1JRXA

Crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrxA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrxA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrxA01
1IUSA 2OALA 3DA1A 3P4PA 3NK1X 3VR9A 1H86A 2YG5A 2YR5A 3SM8A 4GRTA 4B64A 2TPRA 5BULA 2WPEA 5KOWA 4OPUA 1LPFA 3UOYA 4C5OA 3CGDA 1CJ2A 4RG4A 2WPFA 2UZZA 1E1KA 4GF7A 1S2YA 1DODA 1N1PA 1QJDA 4GDEA 1F6MA 3D8XA 3DJDA 3QFAA 1HYUA 4OPIA 2BS3A 3F8PA 1PJ6A 2FJAA 2WQYA 1TRBA 1XHCA 2JAEA 2VVMA 2APGA 3H4KA 5CKUA 2R0GA 2A8XA 2Q0KA 4Z24A 2OT4A 1YY5A 2WOIA 4WJYA 2XFPA 4BJYA 5BVAA 2E5VA 3CN8A 1JOAA 3SFDA 1LVLA 1CJ4A 1GU6A 1CC2A 2HQMA 4HB9A 1DXLA 2WP9A 3V3NA 1ONFA 4UDPA 1E6EA 1K0IA 2WOVA 4GCMA 2B76A 3REDA 5EBKA 4EMJA 1LTXR 2XLTA 3K30A 5FS9A 1F8RA 1D4EA 3AE7A 4CCRA 1TDFA 2YG7A 2PYXA 3GMBA 3UU9A 2BCGG 2V3AA 3OZ2A 4O5QA 1H82A 3ALMA 2WPCA 2GAHB 1JNIA 2YG4A 2EQ6A 3QVRA 1YQZA 4B63A 2LFCA 1ZOYA 5BUKA 3AE8A 3BNUA 1OAHA 2XDOA 3L1TA 2Y6RA 3G5RA 4X9NA 3AB1A 1VQWA 4ECHA 1Q9IA 2WETA 1K0JA 1M1RA 2DKIA 2FJDA 2VOUA 1GOSA 3LB8A 5TR3A 2XFUA 4Q4UA 1OJAA 4LIIA 1Q1RA 4OPGA 1NHQA 2Q0LA 3K7TA 2XCGA 2WOWA 3GSIA 3RP8A 3V76A 4H2QA 3QSEA 1N4UA 1GRGA 2XFNA 5ER0A 2ARDA 3H8IA 1K0LA 1MOKA 3QFBA 3RP7A 1E39A 1GALA 1GRFA 2ACZA 2XLSA 3GYIA 4AOSA 2VVLG 2BCPA 3GM6A 3BNJA 1PHHA 2RGHA 2Z5YA 3IC9A 3GRSA 1LV0A 1FS7A 2GF3A 2YVFA 2C70A 1GXFA 4EQWA 1F3PA 2XVFA 3CNJA 4IV9A 3NG7X 1OJ9A 3DMEA 4JNQA 2A87A 4CNJA 4U2LA 2BS2A 1YQ3A 2K3VA 5IQ1A 2GB0A 1NHSA 2QA2A 4H2RA 1MO9A 1W4XA 3Q9TA 4OCGA 1L9DA 2H88A 4KPRA 1PBEA 4YSYA 1EL8A 4MJWA 4J36A 4U8JA 4BK2A 3C96A 1E1MA 2ZBWA 3ATRA 3UP5A 2WHDA 4CY8A 1FL2A 1GEUA 2JB1A 1H84A 1PBBA 4K22A 5KXJA 4TM0A 1REOA 2XLPA 1GETA 3UTHA 3UTFA 1ZMCA 3I6DA 3R9UA 4I58A 2V6OA 3UOZA 1H7WA 2FJBA 1F8SA 3NYFA 4A6NB 1TDOA 3DGHA 1N4WA 1NG3A 4A7AA 4Z26A 1LQTA 4Z25A 2B9YA 2BA9A 1GV4A 2A89A 4RG3A 2WDRA 4ICYA 1GSNA 2WEUA 3NLCA 4CBQA 3KKJA 5HY5A 4JNAA 3C4AA 3D1CA 2R45A 1BKWA 4Z2RA 3DJEA 4J33A 1PBCA 2C76A 1D5TA 4WX1A 3VR8A 3KPFA 5JCLA 2EQ8A 3NH3X 1NG4A 3NN6X 4TLZA 4TM4A 1TDEA 2IVDA 1FT5A 4I59A 4H4PA 2BC1A 4JN9A 4J31A 4C74A 3SXQA 4Q5BA 1NHPA 2XLUA 3AE3A 1SEZA 4J57A 4U8PA 1S3BA 3VRBA 3I3LA 2FJEA 2YVGA 4U8MA 2Y6QA 3SFEA 1H81A 1B8SA 2X99A 3AD7B 1AOGA 2OAMA 1Y0PA 1N4VA 4DSHA 1BWCA 1M1QA 2YLWA 5J60A 2W0HA 3IWAA 2YQUA 1GT8A 1NEKA 3NYEA 4YKFA 5C3JA 1TDKA 1PN0A 5GSNA 1M6IA 3BI5A 1ELIA 1Q1WA 2GQFA 2X50A 1JRXA 3ABVA 3TTBA 3DH9A 4C3XA 4EIQA 1NENA 3UKAA 2BC0A 1PXAA 1M1PA 1OJTA 3DK4A 4FDCB 1IUVA 1OJDA 1GPEA 1TYTA 1D7YA 3E1TA 4AT0A 2XVHA 3GWDA 3AEFA 5CQFA 1VG0A 3CNDA 3ADAB 3NIXA 3QSMA 4N9XA 3FBSA 4H7UA 1SP3A 