2XTTB 4UFEH 3RXDA 1GI8B 1C5QA 1PPGE 1P10A 3FAOA 1X7AC 3MI4A 3VGCB 1GJ9B 5C5OA 3SZNA 1Y3VA 2ALVA 1P04A 1QTFA 1SGYE 2W6JD 1UTNA 2ZHDA 5HKKD 5E2PA 1V2QT 5DPAA 1MTNC 1QCPA 1GDUA 4O97A 3ZZ3A 3UNRA 1O2UA 5FBEA 1ZTKA 2BDAA 2OC0A 2HLDD 4WVPE 2UUKB 3A7ZA 3ZVBA 1N6YA 5E2OA 5F03A 2ZFTA 2BDIA 4Q80A 4KKDA 1O39A 4AYVB 2ZFPH 4NA9H 4I7YH 4FUIA 1GI1A 2HGTH 3VB3A 3P95A 1E35B 1LO6A 1TMTH 4HFPB 1FXYA 5E8EH 2BY9X 1Y5AT 2W5EA 4B2BA 3TPIZ 3SUFA 5DN6D 3OAAD 4X6OA 1YPMH 1CT2E 3MNBA 2WV4A 4XSKU 4AFZA 1BTHH 1IQMA 2C4FH 2VH0A 1GI9B 1TPOA 3RXLA 3SU5A 1GBLA 3RM0H 1COWD 2KCPA 1GCDA 1PPFE 2P3UB 4B6FA 4Y76A 4ZHLU 2AMQA 3BTGE 5AF9H 7GCHG 3E0NB 3WW7A 1J17T 1H1BA 1GG6C 1FV9A 2XXLA 3NCLA 1GBEA 1PQ8A 4D7FA 2F91A 2OK5A 2ZZUH 3GDVA 3FOAA 3LKWA 1LDTT 1ABIH 3RXCA 3RM2H 5HM2A 1D9IA 3U8TH 2OQ5A 2HNTC 4GCHG 1C1UH 2ZGCA 3MU4A 3A81A 1RIWB 1W7GH 2FODA 1T8NA 2DUCA 4NIXA 3RLWH 2FOHA 2Y7ZA 2F9OA 2YMSC 4JZFH 4ZH8A 1WCZA 1YPHC 4XOJA 3OY6U 5GWZA 2BY7X 4MNYA 3UAIC 1KLIH 2GGVB 5EPYA 1NRSH 1C1QA 1MQ5A 1DITH 3PLBA 1MMJN 3SORA 1D6WA 1HJAB 1SGFG 5C17A 3F2HA 5JDUB 2ZA5A 3DHKH 1NO9H 2FI4E 2V0BA 1DANH 1YPJH 4KTUA 3RC4A 3KN2A 1MKWH 4AN7A 1A1RA 1HJ9A 2P3TB 1EB2A 4FU7A 1XUKA 4TT3D 1CQQA 2LELA 4B1TA 2PUQH 2R2MB 1TNLA 2R0LA 4I8LA 3KYGA 1SR5C 5T1VA 4D76A 4K2YA 1BRUP 1V2UT 3RXIA 1VZQH 1FY4A 3IITA 1HRTH 4I8HA 1V2MT 3F2FA 3QZRA 3D62A 2M5TA 1FIWA 2VWLA 1D3DB 1AZ8A 1ZGVA 2OINA 1ZPZA 1ZMJA 2O8UA 4J1YA 3ZZ8A 1ZPBA 5EG4A 2Y5HA 1SC8U 3UFAA 2ANYA 2R3YA 1NC6A 2FP7B 1EZSC 1MKWK 3UWIA 1L1NA 2KCYA 4ASUD 2BLWA 2BY6X 1NFYA 2ZCLP 2BQWB 4GPGA 4ABDA 2B7DH 1O3LA 4H4FA 1IAUA 5HM9A 1UVOA 4Y10E 2FS9A 1AHTH 3UPEA 1H9LB 1CSOE 2KAIA 1EATA 1TQ7B 2WV5A 1TNKA 2VBCA 1KXEA 2Z9JA 1PPCE 3NPSA 2OUAA 1VCQA 2HPQH 3EAJA 3PWBA 2OTVA 3E91A 4RT0A 3VXFH 4TYDA 1GCTB 1O3IA 1SB1H 1GI0A 4OS2A 1O3BA 3EE7A 2PLXA 1GHBF 1ZJKA 4BOHA 1BMAA 3LT3A 4M7GA 3HKIB 1KIGH 2FI3E 5SGAE 2FS8A 2F4LA 2XWBI 4CRCA 1YC0A 4K5ZA 4UEHH 2C3SA 3A88A 1KTSB 4F48B 2XNDD 4CBOA 2OC8A 4AORA 5B6LA 4ZAEA 5LH8A 1Z8IB 3EA8A 5DP4A 4Z0KA 1A3EH 2ZHWH 1GBCA 1F0TA 3A8AA 1EB1H 1TX7A 3LIWA 1TOMH 3OEHD 2TGDA 4XBBA 1OS8A 4RI0A 1FMGA 2XOKD 2ZQ1A 4ZMAH 4RKOB 1Y5BT 2QE7D 3PLKA 4BNRA 1CO7E 9ESTA 2RA0A 1HIAB 2BDBA 1HAIH 3SV6A 4TWYA 2RDEA 4WY3A 3SV7A 1FONA 2BVSH 2QF4A 2SNVA 3M35A 1LVYA 2VNTA 1ANEA 5L2YH 5F8TA 1L4ZA 5L30H 2TGTA 4ZKOU 2CHAB 3KCGH 1GHAF 3MYWA 4FUJA 5DJ7A 1ZSKA 2FWWA 1SOTA 4O03A 3CP7A 3URDA 3N99A 1AMHA 2GP9B 1TX8A 1V2RT 1C2GA 2EY4C 3M5MA 2FZZA 1Z8JB 5IK2D 4R8TB 2KCAA 3PLPA 1EAUA 3WWBA 2H9EH 1E79D 4DJZB 1BRCE 4YT7H 4UD9H 4NWLA 2BY5X 1LVMA 2H5DA 2J9NA 1NRRH 4Q7XA 1IHTH 3NK8A 5FPYA 3C27B 2W7UA 1V3XA 3D65E 2F9BH 2ZQ2A 2PSYA 2J4IA 2P59A 1BRBE 3ODFA 3QO6A 1DXPA 1QRXA 4QT8C 1ELTA 4BXWA 2VVCA 1QRZA 