1JRTA

Hemiacetal complex between leupeptin and trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two crystal structures of the leupeptin-trypsin complex.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jrtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1jrtA02
1SFQB 3BEUA 1QQ4A 1O3JA 4HZHA 1C1RA 1EAWA 1QB6A 2A2QH 3BTWE 2H5CA 2ZFSA 3PLBA 3BTDE 1AD8H 2IJOB 1QFKH 4H6SB 1TQ7B 3UOUA 5ESTE 1GJ5H 3P95A 4BTIB 2UWLA 1ELGA 3ATLA 2BDHA 5HM2A 4Y71A 1INCA 4F49A 1GI9B 5EXMA 1DUEA 1HBTH 1G2MA 4B74A 2ZGBH 1DFPA 1LO6A 4NWKA 3LU9B 2H9TH 1GBCA 1ZHMA 3M5MA 4MLFB 3K6ZA 1MBQA 2K1QA 3L6PA 2PWXA 2FOBA 1KLIH 3SU4A 1UJ1A 1Y3UA 4X1QU 1GJ7B 3MU0A 3U1JB 1EOJA 1FIWA 1GMCF 3HK3B 1SGFA 1TOCB 5DGJA 2VB0A 1O35A 4FU7A 5DP4A 3QX5H 4BNRA 1XUKA 2KAIA 1ABJH 2B7DH 2TGPZ 2HNTE 4B76A 1UCYH 1D3QB 2ZG0H 1D3PB 2ZTZA 3S7KB 4NIWA 2CN0H 3QO6A 1BJUA 3M3SA 3M61U 5TCCA 1XKAC 1ORFA 1DXWA 1J16A 2A4OA 3PO1C 1DY9A 1SGYE 2A5IA 3D49H 3P92A 1BMLA 5E0HA 1UTMA 1RGQA 2R2WU 1O30A 2AMDA 4K8BA 2WV5A 1FUJA 1FN8A 4CRAA 2AMPA 1PFXC 1C4V2 6ESTA 3V3MA 1O5DH 1YCPM 1HAYB 3U8TH 1OX1A 1N6XA 1LPGB 1BMMH 5C1YA 1HAOH 4ABFA 7GCHF 3M5LA 4Y76A 3U69H 1AVXA 2BQ6B 4GSOA 5E2PA 1O3IA 1A0LA 1HAZB 4WY3A 1NRSH 2FZZA 1BTYA 4B75A 1VGCC 2Z7FE 3GYLB 3TU7H 1O34A 5ETXA 1T4VH 1P12E 5LGOA 2BY5X 1ELEE 1Q31A 2Q1JA 4Y6DA 1J15A 1TX6A 2R9PA 2WPHS 2ZHDA 2PLXA 5CMXH 4TWWA 3TNTA 3OY5U 3F9GA 3F6UH 1TAWA 3MH7A 1C5ZB 3U1IB 1C5TA 1S85A 2FMJA 1S5SA 4CRDA 1FNIA 4BAMB 2I6QA 3TNSA 1GG6C 1FXYA 1BTUA 1C5OH 2Z9IA 3KIDU 1WV7H 1DSTA 1TMBH 2IOTA 4WF8A 4MPVA 1XUFA 1HJ9A 1UHBB 3RP2A 1C5MD 3AAUA 2SNWA 1VJAU 2W7UA 5FXLA 3RMLH 1WSSH 1ZPBA 4UE7H 3GCOA 1C9TA 1O3PB 3MH5A 1S81A 2RA0A 3W95A 2NWNA 3AASA 3STJA 1O3EA 1QRWA 5DJ7A 1OWDA 2XBVA 1CBWC 3ZZAA 3SJOA 1CT2E 1FY3A 2ZPRA 3RU4T 1GL1A 1YPKH 4I31A 5IDKA 2AEIH 5JBTA 1WU1A 1UK2A 2Y81A 5F03A 3M7TA 4K69A 1CA0C 4BXWA 2FODA 2UUJB 1DM4B 2ZDAH 4K8YA 4TPYA 1GBEA 3SZNA 3P17H 3SJ9A 1C1NA 1KYNA 2XRCA 1C5LH 1C2KA 1AE8H 2SGQE 1SGNE 4Y8YA 1BHXF 5EQRA 3DD2H 1Q3XA 2C8YB 4DCDA 2JETB 1O2VA 3FAOA 4UD9H 4ZH8A 1DOJA 3EE0B 3BEFB 4DGJA 4YM9A 4DURA 1DUAA 1KLJH 5FPSA 1KXEA 1GBDA 3ELAH 5FCRA 1JIMA 1G30B 1T8OA 1UTPA 1BRBE 1EZQA 3OSYA 3KQEA 3SJIA 2OC7A 6GCHF 1OP8A 1TONA 1TRNA 1HAXB 4X8VH 2UUFB 2BDAA 2D26C 2XC0A 3TK9A 2OD3B 4XOJA 2BZ6H 4GVUA 7KMEH 2ZU1A 4DY7B 4Y10E 4A1VA 5B6OA 1YYY1 5A0AE 2FX6A 1Z6EA 4D7GA 2FYQA 4Y8ZA 2VIVA 2BY7X 2QYIA 4AB9A 1HLTH 3R0FA 2ZCKP 3RXUA 2Y80A 1L4DA 2VINA 1HIAA 2BQWB 1SGDE 1C2DA 2VIPA 3M36A 2Y5HA 4AFQA 1P3CA 1KDQA 2LPRA 3U9AH 1D6RA 1LPKB 3SJ8A 2PKSC 1UTKA 2QN5T 1HAHH 1NU9A 1ZTJA 1SLWB 3ATIA 3RMNH 4TY6A 3RDZA 5TCAA 2JH0D 3E3TA 6LPRA 3MU5A 5JYIA 2GTBA 4J1YA 3PWBA 1C5NH 1C9PA 2QA9E 3PMAB 4GLYA 1DY8A 2GT8A 4CBNA 1F2SE 1PJPA 2A7CA 1AKSA 1UHBA 1EOLA 1CGJE 4K5ZA 3PYHA 1A61H 5DPAA 1ZMNA 3S69A 3ZZ8A 1HAVB 2STAE 2GKVE 3MH6A 1NFUA 1MTWA 3MTYA 3LC5A 4UFGH 1FN6A 3QUMP 1BTPA 1D3DB 1UK3A 3AW1A 1ZPCA 1PPEE 4JZEH 1NRPH 1NTPA 3RXGA 3NXPA 2HNTC 3M7QA 5LPRA 1UCYK 1ZLRA 3OX7U 1AUJA 2CF8H 1KXFA 2QIQA 1CGHA 2OP9A 1UMAH 2OBQA 1B5GH 4X6NA 4FVDA 3SV7A 1CU1A 3EA9A 1VITF 2R3UA 4ABDA 6GCHG 4H4FA 3OU0A 1K2I1 2ZGCA 1JOUB 2HPPH 2ODPA 5E2OA 1GVZA 9ESTA 1GBKA 1Z8GA 1A3EH 2OQ5A 1V2WT 4AB8A 4MPUA 3B8JA 3RXKA 3KHVA 1QTFA 1ESTA 3HK6B 1IQMA 1TPOA 1NRRH 1NN6A 3PO1B 5AFYH 1V2LT 2F9UA 4B2CA 4MDSA 1PPHE 1EQ9A 2ZGHA 3F9EA 1V2PT 3U98H 1C5WB 1YKTA 1ZMJA 2OC1A 4JCNA 1LVOA 4B1TA 1TNLA 1OWJA 1O2ZA 3A81A 3FP7E 2IN2A 3UFAA 1GJ6A 3TJNA 2OLGA 3BTKE 3PB1E 4K1SA 1W12U 1AUTC 1AFQB 1SR5C 1EUFA 5F8XA 4MPWA 1MKWK 2BD4A 4AFUA 3LJJA 4QT8C 1FY5A 1DPOA 2FS8A 2GDDA 1ZHPA 2XTTB 2ANWA 1T7CA 3UWJH 1QIXB 1GHWH 3LGUA 1MKXH 3ATKA 1C2JA 3F9HA 1EKBB 5T3HA 1GHBF 2RCEA 8LPRA 1IHSH 1GJ8B 3MWIU 1BRCE 3GY8A 2AIQA 2Z3DA 1O2RA 1O2LA 5DP8A 1GGDC 2YOLA 4UFFH 2AH4X 3SNEA 1TIOA 4YT6H 1FIZA 3EGKH 2A4QA 1W13U 2GCTC 1O3KA 2CXVA 3ZZBA 1AGJA 4K3JA 4AYVB 4NFEA 1AWFH 2PTCE 1GVKB 5AHGH 2CHAC 2F9PA 1IQJA 2AGIX 1TNIA 5EODA 1L1GA 3LGIA 1A0JA 1C1TA 2P3UB 3MMGA 1A1RA 3VXEH 5FX5A 3RMMH 3LPRA 3QWCH 3BTME 1ELBA 4B2AA 1RTKA 4YTAA 2FYRA 4Z6AH 1O3HA 2GZ8A 1LDTT 2CF9H 4ZHMU 3VB3A 3WY8A 5C3NA 7ESTE 4CRBA 4K1EA 3LGVA 4AORA 4WVPE 1AN1E 3RXQA 2OINA 4JZDH 1XX9A 2G5NA 5FHTA 1EZSC 1GJ4H 2SGEE 2WUCA 1HFDA 3P70B 1Z8JB 3GYMA 2XNIA 1SGCA 3RXAA 5LPEA 1MU6B 2YNAA 1NC6A 1Y3WA 5DK1A 2VVUA 1HAPH 3UNSA 1D9IA 4ABBA 4GUXA 1CA0B 1AE5A 1DSUA 4XSKU 3RC6A 3T2NA 4NSYA 1W14U 3T62A 3TGIE 5GPIB 2RDLA 2W3IA 1P3EA 2TIOA 1C5XB 1YGCH 2BD2A 4X2XA 3UR9A 5K7RA 1D3TB 1QB1A 3Q3YA 2XBYA 2W3KA 5T6FA 1TGSZ 2B8OH 1QA7A 4KGAA 2LNCA 3T25A 4CR5A 3MHWU 2BDYA 3QGJA 1YPGH 1RD3B 4ABEA 2Z9GA 1MTUA 3P8FA 3GCHC 4R8TB 1EAUA 2C3SA 1O2HA 3GY3A 1UTOA 2H5DA 4FXGH 4A1TA 2A4RA 1BOQA 1LHEH 3E0NB 4INHA 4ISIH 4AFSA 1GPZA 5JB9S 3GY7A 3V12A 1BRUP 1P02A 4NIYA 1A5IA 2H1UA 5F6MA 1ELVA 1O2KA 2TRMA 4J2YB 3UTUH 2Y5GA 2PW8H 3RXLA 2FLBH 1EXFA 1C5QA 1D4PB 1FQ3A 4X2YA 1FI8A 5FX6A 1ELDE 5DP3A 1EZXC 1CGIE 2VH6A 4CRGA 3RXCA 2ZU5A 2AGEX 1JIRA 3A7WA 5C1UA 4I7YH 2J34A 1N1LA 1C1OA 1TYNA 2V6NA 3A89A 3RXSA 4O97A 1GHXH 1TGNA 4H6TA 3PROA 2A2XH 4U32A 