1DJNA 4FX9A 3BHFA 3G5SA 2QCUA 3ZDNA 2RABA 3BNGA 2V61A 2JB3A 4JQ9A 3G5QA 4NTEA 1JNZA 2OLNA 3GDNA 4NTDA 4NTCA 5KWFA 4Y4NA 4C3YA 2C67A 3K7QX 4Z2TA 3KLJA 1XDIA 2GH5A 1JEHA 3BI2A 4ZCCA 2IIDA 2E81A 4CY6A 4ADWA 3RKHA 3ALLA 3AECA 2OA1A 3CNTA 3URHA 4GDPA 1XPQA 1TDNA 2JK6A 3CTYA 4B66A 3KVEA 3GYXA 3CIRA 3FMWA 3DGZA 2H89A 1NDAA 4AP1A 3AEGA 4OPLA 1CF3A 1GERA 2YG6A 5JCIA 3NHOX 4EQSA 1VDCA 2C7GA 3AE9A 1DOCA 4YTNA 1S2QA 2YLXA 4EIPA 3AEDA 1ZY8A 3UKKA 5IPYA 1FS9A 4CRTA 2FBWA 3NK2X 1KNPA 3KA7A 4WCTA 4J56A 3P4QA 4H2PA 3M13A 2R4EA 3AE6A 1JRYA 1L9CA 2GQWA 2X3NA 3NRNA 2BXRA 3GD4A 4B68A 1GTEA 3B6DA 2O9ZA 3F8DA 3IHMA 1IUXA 3QSSA 1F8WA 1IUTA 4H4XA 4HA6A 3CGCA 4BURA 4YTPA 5HYMA 3M12A 4EMIA 2AR8A 4JY2A 3AYLA 4P9SA 5C2TA 5KOXA 2GR0A 2WDQA 3LOVA 1GTHA 4TLXA 1CJCA 1GRTA 4CNKA 1PJ7A 1ZKQA 4UDQA 3ICSA 2JKCA 4Y4MA 4Q5CA 1CL0A 4AOXA 3EPTA 3LJPA 3GWFA 1FT6A 4YT0A 1E1LA 1EBDA 2BXSA 1IUUA 1VRQB 3CPIG 2C3CA 1QDBA 3ZYXA 2E80A 4B65A 1JNRA 2I0ZA 1ZK7A 2RGOA 2WU2A 2CVJA 3CGEA 1M64A 3SCEA 4EM4A 1PS9A 2VQ7A 3UBRA 4U8KA 3IHGA 3NYCA 1KDGA 3ICRA 3O0HA 4H4YA 3SQPA 3GRTA 2GAGB 4K5SA 2GV8A 2WS3A 3OWMA 4OPTA 3UOXA 4YTMA 1V59A 3NTDA 5FMHA 4XWRA 1DJQA 1B37A 1ZMDA 2RF7A 4EQRA 2YR4A 1O94A 2XVIA 3NNEA 1RP0A 4LU6A 4OPDA 1FCDA 4U8NA 3IF9A 3UCLA 5BRTA 4CCQA 3TORA 3AYIA 1X31B 4YWOA 2ZO5A 2WP5A 3FPZA 5M0ZA 3RP6A 2VVLA 2XYOA 3WE0A 1E7PA 2F5ZA 2QA1A 4REKA 4U2SA 1GRAA 2Q7VA 2XFQA 4E0VA 3T37A 2RGJA 3FG2P 5U1OA 3VRAA 2BK3A 4DNAA 3EAOA 1L0VA 2R0CA 2V5ZA 1ZOVA 1KNRA 4H50A 4JY3A 1Z6LA 4LA1A 1BGJA 3FO3A 2WESA 4EMWA 1BZLA 4OPCA 2VRMA 4Z44A 4Q0TA 5EB4A 4EM3A 1NPXA 1MXTA 3AE2A 5L46A 3DK9A 4H4RA 5JCNA 2C3DA 2GRTA 3UKHA 2B7RA 2YLTA 2TMDA 5KRQA 4BK3A 2BK5A 3PVCA 2CFYA 4IVOB 3NGCX 1YKJA 1O95A 1GRBA 3II4A 2ZZ0A 3AXBA 4H4UA 1FEBA 4Z43A 5M10A 1QO8A 3GYJA 5KVIA 2ZZCA 3ITJA 4A79A 1CHUA 3LGQA 2E4GA 2CDUA 2R46A 2C65A 3AEBA 3QVPA 2V60A 5KVHA 1FOHA 2WP6A 3LZXA 2R9ZA 3BI4A 1EL9A 4NEVA 3V3OA 2XLRA 1GREA 3BNFA 1PXCA 3UKPA 5EOWA 1RSGA 1D4CA 1FEAA 1ZX9A 1VG9A 2YVJA 4GUVA 4X4JA 4IA5A 4UP3A 1KSSA 1S3EA 1B4VA 3H8LA 1O5WA 3EF6A 1PXBA 3M0OA 2RDZA 4YKGA 5FS7A 1NAAA 2VZ2A 2BABA 2YLRA 3ICTA 3ATQA 4C77A 4YSZA 2QAEA 3AD8B 2YM2A 1NHRA 1K4QA 2ZZBA 3P1WA 3CNPA 3NT6A 2YWLA 1E1NA 2XVEA 3P9UA 4YSXA 2YR6A 4PAAA 4FK1C 4K2XA 1D7LA 4ZN0A 4IVMB 5DBJA 2C66A 2XVJA 5HHFA 4U2TA 3K7MX 3MMOA 3QJ4A 4JDRA 3UTEA 4B67A 5GRTA 3CPJG 2J7AA 3ALJA 2YLZA 1P2EA 3VQRA 4BV6A 2WDVA 2C75A 1YQ4A 3KD9A 2NVKX 2GMJA 3DJJA 3BNMA 1CJ3A 3UKFA 1TYPA 2VR0A 1FECA 4B1BA 2Q6UA 4A9WA 4DSGA 4Q17A 2YLSA 4KX6A 5HXIA 1JRZA 1GNDA 4YXDA 3GD3A 2YG3A 2V3BA 1JU2A 1EL7A 