2CJIA 1C5YB 1Q2WA 3MU0A 2F43B 5BPEA 4I8KA 5FBIA 1C1OA 2SGPE 5JYIA 7GCHF 3M7QA 2ZIQH 2OC7A 4CRFA 1NU9A 3TIUA 3MO9A 1W8BH 4JZ1A 5EJLA 5JB8S 1V6DA 2R3UA 4BXSA 1IQNA 1GBHA 2BD9A 4P02A 3U1IB 2ZPSA 5JBCS 1D4PB 1TPPA 3ZVAA 1FQ3A 1ELCA 2BDGA 5F53A 3SI3H 3SNDA 2QXIA 1FAKH 1VR1H 2ILNA 2BX3A 1EKBB 1ZHRA 2A4RA 4NA8A 2ALPA 4RSPA 3TJOA 5C5NA 2HVYB 1QB9A 3ZZBA 1S0RA 1UTOA 5FPTA 1V2WT 2BVXH 1GL1A 2H1UA 1ESTA 1SG8B 3SU2A 3ESTA 1XUJA 1Z6JH 3M7UA 1KYNA 4CR9A 4K69A 4NA7A 1C2HA 1AE5A 2XBWA 3KL6A 2A0QB 3BTWE 1UVPA 1K1OA 1DWDH 5TCCA 2ZCKP 1DE7H 1BJUA 1C5RA 3RXVA 4ZXYH 5T6FA 1DLKB 2B9LA 2XC5A 3VFEA 4MNVA 1YPGH 4JYVH 3HKJB 2UWLA 3A87A 1K1JA 1A0HB 3M5LA 3Q76A 1WTGH 2WPLS 2PW8H 1P2IA 3EE0B 4BAHB 4XD7D 4Y11E 3KQEA 2VVUA 2PFEA 3RXTA 3FP6E 3PMAB 2QA9E 1A46H 4ACBA 3AW0A 1YPKH 2V35A 1K1LA 3A8CA 2G00A 2VIOA 1SMFE 2D26C 3NKKA 1H4WA 2FLBH 1FJSA 1JMOH 1CHOF 1NM6A 4UFGH 3QZQA 4YM9A 3B8JA 4E05H 8GCHG 3GY8A 1O2GH 1OOKB 1V2PT 1O34A 3VPKA 1T8LA 5ESBA 4AB9A 2CK3D 5L6NH 3ENSB 3KQCA 1GHXH 4WXIA 4LZ4B 2Y7XA 1Z1IA 1JOUB 3H09A 3SW2B 4DIHH 3L3TA 4Y71A 1IOEA 1A0JA 3M37A 4KGAA 1GGDC 2GD4B 4Z6AH 2P94A 2PSXA 1ZHMA 4NSYA 4CBNA 2GT8A 1MD8A 2V7QD 2YNBA 2AGIX 4IMZA 1DX5M 1LTOA 1ANCA 2ZFSA 3H7TA 1WAYB 1ARCA 2G51A 3GY4A 4OS1A 3QTOH 1FPCH 1BTYA 2Z9IA 4K1SA 1DPOA 2QV1A 1H9HE 1VCWA 5JBTA 2R2WU 5CMXH 4K1EA 1C1TA 1OYQA 3BSQA 5GNDA 2D1JA 2FM2A 3A83A 1UK4A 3GY5A 3MHWU 3P8GA 1SQRA 1FNIA 2Z7FE 3MO6A 3OTPA 3BF6H 3BTTE 1EJAA 4JYTA 1YM0A 3TH3H 3GY7A 1E34B 4FUFA 2AIQA 2ZFRH 1BDAA 1T8MA 3TGJE 3ELAH 2JH6D 2BLVA 1MTWA 1DICA 3FVFB 1MCTA 1VJAU 1SGDE 3MH7A 1SGRE 3BIVH 3R0FA 1LPKB 1W3CA 1G9IE 1JIMA 2GX4A 3QN7A 1LQDB 1DLEA 3OSYA 1WOFA 5DKMA 2UUJB 3FP7E 7ESTE 1P3CA 3D23A 3AK5A 1QQUA 2AMPA 1DY8A 1VITF 1P2OA 1GHWH 3CENA 1PFXC 3KIDU 3HGPA 2ZDKA 1FDPA 3F2GA 6CHAC 4FUCA 4ZKSU 1BTWA 1VGCC 2W7SA 4GAWA 3V3MA 1GI7B 4DURA 1G32B 1THSH 1AVGH 2A2XH 5C0UA 1F5RA 3A7TA 4E7RG 3QDZB 3Q3YA 3SJIA 3BG4B 1N8OC 3SUGA 1DWCH 4DW2U 2WPJS 3SI4H 4OGYA 3BTKE 2XRCA 4A6LA 1HAPH 4GHTA 1A61H 1CHGA 1ORFA 3QGJA 4DGJA 1P2MA 2ZEBA 1J16A 1O2KA 1ETSH 1UTLM 2KM0A 1O2VA 1O3NA 1SGNE 1DS2E 2DE9A 3UNSA 2JETC 1GG6B 1O3HA 4ZHMU 2F83A 4OS5A 1GWAA 5GXPA 4K1TA 2QF0A 4LK4A 4WH6A 4XFQA 4CRDA 1V2VT 1B0FA 1CGHA 4I31A 2PGQB 1MU8B 1RFNA 1Y5UT 1YY3A 3K2UA 3SUDA 1NS3A 5JB9S 3GYLB 4MPXA 1C5NH 2HLCA 1HAGE 1HNEE 3TLOA 3PV2A 3M36A 1GHBG 1JWTA 1C5XB 5C3NA 1O3PB 4JZIA 1AE8H 3SGBE 1E38B 2D2DA 2QXJA 3U8RH 1ZJDA 4MPWA 9LPRA 1K21H 1J8AA 4HZHA 2BY8X 5F8ZA 4CHAC 1THRH 4MNXA 2ZHFH 2ZU4A 4GLYA 2HNTE 1TQ0B 3ZVFA 2UUFB 1UTJA 2L74A 1S83A 3HGNA 2EA3A 1O31A 2IN2A 2GKVE 3ZZ9A 3U1JB 4Q7YA 1UO6A 2V3MA 2GCTC 1K1NA 1TIOA 4FXGH 1YPHE 3IWMA 2ZDLA 6GCHF 5DSFA 1EUFA 1L4DA 3E3TA 1JXPA 2Z9GA 3SNCA 3ATWA 