2BX3A 2ODQA 1L4ZA 1PPBH 1HAIH 1KXBA 3B23B 3MO9A 2XBXA 3GISB 2ZDNA 3RXIA 1MAYA 3SU0A 1C1UH 1ETRH 3F68H 1C2IA 1T8LA 2A32A 2PTNA 1V2UT 1HDTH 1XM1A 3SV9A 1P0SH 3TJUA 4X8SH 1TABE 4OGXA 2BXTH 4D9QA 1VZQH 1TE0A 2VWMA 2BD7A 3A7ZA 2AIPA 4FUDA 3URCA 2CV3A 1P2OA 4Y79A 4OS7A 1G3CA 2F91A 2Q6GA 4X1SU 3VPKA 4B71A 3P8NA 2BDBA 2OBOA 5DKMA 5I46H 1NFWA 2BB4A 1P9UA 3P8GA 2H9EH 5AFZH 3ZVEA 1THPB 1LCYA 1HNEE 1QBOA 4CREA 3MU4A 1JRTA 2FM2A 2QF3A 2VJ1A 1QL7A 1TBZH 2BDCA 1O37A 1BHXB 1BBRE 1E34B 1K1JA 1MBMA 4WH6A 2ZU2A 4KKDA 3RXHA 2ZZUH 1SGPE 2Z6BD 4YT7H 2NU2E 4CHAC 5L2YH 1A5GH 4ZUHA 3RC4A 4TYDA 1YM0A 2BY8X 3FFGA 1YP9A 3JZ2B 2R0LA 1DWEH 1SL3A 2EC9H 3LKWA 1GI2A 2ZQ1A 3LJOA 7LPRA 1MQ5A 4JZFH 1ANEA 2P3FH 1AVWA 5DP7A 1G2LA 4B73A 1NPMA 5DG6A 1FZZA 1DT2A 1Y3YA 4Q7YA 1ZPZA 1GCTB 3VXFH 3N7OA 3GDSA 3LH3A 1AKSB 4FUCA 3RXOA 1E37B 3A85A 4Y11E 1GHAF 1OXGA 1AZ8A 1K22H 5EOKA 5EW1H 1JMOH 1EJMA 2FI3E 7GCHG 1MD8A 1VCWA 1VR1H 1F5LA 2QXIA 1C2FA 1Y5UT 3EA8A 1TPAE 1A4WH 1SLXB 3FP8E 3LH1A 3Q76A 3T29A 2I6SA 4MNXA 4GCHG 4NWLA 1O3DA 1OPHB 4WMFA 1P2IA 3SU1A 1QHRB 1VJ9U 5JBAS 1O2UA 1V6DA 3AAVA 2XW9A 1EB2A 3TITA 4GPGA 2NU4E 2GCTB 4LK4A 3RU4D 3SUDA 4ASHA 1ZMLA 1GJ9B 2FS9A 2ZFTA 3KF2A 1O2PA 4RN6A 1BT7A 1TGBA 1SG8B 2FO9A 1TX7A 5DP9A 2WYJA 1F0UA 2CHAB 1G3DA 1S0RA 2EEKA 5EQSA 3ZVGA 3MNBA 2OTVA 2W7SA 1SFIA 3A84A 1ARBA 2J38A 1L1NA 1P8VC 4FUHA 2BOKA 1AY6H 2J9NA 3H7OA 1VCPA 3KN2A 2ZFRH 1O2SA 1SQAA 1C1MA 1T4UH 2HVXA 1OS8A 3BTTE 2VVVA 2JH6D 1TNJA 2PV9B 1MQ6A 1MTNB 3MOCA 3PTNA 5EXNA 1JXPA 5C1XA 2Z9LA 2QCYA 1O33A 5GWZA 2JETC 3A7YA 2OXSA 1LHFH 3DUXH 3ZYDA 3MO3A 1JWTA 4XBBA 4OS2A 2FXRA 1N6YA 4IN1A 1G32B 2ZO3H 2HPQH 1Y8TA 2PGQB 4NA9H 3PM3A 2A7JA 1RIWB 4JMYA 1TNHA 3QK1A 5FBEA 1C5PA 1NZQH 2FX4A 3E16B 1H8IH 3UWIA 1G3EA 1HGTH 1XUIA 1M9UA 1DITH 3A8AA 3ODDA 1BUIA 2C8WB 4AYYB 1O5GH 1TQ0B 2R2MB 4K2YA 5EU8A 1GI6A 2GT7A 4BANB 1BTWA 1LVBA 1MAXA 1AQ7A 1YPLH 3BG4C 3CP7A 3O8BA 1UVUH 2QXHA 2PUXB 2GZ7A 2FPZA 3FZDA 2GV6A 3TK6A 3KQBA 2Z9KA 2SGDE 1UK4A 2AMQA 1C1VH 1TGCA 1GWAA 2TPIZ 2VIQA 2FTLE 1C4U2 2Y7XA 2FTMA 3UNQA 2FOFA 2BTCE 3FZZA 3W94A 3ENSB 4ISOA 4ZROA 1ZZZA 3ITIA 1V2VT 1S0QA 3SGQE 2WPLS 1GI7B 2ZTYA 4ABJA 2V3HH 1GMCG 4R0IA 2PKSB 1GHVH 3EAJA 4YLUA 5JBBS 3SJKA 1AWHB 3LGTA 3V0XA 2THFB 2FP7B 3PMBB 5EW2H 1WCZA 1MTVA 3TJOA 3O8CA 2Q6DA 4XBDA 1C2HA 4IC6A 1BMNH 1TBRH 1P09A 1KY9A 5IYTA 1SOZA 1UTLM 1HYLA 3ZV8A 4MG3A 1MZAA 1DDJA 3RXVA 3QGNB 1IQIA 1GBTA 1FAKH 5A0BA 4E7NA 2UUYA 4KTCA 2CMYA 1CVWH 1V3XA 4NIXA 4X1NU 3A80A 1P2MA 2XBWA 1BTHH 2NU3E 1HCGA 5A09A 1O3FA 1C5SA 1ZJKA 1QB9A 1Z1IA 1GI1A 2GVFA 4X8TH 1KXDA 4X1RU 3U8OH 1ZRKA 2VNTA 4HTCH 1SGFG 1K21H 1NM6A 2FEQH 1MD7A 2AFQB 3E91A 2SNVA 1SI5H 4GHQA 1RJXB 1TMTH 5GDSH 1GJBB 3MNSA 1SGRE 2O8TA 1NFXA 2PR3A 1O2MA 1W8BH 4CRFA 1SLVB 2WV4A 1C2LA 1XUHA 5H4IB 5EPNA 1O39A 3EA7A 2XC4A 5J4SA 1P57B 4IC5A 3UOPA 4X2VA 3SNBA 4BTUB 2BDIA 1HXEH 2JKHA 4MNYA 2A7HA 5E0GA 3L3TA 4MNVA 1XVOA 1SGEE 2BLOA 2AERH 5T6GA 4LZ1H 3LT3A 3RC5A 3HATH 2QAAA 2GP9B 2TGDA 1H9LB 2O8WA 1SBWA 2ZPSA 1WQSA 4UONA 1MCTA 1DWDH 3NWUA 1H8DH 3RXDA 2P59A 1ZSLA 3LIWA 1GBBA 1P2KA 1WYKA 4YESB 5LH8A 8GCHF 2PFEA 3UUZA 4UEHH 3DA9B 1OOKB 1DE7H 2ZCHP 3VB5A 5JBCS 1GMHF 4Q7ZA 1KXAA 1LTOA 4HGCA 2A5KA 1O3LA 3RXTA 1BZXE 5HXFA 4U30A 3KGPA 4DT7B 1W0ZU 1E36B 3PMJA 1OWIA 2QC2A 1GMDG 2A1DB 2HOBA 3C27B 1GHZA 1LKAA 3D65E 1BBRH 4Q2KA 3LC3A 2XXLA 4JYVH 4X2WA 2G4UA 3CS0A 1ANBA 2R3YA 4AX9H 3FVFB 1O2YA 1GJDB 1V2NT 1SSXA 2RG3A 2OC0A 1K1PA 1TGTA 2TGAA 4AN7A 3NKKA 3PMHB 2BD8A 4ZAEA 3DFJA 3M5OA 3A88A 4IW4E 1C1PA 3TJVA 3D23A 2O9QA 1HPGA 1O2OA 2Y7ZA 1W2KH 3A87A 4HI3A 1YLCA 1CA8B 4MVNA 1KDQB 2WPKS 3TK5A 1ANDA 1SGIB 4BAOB 1KTTB 1O5EH 2QXJA 3SBKA 1TRMA 1HIAB 1Z6JH 2ANKH 3QLPH 4ZHAA 4THNH 2AGGX 1TX8A 2UWPA 3Q3XA 4MNWA 4XFQA 3VB7A 1CHOF 5FAHA 2EA3A 2ZNKH 2C8XB 4OGYA 1UVPA 3SQEE 1CT4E 1A2CH 1JBUH 1AZZA 1WTHD 2M5TA 1KSNA 2PSYA 4Z0KA 1EPTA 1C5VA 1OWKA 1P9SA 1QGFA 1C4Y2 1AIXH 5LPFA 1AO5A 1F0TA 5FCKA 1FV9A 1GBIA 2BOHB 3NCLA 2FLRH 2ZDMA 1YPHE 1LVMA 5K0HA 3M7UA 3BTGE 4Y0YE 5ESBA 2B5TB 4XE4A 2ZHQH 2BX4A 1TNKA 3RLWH 4DG4A 3OTJE 4ZKRU 1DS2E 3MH4A 2O8MA 9LPRA 1S83A 2BXUH 2G8TA 3E1XB 2J2UA 3SGBE 4NZQA 1IAUA 3IG6B 4ABAA 3P6ZB 1HJ8A 4X6MA 3ZYEA 3PLPA 3PLKA 3ZZ6A 4BTTB 1A5HA 2B0FA 2VH0A 2YNBA 1NRNH 1EAXA 3GCHB 4XDEA 3ZZ7A 4E7RG 2SFAA 1GL0E 1BTXA 1UTNA 3RXBA 5A2MH 5JPMH 2ZQ2A 1K1MA 1DLEA 4FU8A 1XXFA 2V3OH 1GBLA 3VEQB 1CO7E 4CBOA 4FUEA 4ZMAH 1O2TA 3QDZB 1HUTH 4VGCC 4H42U 3ZVBA 1QBVH 5GXPA 1QJ7B 1YCPH 3BG4B 3A82A 1V2KT 2BDGA 2SGPE 4NG9H 1O2NA 1ARCA 1S6FA 1O3NA 2VIOA 2WUBA 1XUJA 1PQ8A 1W3CA 3HPTB 2HNTF 4ZXXH 1GBFA 6CHAC 1HV7A 4X8UH 1UVOA 3MU8A 1O3MA 3QN7A 2ZEBA 2EI7A 1V2OT 1O38A 2G4TA 4OS5A 1C1WH 3GY5A 1J14A 1A3BH 1AU8A 1FPHH 1O5FH 3GDVA 2ZF0H 4UFEH 4BAKB 1AFEH 1SGQE 1O36A 5BPEA 3TH4H 3QTVH 4AG1A 3UIRA 5E0JA 1IQGA 2ZCLP 1RRKA 3ODFA 3MU1A 1C1SA 4O03A 1RTFB 1TOMH 4IN2A 1SMFE 4O3UA 2ODYB 3SNAA 1K28D 2F83A 1OYQA 2P8OC 3OYPA 3PWCA 4UFDH 1BQYA 3QZQA 1AB9C 1K9OE 1GHYH 3DHKH 1C2EA 2ALVA 1L1JA 4OS1A 3SU6A 1AVGH 8KME2 4DIIH 2GCHG 3TGKE 2VIDA 4NFFA 1G3BA 2PKAA 3KQCA 