4GR1A 3P4SA 2JB2A 4Y4LA 5IQ4A 2GR2A 3LADA 2WBAA 3NN0X 1D4DA 3AE5A 5JCKA 1H7XA 1DOEA 3LG1A 4PABA 3S5WA 5FS8A 3AYJA 3UKLA 1KF6A 3UTGA 3VRDB 4U8OA 3LZWA 3COXA 4A65A 2X8HA 2B9XA 1L9EA 5EB5A 5U63A 4ZCDA 1PDHA 2GR1A 4YSHA 2C64A 2BK4A 3NTAA 4D04A 4A6NA 3UOVA 1DOBA 3NK0X 4XWZA 1CC6A 4H2NA 4U8IA 3C4NA 4DGKA 3BNHA 2GEWA 3AWIA 3LXDA 2IVEA 4H4WA 3F29A 3L1RA 1KSUA 4K7ZA 1GESA 1Y56A 1CC4A 4TM3A 1ZDLA 3RNMA 4A99A 4XXGA 4IA6A 4M52A 1B5QA 4BK1A 4H4QA 4J34A 4X9MA 4TM1A 3BHKA 4NEWA 3CNSA 4OVIA 5JCMA 4RSLA 4J2WA 1DNCA 3SGLA 3OC4A 4H4SA 1CBOA 1P2HA 1FS8A 4L3YA 1H83A 1QLBA 3CPHG 2OLOA 3ISHA 1IJHA 1IUWA 5J7XA 4B69A 3Q6JA 3FIMB 1GRHA 3AEAA 4UDRA 4APNA 2GR3A 4O5UA 2JBVA 1BGNA 1ZP0A 3UP4A 2WU5A 3DJGX 3PS9A 4NZHA 4K8DA 2B9WA 3DK8A 4Z2UA 3AD9B 3UKQA 4USRA 3GDPA 2PHHA 1PBDA 4H4TA 4D03A 2AQJA 1XANA 2VRLA 1OJCA 1PBFA 2C73A 2EQ9A 1RYIA 1EL5A 2X8CA 2R4JA 3F8RA 4A5LA 2E1MA 2B7SA 3GMCA 4H4ZA 4Q1OA 3NKSA 2YAUA 1UKVG 3AE4A 3EANA 1COYA 4BJZA 2C72A 2BS4A 1Y56B 4USQA 4L3XA 2YM1A 2Z5XA 2BACA 4U8LA 4AP3A 2NPXA 2EQ7A 2CULA 1KFYA 3B3RA 3P4RA 3S61A 5U25A 2BYBA 1LJ1A 1BF3A 1BVBA 3PO7A 1LQUA 5LV9A 2GVCA 2X8GA 3AE1A 3JSKA 3KU9A 2VQBA 3RHAA 2J3NA 4AT2A 4EQXA 3S7WA 3D1IA 5FS6A 2GMHA 2R0PA 4L38A 3HZLA 1H6VA 4H4VA 3CGBA 3AEEA 1PJ5A 4FK1A 4L3ZA 4K5RA 2DKHA 2XFOA 2AAQA 3L8KA
chains in the Genus database with same CATH superfamily
1IUSA 2OALA 3DA1A 3P4PA 3NK1X 3VR9A 1H86A 2YG5A 2YR5A 3SM8A 4GRTA 4B64A 2TPRA 5BULA 2WPEA 5KOWA 4OPUA 1LPFA 3UOYA 4C5OA 3CGDA 1CJ2A 4RG4A 2WPFA 2UZZA 1E1KA 4GF7A 1S2YA 1DODA 1N1PA 1QJDA 4GDEA 1F6MA 3D8XA 3DJDA 3QFAA 1HYUA 4OPIA 2BS3A 3F8PA 1PJ6A 2FJAA 2WQYA 1TRBA 1XHCA 2JAEA 2VVMA 3SZFA 2APGA 3H4KA 5CKUA 2R0GA 2A8XA 3SZ0A 2Q0KA 4Z24A 2OT4A 1YY5A 2WOIA 4WJYA 2XFPA 4BJYA 5BVAA 2E5VA 3CN8A 1JOAA 3SFDA 1LVLA 1CJ4A 1GU6A 1CC2A 2HQMA 4HB9A 1DXLA 2WP9A 3V3NA 1ONFA 4UDPA 1E6EA 1K0IA 2WOVA 4GCMA 2B76A 3REDA 5EBKA 4EMJA 1LTXR 2XLTA 3K30A 5FS9A 1F8RA 1D4EA 3AE7A 4CCRA 1TDFA 2YG7A 2PYXA 3GMBA 3UU9A 2BCGG 2V3AA 3OZ2A 4O5QA 1H82A 3ALMA 2WPCA 2GAHB 1JNIA 4II2A 2YG4A 2EQ6A 3QVRA 1YQZA 3HYVA 4B63A 1ZOYA 5BUKA 2LFCA 3AE8A 3BNUA 1OAHA 2XDOA 3L1TA 2Y6RA 3G5RA 4X9NA 3AB1A 1VQWA 4ECHA 1Q9IA 2WETA 1K0JA 1M1RA 2DKIA 2FJDA 2VOUA 4NWZA 1GOSA 3LB8A 5TR3A 3T31A 2XFUA 5KMPA 4Q4UA 1OJAA 4LIIA 1Q1RA 3T2YA 4OPGA 1NHQA 3T0KA 2Q0LA 4GAVA 3K7TA 2XCGA 2WOWA 3GSIA 3RP8A 3V76A 4H2QA 3QSEA 1N4UA 1GRGA 2XFNA 5ER0A 2ARDA 3H8IA 1K0LA 1MOKA 3QFBA 3RP7A 1E39A 1GALA 1GRFA 2ACZA 2XLSA 3GYIA 4AOSA 2VVLG 2BCPA 3GM6A 3BNJA 1PHHA 2RGHA 2Z5YA 3IC9A 3GRSA 1LV0A 1FS7A 3SXIA 2GF3A 2YVFA 2C70A 