3GY3A 2BQ7B 4AC9A 3E90B 3RXGA 3S7HB 1JBUH 3E1XB 3SQEE 3RXUA 2F9UA 3CS0A 1OXGA 5EU8A 3PRDA 3A8BA 1C5TA 1GBMA 5AFYH 1E1RD 1SFQB 5DGJA 1GJ5H 8LPRA 1C4V2 2R9PA 2BVRH 3F68H 2ZDVH 4X2VA 3PYHA 1GHAG 2O8WA 4O9VA 2ZFQH 1O5GH 3P8OA 4AZ2B 2EC9H 3QK1A 1HAHH 4SGAE 1NESE 1WBGB 4DOQA 2WUBA 1O0DH 1CE5A 5E0JA 1CGJE 1BJVA 1M9UA 2CXVA 1C1MA 2L6OA 3T25A 1NU7B 3MU5A 2Z3EA 4F55A 4AFSA 1Z71A 4YESB 5KEDA 3MNSA 1GBDA 1O30A 1QZ8A 5ESTE 1S5SA 1QR3E 1C2KA 1O3OA 3ATLA 1OP2A 3GCHC 1YLNA 1ETTH 2IOTA 3UB0A 1W2KH 5I46H 1S0QA 2BHGA 1G3CA 1HB0B 2EQNA 4Y6DA 1H8IH 2FPZA 4D9QA 3T29A 3EA9A 4R0IA 4AFUA 3K65B 4CRAA 2ZNKH 4DIIH 1N1LA 3OE7D 2ANWA 1T4VH 4X1SU 1WV7H 3LDXH 1W11U 1A3BH 1O5CB 1O2HA 1PQAA 3S69A 3A8DA 3EA7A 5LGOA 4D8NA 2C93B 2FDAA 8GCHF 2PKAA 1K1PA 1S84A 2XYAA 3SU0A 1V2LT 1V2NT 1TBQH 3BN9A 1YKTA 4X6PA 2RG3A 3DFJA 1BMLA 1TRNA 3F0PA 3RUOA 2HALA 1P05A 4CH2B 2ZDNA 4O3TA 4IN1A 1O37A 2WPMS 2ZDAH 5FCRA 1WU1A 2QN5T 1EPTC 2NU0E 1TRYA 1S82A 1TMBH 3MQKC 2O8MA 2ZO3H 2P16A 3I78A 2OD3B 4YZUA 2BD5A 1GDQA 3ZIAD 1V2OT 3A7YA 5DP6A 3GY2A 2PHBA 4M9FA 1AFQB 5DP5A 3GICB 2XC4A 1LHEH 3QUMP 4HGCA 1L0ZA 2AIPA 1BITA 3RXAA 4IC5A 1MBMA 2CN0H 2C8ZB 2I6SA 1A5HA 5GDSH 4TPIZ 2GMTB 1ELEE 1UJ1A 4ZXXH 1W0YH 3PWCA 1O2QA 1TAWA 3BTHE 4A92A 1G36A 1IQFA 2PUXB 3O8RA 3MWIU 3SNBA 1DXWA 3HK6B 4UFFH 1GMDG 1O5EH 2FOMB 3A80A 1RTLA 1IQLA 2W6ID 1TNIA 1H8ED 1AGJA 2V3OH 2ZTZA 3SN8A 2J92A 2GDDA 1F0RA 2P8OB 1K2I1 1MBQA 1BHXF 2ZU1A 1LKAA 1ZRBA 2AGGX 2HOBA 1J15A 1OWEA 3TH2H 4JK6A 3V13A 2FOGA 3E8LA 1GBTA 1CHOG 1TBZH 2ODYB 1SLXB 3VB7A 4HI3A 4ZROA 1RXPA 4IBLH 2IPQX 1KY9A 3P8FA 1PPZA 2OQUA 1CBWC 1F7ZA 1MUEB 1O3KA 4YOIA 2A4QA 1BMNH 3RC5A 1OP8A 1ZGIA 3JZ1B 1KSNA 2PTCE 4TY6A 1MD7A 2LPRA 3U98H 5C1UA 4IC6A 1XUGA 4MLFB 5CHAC 3A89A 1MTVA 3FFGA 4BAMB 3WWFA 3SJ8A 4NG9H 2F3CE 1ACBE 1AUTC 5JBBS 3V0XA 4A1XA 1HV7A 5C67A 5LPFA 1GHYH 1BTZA 2ZGXH 1QJ6B 4CH8B 3OEED 3HPTB 4ISNA 4MNWA 2A4GA 3BEFB 3DA9B 1RGQA 1P9SA 5CDFE 3S7KB 3E6PH 3BV9B 2QF5A 2BD8A 1GI2A 2KX4A 2V6NA 4I8GA 4U30A 4AOQA 2P93A 4X1QU 2JH5D 1O3JA 1JRSA 1SLVB 4X6NA 2NU1E 4NFFA 4LXBH 1SQTA 2GZ9A 3F0OA 1GMCF 1SKYE 4MPVA 3ZYDA 5L2ZH 2C90B 4I8JA 1CT4E 1ELVA 2UWOA 2VWOA 3PB1E 3MH5A 4I33A 4UFDH 2F9PA 2OCVB 4B76A 1Z6EA 1LHFH 2WPIS 5TJXA 2BMGB 2G55A 4MDSA 5EIYA 3DSGA 2KAIB 4HG6A 1LVOA 2PR3A 2TIOA 4A5TS 1GI3A 1V2JT 5HIYA 1MU6B 4JCNA 3PMJA 1VITG 1FX0B 4WMFA 3OFND 1J14A 2QXGA 1ZYOA 1W10U 2GV7A 3RXFA 3A86A 5JBAS 3JZ2B 1FZZA 1QJ1B 1SI5H 1W12U 2VWMA 1YCPH 2IJD1 3O8BA 1DFPA 1A2CH 1G30B 2KR7A 1SBWA 2FIRH 2Q6GA 5JPMH 1Z8RA 4GVUA 1AI8H 2K1QA 1DDJA 2H6MA 3TK5A 4H42U 1HXFH 4RKJB 2GCHG 1K0HA 2R0KA 1C1NA 2VIPA 1PYTC 2JH0D 2JJ2D 2XBXA 1W14U 2J98A 5HMAA 3RC6A 1ANBA 3EDXB 5GIBA 5C20A 1NRNH 3UR9A 1ZRKA 1TYNA 3MTYA 