1CQQA 2FWWA 1PQAA 2EI6A 5F8TA 3EYDA 2F9NA 1OSSA 5CHAC 1LMWB 3GICB 1SHHB 1YF4A 3RU4E 1QNJA 3GY2A 2ZGXH 3ZZDA 1TLDA 1PQ7A 1GDNA 1TRYA 2VGCB 1GMDF 4ISNA 1SPJA 4RKOB 4AFZA 4XBCA 1CE5A 1LHCH 1MTSA 1YPMH 1V2TT 2D8WA 2Z94A 1KTSB 1O31A 3SHAH 3S7HB 4Q80A 1QJ6B 5EG4A 3ZZ4A 3URDA 3KL6A 1GJCB 1PYTC 1GMHG 1V2MT 2XYAA 1NFYA 3S9BA 3I77A 1NRQH 1MZDA 1TALA 4I32A 1V2ST 3NUMA 1TBQH 1HB0B 3VB4A 4LOYH 3LONA 2ZECA 4FUFA 1ZOMA 5A8XA 4WMDA 3BIVH 1IQNA 2BY6X 1C2MA 5SGAE 4DOQA 4BXSA 3GCTG 3GY6A 3ATMA 3BF6H 4JYUH 1CHGA 2ZU3A 3SN8A 2ZPQA 4ZXYH 2G5VA 1IQHA 2Y5FA 1DICA 3DFLA 1V2QT 1GDUA 1O3BA 1SQOA 1QCPA 4D7FA 1QRXA 3FANA 1GHAG 1F92A 4DVAU 1MCVA 4I8JA 2H9HA 1AI8H 3BN9A 4NZLA 4CH2B 4HFPB 2ZDVH 1CSOE 2W5EA 2VWNA 5C2ZA 5JDUB 3BTHE 1DWBH 1CT0E 2PSXA 3GCTF 1GBJA 5HMAA 1BRAA 2ZHEH 2ZU4A 1P11E 1F7ZA 2G81E 3SV2H 1C5UA 4OS6A 1ZHRA 5EGMA 1UVTH 3M3VA 4WXIA 4A7IB 1QRZA 4FUIA 1ZR0A 2SGFE 3TVJB 2NU1E 4TY7A 1O3OA 1BITA 1GBHA 4BAQB 1GBAA 2P94A 4YOIA 1Z8IB 1OYTH 5GCHG 3ZVAA 1WAYB 3LDXH 3T26A 1ABIH 3CS7A 3E6PH 3ZZ9A 3T28A 1IQKA 3HKJB 2WINI 4U2WA 1SGTA 3BSQA 4YO9A 2ZP0H 3E90B 3SQHE 2F9BH 1O2GH 3SUGA 1THRH 1YBWA 1MU8B 3S0NA 3GY4A 4B2BA 1GI8B 2A0QB 1H9IE 1EPTB 1TNGA 3KQDA 1Y5BT 1EP5A 3RMOH 2QY0B 3A83A 2GX4A 4IBLH 4AGJA 2P95A 1TWXB 4D9RA 1BIOA 2BQ7B 1QA0A 2Z3EA 1E38B 4NA7A 1GBMA 4ZKSU 1P06A 2O8LA 1H9HE 4KELA 1A7SA 2DE9A 5GIBA 1TB6H 4IMQA 1Z7KA 1C5YB 3A86A 3GCNA 2BVRH 1DXPA 2FI5E 4E05H 1PPCE 2BVSH 1FY1A 2NU0E 3NZIA 1G37A 2QXGA 1AMHA 4SGAE 1IQFA 1EJAA 1KLTA 4GAWA 1IOEA 4WXVA 3O8DA 1QL8A 1A46H 4NA8A 1O0DH 3ZZCA 4BOHA 2G51A 1FONA 1XKBC 3A7TA 1W10U 2ALPA 1GHBG 2FOAA 1P01A 3VGCB 1O2WA 4CR9A 2EI8A 4ZKOU 1DLKB 2J95A 1UTJA 3A7XA 1WUNH 1W7GH 1Z8RA 4MQAA 2WPMS 2AS9A 3SNDA 3F1SB 1T8NA 2BM2A 1ELTA 1LPZB 2BZAA 3SHCH 1OWEA 1TFXA 3HGNA 2C93B 2BD5A 3B9FH 1FJSA 4D8NA 1Y3VA 1AB9B 2HLCA 4BAHB 1C5RA 5C5NA 2J94A 1WBGB 3VFEA 4AGKA 1ZJDA 1NROH 2XC5A 2B9LA 3A8CA 4O9VA 2P93A 2ZFPH 1P05A 3UPEA 3UR6A 4F4OC 2F9OA 1TPPA 1WOFA 1BCUH 2ANMH 1F5RA 1GVLA 6CHAB 1TA6A 1ZYOA 2BD3A 1S82A 2FOHA 1ESAA 4KTUA 5AVDA 4ISHH 1EX3A 1MKXK 2OQUA 1XMNB 1JRSA 2G00A 2GMTC 4JYTA 1OKXA 1U6QA 4INKA 5A8YA 1HAVA 1LQDB 1GI5A 5C67A 3M5NA 4WWYA 1O5CB 4FUBA 4IGDA 4ESTE 1QURH 4CHAB 1SHYA 3SU5A 4Y8XA 2QV1A 4I8GA 3EQ0H 2A45B 5EXLA 2FOGA 1LQEA 3EDXB 3PV4A 2OC8A 3HGPA 1SOTA 2CGAA 2ZWLH 2GCHF 4MPXA 1P10A 1TPSA 3RLYH 4TPIZ 1Z71A 3M35A 2BLQA 4NGAH 1S6HA 2BY9X 3BTQE 3ATWA 3AW0A 2C8ZB 2XCNA 1ELFA 2V0BA 2WYGA 1P2QA 1EAIA 3I78A 5EPYA 1EZUC 1YPEH 1VITG 1XUGA 5L30H 1BA8B 4KP0A 2GGVB 2UWOA 1O3GA 4ZHLU 2PKAB 3D62A 2VGCC 3HKIB 5TJXA 2PHBA 4K1TA 2ANYA 1OP2A 4ABHA 1K1OA 4RKJB 3SGAE 1DWCH 4NIVA 2JH5D 2BLWA 3MO6A 3V13A 4X6OA 1ZRBA 2G55A 3RXPA 3QZRA 1SVPA 1AFQC 1ZTKA 1BJVA 4INLA 5FPTA 1W11U 1WQVH 1YLDA 1J17T 3TPIZ 3JZ1B 1CBWB 1P2NA 3S9CA 3KEEA 3K2UA 1O2IA 4D76A 1QR3E 3GOVB 3Q3KA 2P16A 1V2JT 3IITA 4JZIA 1Q2WA 1PPZA 1PQ5A 2PGBB 1ACBE 2ZTXA 2SGAA 5HYOA 2Z3CA 1FAXA 1GGDB 4Y7BA 2AYWA 1K1NA 2ZFFH 1FDPA 1LHDH 1XVMA 2F9VA 2BYAX 2Y6TA 3BTFE 2V35A 2OCVB 1HXFH 2OUAA 1E0FD 1KXCA 1VITH 3KCGH 3TLOA 3S9AA 4CRCA 1ANCA 3MFJA 4LXBH 1KIGH 3SU3A 2ZC9H 3GDUA 3SV6A 1D6WA 3SW2B 1HAGE 1N8OB 4A6LA 1GDQA 1MMJN 3TGJE 3M37A 3A8BA 1EJNA 1CHOG 1YC0A 3SUEA 1ELAA 1UO6A 1K1IA 4NCYA 1O32A 1OP0A 2FI4E 3RXJA 1DX5M 3BEIB 1A0HB 2FIRH 2P3TB 3SU2A 1VCQA 1F5KU 3RXEA 4WJG2 1FY8E 4ISLA 4NSVA 3T5FH 4I8HA 4WMEA 1NS3A 5T6DA 3O8RA 2BLVA 1TA2A 4YLQH 5HGGA 1IHTH 1RIWC 2ILNA 3TIUA 1E35B 2PUQH 1DVAH 2ZGJA 3Q77A 1MUEB 5C5OA 1B0EA 5ABWA 1J8AA 1MKWH 4MTBA 4ZKNU 1GI0A 3QTOH 1GI3A 2J92A 1O5BB 4OS4A 5DP5A 2VWOA 1ETSH 2WPJS 4ABIA 5GCHF 3BIUH 1PPGE 4GHTA 1ESBA 3M3TA 2R0KA 4CH8B 2BHGA 1DANH 1ZTLA 2J4IA 5PTPA 1HJAB 2D1JA 4X0WU 2TBSA 2DE8A 2ULLA 2UUKB 3RXFA 4GCHF 2Q6FA 1UVSH 1UTQA 3VGCC 3ZZ5A 3H7TA 2C4FH 2HRVA 2A31A 1RTLA 4A1XA 1O2XA 1ZGIA 3LGYA 1RFNA 5JB8S 4DW2U 2G52A 2STBE 3K65B 3H5CB 1SC8U 3SORA 2CJIA 1O2QA 3A8DA 3T27A 4X6PA 4I33A 4YOGA 1WTGH 5E8EH 1V2RT 1OWHA 3E8LA 1F0RA 4AZ2B 1T32A 3VB6A 5HM9A 3ESTA 3UQOA 2ZHFH 3RM0H 8ESTE 1EB1H 3PTBA 1EATA 3K6YA 1C1QA 1O3AA 4VGCB 3LOXA 4JK5A 1NESE 3AVZA 1NT1A 1BMAA 1T8MA 3ZV9A 3IWMA 1NY22 1YPJH 1FPCH 1X7AC 2BVXH 1LHGH 2HWLB 1F0SA 1BB0B 1ID5H 2RA3A 3MNXA 2VVCA 2XCFA 3U8RH 1RXPA 1ZGVA 1NU7B 2XWAA 1QY6A 1Y3XA 1H1BA 1L0ZA 2H2ZA 4SGBE 1W0YH 4FVBA 4IMZA 1QQUA 3I29A 3SO3A 3ZVCA 1BBRK 1GCDA 1O5AB 3NPSA 2ZHWH 1PYTD 3TH2H 3G01A 5J4QA 4I8KA 2FOEA 4E06H 2TGTA 1VGCB 3SV8A 2P8OB 2VIWA 4K60A 1O3CA 5FPYA 4Y0ZE 4A5TS 1THSH 5CHAB 3STIA 4I8LA 3RXMA 1L2EA 2C90B 1SQTA 2GMTB 3BG8A 3SI4H 1FY4A 3BTEE 1GG6B 3FP6E 4FU9A 5BRRE 3NK8A 2ZKSA 2Z9JA 1ELCA 2XWBI 4PROA 4AG2A 3LGWA 5G4BA 4YOJA 1ETTH 2GD4B 2GDEH 4TWYA 4YZUA 3UY9A 1GJAB 5A8ZA 3ZZ3A 1G36A 3MYWA 5DP6A 2D2DA 1EP6A 5C20A 1LVYA 4A92A 3UREA 5A0CA 4JZ1A 2ZDKA 1HRTH 1SLUB 4WH8A 2GV7A 1QL9A 1G9IE 2WPIS 3MNCA 3SI3H 5DO4H 5EQQA 2HGTH 4ABGA 3CENA 1ZSJA 1LKBA 5GJ4B 1P04A 3A7VA 1IQEA 4LZ4B 1GCTC 5L2ZH 1B0FA 1BDAA 4U01A 3KNXA 2HALA 3TH3H 4AOQA 2O8UA 3E0PB 4DIHH 5I25A 1H4WA 1IQLA 1P03A 3R3GB 1QJ1B 4Y7AA 3L33A 1ZSKA 2ZFQH 4JK6A 2FOMB 8GCHG 3DT0H 1GI4A 5AF9H 3RXRA 2QGRA 1FMGA 1BTZA 2BD9A 3UNRA 1UCYE 2ZI2H 1MH0A 1O2JA 3V7TA 3SNCA 4DJZB 1S84A 2ESTE 2W26A 4FUGA 5F8ZA 4X1PU 1YCPK 4FUJA 1YPHC 1K1LA 3K9XB 1QBNA 2ZIQH 1Z1JA 2FESH 2A5AA 3F9FA 4O3TA 3UQVA 1PPFE 1FLEE 5L6NH 2QF0A 1Y5AT 1XXDA 2ASUB 3ZVDA 2IPHA 3ZVFA 1N8OC 4KTSA 3OY6U 2ZDLA 2H6MA 1SB1H 2GZ9A 1HJAC 4UDWH 1NO9H 4IS5A 1EASA 5FBIA 4RSPA 2VU8E 2VWLA 1AHTH 3P8OA 2BMGB 1RS0A 2Y82A 1B7XB 1EPTC 3RUOA 2DUCA 1MTNC 1TMUH 1Y59T 2FOCA 4Q7XA 5CE1A 3RM2H 4M7GA 3MI4A 1T31A 3C1KA 3BV9B 3SUFA 3SOSA 1W7XH 3Q00A 2F3CE 1C2GA 1P2JA 2A4GA 2FDAA 2ZA5A 1J9CH 2KAIB