1GXFA 4EQWA 1F3PA 2XVFA 3CNJA 4IV9A 3NG7X 1OJ9A 3DMEA 4JNQA 2A87A 4CNJA 4U2LA 2BS2A 1YQ3A 2K3VA 5IQ1A 2GB0A 1NHSA 2QA2A 4H2RA 1MO9A 1W4XA 3Q9TA 4OCGA 1L9DA 2H88A 4KPRA 5KMSA 1PBEA 4YSYA 1EL8A 4MJWA 4J36A 4U8JA 4BK2A 3C96A 1E1MA 2ZBWA 3ATRA 3UP5A 2WHDA 4CY8A 1FL2A 1GEUA 2JB1A 1H84A 1PBBA 4K22A 5KXJA 4TM0A 1REOA 2XLPA 1GETA 3UTHA 3UTFA 1ZMCA 3I6DA 3R9UA 4I58A 2V6OA 3UOZA 1H7WA 2FJBA 1F8SA 3NYFA 4A6NB 1TDOA 3DGHA 1N4WA 1NG3A 4A7AA 4Z26A 1LQTA 4Z25A 2B9YA 2BA9A 1GV4A 2A89A 4RG3A 2WDRA 4ICYA 1GSNA 2WEUA 3NLCA 4CBQA 3KKJA 5HY5A 4JNAA 3C4AA 3D1CA 2R45A 1BKWA 4Z2RA 3DJEA 4J33A 1PBCA 2C76A 1D5TA 4WX1A 3VR8A 3KPFA 5JCLA 2EQ8A 3NH3X 1NG4A 3NN6X 4TLZA 4TM4A 1TDEA 2IVDA 3SX6A 1FT5A 4I59A 4H4PA 2BC1A 4JN9A 4J31A 4C74A 4II3A 3SXQA 4Q5BA 1NHPA 2XLUA 3AE3A 1SEZA 4J57A 4U8PA 1S3BA 3VRBA 3I3LA 2FJEA 2YVGA 4U8MA 2Y6QA 3SFEA 1H81A 1B8SA 2X99A 3AD7B 1AOGA 2OAMA 1Y0PA 1N4VA 4DSHA 1BWCA 1M1QA 2YLWA 5J60A 2W0HA 3IWAA 2YQUA 1GT8A 1NEKA 3NYEA 4YKFA 5C3JA 1TDKA 1PN0A 5GSNA 1M6IA 3BI5A 1ELIA 1Q1WA 2GQFA 2X50A 1JRXA 3ABVA 3TTBA 3DH9A 4C3XA 4EIQA 1NENA 3KPKA 3UKAA 2BC0A 1PXAA 1M1PA 1OJTA 3DK4A 4FDCB 1IUVA 1OJDA 1GPEA 1TYTA 1D7YA 3E1TA 4AT0A 2XVHA 3GWDA 3AEFA 5CQFA 1VG0A 3CNDA 3ADAB 3NIXA 3QSMA 4N9XA 3FBSA 4H7UA 1SP3A 1DJNA 4FX9A 3BHFA 3G5SA 2QCUA 3ZDNA 2RABA 3BNGA 2V61A 2JB3A 4JQ9A 3G5QA 4NTEA 1JNZA 2OLNA 3GDNA 4NTDA 4NTCA 3SZCA 5KWFA 4Y4NA 4C3YA 2C67A 3K7QX 4Z2TA 3KLJA 1XDIA 2GH5A 1JEHA 3BI2A 4ZCCA 2IIDA 2E81A 4CY6A 4ADWA 3RKHA 3ALLA 3AECA 2OA1A 3CNTA 3HYXA 3URHA 4GDPA 1XPQA 1TDNA 2JK6A 3CTYA 4B66A 3KVEA 3GYXA 3CIRA 4G73A 3FMWA 3DGZA 2H89A 1NDAA 4AP1A 3AEGA 4OPLA 1CF3A 1GERA 2YG6A 5JCIA 3NHOX 3SY4A 1VDCA 4EQSA 2C7GA 3AE9A 1DOCA 4YTNA 1S2QA 2YLXA 4EIPA 3AEDA 1ZY8A 3UKKA 5IPYA 1FS9A 4CRTA 2FBWA 3NK2X 1KNPA 3KA7A 4WCTA 4J56A 3P4QA 4H2PA 3M13A 2R4EA 3AE6A 1JRYA 1L9CA 2GQWA 2X3NA 3NRNA 2BXRA 3GD4A 4B68A 1GTEA 2C4CA 5KMQA 3B6DA 2O9ZA 3F8DA 3IHMA 1IUXA 3QSSA 1F8WA 1IUTA 4H4XA 4HA6A 3CGCA 4BURA 4YTPA 5HYMA 3M12A 4EMIA 2AR8A 4JY2A 3AYLA 4P9SA 5C2TA 5KOXA 2GR0A 2WDQA 3LOVA 1GTHA 4TLXA 1CJCA 1GRTA 2CZSA 1PJ7A 1ZKQA 4UDQA 4CNKA 3ICSA 2JKCA 4Y4MA 4Q5CA 1CL0A 4AOXA 3EPTA 3LJPA 3GWFA 1FT6A 4YT0A 1E1LA 1EBDA 2BXSA 1IUUA 1VRQB 3CPIG 2C3CA 1QDBA 3ZYXA 2E80A 4B65A 1JNRA 2I0ZA 1ZK7A 2RGOA 2WU2A 4G6GA 2CVJA 3CGEA 1M64A 3SCEA 4EM4A 1PS9A 2BRAA 2VQ7A 3UBRA 4U8KA 3HYWA 3IHGA 3NYCA 1KDGA 3ICRA 3O0HA 4H4YA 3SQPA 2BRYA 3GRTA 2GAGB 4K5SA 2GV8A 2WS3A 3OWMA 4OPTA 3UOXA 4YTMA 1V59A 3NTDA 5FMHA 4XWRA 1DJQA 1B37A 1ZMDA 2RF7A 4EQRA 2YR4A 1O94A 2XVIA 3NNEA 1RP0A 4LU6A 4OPDA 