3RMOH 2Q6DA 1HJAC 3GYMA 1QBVH 1PPEE 1P2JA 1VKYA 2BOHB 2A31A 1T8OA 3AAUA 4XE4A 1DSTA 2AERH 2FTLE 1BIOA 2FEQH 6ESTA 3F9FA 2ZGJA 1UK2A 2RDLA 1O5BB 3W95A 3ZV9A 1QURH 2QY0B 1YLDA 5FL7D 3MU8A 1FN8A 5T6DA 1CT0E 2STBE 1LHGH 2XWAA 3U69H 3KGPA 1TB6H 2H9HA 3U8OH 3B9FH 1Y59T 1OHHD 2Y5GA 1A7SA 2ZU2A 2H9TH 1XXFA 2J98B 3SU3A 4U01A 4Y8YA 4WMEA 1L1GA 2BYAX 4Z1MD 3M3SA 4D9RA 3GDUA 3VXEH 2H5CA 1OYTH 3P8NA 1TGBA 4IGDA 2SGEE 3SV9A 3SJ9A 3TK9A 2G5NA 3SOSA 2BX4A 1CGIE 1HDTH 1UK3A 3UTUH 6GCHG 1TGTA 1RD3B 2FYRA 3DSOA 2ZU5A 1EQ9A 3LPRA 3BIUH 1NFXA 1G2MA 1UTPA 3ZZ6A 1KDQA 4INKA 1CA8B 1GJBB 4UONA 1KMHB 3A7XA 4OM9A 2PP6A 4DT7B 4BTTB 2GVFA 1C1WH 5C1YA 4U32A 1BT7A 2VVVA 1NZQH 5K7RA 2F9NA 3H7OA 4P00A 2C8YB 3ITIA 2WSSD 5GPIB 1SGIB 3UUZA 4YOGA 1O3DA 1OWJA 1VGCB 4K8BA 3QX5H 3PRBA 3SHCH 1BZXE 1O2RA 1UTKA 1IHSH 1MAYA 2HRVA 3M7TA 1HAZB 4TPYA 3SZEA 4ASHA 1C2MA 1QJ7B 3B23B 2ODPA 3SUEA 4CRGA 1Q3XA 1KDQB 3S9BA 3EQ0H 1SLUB 4NIWA 1AKSA 3BTQE 1GMDF 2NU3E 1WTHD 1D6RA 3LGIA 1MQ6A 1WUNH 1SGCA 2BD7A 1P9UA 1IQGA 2BLOA 3PTNA 1TE0A 3BG8A 4X2WA 1O2LA 1HLTH 3Q77A 3OY5U 2BLQA 2ZWLH 4NFEA 4TY7A 1RJXB 1VJ9U 1HAXB 4X0WU 1HJ8A 4Y0ZE 4X8UH 1OWIA 4YOJA 1PQ7A 1GDNA 2BD2A 2XBVA 1C5WB 3UIRA 3VB6A 1KXBA 2XNIA 1AD8H 4WMDA 2ZG0H 1YPLH 5J4SA 2ZHEH 2ZU3A 2C8XB 4F49A 3TGKE 1AU8A 2G4TA 2FYQA 1CA0B 3Q3XA 4ISOA 1C5PA 1GVZA 2SGAA 3RXBA 1ETRH 1QFKH 3M3VA 1P01A 1SQAA 2BD3A 1EOJA 4NGAH 4CHAB 1QA7A 1O2IA 1XVMA 1AKSB 1GBAA 1C5OH 1WXRA 1AVWA 1V2TT 1HAYB 4GHQA 2O9QA 1HXEH 1XUIA 3ZZAA 2ZHQH 1WQVH 5EW2H 7KMEH 5FPSA 1BTXA 1NRQH 4Y7BA 1YBWA 1O2YA 2G52A 5G4BA 2HPPH 3C1KA 1O2SA 5LPEA 3STIA 2WZQA 3K6YA 1BBRE 3RMNH 5HXFA 4K60A 3RXKA 2BM2A 1TONA 2FOEA 5AFZH 2O8LA 1FIZA 3OYPA 4ABHA 4Q2KA 1TWXB 2BXUH 1O2PA 2G4UA 1KLTA 1KXAA 1FN6A 1GBIA 3V12A 3BTME 2THFB 1C2LA 1MTNB 3SNAA 4I32A 3N7OA 4X8SH 3RDZA 1YWUA 1K22H 1NT1A 3FKSD 4ISLA 3T26A 1EAIA 4B71A 3PV4A 1G37A 2SNWA 4Q7ZA 2G81E 1GJAB 4JMYA 1SLWB 1D3QB 2CGAA 2YMSD 1P09A 1PPBH 4DG4A 4FUGA 2ODQA 3A85A 1TNJA 3T62A 1E0FD 1DY9A 5T3HA 2FI5E 2Z3CA 5F8XA 3SV8A 5B6OA 1IQEA 1SVPA 1IQKA 4AFQA 4JZEH 3OTJE 4FVDA 1EJMA 3M5NA 2A7JA 3GCHB 1U6QA 4AB8A 3ATIA 1K1IA 4ABIA 1G3BA 1EPTA 2VIVA 2GTBA 1DUEA 3SHAH 1FI8A 1YLCA 1DWEH 2NU2E 1E36B 1MZDA 4FOUC 8ESTE 2GCHF 2VGCC 3UNQA 4F4OC 4WH8A 5GJ4B 5KGOA 1ZR0A 2J97A 4KTCA 3DCLA 1KXFA 1TALA 2ANKH 5EXMA 4FUDA 2XCFA 1K28D 5CHBA 1ZSJA 4ESTE 4IW4E 4NCYA 2TGAA 1O5AB 5EQQA 4Y79A 4JK5A 1GPZA 1O38A 1MAXA 1O2TA 1Z7KA 2FLRH 4XBCA 5FAHA 2M2AA 3AAVA 4MTBA 1S6FA 5E0GA 2QGRA 1BMFD 1CU1A 1O2ZA 1W7XH 1P11E 4NIYA 5EPNA 1EPTB 1S6HA 1UVUH 2GZ8A 1TGSZ 4DVAU 2ZFFH 2FXRA 1NBMD 1O35A 1UCYE 2Z6BD 1GMCG 5E0HA 1GBJA 5A0AE 5BRRE 1P12E 1UVTH 3LJJA 1YCPM 4INHA 1ID5H 1XMNB 1TRMA 4CR5A 5A8ZA 3FP8E 