chains in the Genus database with same CATH superfamily
1SFQB 3BEUA 1QQ4A 1O3JA 4HZHA 1VKYA 1C1RA 1EAWA 1QB6A 2A2QH 3BTWE 2H5CA 2ZFSA 3DSGA 3PLBA 3BTDE 1AD8H 2IJOB 1QFKH 4H6SB 1TQ7B 3UOUA 5ESTE 1GJ5H 3P95A 4BTIB 2UWLA 1ELGA 3ATLA 2BDHA 3PRBA 5HM2A 4Y71A 1INCA 4F49A 1GI9B 5EXMA 1DUEA 1HBTH 1G2MA 4B74A 2ZGBH 1DFPA 1LO6A 4NWKA 3LU9B 2H9TH 1GBCA 1ZHMA 3M5MA 4MLFB 3K6ZA 1MBQA 2K1QA 3L6PA 2PWXA 2FOBA 1KLIH 3SU4A 1UJ1A 1Y3UA 4X1QU 1GJ7B 3MU0A 3U1JB 3ZIAD 1EOJA 1FIWA 1GMCF 3HK3B 1SGFA 1TOCB 5DGJA 2VB0A 1O35A 4FU7A 5DP4A 3QX5H 4BNRA 1XUKA 2KAIA 1ABJH 2B7DH 2TGPZ 2HNTE 4B76A 1UCYH 1D3QB 2ZG0H 1D3PB 2ZTZA 3S7KB 4NIWA 2CN0H 3QO6A 1BJUA 3M3SA 2IJD1 3M61U 5TCCA 1XKAC 1ORFA 1DXWA 1J16A 2A4OA 3PO1C 1DY9A 2AHME 1SGYE 2KCPA 2A5IA 3D49H 3P92A 1BMLA 5E0HA 1UTMA 1RGQA 5GNDA 2R2WU 1O30A 4HG6A 2AMDA 4K8BA 2WV5A 1FUJA 1FN8A 4CRAA 2AMPA 1PFXC 1C4V2 6ESTA 2KZ4A 3V3MA 1O5DH 1YCPM 4Z1MD 1HAYB 3U8TH 3N7DA 1OX1A 1N6XA 2HVYB 1LPGB 1BMMH 5C1YA 1HAOH 4ABFA 7GCHF 3M5LA 4Y76A 3U69H 1AVXA 2BQ6B 4ZCNA 4GSOA 5E2PA 1O3IA 1A0LA 1HAZB 4WY3A 1NRSH 2FZZA 1BTYA 4B75A 1VGCC 2Z7FE 3GYLB 3TU7H 1O34A 5ETXA 1T4VH 1P12E 5LGOA 2BY5X 1ELEE 1Q31A 2Q1JA 4Y6DA 1J15A 1TX6A 2R9PA 2WPHS 2W6JD 5DSFA 2ZHDA 2PLXA 5CMXH 4TWWA 3TNTA 3OY5U 3F9GA 3F6UH 1TAWA 3MH7A 1C5ZB 3U1IB 1C5TA 1S85A 2FMJA 1S5SA 4CRDA 1FNIA 2L6OA 3FN8A 4BAMB 2I6QA 3TNSA 1GG6C 1FXYA 1BTUA 1C5OH 2Z9IA 3KIDU 1WV7H 1DSTA 1TMBH 2IOTA 3UB0A 4WF8A 4MPVA 1XUFA 1HJ9A 1UHBB 3RP2A 1C5MD 3AAUA 2SNWA 1VJAU 2QF4A 2W7UA 5FXLA 3RMLH 1WSSH 1ZPBA 4UE7H 3GCOA 1C9TA 1O3PB 3MH5A 1S81A 2RA0A 3W95A 2NWNA 3AASA 3STJA 1O3EA 1QRWA 5DJ7A 1OWDA 1CBWC 2XBVA 3ZZAA 3SJOA 3OE7D 1CT2E 1FY3A 2ZPRA 3RU4T 1GL1A 1YPKH 4I31A 5IDKA 2AEIH 5JBTA 1WU1A 1UK2A 2Y81A 5F03A 2EY4C 3M7TA 4K69A 1CA0C 4B6FA 4BXWA 2FODA 2UUJB 1DM4B 2ZDAH 4K8YA 4TPYA 1GBEA 3SZNA 3P17H 3SJ9A 1C1NA 1KYNA 2XRCA 1C5LH 1C2KA 1AE8H 2SGQE 1SGNE 4Y8YA 1BHXF 5EQRA 3DD2H 1Q3XA 2C8YB 4DCDA 2JETB 2XNDD 1O2VA 3FAOA 4UD9H 4ZH8A 1DOJA 3EE0B 3BEFB 4DGJA 4YM9A 4DURA 1DUAA 1KLJH 5FPSA 1KXEA 1GBDA 2WHXA 3ELAH 5FCRA 1JIMA 1G30B 4FOUC 1T8OA 1UTPA 1BRBE 1EZQA 3OSYA 3KQEA 3SJIA 2OC7A 6GCHF 1OP8A 1TONA 1TRNA 1HAXB 4X8VH 2UUFB 2BDAA 2D26C 2XC0A 3TK9A 2OD3B 4XOJA 2BZ6H 4GVUA 3F2FA 7KMEH 2ZU1A 4DY7B 4Y10E 4A1VA 5B6OA 1YYY1 5A0AE 2FX6A 1Z6EA 4D7GA 2FYQA 4Y8ZA 2VIVA 2BY7X 2QYIA 4AB9A 1HLTH 3R0FA 2ZCKP 3RXUA 2Y80A 1L4DA 2VINA 1HIAA 3N7EA 2BQWB 1SGDE 1C2DA 2VIPA 3M36A 2Y5HA 4AFQA 1P3CA 2VBCA 1KDQA 2LPRA 3U28C 3U9AH 1D6RA 1LPKB 3SJ8A 1WXRA 2PKSC 1UTKA 2QN5T 1HAHH 1NU9A 1ZTJA 1SLWB 3ATIA 3RMNH 4TY6A 3RDZA 5TCAA 2JH0D 3E3TA 6LPRA 3MU5A 5JYIA 2GTBA 4J1YA 4ASUD 3PWBA 3SYJA 1C5NH 1C9PA 2QA9E 3PMAB 4GLYA 1DY8A 2GT8A 4CBNA 1F2SE 1PJPA 2A7CA 1AKSA 1UHBA 1EOLA 1CGJE 4K5ZA 3PYHA 1A61H 5DPAA 1ZMNA 3S69A 3ZZ8A 1HAVB 2STAE 2GKVE 3MH6A 1NFUA 1MTWA 2KCAA 3MTYA 3LC5A 4UFGH 1FN6A 3QUMP 1BTPA 1D3DB 1UK3A 3AW1A 1ZPCA 1PPEE 4JZEH 2KFWA 1NRPH 1NTPA 3RXGA 3NXPA 2HNTC 3M7QA 5LPRA 1UCYK 1ZLRA 3OX7U 1AUJA 2CF8H 1KXFA 5KEDA 2QIQA 2KR7A 1CGHA 2OP9A 1UMAH 2OBQA 1B5GH 4X6NA 4FVDA 3SV7A 4TSFD 1CU1A 3EA9A 1VITF 2R3UA 4ABDA 6GCHG 5EJLA 4H4FA 3OU0A 1K2I1 2ZGCA 3WWFA 1JOUB 2HPPH 2ODPA 5E2OA 1GVZA 9ESTA 1GBKA 1Z8GA 1A3EH 2OQ5A 1V2WT 4AB8A 4MPUA 3B8JA 3RXKA 3KHVA 4DT4A 1QTFA 1ESTA 3HK6B 1IQMA 1TPOA 1NRRH 1NN6A 3PO1B 5AFYH 1V2LT 2F9UA 4B2CA 4MDSA 1PPHE 4B6EA 1EQ9A 2ZGHA 3F9EA 1V2PT 3U98H 1C5WB 1YKTA 1ZMJA 2OC1A 4JCNA 1LVOA 4B1TA 1TNLA 1OWJA 1O2ZA 3A81A 3FP7E 2IN2A 3UFAA 1GJ6A 3TJNA 2OLGA 3BTKE 3PB1E 4K1SA 1W12U 1AUTC 1AFQB 1SR5C 1EUFA 5F8XA 4MPWA 1MKWK 2HLDD 1E1RD 2BD4A 4AFUA 3LJJA 4QT8C 1FY5A 1DPOA 2FS8A 2GDDA 2W6ID 1ZHPA 2XTTB 2ANWA 1T7CA 3UWJH 1QIXB 1GHWH 3LGUA 1MKXH 3ATKA 1C2JA 3F9HA 1EKBB 5T3HA 1GHBF 2RCEA 8LPRA 1IHSH 1GJ8B 3MWIU 1BRCE 3GY8A 2AIQA 2Z3DA 1O2RA 1O2LA 5DP8A 1GGDC 2YOLA 4UFFH 2AH4X 3SNEA 1TIOA 4YT6H 1FIZA 3EGKH 2A4QA 1W13U 2GCTC 1O3KA 2CXVA 3ZZBA 1AGJA 4K3JA 4AYVB 3KYGA 4NFEA 1AWFH 2PTCE 1GVKB 5AHGH 2CHAC 2F9PA 1IQJA 2AGIX 1TNIA 5EODA 1L1GA 3LGIA 1A0JA 1C1TA 2P3UB 2J97A 3MMGA 1A1RA 3VXEH 5FX5A 3RMMH 3LPRA 3QWCH 3BTME 1ELBA 4B2AA 1RTKA 4YTAA 2FYRA 4Z6AH 1O3HA 2GZ8A 1LDTT 2CF9H 4ZHMU 3VB3A 3WY8A 5C3NA 7ESTE 4CRBA 4K1EA 3LGVA 4AORA 4WVPE 1AN1E 3RXQA 2OINA 4JZDH 1XX9A 2G5NA 5CHBA 5FHTA 1EZSC 1GJ4H 2SGEE 2WUCA 1HFDA 3P70B 1Z8JB 3GYMA 2XNIA 1SGCA 3RXAA 5LPEA 1MU6B 2YNAA 1NC6A 2V7QD 1Y3WA 5DK1A 2VVUA 1HAPH 3UNSA 1D9IA 4ABBA 3OEED 4GUXA 1CA0B 1AE5A 1DSUA 4XSKU 3RC6A 3T2NA 