1FCDA 4U8NA 3IF9A 3UCLA 5BRTA 4G74A 3TORA 3AYIA 4CCQA 1X31B 4YWOA 2ZO5A 2WP5A 3FPZA 5M0ZA 3RP6A 2VVLA 2XYOA 3WE0A 1E7PA 2F5ZA 2QA1A 4REKA 4U2SA 1GRAA 2Q7VA 2XFQA 4E0VA 3T37A 2RGJA 3FG2P 5U1OA 3VRAA 2BK3A 4DNAA 3EAOA 1L0VA 2R0CA 2V5ZA 1ZOVA 1KNRA 4H50A 4JY3A 1Z6LA 4LA1A 1BGJA 3FO3A 2WESA 4EMWA 1BZLA 4OPCA 2VRMA 4Z44A 4Q0TA 5EB4A 4EM3A 1NPXA 1MXTA 3AE2A 5L46A 3DK9A 4H4RA 5JCNA 2C3DA 2GRTA 3UKHA 2B7RA 2YLTA 2TMDA 5KRQA 4BK3A 2BK5A 3PVCA 2CFYA 4IVOB 3NGCX 1YKJA 1O95A 1GRBA 3II4A 5KMRA 2ZZ0A 3AXBA 4H4UA 1FEBA 4Z43A 4NNJA 5M10A 1QO8A 3GYJA 5KVIA 2ZZCA 3ITJA 4A79A 1CHUA 3LGQA 2E4GA 2CDUA 2R46A 2C65A 3AEBA 3QVPA 2V60A 3T2KA 5KVHA 1FOHA 2WP6A 3LZXA 2R9ZA 3BI4A 1EL9A 4NEVA 3V3OA 2XLRA 1GREA 3SZWA 3BNFA 1PXCA 3UKPA 5EOWA 1RSGA 1D4CA 1FEAA 1ZX9A 1VG9A 2YVJA 4GUVA 4X4JA 4IA5A 4UP3A 1KSSA 1S3EA 1B4VA 3H8LA 1O5WA 3EF6A 1PXBA 3M0OA 2RDZA 4YKGA 5FS7A 1NAAA 2VZ2A 2BABA 2YLRA 3ICTA 3ATQA 4C77A 4YSZA 2QAEA 3AD8B 2YM2A 1NHRA 1K4QA 2ZZBA 3P1WA 3SYIA 3CNPA 3NT6A 2YWLA 1E1NA 2XVEA 3P9UA 4YSXA 2YR6A 4PAAA 4FK1C 4K2XA 1D7LA 4ZN0A 4IVMB 5DBJA 2C66A 2XVJA 5HHFA 4U2TA 3K7MX 3MMOA 3QJ4A 4JDRA 3UTEA 4B67A 5GRTA 3CPJG 2J7AA 3ALJA 2YLZA 1P2EA 3VQRA 4BV6A 2WDVA 2C75A 1YQ4A 3KD9A 2NVKX 2GMJA 3DJJA 3BNMA 1CJ3A 3UKFA 1TYPA 2VR0A 1FECA 4B1BA 2Q6UA 4A9WA 4DSGA 4Q17A 2YLSA 4KX6A 5HXIA 1JRZA 1GNDA 4YXDA 3GD3A 2YG3A 2V3BA 1JU2A 1EL7A 4GR1A 3P4SA 2JB2A 4Y4LA 5IQ4A 2GR2A 3LADA 2WBAA 3NN0X 1D4DA 3AE5A 4G6HA 1H7XA 1DOEA 3LG1A 4PABA 3S5WA 5JCKA 5FS8A 5KNLA 3AYJA 3UKLA 1KF6A 3UTGA 3VRDB 4U8OA 3LZWA 3COXA 4A65A 2X8HA 2B9XA 1L9EA 5EB5A 5U63A 4ZCDA 1PDHA 2GR1A 4YSHA 2C64A 2BK4A 3NTAA 4D04A 4A6NA 3UOVA 1DOBA 3NK0X 4XWZA 1CC6A 4H2NA 4U8IA 3C4NA 4DGKA 3BNHA 2GEWA 3AWIA 3LXDA 2IVEA 4H4WA 3T14A 3F29A 3L1RA 1KSUA 4K7ZA 1GESA 1Y56A 1CC4A 4TM3A 1ZDLA 3RNMA 4A99A 4XXGA 4IA6A 4M52A 1B5QA 4BK1A 4H4QA 4J34A 4X9MA 4TM1A 3CMMA 3BHKA 4NEWA 3CNSA 4OVIA 5JCMA 4RSLA 4J2WA 1DNCA 3SGLA 3OC4A 4H4SA 1CBOA 1P2HA 4G9KA 1FS8A 4L3YA 1H83A 1QLBA 3CPHG 2OLOA 3ISHA 1IJHA 1IUWA 5J7XA 4B69A 3Q6JA 3FIMB 1GRHA 3AEAA 4UDRA 4APNA 2GR3A 4O5UA 2JBVA 1BGNA 1ZP0A 3UP4A 2WU5A 3DJGX 3PS9A 4NZHA 4K8DA 2B9WA 3DK8A 4Z2UA 3AD9B 3UKQA 4USRA 3GDPA 2PHHA 1PBDA 4H4TA 4D03A 2AQJA 1XANA 2VRLA 1OJCA 1PBFA 2C73A 2EQ9A 1RYIA 1EL5A 2X8CA 2R4JA 3F8RA 4A5LA 2E1MA 2B7SA 3GMCA 4H4ZA 4Q1OA 3NKSA 2YAUA 1UKVG 3AE4A 3EANA 1COYA 4BJZA 2C72A 2BS4A 1Y56B 4USQA 4L3XA 2YM1A 2Z5XA 2BACA 4U8LA 4AP3A 2NPXA 2EQ7A 2CULA 1KFYA 3B3RA 3P4RA 3S61A 5U25A 2BYBA 1LJ1A 1BF3A 1BVBA 3PO7A 1LQUA 5LV9A 2GVCA 2X8GA 3AE1A 3JSKA 3KU9A 2VQBA 3RHAA 2J3NA 4AT2A 4EQXA 3S7WA 3D1IA 5FS6A 2GMHA 4GAPA 2R0PA 3T2ZA 4L38A 3HZLA 1H6VA 4H4VA 3CGBA 3AEEA 1PJ5A 4FK1A 4L3ZA 4K5RA 2DKHA 2XFOA 2AAQA 3L8KA