1SGFA 1ESAA 2YMSB 4JZDH 2FMJA 2ULLA 3DT0H 1C5VA 1V2KT 4RT1A 5FCKA 1JIRA 4OGXA 1PJPA 3LOXA 3UOPA 2IPHA 2G5VA 4FUBA 2FOAA 3KQBA 2WPDD 5KECA 5A0CA 3MH4A 2AH4X 2PKSC 1AN1E 3URCA 1GJ8B 3D49H 3F6UH 1BTUA 1F2SE 3KQDA 4NZLA 2BDHA 5C0TA 2BDCA 3P70B 4TSFD 3BEIB 1O2NA 2GJGA 1EZUC 2BD4A 1TGNA 2UUYA 1YPEH 3NZIA 1NRPH 2Q6FA 3ZYEA 1SGEE 3VB4A 2PV9B 5ETXA 2J94A 3LC5A 3MOCA 1A4WH 4WXVA 1A5IA 1G2LA 1ABJH 1JRTA 1DUAA 1PPHE 4MPUA 2AS9A 1FUJA 2ZTYA 5EOKA 4KELA 2FOBA 3RXSA 4JYUH 1OX1A 1DSUA 4A7IB 1DOJA 1W0JD 5IDKA 2AEIH 1TLDA 4A1VA 2D8WA 1SFIA 1FPHH 1CBWB 2A2QH 3FANA 4X1RU 3M3TA 3ATKA 3Q3KA 1O3MA 3RP2A 5EXNA 2P3FH 2IJOB 1AWHB 1RTKA 5EQRA 5CHAB 2V3HH 2Y6TA 3V7TA 2GZ7A 4NSVA 3I29A 5FX5A 2Z94A 4NIVA 4FU8A 3AVZA 3FZZA 3TNTA 1PYTD 1NBME 1TABE 1DWBH 4GSOA 4DCDA 4BANB 1P06A 1SL3A 1SPJA 1NPMA 3N7DA 2O8TA 3CNRA 3RLYH 3TITA 1ESBA 2ANMH 3ZVDA 2ZPQA 2BXTH 2XCNA 1QNJA 2OXSA 1QBOA 2K8IA 2YNAA 3BG4C 3MNXA 1UTMA 1LKBA 2AYWA 2J95A 1ELBA 4YO9A 1ARBA 1Z8GA 3IG6B 3TU7H 4H6TA 2VIDA 3UREA 3HK3B 1OWKA 2AGEX 4OS6A 1SSXA 2KZ4A 3LGVA 4AGKA 3SU6A 1MKXH 4K8YA 3LU9B 1UVSH 1S85A 3KF2A 1V2ST 3ZVGA 1Q31A 1C5ZB 4YT6H 1BA8B 1O32A 4CREA 2GT7A 2OC1A 4ZKNU 3UY9A 5C2ZA 5FX6A 2A5AA 1C2IA 3PO1C 1O3AA 3DD2H 2KFWA 4B73A 4YLUA 3ZVCA 2WPHS 2LNCA 4U2WA 2CF9H 3GISB 1L1JA 1BBRH 4B74A 4E7NA 5DG6A 1GJDB 4UE7H 2PKAB 3GCOA 1P8VC 1QQ4A 1O2OA 1QA0A 2STAE 1TPAE 3T2NA 1TX6A 1GL0E 1AB9C 1QIXB 1TNHA 1Z1JA 3QWCH 5EXLA 2ZKSA 1FAXA 1YP9A 3GDSA 1EASA 1HPGA 1GMHF 3FO8D 1F92A 1T7CA 1ELFA 3L33A 2VB0A 2Y82A 3MMGA 2I6QA 4IN2A 4H6SB 1MKXK 1G3DA 2F9VA 4X8TH 5A8YA 2ZGHA 1LCYA 4Y8ZA 4VGCC 3TH4H 1DVAH 1FY8E 1O36A 1ELDE 1O2MA 1MABB 2DE8A 1ZOMA 1EAWA 5HGGA 4FETA 4XDEA 1NFWA 3U28C 1B0EA 4BAQB 2QCYA 5DK1A 4ABBA 2JJ1D 1YYY1 3DUXH 1BBRK 1UHBA 2QF3A 5GCHG 1IQJA 5FXLA 1P02A 1C2JA 1BOQA 1GJCB 1TFXA 2C8WB 1C9TA 1ZZZA 2TBSA 1C5SA 3LH1A 5DP7A 4BTIB 1O2JA 5EQSA 2Z9LA 3I77A 3VGCC 3BTDE 3SBKA 4Y0YE 1EFRD 3E16B 3TVJB 3RU4D 1AFEH 1C4Y2 3SGAE 1LQEA 1EP5A 4YLQH 3SJOA 1TNGA 1W0KD 1BUIA 5EJZA 3OX7U 1ZHPA 1A0LA 4X1NU 3P92A 1HBTH 1GVKB 3KQ5A 1GBKA 1PQ5A 4FUHA 2G8TA 1UW7A 3F1SB 2BTCE 5FHTA 4CRBA 2QIQA 4FUEA 4INLA 1UHBB 1LHDH 1P2NA 1ANDA 3PROA 1S81A 1GJ4H 1C5MD 4Y8XA 1NROH 3T27A 1O3CA 3SNEA 4PROA 2A4OA 1C4U2 4BAKB 4ZCNA 1T32A 2AHME 2W3KA 3ODDA 5H4IB 3SQHE 1FLEE 3LJOA 3PM3A 1TMUH 4AYYB 1C5LH 1QGFA 1UCYH 3SGQE 1Y3YA 2JKHA 5A09A 2SFAA 1XKBC 1EJNA 2Z9KA 1XXDA 2WYJA 1OP0A 3GY6A 5EJ1A 2KCOA 1O3EA 5DP9A 2SGDE 1MH0A 3FN8A 3NXPA 4K3JA 2EEKA 3NUMA 1GJ6A 2VIQA 3S9CA 2FESH 2QXHA 1HAVA 4WF8A 3QLPH 2BB4A 3TJVA 1T31A 2WUCA 3GOVB 2FX4A 4LOYH 1HIAA 2A7HA 3E0PB 3ZZ7A 4IS5A 5A0BA 3LGYA 1NN6A 3RXRA 2B5TB 2TRMA 1OKXA 4ABFA 3GS9A 1SOZA 1QB1A 5K0HA 3M5OA 1THPB 2EI8A 1UCYK 1EZQA 1AO5A 3AW1A 1T4UH 1WSSH 1O2WA 4OS4A 1KTTB 4ABAA 4ZKRU 1QRWA 2Z3DA 1RIWC 1YGCH 4ABJA 3O8CA 1HGTH 1FY1A 2YOLA 3DFLA 3RU4E 3PV5A 5ABWA 1KXDA 5EW1H 1FY3A 4LZ1H 1XVOA 1O3FA 1AFQC 5I25A 1C1VH 1HAVB