4NSYA 1W14U 3T62A 3TGIE 5GPIB 2RDLA 2W3IA 1P3EA 2TIOA 1C5XB 1YGCH 2BD2A 4X2XA 3UR9A 5K7RA 1D3TB 1QB1A 3Q3YA 2XBYA 2W3KA 5T6FA 1TGSZ 3UAIC 2B8OH 1QA7A 4KGAA 2LNCA 3T25A 4CR5A 3MHWU 2BDYA 3QGJA 1YPGH 1RD3B 4ABEA 2Z9GA 1MTUA 3P8FA 3GCHC 4R8TB 1EAUA 2C3SA 1O2HA 3GY3A 1UTOA 2H5DA 4FXGH 4A1TA 2A4RA 1BOQA 1LHEH 3E0NB 4INHA 4ISIH 4AFSA 1GPZA 5JB9S 3GY7A 3V12A 1BRUP 1P02A 4NIYA 1A5IA 2H1UA 5F6MA 1ELVA 1O2KA 2TRMA 4J2YB 3UTUH 2Y5GA 2PW8H 3RXLA 2FLBH 1EXFA 1C5QA 1D4PB 1FQ3A 4X2YA 1FI8A 5FX6A 1ELDE 5DP3A 1EZXC 1CGIE 2VH6A 4CRGA 3RXCA 2ZU5A 2AGEX 1JIRA 3A7WA 5C1UA 4I7YH 2J34A 1N1LA 1C1OA 1TYNA 2V6NA 3A89A 3RXSA 3GS9A 3FKSD 4O97A 1GHXH 1TGNA 4H6TA 3PROA 2A2XH 4U32A 2BX3A 2ODQA 1SQRA 1L4ZA 1PPBH 1HAIH 1KXBA 2YMSB 3B23B 3MO9A 2XBXA 3GISB 2ZDNA 3RXIA 1MAYA 3SU0A 1C1UH 2PP6A 1ETRH 3F68H 1C2IA 1T8LA 2A32A 2PTNA 1V2UT 1HDTH 1XM1A 3SV9A 1P0SH 3TJUA 4X8SH 1TABE 4OGXA 2WPDD 2BXTH 4D9QA 1VZQH 5KECA 1TE0A 2VWMA 2BD7A 4ACBA 3A7ZA 2AIPA 4FUDA 3URCA 2CV3A 1P2OA 4Y79A 4OS7A 1G3CA 2F91A 2Q6GA 4X1SU 3VPKA 4B71A 3P8NA 2BDBA 2OBOA 5DKMA 5I46H 1NFWA 2BB4A 5C0TA 1P9UA 2F43B 3P8GA 2H9EH 5AFZH 3ZVEA 1THPB 1LCYA 1HNEE 1QBOA 4CREA 4M9FA 3MU4A 1JRTA 2FM2A 2QF3A 2VJ1A 1QL7A 1TBZH 2BDCA 1O37A 1BHXB 1BBRE 1E34B 1K1JA 1MBMA 4WH6A 2ZU2A 4KKDA 3RXHA 2ZZUH 1SGPE 2Z6BD 4YT7H 2NU2E 4CHAC 5L2YH 1A5GH 3KYFA 4ZUHA 3RC4A 4TYDA 4XRNA 2YMSD 1YM0A 2BY8X 3FFGA 1YP9A 3JZ2B 2R0LA 1DWEH 1SL3A 2EC9H 3LKWA 1GI2A 2ZQ1A 3LJOA 7LPRA 1MQ5A 4JZFH 1ANEA 2P3FH 3F0OA 1AVWA 5DP7A 1G2LA 4B73A 1KMHB 1NPMA 5DG6A 1FZZA 1DT2A 1Y3YA 5DN6D 4Q7YA 1ZPZA 1GCTB 3VXFH 3N7OA 3GDSA 3LH3A 1AKSB 4FUCA 3RXOA 1E37B 3A85A 4Y11E 1GHAF 1OXGA 1AZ8A 1K22H 4FETA 5EOKA 5EW1H 1JMOH 1EJMA 2FI3E 7GCHG 1MD8A 1VCWA 1VR1H 5EJ1A 1F5LA 2QXIA 1C2FA 1Y5UT 3EA8A 1TPAE 1A4WH 1SLXB 3FP8E 3LH1A 3Q76A 3T29A 2I6SA 4MNXA 4GCHG 4NWLA 1O3DA 1OPHB 4WMFA 1P2IA 3SU1A 1QHRB 3WW7A 1VJ9U 5JBAS 1O2UA 2L74A 1V6DA 3AAVA 2XW9A 1EB2A 3TITA 4GPGA 1S6LA 2NU4E 2GCTB 4LK4A 3RU4D 3SUDA 4ASHA 1ZMLA 1GJ9B 2FS9A 2ZFTA 3KF2A 1SKYE 1O2PA 4RN6A 1BT7A 1TGBA 1NBMD 1SG8B 2FO9A 1TX7A 5DP9A 2WYJA 1F0UA 2CHAB 1G3DA 1S0RA 2EEKA 5EQSA 3ZVGA 3MNBA 2OTVA 2W7SA 1SFIA 3A84A 1ARBA 2J38A 1L1NA 1P8VC 4FUHA 2BOKA 5C0UA 1AY6H 2J9NA 3H7OA 1VCPA 3KN2A 2LP6A 2ZFRH 1O2SA 1SQAA 1C1MA 1T4UH 2HVXA 1OS8A 3BTTE 2VVVA 2JH6D 1TNJA 2PV9B 1MQ6A 1MTNB 3MOCA 3PTNA 5EXNA 1JXPA 5C1XA 2Z9LA 2QCYA 1O33A 5GWZA 2JETC 3A7YA 2OXSA 1LHFH 3DUXH 3ZYDA 3MO3A 1JWTA 2J5UA 1YLNA 4XBBA 4OS2A 2FXRA 1N6YA 4IN1A 1G32B 2ZO3H 2HPQH 1Y8TA 2PGQB 4NA9H 3AK5A 3PM3A 2A7JA 1RIWB 4JMYA 1TNHA 3QK1A 5FBEA 1C5PA 1NZQH 2FX4A 3E16B 1H8IH 1W0KD 3UWIA 1G3EA 1HGTH 1XUIA 1M9UA 1DITH 3A8AA 3ODDA 1BUIA 2C8WB 4AYYB 1O5GH 1TQ0B 1OHHD 2R2MB 4K2YA 5EU8A 1GI6A 2GT7A 4BANB 1BTWA 1LVBA 1MAXA 1AQ7A 1YPLH 3BG4C 3CP7A 3O8BA 1UVUH 2QXHA 2PUXB 2GZ7A 2FPZA 3FZDA 2GV6A 3TK6A 3KQBA 2Z9KA 2SGDE 1UK4A 2AMQA 1C1VH 1TGCA 1GWAA 2TPIZ 2VIQA 2FTLE 1C4U2 2Y7XA 2FTMA 3UNQA 2FOFA 2BTCE 3FZZA 3W94A 3ENSB 4ISOA 4ZROA 1ZZZA 3ITIA 1V2VT 1S0QA 3SGQE 2WPLS 1GI7B 2KCYA 2ZTYA 4ABJA 2V3HH 1GMCG 4R0IA 2PKSB 1GHVH 3EAJA 4YLUA 5JBBS 3SJKA 1AWHB 2EQNA 3LGTA 3V0XA 2THFB 2FP7B 4TT3D 3PMBB 5EW2H 1WCZA 1MTVA 3TJOA 3O8CA 2Q6DA 4XBDA 1C2HA 4IC6A 1BMNH 1TBRH 2WV9A 1P09A 1KY9A 5IYTA 1SOZA 1UTLM 2CK3D 1HYLA 3ZV8A 4MG3A 1MZAA 1DDJA 3RXVA 3QGNB 1IQIA 1GBTA 1FAKH 3OAAD 4E7NA 2UUYA 4KTCA 2CMYA 1CVWH 1V3XA 4NIXA 4X1NU 5A0BA 3A80A 1P2MA 2XBWA 1YY3A 1BTHH 2NU3E 1HCGA 5A09A 1O3FA 1C5SA 1ZJKA 1QB9A 1Z1IA 1GI1A 2GVFA 4X8TH 1KXDA 4X1RU 2JJ2D 3U8OH 1ZRKA 2VNTA 4HTCH 1SGFG 1K21H 1NM6A 2FEQH 1MD7A 2AFQB 3E91A 2SNVA 1SI5H 4GHQA 1RJXB 1TMTH 5GDSH 1GJBB 3MNSA 1SGRE 2O8TA 1NFXA 2PR3A 1O2MA 1W8BH 4CRFA 1SLVB 2WV4A 1C2LA 1XUHA 5H4IB 5EPNA 1O39A 3EA7A 2XC4A 2GJGA 1P57B 4IC5A 3UOPA 5J4SA 4X2VA 3SNBA 4BTUB 2BDIA 1HXEH 2JKHA 4MNYA 2A7HA 5E0GA 3L3TA 4MNVA 1XVOA 1SGEE 2F4LA 5HIZA 2BLOA 2AERH 5T6GA 4LZ1H 2LELA 3LT3A 3RC5A 3HATH 2QAAA 2GP9B 2TGDA 1H9LB 2O8WA 1SBWA 2ZPSA 1H8ED 1WQSA 4UONA 1MCTA 1DWDH 3NWUA 1H8DH 3RXDA 2P59A 1ZSLA 3LIWA 1GBBA 1P2KA 1WYKA 4YESB 5LH8A 8GCHF 2PFEA 3UUZA 4UEHH 3DA9B 1OOKB 1DE7H 2ZCHP 3VB5A 5JBCS 1GMHF 4Q7ZA 1KXAA 1LTOA 4HGCA 2A5KA 1O3LA 3RXTA 1BZXE 5HXFA 4U30A 3KGPA 4DT7B 1W0ZU 5B6LA 1E36B 3W1EA 3PMJA 1OWIA 2QC2A 1GMDG 2A1DB 2HOBA 3C27B 1GHZA 1LKAA 1QZ8A 3D65E 1BBRH 4Q2KA 3LC3A 2XXLA 4JYVH 4X2WA 2G4UA 3CS0A 1ANBA 2R3YA 4AX9H 3FVFB 1O2YA 1GJDB 1V2NT 1SSXA 2RG3A 2OC0A 2QF5A 1K1PA 1TGTA 2TGAA 4AN7A 3NKKA 3PMHB 2BD8A 4ZAEA 1H8HD 3DFJA 3M5OA 3A88A 4IW4E 1C1PA 3TJVA 3D23A 2O9QA 1HPGA 1O2OA 2Y7ZA 1W2KH 3A87A 4HI3A 1YLCA 1CA8B 4MVNA 1KDQB 2WPKS 3TK5A 1ANDA 1SGIB 4BAOB 1KTTB 1O5EH 2QXJA 3SBKA 1TRMA 1HIAB 1Z6JH 2ANKH 3QLPH 4ZHAA 4THNH 2AGGX 1TX8A 2UWPA 3Q3XA 4MNWA 4XFQA 2WZQA 1K0HA 3VB7A 1CHOF 5FAHA 2EA3A 2ZNKH 2C8XB 4OGYA 1UVPA 3SQEE 1CT4E 1A2CH 1JBUH 1AZZA 1WTHD 2M5TA 1KSNA 2PSYA 4Z0KA 1EPTA 1C5VA 1OWKA 1P9SA 1QGFA 1C4Y2 1AIXH 5LPFA 1AO5A 1F0TA 5FCKA 1FV9A 1GBIA 2BOHB 3NCLA 2FLRH 2ZDMA 1YPHE 1LVMA 5K0HA 3M7UA 3BTGE 4Y0YE 5ESBA 2B5TB 4XE4A 2ZHQH 2BX4A 1TNKA 3RLWH 