chains in the Genus database with same CATH topology
1IUSA 2OALA 3DA1A 3P4PA 3NK1X 3VR9A 1H86A 2YG5A 2YR5A 3SM8A 4GRTA 4B64A 2TPRA 5BULA 2WPEA 5KOWA 4OPUA 1LPFA 3UOYA 4C5OA 3CGDA 1CJ2A 4RG4A 2WPFA 2UZZA 1E1KA 4GF7A 1S2YA 1DODA 1N1PA 1QJDA 4GDEA 1F6MA 3D8XA 3DJDA 3QFAA 1HYUA 4OPIA 2BS3A 3F8PA 1PJ6A 2FJAA 2WQYA 1TRBA 1XHCA 2JAEA 2VVMA 3SZFA 2APGA 3H4KA 5CKUA 2R0GA 2A8XA 3SZ0A 2Q0KA 4Z24A 2OT4A 1YY5A 2WOIA 4WJYA 2XFPA 4BJYA 5BVAA 2E5VA 3CN8A 1JOAA 3SFDA 1LVLA 1CJ4A 1GU6A 1CC2A 2HQMA 4HB9A 1DXLA 2WP9A 3V3NA 1ONFA 4UDPA 1E6EA 1K0IA 2WOVA 4GCMA 2B76A 3REDA 5EBKA 4EMJA 1LTXR 2XLTA 3K30A 5FS9A 1F8RA 1D4EA 3AE7A 4CCRA 1TDFA 2YG7A 2PYXA 3GMBA 3UU9A 2BCGG 2V3AA 3OZ2A 4O5QA 1H82A 3ALMA 2WPCA 2GAHB 1JNIA 4II2A 2YG4A 2EQ6A 3QVRA 1YQZA 3HYVA 4B63A 1ZOYA 5BUKA 2LFCA 3AE8A 3BNUA 1OAHA 2XDOA 3L1TA 2Y6RA 3G5RA 4X9NA 3AB1A 1VQWA 4ECHA 1Q9IA 2WETA 1K0JA 1M1RA 2DKIA 2FJDA 2VOUA 4NWZA 1GOSA 3LB8A 5TR3A 3T31A 2XFUA 5KMPA 4Q4UA 1OJAA 4LIIA 1Q1RA 3T2YA 4OPGA 1NHQA 3T0KA 2Q0LA 4GAVA 3K7TA 2XCGA 2WOWA 3GSIA 3RP8A 3V76A 4H2QA 3QSEA 1N4UA 1GRGA 2XFNA 5ER0A 2ARDA 3H8IA 1K0LA 1MOKA 3QFBA 3RP7A 1E39A 1GALA 1GRFA 2ACZA 2XLSA 3GYIA 4AOSA 2VVLG 2BCPA 3GM6A 3BNJA 1PHHA 2RGHA 2Z5YA 3IC9A 3GRSA 1LV0A 1FS7A 3SXIA 2GF3A 2YVFA 2C70A 1GXFA 4EQWA 1F3PA 2XVFA 3CNJA 4IV9A 3NG7X 1OJ9A 3DMEA 4JNQA 2A87A 4CNJA 4U2LA 2BS2A 1YQ3A 2K3VA 5IQ1A 2GB0A 1NHSA 2QA2A 4H2RA 1MO9A 1W4XA 3Q9TA 4OCGA 1L9DA 2H88A 4KPRA 5KMSA 1PBEA 4YSYA 1EL8A 4MJWA 4J36A 4U8JA 4BK2A 3C96A 1E1MA 2ZBWA 3ATRA 3UP5A 2WHDA 4CY8A 1FL2A 1GEUA 2JB1A 1H84A 1PBBA 4K22A 5KXJA 4TM0A 1REOA 2XLPA 1GETA 3UTHA 3UTFA 1ZMCA 3I6DA 3R9UA 4I58A 2V6OA 3UOZA 1H7WA 2FJBA 1F8SA 3NYFA 4A6NB 1TDOA 3DGHA 1N4WA 1NG3A 4A7AA 4Z26A 1LQTA 4Z25A 2B9YA 2BA9A 1GV4A 2A89A 4RG3A 2WDRA 4ICYA 1GSNA 2WEUA 3NLCA 4CBQA 3KKJA 5HY5A 4JNAA 3C4AA 3D1CA 2R45A 1BKWA 4Z2RA 3DJEA 4J33A 1PBCA 2C76A 1D5TA 4WX1A 3VR8A 3KPFA 5JCLA 2EQ8A 3NH3X 1NG4A 3NN6X 4TLZA 4TM4A 1TDEA 2IVDA 3SX6A 1FT5A 4I59A 4H4PA 2BC1A 4JN9A 4J31A 4C74A 4II3A 3SXQA 4Q5BA 1NHPA 2XLUA 3AE3A 1SEZA 4J57A 4U8PA 1S3BA 3VRBA 3I3LA 2FJEA 2YVGA 4U8MA 2Y6QA 3SFEA 1H81A 1B8SA 2X99A 3AD7B 1AOGA 2OAMA 1Y0PA 1N4VA 4DSHA 1BWCA 1M1QA 2YLWA 5J60A 2W0HA 3IWAA 2YQUA 1GT8A 1NEKA 3NYEA 4YKFA 5C3JA 1TDKA 1PN0A 5GSNA 1M6IA 3BI5A 1ELIA 1Q1WA 2GQFA 2X50A 1JRXA 3ABVA 3TTBA 3DH9A 4C3XA 4EIQA 1NENA 3KPKA 3UKAA 2BC0A 1PXAA 1M1PA 1OJTA 3DK4A 4FDCB 1IUVA 1OJDA 1GPEA 