chains in the Genus database with same CATH topology
3GCTG 1QY6A 2A5IA 2ZF0H 4UDWH 3K6ZA 3ZZ5A 4AG1A 1BRAA 3VB5A 2CMYA 1C1PA 1E37B 3F9GA 2Y5FA 3R3GB 1YCPK 2GMTC 3P6ZB 4MVNA 1Y3WA 3AASA 3GCNA 1BCUH 4X2XA 4WJG2 5DP3A 2FX6A 2ZDMA 2CV3A 5EODA 3O8DA 1ZPCA 1KLJH 1LMWB 1NFUA 3UQOA 1GGDB 1BQYA 3F9EA 8KME2 1C9PA 1GHVH 2BZ6H 1H9IE 3BTEE 3G01A 2BQ6B 4GUXA 2P8OC 1C2FA 1EAXA 3KNXA 3BEUA 4O3UA 3ZZ4A 2WINI 1QB6A 1QBNA 3PMHB 1LPZB 1Y8TA 1LPGB 5HYOA 4Y7AA 1C1RA 1TPSA 4BTUB 5F6MA 5TCAA 3ATMA 3SU1A 1SGQE 3TK6A 3RMLH 1SHHB 1P2KA 1D3PB 1VCPA 1W13U 1C2EA 2HNTF 3ZVEA 1RS0A 1QL7A 2VWNA 4X1PU 2VH6A 1OWHA 1ZMNA 3QTVH 5AVDA 1TGCA 3STJA 3SU4A 4X6MA 3CS7A 1DT2A 3H5CB 1OPHB 4ABGA 3S0NA 1B7XB 2QYIA 3LONA 1F5KU 3A7VA 6CHAB 1TA2A 2GV6A 1ZSLA 2W3IA 1SGTA 4GCHF 3RXHA 1GCTC 3RXJA 3LGWA 2GDEH 1K1MA 2OLGA 2Q1JA 1GBFA 2SGFE 1BTPA 1O5FH 2A1DB 4ZUHA 1WQSA 3ZZDA 1AVXA 4WWYA 1N8OB 1N6XA 2FO9A 2VGCB 1HCGA 2ZPRA 2ZI2H 3RU4T 4B75A 3A84A 3VEQB 1BHXB 2AMDA 1O2XA 2CF8H 5AHGH 1GJ7B 2OBQA 1P3EA 4AG2A 3P17H 2JETB 5IYTA 3MH6A 1C1SA 1VITH 1XKAC 3RXMA 3UR6A 1H8DH 5GCHF 3A7WA 1G3EA 1AUJA 4KTSA 1QL8A 4X8VH 1ZLRA 1W0ZU 3SV2H 3BTFE 2B8OH 1TBRH 1EZXC 2SGQE 3SO3A 4E06H 3LGUA 3WY8A 1HAOH 2WYGA 4NZQA 1KXCA 2AFQB 2FTMA 1XM1A 3LH3A 2CHAC 3T5FH 2WPKS 3MU1A 1TA6A 1NY22 2BZAA 2P95A 4KP0A 1L2EA 3NWUA 4FVBA 5PTPA 3MFJA 1MTUA 3QGNB 1EOLA 1INCA 2GCTB 2PKSB 2UWPA 3UOUA 3ZZCA 2NWNA 2VIWA 1EP6A 1C5UA 2H2ZA 3K9XB 1D3TB 1RTFB 3PTBA 5A2MH 2BDYA 1SGPE 4AGJA 5EGMA 1WYKA 4HTCH 3TJNA 4B2CA 4NWKA 1GMHG 3T28A 4X2YA 2ZCHP 4IMQA 1LHCH 2HVXA 4J2YB 3RXOA 4D7GA 2HWLB 1HFDA 1QL9A 5T6GA 3ZV8A 2RCEA 1P2QA 1DM4B 4B2AA 1RRKA 1SHYA 4SGBE 2ZP0H 1XUHA 1B5GH 3LC3A 3RXQA 1EX3A 1A5GH 4RN6A 1LVBA 3OU0A 2A7CA 4ABEA 5C1XA 6LPRA 1ZMLA 2ZECA 1F0SA 3UWJH 3FZDA 4AX9H 1Y3XA 2TPIZ 3MNCA 2QC2A 2XC0A 1OWDA 1GBBA 3L6PA 1GI6A 1GVLA 2QAAA 1ZTLA 3RMMH 1P57B 2A32A 1F0UA 3GCTF 3HATH 1HUTH 2ZGBH 1AQ7A 4A1TA 1P03A 1MZAA 2NU4E 1MTSA 2J2UA 2PGBB 2ZTXA 1MCVA 1ZTJA 3Q00A 1GHZA 4YTAA 2VU8E 2EI7A 3KEEA 3TJUA 2XW9A 1P0SH 4BAOB 1EXFA 5LPRA 1IQIA 4TWWA 5J4QA 2VINA 2A45B 2EI6A 1XX9A 4DY7B 1YF4A 1AZZA 3U9AH 1AIXH 1BB0B 1UTQA 2J34A 1HYLA 2ZC9H 3MO3A 1FY5A 2Y81A 3PO1B 7LPRA 2OP9A 2BOKA 2RA3A 1ELGA 1BMMH 3LGTA 4XBDA 3S9AA 5DP8A 1C2DA 2A5KA 1J9CH 1XUFA 2TGPZ 2FOCA 3RXPA 2PTNA 1ELAA 1GI5A 2ESTE 1AB9B 2XBYA 3M61U 3UQVA 4OS7A 2ASUB 1CA0C 1CVWH 1AWFH 3EYDA 4MQAA 4MG3A 1O33A 4ISIH 1O3GA 4ISHH 3EGKH 4FU9A 2OBOA 1IQHA 3PMBB 3F9HA 4VGCB 3A82A 3RXEA 4THNH 1OSSA 3TGIE 5A8XA 5CE1A 2VJ1A 1Y3UA 2FOFA 