3DSPA 4DG4A 3OTJE 4ZKRU 1DS2E 3MH4A 2O8MA 9LPRA 1S83A 2BXUH 2G8TA 3E1XB 2J2UA 3SGBE 4NZQA 1IAUA 3IG6B 4ABAA 5C17A 3P6ZB 1HJ8A 4X6MA 5HIYA 3PLPA 3ZYEA 3PLKA 3ZZ6A 4BTTB 1A5HA 2B0FA 2VH0A 2YNBA 1NRNH 1EAXA 2K8IA 3GCHB 4XDEA 3ZZ7A 4E7RG 2SFAA 1GL0E 1BTXA 1UTNA 3RXBA 5A2MH 5JPMH 5T1VA 2ZQ2A 1K1MA 1DLEA 4FU8A 1XXFA 2V3OH 1GBLA 3VEQB 1CO7E 4CBOA 4RT1A 4FUEA 4ZMAH 1O2TA 3QDZB 1HUTH 4VGCC 4H42U 3ZVBA 1QBVH 5GXPA 1QJ7B 1YCPH 3BG4B 3A82A 1V2KT 2BDGA 2SGPE 4NG9H 1O2NA 1ARCA 1S6FA 1O3NA 2VIOA 2WUBA 1XUJA 1PQ8A 1W3CA 3HPTB 1UW7A 2HNTF 4ZXXH 1GBFA 6CHAC 1HV7A 1MABB 4X8UH 1UVOA 3MU8A 1O3MA 3QN7A 2ZEBA 2EI7A 1V2OT 1O38A 2G4TA 4OS5A 1C1WH 3GY5A 1J14A 1A3BH 1AU8A 1FPHH 1O5FH 3GDVA 2ZF0H 4UFEH 4BAKB 1AFEH 1SGQE 1O36A 5BPEA 3TH4H 1W0JD 3QTVH 3UIRA 5E0JA 4AG1A 1IQGA 2ZCLP 1RRKA 3ODFA 4RI0A 3MU1A 1C1SA 4O03A 3F2HA 1RTFB 1TOMH 4IN2A 1SMFE 4O3UA 2ODYB 3SNAA 1K28D 2F83A 1OYQA 2P8OC 3OYPA 3PWCA 3FOAA 1BQYA 3QZQA 4UFDH 1AB9C 1K9OE 1GHYH 3DHKH 1C2EA 2ALVA 1L1JA 4OS1A 3SU6A 1AVGH 8KME2 4DIIH 2GCHG 3TGKE 2VIDA 4NFFA 1G3BA 2PKAA 3KQCA 1CQQA 2FWWA 1PQAA 2EI6A 5F8TA 3EYDA 2F9NA 1OSSA 5CHAC 1LMWB 3GICB 1SHHB 1YF4A 3RU4E 1QNJA 3GY2A 2ZGXH 3ZZDA 1TLDA 1PQ7A 1GDNA 1TRYA 2VGCB 1GMDF 4ISNA 1SPJA 4RKOB 4AFZA 3FO8D 1CE5A 4XBCA 1LHCH 1MTSA 1YPMH 5HKKD 1V2TT 5CDFE 2D8WA 2Z94A 1KTSB 1O31A 3SHAH 3S7HB 4Q80A 1QJ6B 5EG4A 3ZZ4A 3URDA 3KL6A 1GJCB 1PYTC 1GMHG 1V2MT 2XYAA 1NFYA 3S9BA 3I77A 1NRQH 1MZDA 1TALA 4I32A 2RFKC 1V2ST 3NUMA 1NBME 1TBQH 1HB0B 3VB4A 2KCOA 4LOYH 3LONA 2ZECA 4FUFA 1ZOMA 5A8XA 4WMDA 3BIVH 1IQNA 2BY6X 3WWBA 1C2MA 5SGAE 4DOQA 4BXSA 3GCTG 3GY6A 3ATMA 3BF6H 4JYUH 1CHGA 2ZU3A 3SN8A 2ZPQA 4ZXYH 2G5VA 1IQHA 2Y5FA 1DICA 3DFLA 1V2QT 1GDUA 1O3BA 1SQOA 1QCPA 4D7FA 1QRXA 3FANA 1GHAG 1F92A 4DVAU 1MCVA 4I8JA 2H9HA 1AI8H 3BN9A 4NZLA 4CH2B 4HFPB 2ZDVH 1CSOE 2W5EA 2VWNA 5C2ZA 5JDUB 3BTHE 1DWBH 1CT0E 2PSXA 3GCTF 1GBJA 5HMAA 1BRAA 2ZHEH 2ZU4A 1P11E 1F7ZA 2G81E 3SV2H 1C5UA 4OS6A 1ZHRA 5EGMA 1UVTH 3M3VA 4WXIA 4A7IB 1QRZA 4FUIA 1ZR0A 2SGFE 3TVJB 2NU1E 4TY7A 1O3OA 1BITA 1GBHA 4BAQB 1GBAA 2P94A 4YOIA 1Z8IB 1OYTH 5GCHG 3ZVAA 1EFRD 1WAYB 3LDXH 3T26A 1ABIH 3CS7A 3E6PH 3ZZ9A 3T28A 1IQKA 3HKJB 2WINI 4U2WA 1SGTA 3BSQA 4YO9A 1BMFD 2ZP0H 3E90B 3SQHE 2F9BH 1O2GH 2JDID 3SUGA 1THRH 1YBWA 1MU8B 3S0NA 3GY4A 4B2BA 1GI8B 2A0QB 1H9IE 1EPTB 4P02A 2K0QA 1TNGA 3KQDA 1Y5BT 1E1QD 1EP5A 3RMOH 2QY0B 3A83A 2GX4A 4IBLH 4AGJA 2P95A 1TWXB 4D9RA 1BIOA 3DCLA 2BQ7B 1QA0A 2Z3EA 1E38B 4NA7A 1GBMA 4ZKSU 1P06A 2O8LA 1H9HE 4KELA 1A7SA 2DE9A 5GIBA 1TB6H 4IMQA 1Z7KA 1C5YB 3A86A 3GCNA 2BVRH 1DXPA 2FI5E 4E05H 2BVSH 1PPCE 1FY1A 2NU0E 3NZIA 1G37A 2QXGA 1AMHA 4SGAE 1IQFA 2JJ1D 1EJAA 1KLTA 4GAWA 1IOEA 4WXVA 3O8DA 1QL8A 1A46H 4NA8A 1O0DH 3ZZCA 4BOHA 2G51A 1FONA 1XKBC 3A7TA 1W10U 2ALPA 1GHBG 2FOAA 1P01A 3VGCB 1O2WA 4CR9A 2EI8A 2KX4A 4ZKOU 3F2GA 1DLKB 2J95A 1UTJA 3A7XA 2V3MA 1WUNH 1W7GH 3MQKC 1Z8RA 4MQAA 2WPMS 3EE7A 2AS9A 3SNDA 3F1SB 1T8NA 2BM2A 1ELTA 1LPZB 2BZAA 3SHCH 1OWEA 1TFXA 3HGNA 3NRLA 2C93B 2BD5A 3B9FH 1FJSA 4D8NA 1Y3VA 2KM0A 1AB9B 2HLCA 4BAHB 1C5RA 5C5NA 2J94A 1WBGB 3VFEA 4AGKA 1ZJDA 1NROH 2XC5A 2B9LA 3A8CA 4O9VA 2P93A 2ZFPH 1P05A 3UPEA 3UR6A 4F4OC 2F9OA 1TPPA 1WOFA 3PV5A 1BCUH 2ANMH 1F5RA 1GVLA 6CHAB 1TA6A 1ZYOA 2BD3A 1S82A 2FOHA 1ESAA 4KTUA 5AVDA 4ISHH 1EX3A 1MKXK 2OQUA 1XMNB 1JRSA 2G00A 4Q63A 2GMTC 4JYTA 1OKXA 1U6QA 4INKA 4F48B 5A8YA 1HAVA 1LQDB 1GI5A 5C67A 3M5NA 4WWYA 1O5CB 4FUBA 4IGDA 4ESTE 5FL7D 1QURH 2OK5A 4CHAB 3SZEA 1SHYA 3SU5A 4Y8XA 2QV1A 4I8GA 3EQ0H 2A45B 5EXLA 2FOGA 2M2AA 1LQEA 3EDXB 1COWD 3PV4A 2OC8A 3HGPA 1SOTA 2CGAA 2ZWLH 2GCHF 4MPXA 1P10A 1TPSA 3RLYH 4TPIZ 1Z71A 3M35A 2BLQA 4NGAH 1S6HA 2BY9X 3BTQE 3ATWA 3AW0A 2C8ZB 2XCNA 1ELFA 2V0BA 2WYGA 1P2QA 1WDIA 1EAIA 4RT0A 3I78A 5EPYA 1EZUC 1YPEH 1VITG 1XUGA 5L30H 1BA8B 4KP0A 2GGVB 2UWOA 1O3GA 4ZHLU 4AC9A 2PKAB 3D62A 2VGCC 3HKIB 5TJXA 2PHBA 4K1TA 2ANYA 1OP2A 4ABHA 1K1OA 4RKJB 3SGAE 1DWCH 4NIVA 2JH5D 2BLWA 3MO6A 3V13A 4X6OA 1ZRBA 2G55A 3RXPA 3QZRA 1SVPA 1AFQC 1ZTKA 1BJVA 4INLA 5FPTA 1W11U 1WQVH 1YLDA 1J17T 3TPIZ 3JZ1B 3F0PA 1CBWB 1P2NA 3S9CA 3KEEA 3K2UA 1O2IA 4D76A 1QR3E 1E79D 3GOVB 3Q3KA 2P16A 4F55A 1V2JT 3IITA 4JZIA 1Q2WA 1PPZA 1PQ5A 2PGBB 1ACBE 2ZTXA 2SGAA 5HYOA 2Z3CA 1FAXA 1GGDB 4Y7BA 2AYWA 1K1NA 2ZFFH 1FDPA 1LHDH 1XVMA 2F9VA 2J98B 2BYAX 2Y6TA 3BTFE 2V35A 2OCVB 1HXFH 2OUAA 1E0FD 1KXCA 1VITH 3KCGH 3TLOA 3S9AA 4CRCA 1ANCA 5EIYA 3MFJA 4LXBH 1KIGH 3SU3A 2ZC9H 3GDUA 3SV6A 1D6WA 3SW2B 1HAGE 1N8OB 4A6LA 5IK2D 1GDQA 1MMJN 3TGJE 3M37A 3A8BA 1EJNA 1CHOG 1YC0A 3SUEA 1ELAA 1UO6A 1K1IA 4NCYA 1O32A 1OP0A 2FI4E 4I86A 3RXJA 1DX5M 3BEIB 1A0HB 2FIRH 2P3TB 3SU2A 1VCQA 1F5KU 3N99A 3RXEA 4WJG2 1FY8E 4ISLA 4NSVA 3T5FH 4I8HA 4WMEA 1NS3A 5T6DA 3O8RA 2BLVA 1TA2A 4YLQH 5HGGA 1IHTH 1RIWC 2ILNA 3TIUA 1E35B 2PUQH 1DVAH 2ZGJA 3Q77A 1MUEB 5C5OA 5EJZA 1B0EA 5ABWA 1J8AA 1MKWH 4MTBA 4ZKNU 1GI0A 2XOKD 3QTOH 1GI3A 2J92A 1O5BB 4OS4A 5DP5A 2VWOA 1ETSH 2WSSD 2WPJS 4ABIA 5GCHF 3BIUH 1PPGE 4GHTA 1ESBA 3M3TA 2R0KA 4CH8B 2BHGA 1DANH 1ZTLA 2J4IA 5PTPA 1HJAB 2D1JA 4X0WU 2TBSA 