1TYTA 1D7YA 3E1TA 4AT0A 2XVHA 3GWDA 3AEFA 5CQFA 1VG0A 3CNDA 3ADAB 3NIXA 3QSMA 4N9XA 3FBSA 4H7UA 1SP3A 1DJNA 4FX9A 3BHFA 3G5SA 2QCUA 3ZDNA 2RABA 3BNGA 2V61A 2JB3A 4JQ9A 3G5QA 4NTEA 1JNZA 2OLNA 3GDNA 4NTDA 4NTCA 3SZCA 5KWFA 4Y4NA 4C3YA 2C67A 3K7QX 4Z2TA 3KLJA 1XDIA 2GH5A 1JEHA 3BI2A 4ZCCA 2IIDA 2E81A 4CY6A 4ADWA 3RKHA 3ALLA 3AECA 2OA1A 3CNTA 3HYXA 3URHA 4GDPA 1XPQA 1TDNA 2JK6A 3CTYA 4B66A 3KVEA 3GYXA 3CIRA 4G73A 3FMWA 3DGZA 2H89A 1NDAA 4AP1A 3AEGA 4OPLA 1CF3A 1GERA 2YG6A 5JCIA 3NHOX 3SY4A 1VDCA 4EQSA 2C7GA 3AE9A 1DOCA 4YTNA 1S2QA 2YLXA 4EIPA 3AEDA 1ZY8A 3UKKA 5IPYA 1FS9A 4CRTA 2FBWA 3NK2X 1KNPA 3KA7A 4WCTA 4J56A 3P4QA 4H2PA 3M13A 2R4EA 3AE6A 1JRYA 1L9CA 2GQWA 2X3NA 3NRNA 2BXRA 3GD4A 4B68A 1GTEA 2C4CA 5KMQA 3B6DA 2O9ZA 3F8DA 3IHMA 1IUXA 3QSSA 1F8WA 1IUTA 4H4XA 4HA6A 3CGCA 4BURA 4YTPA 5HYMA 3M12A 4EMIA 2AR8A 4JY2A 3AYLA 4P9SA 5C2TA 5KOXA 2GR0A 2WDQA 3LOVA 1GTHA 4TLXA 1CJCA 1GRTA 4CNKA 1PJ7A 1ZKQA 4UDQA 3ICSA 2JKCA 4Y4MA 4Q5CA 1CL0A 4AOXA 3EPTA 3LJPA 3GWFA 1FT6A 4YT0A 1E1LA 1EBDA 2BXSA 1IUUA 1VRQB 3CPIG 2C3CA 1QDBA 3ZYXA 2E80A 4B65A 1JNRA 2I0ZA 1ZK7A 2RGOA 2WU2A 4G6GA 2CVJA 3CGEA 1M64A 3SCEA 4EM4A 1PS9A 2BRAA 2VQ7A 3UBRA 4U8KA 3HYWA 3IHGA 3NYCA 1KDGA 3ICRA 3O0HA 4H4YA 3SQPA 2BRYA 3GRTA 2GAGB 4K5SA 2GV8A 2WS3A 3OWMA 4OPTA 3UOXA 4YTMA 1V59A 3NTDA 5FMHA 4XWRA 1DJQA 1B37A 1ZMDA 2RF7A 4EQRA 2YR4A 1O94A 2XVIA 3NNEA 1RP0A 4LU6A 4OPDA 1FCDA 4U8NA 3IF9A 3UCLA 5BRTA 4G74A 3TORA 3AYIA 4CCQA 1X31B 4YWOA 2ZO5A 2WP5A 3FPZA 5M0ZA 3RP6A 2VVLA 2XYOA 3WE0A 1E7PA 2F5ZA 2QA1A 4REKA 4U2SA 1GRAA 2Q7VA 2XFQA 4E0VA 3T37A 2RGJA 3FG2P 5U1OA 3VRAA 2BK3A 4DNAA 3EAOA 1L0VA 2R0CA 2V5ZA 1ZOVA 1KNRA 4H50A 4JY3A 1Z6LA 4LA1A 1BGJA 3FO3A 2WESA 4EMWA 1BZLA 4OPCA 2VRMA 4Z44A 4Q0TA 5EB4A 4EM3A 1NPXA 1MXTA 3AE2A 5L46A 3DK9A 4H4RA 5JCNA 2C3DA 2GRTA 3UKHA 2B7RA 2YLTA 2TMDA 5KRQA 4BK3A 2BK5A 3PVCA 2CFYA 4IVOB 3NGCX 1YKJA 1O95A 1GRBA 3II4A 5KMRA 2ZZ0A 3AXBA 4H4UA 1FEBA 4Z43A 4NNJA 5M10A 1QO8A 3GYJA 5KVIA 2ZZCA 3ITJA 4A79A 1CHUA 3LGQA 2E4GA 2CDUA 2R46A 2C65A 3AEBA 3QVPA 2V60A 3T2KA 5KVHA 1FOHA 2WP6A 3LZXA 2R9ZA 3BI4A 1EL9A 4NEVA 3V3OA 2XLRA 1GREA 3SZWA 3BNFA 1PXCA 3UKPA 5EOWA 1RSGA 1D4CA 1FEAA 1ZX9A 1VG9A 2YVJA 4GUVA 4X4JA 4IA5A 4UP3A 1KSSA 1S3EA 1B4VA 3H8LA 1O5WA 3EF6A 1PXBA 3M0OA 2RDZA 4YKGA 5FS7A 1NAAA 2VZ2A 2BABA 2YLRA 3ICTA 3ATQA 4C77A 4YSZA 2QAEA 3AD8B 2YM2A 1NHRA 1K4QA 2ZZBA 3P1WA 3SYIA 3CNPA 3NT6A 2YWLA 1E1NA 2XVEA 3P9UA 4YSXA 2YR6A 4PAAA 4FK1C 4K2XA 1D7LA 4ZN0A 4IVMB 5DBJA 2C66A 2XVJA 5HHFA 4U2TA 3K7MX 3MMOA 3QJ4A 4JDRA 3UTEA 4B67A 5GRTA 3CPJG 2J7AA 