2B0FA 1UMAH 2W26A 2Y80A 1AY6H 1O5DH 3TNSA 1NTPA 2PWXA 3SJKA 1TOCB 2J38A 1QHRB 5DO4H 1GI4A 4ZHAA 3W94A 1F5LA 1K9OE 1SQOA 3KHVA 2XTTB 4UFEH 3RXDA 1GI8B 1C5QA 1PPGE 1P10A 3FAOA 1X7AC 3MI4A 3VGCB 1GJ9B 5C5OA 3SZNA 1Y3VA 2ALVA 1P04A 1QTFA 1SGYE 1UTNA 2ZHDA 5E2PA 1V2QT 5DPAA 1MTNC 1QCPA 1GDUA 4O97A 3ZZ3A 3UNRA 1O2UA 5FBEA 1ZTKA 2BDAA 2OC0A 4WVPE 2UUKB 3A7ZA 3ZVBA 1N6YA 5E2OA 5F03A 2ZFTA 2BDIA 4Q80A 4KKDA 1O39A 4AYVB 2ZFPH 4NA9H 4I7YH 4FUIA 1GI1A 2HGTH 3VB3A 3P95A 1E35B 1LO6A 1TMTH 4HFPB 1FXYA 5E8EH 2BY9X 1Y5AT 2W5EA 4B2BA 3TPIZ 3SUFA 4X6OA 1YPMH 1CT2E 3MNBA 2WV4A 4XSKU 4AFZA 1BTHH 1IQMA 2C4FH 2VH0A 1GI9B 1TPOA 3RXLA 3SU5A 1GBLA 3RM0H 1GCDA 1PPFE 2P3UB 4ZHLU 4Y76A 5AF9H 2AMQA 3BTGE 7GCHG 3E0NB 1J17T 1H1BA 1GG6C 1FV9A 2XXLA 3NCLA 1GBEA 1PQ8A 4D7FA 2F91A 2ZZUH 3GDVA 3LKWA 1LDTT 1ABIH 3RXCA 3RM2H 5HM2A 1D9IA 3U8TH 2OQ5A 2HNTC 4GCHG 1C1UH 2ZGCA 3MU4A 3A81A 1RIWB 1W7GH 2FODA 1T8NA 2DUCA 4NIXA 3RLWH 2FOHA 2Y7ZA 2F9OA 4JZFH 4ZH8A 1WCZA 1YPHC 4XOJA 3OY6U 5GWZA 2BY7X 4MNYA 1KLIH 2GGVB 5EPYA 1NRSH 1C1QA 1MQ5A 1DITH 3PLBA 1MMJN 3SORA 1D6WA 1HJAB 1SGFG 5JDUB 2ZA5A 3DHKH 1NO9H 2FI4E 2V0BA 1DANH 1YPJH 4KTUA 3RC4A 3KN2A 1MKWH 4AN7A 1A1RA 1HJ9A 2P3TB 1EB2A 4FU7A 1XUKA 1CQQA 4B1TA 2PUQH 2R2MB 1TNLA 2R0LA 4I8LA 1SR5C 4D76A 4K2YA 1BRUP 1V2UT 3RXIA 1VZQH 1FY4A 3IITA 1HRTH 4I8HA 1V2MT 3QZRA 3D62A 2M5TA 1FIWA 2VWLA 1D3DB 1AZ8A 1ZGVA 2OINA 1ZPZA 1ZMJA 2O8UA 4J1YA 3ZZ8A 1ZPBA 5EG4A 2Y5HA 1SC8U 3UFAA 2ANYA 2R3YA 1NC6A 2FP7B 1EZSC 1MKWK 3UWIA 1L1NA 2BLWA 2BY6X 1NFYA 2ZCLP 2BQWB 4GPGA 4ABDA 2B7DH 1O3LA 4H4FA 1IAUA 5HM9A 1UVOA 4Y10E 2FS9A 1AHTH 3UPEA 1H9LB 1CSOE 2KAIA 1EATA 1TQ7B 2WV5A 1TNKA 1KXEA 2Z9JA 1PPCE 3NPSA 2OUAA 1VCQA 2HPQH 3EAJA 3PWBA 2OTVA 3E91A 3VXFH 4TYDA 1GCTB 1O3IA 1SB1H 1GI0A 4OS2A 1O3BA 2PLXA 1GHBF 1ZJKA 4BOHA 1BMAA 3LT3A 4M7GA 3HKIB 1KIGH 2FI3E 5SGAE 2FS8A 4CRCA 2XWBI 1YC0A 4K5ZA 4UEHH 2C3SA 3A88A 1KTSB 4CBOA 2OC8A 4AORA 4ZAEA 5LH8A 1Z8IB 3EA8A 5DP4A 4Z0KA 1A3EH 2ZHWH 1GBCA 1F0TA 3A8AA 1EB1H 1TX7A 3LIWA 1TOMH 2TGDA 4XBBA 1OS8A 1FMGA 2ZQ1A 4ZMAH 4RKOB 1Y5BT 3PLKA 4BNRA 1CO7E 9ESTA 2RA0A 1HIAB 2BDBA 1HAIH 3SV6A 4TWYA 4WY3A 3SV7A 1FONA 2BVSH 2SNVA 3M35A 1LVYA 2VNTA 1ANEA 5L2YH 5F8TA 1L4ZA 5L30H 2TGTA 4ZKOU 2CHAB 3KCGH 1GHAF 3MYWA 4FUJA 5DJ7A 1ZSKA 2FWWA 1SOTA 4O03A 3CP7A 3URDA 1AMHA 2GP9B 1TX8A 1V2RT 1C2GA 3M5MA 2FZZA 1Z8JB 4R8TB 3PLPA 1EAUA 2H9EH 4DJZB 1BRCE 4YT7H 4UD9H 4NWLA 2BY5X 1LVMA 2H5DA 2J9NA 1NRRH 4Q7XA 1IHTH 3NK8A 5FPYA 3C27B 2W7UA 1V3XA 3D65E 2F9BH 2ZQ2A 2PSYA 2J4IA 2P59A 1BRBE 3ODFA 3QO6A 1DXPA 1QRXA 4QT8C 1ELTA 4BXWA 2VVCA 1QRZA 2CJIA 1C5YB 1Q2WA 3MU0A 5BPEA 4I8KA 5FBIA 1C1OA 2SGPE 5JYIA 7GCHF 3M7QA 2ZIQH 2OC7A 4CRFA 1NU9A 3TIUA 3MO9A 1W8BH 4JZ1A 