2DE8A 2ULLA 2UUKB 3DSOA 3RXFA 4GCHF 2Q6FA 1UVSH 1UTQA 3VGCC 3ZZ5A 3H7TA 2C4FH 2HRVA 2A31A 1RTLA 4A1XA 1O2XA 1YWUA 1ZGIA 3LGYA 1RFNA 5JB8S 4DW2U 2G52A 2STBE 3K65B 4P00A 3H5CB 1SC8U 3SORA 2CJIA 1O2QA 3A8DA 3T27A 4OM9A 4X6PA 4I33A 4YOGA 1WTGH 5E8EH 1V2RT 5KGOA 1OWHA 2J98A 3E8LA 1F0RA 3PRDA 4AZ2B 4YXWD 1T32A 3VB6A 5HM9A 3ESTA 3UQOA 2ZHFH 3RM0H 8ESTE 1EB1H 3PTBA 1EATA 3K6YA 1C1QA 1O3AA 4VGCB 3LOXA 4JK5A 1NESE 3AVZA 3F3BA 1NT1A 1BMAA 1T8MA 3ZV9A 3IWMA 1NY22 1YPJH 1FPCH 1X7AC 2BVXH 1LHGH 2HWLB 1F0SA 3OTPA 1BB0B 1ID5H 2RA3A 3MNXA 2YMSC 3H09A 2VVCA 2XCFA 3U8RH 1RXPA 1ZGVA 1NU7B 2XWAA 1QY6A 1Y3XA 1H1BA 1L0ZA 2H2ZA 5C94A 4SGBE 1W0YH 4FVBA 4IMZA 1FX0B 1QQUA 3I29A 3SO3A 3ZVCA 1BBRK 1GCDA 1O5AB 3NPSA 2ZHWH 1PYTD 3TH2H 3G01A 5J4QA 4I8KA 2FOEA 4E06H 2TGTA 1VGCB 3SV8A 2P8OB 2VIWA 4K60A 3OFND 2QE7D 1O3CA 5FPYA 4Y0ZE 4A5TS 2IPQX 1THSH 5CHAB 3STIA 4I8LA 3RXMA 1L2EA 2C90B 1SQTA 2GMTB 3BG8A 3SI4H 5F53A 3OEHD 1FY4A 3BTEE 1GG6B 3FP6E 4FU9A 5BRRE 3NK8A 2ZKSA 2Z9JA 1ELCA 2XWBI 4PROA 4AG2A 4Q4LA 3LGWA 5G4BA 4YOJA 1ETTH 2GD4B 2GDEH 4TWYA 4YZUA 3UY9A 1GJAB 5A8ZA 3ZZ3A 1G36A 3KQ5A 3MYWA 5DP6A 2D2DA 4ACAA 1EP6A 5C20A 1LVYA 4A92A 3UREA 5A0CA 4JZ1A 2ZDKA 1HRTH 1SLUB 4WH8A 2GV7A 1QL9A 1G9IE 2WPIS 3MNCA 3SI3H 5DO4H 5EQQA 2HGTH 4ABGA 3CENA 1ZSJA 1LKBA 5GJ4B 1P04A 3A7VA 3VG8A 1IQEA 4LZ4B 1GCTC 5L2ZH 1B0FA 1BDAA 4U01A 3KNXA 2HALA 4XD7D 3TH3H 4AOQA 2O8UA 3E0PB 4DIHH 5I25A 1H4WA 1IQLA 1P03A 3R3GB 1QJ1B 4Y7AA 3L33A 3PV2A 1ZSKA 2ZFQH 4JK6A 2FOMB 8GCHG 3DT0H 1GI4A 5AF9H 3RXRA 2QGRA 1FMGA 1BTZA 2BD9A 3UNRA 1UCYE 2ZI2H 1MH0A 1O2JA 3V7TA 2JIZD 3SNCA 4DJZB 1S84A 2ESTE 2W26A 4FUGA 5F8ZA 4X1PU 3CNRA 1YCPK 4FUJA 1YPHC 1K1LA 3K9XB 2RDEA 1QBNA 2ZIQH 1Z1JA 2FESH 2A5AA 3F9FA 4O3TA 3UQVA 1PPFE 1FLEE 5L6NH 2QF0A 1Y5AT 1XXDA 2ASUB 3ZVDA 2IPHA 3ZVFA 1N8OC 4KTSA 3OY6U 2ZDLA 2H6MA 1SB1H 2GZ9A 1HJAC 4UDWH 1NO9H 4IS5A 1EASA 5FBIA 4RSPA 2VU8E 2VWLA 1AHTH 3P8OA 2BMGB 1RS0A 2Y82A 1B7XB 1EPTC 3RUOA 2DUCA 1MTNC 1TMUH 1Y59T 2FOCA 4Q7XA 5CE1A 3RM2H 4M7GA 3MI4A 1T31A 3C1KA 3BV9B 3SUFA 3SOSA 1W7XH 3Q00A 2F3CE 1C2GA 1P2JA 2A4GA 2FDAA 2ZA5A 1J9CH 2KAIB
chains in the Genus database with same CATH topology
1SFQB 3BEUA 1QQ4A 1O3JA 4HZHA 1C1RA 1EAWA 1QB6A 2A2QH 3BTWE 2H5CA 2ZFSA 3PLBA 3BTDE 1AD8H 2IJOB 1QFKH 4H6SB 1TQ7B 3UOUA 5ESTE 1GJ5H 3P95A 4BTIB 2UWLA 1ELGA 3ATLA 2BDHA 5HM2A 4Y71A 1INCA 4F49A 1GI9B 5EXMA 1DUEA 1HBTH 1G2MA 4B74A 2ZGBH 1DFPA 1LO6A 4NWKA 3LU9B 2H9TH 1GBCA 1ZHMA 3M5MA 4MLFB 3K6ZA 1MBQA 2K1QA 3L6PA 2PWXA 2FOBA 1KLIH 3SU4A 1UJ1A 1Y3UA 4X1QU 1GJ7B 3MU0A 3U1JB 1EOJA 1FIWA 1GMCF 3HK3B 1SGFA 1TOCB 5DGJA 2VB0A 1O35A 4FU7A 5DP4A 3QX5H 4BNRA 1XUKA 2KAIA 1ABJH 2B7DH 2TGPZ 2HNTE 4B76A 1UCYH 1D3QB 2ZG0H 1D3PB 2ZTZA 3S7KB 4NIWA 2CN0H 3QO6A 1BJUA 3M3SA 3M61U 5TCCA 1XKAC 1ORFA 1DXWA 1J16A 2A4OA 3PO1C 1DY9A 1SGYE 2A5IA 3D49H 3P92A 1BMLA 5E0HA 1UTMA 1RGQA 2R2WU 1O30A 2AMDA 4K8BA 2WV5A 1FUJA 1FN8A 4CRAA 2AMPA 1PFXC 1C4V2 6ESTA 3V3MA 1O5DH 1YCPM 1HAYB 3U8TH 1OX1A 1N6XA 1LPGB 1BMMH 5C1YA 1HAOH 4ABFA 7GCHF 3M5LA 4Y76A 3U69H 1AVXA 2BQ6B 4GSOA 5E2PA 1O3IA 1A0LA 1HAZB 4WY3A 1NRSH 2FZZA 1BTYA 4B75A 1VGCC 2Z7FE 3GYLB 3TU7H 1O34A 5ETXA 1T4VH 1P12E 5LGOA 2BY5X 1ELEE 1Q31A 2Q1JA 4Y6DA 1J15A 1TX6A 2R9PA 2WPHS 2ZHDA 2PLXA 5CMXH 4TWWA 3TNTA 3OY5U 3F9GA 3F6UH 1TAWA 3MH7A 1C5ZB 3U1IB 1C5TA 1S85A 2FMJA 1S5SA 4CRDA 1FNIA 4BAMB 2I6QA 3TNSA 1GG6C 1FXYA 1BTUA 1C5OH 2Z9IA 3KIDU 1WV7H 1DSTA 1TMBH 2IOTA 4WF8A 4MPVA 1XUFA 1HJ9A 1UHBB 3RP2A 1C5MD 3AAUA 2SNWA 1VJAU 2W7UA 5FXLA 3RMLH 1WSSH 1ZPBA 4UE7H 3GCOA 1C9TA 1O3PB 3MH5A 1S81A 2RA0A 3W95A 2NWNA 3AASA 3STJA 1O3EA 1QRWA 5DJ7A 1OWDA 2XBVA 1CBWC 3ZZAA 3SJOA 1CT2E 1FY3A 2ZPRA 3RU4T 1GL1A 1YPKH 4I31A 5IDKA 2AEIH 5JBTA 1WU1A 1UK2A 2Y81A 5F03A 3M7TA 4K69A 1CA0C 4BXWA 2FODA 2UUJB 1DM4B 2ZDAH 4K8YA 4TPYA 1GBEA 3SZNA 3P17H 3SJ9A 1C1NA 1KYNA 2XRCA 1C5LH 1C2KA 1AE8H 2SGQE 1SGNE 4Y8YA 1BHXF 5EQRA 3DD2H 1Q3XA 2C8YB 4DCDA 2JETB 1O2VA 3FAOA 4UD9H 4ZH8A 1DOJA 3EE0B 3BEFB 4DGJA 4YM9A 4DURA 1DUAA 1KLJH 5FPSA 1KXEA 1GBDA 3ELAH 5FCRA 1JIMA 1G30B 1T8OA 1UTPA 1BRBE 1EZQA 3OSYA 3KQEA 3SJIA 2OC7A 6GCHF 1OP8A 1TONA 1TRNA 1HAXB 4X8VH 2UUFB 2BDAA 2D26C 2XC0A 3TK9A 2OD3B 4XOJA 2BZ6H 4GVUA 7KMEH 2ZU1A 4DY7B 4Y10E 4A1VA 5B6OA 1YYY1 5A0AE 2FX6A 1Z6EA 4D7GA 2FYQA 4Y8ZA 2VIVA 2BY7X 2QYIA 4AB9A 1HLTH 3R0FA 2ZCKP 3RXUA 2Y80A 1L4DA 2VINA 1HIAA 2BQWB 1SGDE 1C2DA 2VIPA 3M36A 2Y5HA 4AFQA 1P3CA 1KDQA 2LPRA 3U9AH 1D6RA 1LPKB 3SJ8A 2PKSC 1UTKA 2QN5T 1HAHH 1NU9A 1ZTJA 1SLWB 3ATIA 3RMNH 4TY6A 3RDZA 5TCAA 2JH0D 3E3TA 6LPRA 3MU5A 5JYIA 2GTBA 4J1YA 3PWBA 1C5NH 1C9PA 2QA9E 3PMAB 4GLYA 1DY8A 2GT8A 4CBNA 1F2SE 1PJPA 2A7CA 1AKSA 1UHBA 1EOLA 1CGJE 4K5ZA 3PYHA 1A61H 5DPAA 1ZMNA 3S69A 3ZZ8A 1HAVB 2STAE 2GKVE 3MH6A 1NFUA 1MTWA 3MTYA 3LC5A 4UFGH 1FN6A 3QUMP 1BTPA 1D3DB 1UK3A 3AW1A 1ZPCA 1PPEE 4JZEH 1NRPH 1NTPA 3RXGA 3NXPA 2HNTC 3M7QA 5LPRA 1UCYK 1ZLRA 3OX7U 1AUJA 2CF8H 1KXFA 2QIQA 1CGHA 2OP9A 1UMAH 2OBQA 1B5GH 4X6NA 4FVDA 3SV7A 1CU1A 3EA9A 1VITF 2R3UA 4ABDA 6GCHG 4H4FA 3OU0A 1K2I1 2ZGCA 1JOUB 2HPPH 2ODPA 5E2OA 1GVZA 9ESTA 1GBKA 1Z8GA 1A3EH 2OQ5A 1V2WT 4AB8A 4MPUA 3B8JA 3RXKA 3KHVA 1QTFA 1ESTA 3HK6B 1IQMA 1TPOA 1NRRH 1NN6A 3PO1B 5AFYH 1V2LT 2F9UA 4B2CA 4MDSA 1PPHE 1EQ9A 2ZGHA 3F9EA 1V2PT 3U98H 1C5WB 1YKTA 1ZMJA 2OC1A 4JCNA 1LVOA 4B1TA 1TNLA 1OWJA 1O2ZA 3A81A 3FP7E 2IN2A 3UFAA 1GJ6A 3TJNA 2OLGA 3BTKE 3PB1E 4K1SA 1W12U 1AUTC 1AFQB 1SR5C 1EUFA 5F8XA 4MPWA 1MKWK 2BD4A 4AFUA 3LJJA 4QT8C 1FY5A 1DPOA 2FS8A 2GDDA 1ZHPA 2XTTB 2ANWA 1T7CA 3UWJH 1QIXB 1GHWH 3LGUA 1MKXH 3ATKA 1C2JA 3F9HA 1EKBB 5T3HA 1GHBF 2RCEA 8LPRA 1IHSH 1GJ8B 3MWIU 1BRCE 3GY8A 2AIQA 2Z3DA 1O2RA 1O2LA 5DP8A 1GGDC 2YOLA 4UFFH 2AH4X 3SNEA 1TIOA 4YT6H 1FIZA 3EGKH 2A4QA 1W13U 2GCTC 1O3KA 2CXVA 3ZZBA 1AGJA 4K3JA 4AYVB 4NFEA 1AWFH 2PTCE 1GVKB 5AHGH 2CHAC 2F9PA 1IQJA 2AGIX 1TNIA 5EODA 1L1GA 3LGIA 1A0JA 1C1TA 2P3UB 3MMGA 1A1RA 3VXEH 5FX5A 3RMMH 3LPRA 3QWCH 3BTME 1ELBA 4B2AA 1RTKA 4YTAA 2FYRA 4Z6AH 1O3HA 2GZ8A 1LDTT 2CF9H 4ZHMU 3VB3A 3WY8A 5C3NA 7ESTE 4CRBA 4K1EA 3LGVA 4AORA 4WVPE 1AN1E 3RXQA 2OINA 4JZDH 1XX9A 2G5NA 5FHTA 1EZSC 1GJ4H 2SGEE 2WUCA 1HFDA 3P70B 1Z8JB 3GYMA 2XNIA 1SGCA 3RXAA 5LPEA 1MU6B 2YNAA 1NC6A 1Y3WA 5DK1A 2VVUA 1HAPH 3UNSA 1D9IA 4ABBA 4GUXA 1CA0B 1AE5A 1DSUA 4XSKU 3RC6A 3T2NA 4NSYA 1W14U 3T62A 3TGIE 5GPIB 2RDLA 2W3IA 1P3EA 2TIOA 1C5XB 1YGCH 2BD2A 4X2XA 3UR9A 5K7RA 1D3TB 1QB1A 3Q3YA 2XBYA 2W3KA 5T6FA 1TGSZ 2B8OH 1QA7A 4KGAA 2LNCA 3T25A 4CR5A 3MHWU 2BDYA 3QGJA 1YPGH 1RD3B 4ABEA 2Z9GA 1MTUA 3P8FA 3GCHC 4R8TB 1EAUA 2C3SA 1O2HA 3GY3A 1UTOA 2H5DA 4FXGH 4A1TA 2A4RA 1BOQA 1LHEH 3E0NB 4INHA 4ISIH 4AFSA 1GPZA 5JB9S 3GY7A 3V12A 1BRUP 1P02A 4NIYA 1A5IA 2H1UA 5F6MA 1ELVA 1O2KA 2TRMA 4J2YB 3UTUH 2Y5GA 2PW8H 3RXLA 2FLBH 1EXFA 1C5QA 1D4PB 1FQ3A 4X2YA 1FI8A 5FX6A 1ELDE 5DP3A 1EZXC 1CGIE 2VH6A 4CRGA 3RXCA 2ZU5A 2AGEX 1JIRA 3A7WA 5C1UA 4I7YH 2J34A 1N1LA 1C1OA 1TYNA 2V6NA 3A89A 3RXSA 4O97A 1GHXH 1TGNA 4H6TA 3PROA 2A2XH 4U32A 2BX3A 2ODQA 1L4ZA 1PPBH 1HAIH 1KXBA 3B23B 3MO9A 2XBXA 3GISB 2ZDNA 3RXIA 1MAYA 3SU0A 1C1UH 1ETRH 3F68H 1C2IA 1T8LA 2A32A 2PTNA 1V2UT 1HDTH 1XM1A 3SV9A 1P0SH 3TJUA 4X8SH 1TABE 4OGXA 2BXTH 4D9QA 1VZQH 1TE0A 2VWMA 2BD7A 3A7ZA 2AIPA 4FUDA 3URCA 2CV3A 1P2OA 4Y79A 4OS7A 1G3CA 2F91A 2Q6GA 4X1SU 3VPKA 4B71A 3P8NA 2BDBA 2OBOA 5DKMA 5I46H 1NFWA 2BB4A 1P9UA 3P8GA 2H9EH 5AFZH 3ZVEA 1THPB 1LCYA 1HNEE 1QBOA 4CREA 3MU4A 1JRTA 2FM2A 2QF3A 2VJ1A 1QL7A 1TBZH 2BDCA 1O37A 1BHXB 1BBRE 1E34B 1K1JA 1MBMA 4WH6A 2ZU2A 4KKDA 3RXHA 2ZZUH 1SGPE 2Z6BD 4YT7H 2NU2E 4CHAC 5L2YH 1A5GH 4ZUHA 3RC4A 4TYDA 1YM0A 2BY8X 3FFGA 1YP9A 3JZ2B 2R0LA 1DWEH 1SL3A 2EC9H 3LKWA 1GI2A 2ZQ1A 3LJOA 7LPRA 1MQ5A 4JZFH 1ANEA 2P3FH 1AVWA 5DP7A 1G2LA 4B73A 1NPMA 5DG6A 1FZZA 1DT2A 1Y3YA 4Q7YA 1ZPZA 1GCTB 3VXFH 3N7OA 3GDSA 3LH3A 1AKSB 4FUCA 3RXOA 1E37B 3A85A 4Y11E 1GHAF 1OXGA 1AZ8A 1K22H 5EOKA 5EW1H 1JMOH 1EJMA 2FI3E 7GCHG 1MD8A 1VCWA 1VR1H 1F5LA 2QXIA 1C2FA 1Y5UT 3EA8A 1TPAE 1A4WH 1SLXB 3FP8E 3LH1A 3Q76A 3T29A 2I6SA 4MNXA 4GCHG 4NWLA 1O3DA 1OPHB 4WMFA 1P2IA 3SU1A 1QHRB 1VJ9U 5JBAS 1O2UA 1V6DA 3AAVA 2XW9A 1EB2A 3TITA 4GPGA 2NU4E 2GCTB 4LK4A 3RU4D 3SUDA 4ASHA 1ZMLA 1GJ9B 2FS9A 2ZFTA 3KF2A 1O2PA 4RN6A 1BT7A 1TGBA 1SG8B 2FO9A 1TX7A 5DP9A 2WYJA 1F0UA 2CHAB 1G3DA 1S0RA 2EEKA 5EQSA 3ZVGA 3MNBA 2OTVA 2W7SA 1SFIA 3A84A 1ARBA 2J38A 1L1NA 1P8VC 4FUHA 2BOKA 1AY6H 2J9NA 3H7OA 1VCPA 3KN2A 2ZFRH 1O2SA 1SQAA 1C1MA 1T4UH 2HVXA 1OS8A 3BTTE 2VVVA 2JH6D 1TNJA 2PV9B 1MQ6A 1MTNB 3MOCA 3PTNA 5EXNA 1JXPA 5C1XA 2Z9LA 2QCYA 1O33A 5GWZA 2JETC 3A7YA 2OXSA 1LHFH 3DUXH 3ZYDA 3MO3A 1JWTA 4XBBA 4OS2A 2FXRA 1N6YA 4IN1A 1G32B 2ZO3H 2HPQH 1Y8TA 2PGQB 4NA9H 3PM3A 2A7JA 1RIWB 4JMYA 1TNHA 3QK1A 5FBEA 1C5PA 1NZQH 2FX4A 3E16B 1H8IH 3UWIA 1G3EA 1HGTH 1XUIA 1M9UA 1DITH 3A8AA 3ODDA 1BUIA 2C8WB 4AYYB 1O5GH 1TQ0B 2R2MB 4K2YA 5EU8A 1GI6A 2GT7A 4BANB 1BTWA 1LVBA 1MAXA 1AQ7A 1YPLH 3BG4C 3CP7A 3O8BA 1UVUH 2QXHA 2PUXB 2GZ7A 2FPZA 3FZDA 2GV6A 3TK6A 3KQBA 2Z9KA 2SGDE 1UK4A 2AMQA 1C1VH 1TGCA 1GWAA 2TPIZ 2VIQA 2FTLE 1C4U2 2Y7XA 2FTMA 3UNQA 2FOFA 2BTCE 3FZZA 3W94A 3ENSB 4ISOA 4ZROA 1ZZZA 3ITIA 1V2VT 1S0QA 3SGQE 2WPLS 1GI7B 2ZTYA 4ABJA 2V3HH 1GMCG 4R0IA 2PKSB 1GHVH 3EAJA 4YLUA 5JBBS 3SJKA 1AWHB 3LGTA 3V0XA 2THFB 2FP7B 3PMBB 5EW2H 1WCZA 1MTVA 3TJOA 3O8CA 2Q6DA 4XBDA 1C2HA 4IC6A 1BMNH 1TBRH 1P09A 1KY9A 5IYTA 1SOZA 1UTLM 1HYLA 3ZV8A 4MG3A 1MZAA 1DDJA 3RXVA 3QGNB 1IQIA 1GBTA 1FAKH 5A0BA 4E7NA 2UUYA 4KTCA 2CMYA 1CVWH 1V3XA 4NIXA 4X1NU 3A80A 1P2MA 2XBWA 1BTHH 2NU3E 1HCGA 5A09A 1O3FA 1C5SA 1ZJKA 1QB9A 1Z1IA 1GI1A 2GVFA 4X8TH 1KXDA 4X1RU 3U8OH 1ZRKA 2VNTA 4HTCH 1SGFG 1K21H 1NM6A 2FEQH 1MD7A 2AFQB 3E91A 2SNVA 1SI5H 4GHQA 1RJXB 1TMTH 5GDSH 1GJBB 3MNSA 1SGRE 2O8TA 1NFXA 2PR3A 1O2MA 1W8BH 4CRFA 1SLVB 2WV4A 1C2LA 1XUHA 5H4IB 5EPNA 1O39A 3EA7A 2XC4A 5J4SA 1P57B 4IC5A 3UOPA 4X2VA 3SNBA 4BTUB 2BDIA 1HXEH 2JKHA 4MNYA 2A7HA 5E0GA 3L3TA 4MNVA 1XVOA 1SGEE 2BLOA 2AERH 5T6GA 4LZ1H 3LT3A 3RC5A 3HATH 2QAAA 2GP9B 2TGDA 1H9LB 2O8WA 1SBWA 2ZPSA 1WQSA 4UONA 1MCTA 1DWDH 3NWUA 1H8DH 3RXDA 2P59A 1ZSLA 3LIWA 1GBBA 1P2KA 1WYKA 4YESB 5LH8A 8GCHF 2PFEA 3UUZA 4UEHH 3DA9B 1OOKB 1DE7H 2ZCHP 3VB5A