5JB8S 1V6DA 2R3UA 4BXSA 1IQNA 1GBHA 2BD9A 3U1IB 2ZPSA 5JBCS 1D4PB 1TPPA 3ZVAA 1FQ3A 1ELCA 2BDGA 3SI3H 3SNDA 2QXIA 1FAKH 1VR1H 2ILNA 2BX3A 1EKBB 1ZHRA 2A4RA 4NA8A 2ALPA 4RSPA 3TJOA 5C5NA 1QB9A 3ZZBA 1S0RA 1UTOA 5FPTA 1V2WT 2BVXH 1GL1A 2H1UA 1ESTA 1SG8B 3SU2A 3ESTA 1XUJA 1Z6JH 3M7UA 1KYNA 4CR9A 4K69A 4NA7A 1C2HA 1AE5A 2XBWA 3KL6A 2A0QB 3BTWE 1UVPA 1K1OA 1DWDH 5TCCA 2ZCKP 1DE7H 1BJUA 1C5RA 3RXVA 4ZXYH 5T6FA 1DLKB 2B9LA 2XC5A 3VFEA 4MNVA 1YPGH 4JYVH 3HKJB 2UWLA 3A87A 1K1JA 1A0HB 3M5LA 3Q76A 1WTGH 2WPLS 2PW8H 1P2IA 3EE0B 4BAHB 4Y11E 3KQEA 2VVUA 2PFEA 3RXTA 3FP6E 3PMAB 2QA9E 1A46H 3AW0A 1YPKH 2V35A 1K1LA 3A8CA 2G00A 2VIOA 1SMFE 2D26C 3NKKA 1H4WA 2FLBH 1FJSA 1JMOH 1CHOF 1NM6A 4UFGH 3QZQA 4YM9A 3B8JA 4E05H 8GCHG 3GY8A 1O2GH 1OOKB 1V2PT 1O34A 3VPKA 1T8LA 5ESBA 4AB9A 5L6NH 3ENSB 3KQCA 1GHXH 4WXIA 4LZ4B 2Y7XA 1Z1IA 1JOUB 3SW2B 4DIHH 3L3TA 4Y71A 1IOEA 1A0JA 3M37A 4KGAA 1GGDC 2GD4B 4Z6AH 2P94A 2PSXA 1ZHMA 4NSYA 4CBNA 2GT8A 1MD8A 4IMZA 2YNBA 2AGIX 1DX5M 1LTOA 1ANCA 2ZFSA 3H7TA 1WAYB 1ARCA 2G51A 3GY4A 4OS1A 3QTOH 1FPCH 1BTYA 2Z9IA 4K1SA 1DPOA 2QV1A 1H9HE 1VCWA 5JBTA 2R2WU 5CMXH 4K1EA 1C1TA 1OYQA 3BSQA 2D1JA 2FM2A 3A83A 1UK4A 3GY5A 3MHWU 3P8GA 2Z7FE 1FNIA 3MO6A 3BF6H 3BTTE 1EJAA 4JYTA 1YM0A 3TH3H 3GY7A 1E34B 4FUFA 2AIQA 2ZFRH 1BDAA 1T8MA 3TGJE 3ELAH 2JH6D 2BLVA 1MTWA 1DICA 3FVFB 1MCTA 1VJAU 1SGDE 3MH7A 1SGRE 3BIVH 3R0FA 1LPKB 1W3CA 1G9IE 1JIMA 2GX4A 3QN7A 1LQDB 1DLEA 3OSYA 1WOFA 5DKMA 2UUJB 3FP7E 7ESTE 1P3CA 3D23A 1QQUA 2AMPA 1DY8A 1VITF 1P2OA 1GHWH 3CENA 1PFXC 3KIDU 3HGPA 2ZDKA 1FDPA 6CHAC 4FUCA 4ZKSU 1BTWA 1VGCC 2W7SA 4GAWA 3V3MA 1GI7B 4DURA 1G32B 1THSH 1AVGH 2A2XH 1F5RA 3A7TA 4E7RG 3QDZB 3Q3YA 3SJIA 3BG4B 1N8OC 3SUGA 1DWCH 4DW2U 2WPJS 3SI4H 4OGYA 3BTKE 2XRCA 4A6LA 1HAPH 4GHTA 1A61H 1CHGA 1ORFA 3QGJA 4DGJA 1P2MA 2ZEBA 1J16A 1O2KA 1ETSH 1UTLM 1O2VA 1O3NA 1SGNE 1DS2E 2DE9A 3UNSA 2JETC 1GG6B 1O3HA 4ZHMU 2F83A 4OS5A 1GWAA 5GXPA 4K1TA 2QF0A 4LK4A 4WH6A 4XFQA 4CRDA 1V2VT 1B0FA 1CGHA 4I31A 2PGQB 1MU8B 1RFNA 1Y5UT 3K2UA 3SUDA 1NS3A 5JB9S 3GYLB 4MPXA 1C5NH 2HLCA 1HAGE 1HNEE 3TLOA 3M36A 1GHBG 1JWTA 1C5XB 5C3NA 1O3PB 4JZIA 1AE8H 3SGBE 1E38B 2D2DA 2QXJA 3U8RH 1ZJDA 4MPWA 9LPRA 1K21H 1J8AA 4HZHA 2BY8X 5F8ZA 4CHAC 1THRH 4MNXA 2ZHFH 2ZU4A 4GLYA 2HNTE 1TQ0B 3ZVFA 2UUFB 1UTJA 1S83A 3HGNA 2EA3A 1O31A 2IN2A 2GKVE 3ZZ9A 3U1JB 4Q7YA 1UO6A 2GCTC 1K1NA 1TIOA 4FXGH 1YPHE 3IWMA 2ZDLA 6GCHF 1EUFA 1L4DA 3E3TA 1JXPA 2Z9GA 3SNCA 3ATWA 3GY3A 2BQ7B 3E90B 3RXGA 3S7HB 1JBUH 3E1XB 3SQEE 3RXUA 2F9UA 3CS0A 1OXGA 5EU8A 3A8BA 1C5TA 1GBMA 5AFYH 1SFQB 5DGJA 1GJ5H 8LPRA 1C4V2 2R9PA 2BVRH 3F68H 2ZDVH 4X2VA 3PYHA 1GHAG 2O8WA 4O9VA 2ZFQH 1O5GH 3P8OA 4AZ2B 2EC9H 3QK1A 1HAHH 4SGAE 1NESE 1WBGB 4DOQA