3ALJA 2YLZA 1P2EA 3VQRA 4BV6A 2WDVA 2C75A 1YQ4A 3KD9A 2NVKX 2GMJA 3DJJA 3BNMA 1CJ3A 3UKFA 1TYPA 2VR0A 1FECA 4B1BA 2Q6UA 4A9WA 4DSGA 4Q17A 2YLSA 4KX6A 5HXIA 1JRZA 1GNDA 4YXDA 3GD3A 2YG3A 2V3BA 1JU2A 1EL7A 4GR1A 3P4SA 2JB2A 4Y4LA 5IQ4A 2GR2A 3LADA 2WBAA 3NN0X 1D4DA 3AE5A 4G6HA 1H7XA 1DOEA 3LG1A 4PABA 3S5WA 5JCKA 5FS8A 5KNLA 3AYJA 3UKLA 1KF6A 3UTGA 3VRDB 4U8OA 3LZWA 3COXA 4A65A 2X8HA 2B9XA 1L9EA 5EB5A 5U63A 4ZCDA 1PDHA 2GR1A 4YSHA 2C64A 2BK4A 3NTAA 4D04A 4A6NA 3UOVA 1DOBA 3NK0X 4XWZA 1CC6A 4H2NA 4U8IA 3C4NA 4DGKA 3BNHA 2GEWA 3AWIA 3LXDA 2IVEA 4H4WA 3T14A 3F29A 3L1RA 1KSUA 4K7ZA 1GESA 1Y56A 1CC4A 4TM3A 1ZDLA 3RNMA 4A99A 4XXGA 4IA6A 4M52A 1B5QA 4BK1A 4H4QA 4J34A 4X9MA 4TM1A 3CMMA 3BHKA 4NEWA 3CNSA 4OVIA 5JCMA 4RSLA 4J2WA 1DNCA 3SGLA 3OC4A 4H4SA 1CBOA 1P2HA 4G9KA 1FS8A 4L3YA 1H83A 1QLBA 3CPHG 2OLOA 3ISHA 1IJHA 1IUWA 5J7XA 4B69A 3Q6JA 3FIMB 1GRHA 3AEAA 4UDRA 4APNA 2GR3A 4O5UA 2JBVA 1BGNA 1ZP0A 3UP4A 2WU5A 3DJGX 3PS9A 4NZHA 4K8DA 2B9WA 3DK8A 4Z2UA 3AD9B 3UKQA 4USRA 3GDPA 2PHHA 1PBDA 4H4TA 4D03A 2AQJA 1XANA 2VRLA 1OJCA 1PBFA 2C73A 2EQ9A 1RYIA 1EL5A 2X8CA 2R4JA 3F8RA 4A5LA 2E1MA 2B7SA 3GMCA 4H4ZA 4Q1OA 3NKSA 2YAUA 1UKVG 3AE4A 3EANA 1COYA 4BJZA 2C72A 2BS4A 1Y56B 4USQA 4L3XA 2YM1A 2Z5XA 2BACA 4U8LA 4AP3A 2NPXA 2EQ7A 2CULA 1KFYA 3B3RA 3P4RA 3S61A 5U25A 2BYBA 1LJ1A 1BF3A 1BVBA 3PO7A 1LQUA 5LV9A 2GVCA 2X8GA 3AE1A 3JSKA 3KU9A 2VQBA 3RHAA 2J3NA 4AT2A 4EQXA 3S7WA 3D1IA 5FS6A 2GMHA 4GAPA 2R0PA 3T2ZA 4L38A 3HZLA 1H6VA 4H4VA 3CGBA 3AEEA 1PJ5A 4FK1A 4L3ZA 4K5RA 2DKHA 2XFOA 2AAQA 3L8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUS A;  2OAL A;  3DA1 A;  3P4P A;  3NK1 X;  3VR9 A;  1H86 A;  2YG5 A;  2YR5 A;  3SM8 A;  4GRT A;  4B64 A;  2TPR A;  5BUL A;  2WPE A;  5KOW A;  4OPU A;  1LPF A;  3UOY A;  4C5O A;  3CGD A;  1CJ2 A;  4RG4 A;  2WPF A;  2UZZ A;  1E1K A;  4GF7 A;  1S2Y A;  1DOD A;  1N1P A;  1QJD A;  4GDE A;  1F6M A;  3D8X A;  3DJD A;  3QFA A;  1HYU A;  4OPI A;  2BS3 A;  3F8P A;  1PJ6 A;  2FJA A;  2WQY A;  1TRB A;  1XHC A;  2JAE A;  2VVM A;  2APG A;  3H4K A;  5CKU A;  2R0G A;  2A8X A;  2Q0K A;  4Z24 A;  2OT4 A;  1YY5 A;  2WOI A;  4WJY A;  2XFP A;  4BJY A;  5BVA A;  2E5V A;  3CN8 A;  1JOA A;  3SFD A;  1LVL A;  1CJ4 A;  1GU6 A;  1CC2 A;  2HQM A;  4HB9 A;  1DXL A;  2WP9 A;  3V3N A;  1ONF A;  4UDP A;  1E6E A;  1K0I A;  2WOV A;  4GCM A;  2B76 A;  3RED A;  5EBK A;  4EMJ A;  1LTX R;  2XLT A;  3K30 A;  5FS9 A;  1F8R A;  1D4E A;  3AE7 A;  4CCR A;  1TDF A;  2YG7 A;  2PYX A;  3GMB A;  3UU9 A;  2BCG G;  2V3A A;  3OZ2 A;  4O5Q A;  1H82 A;  3ALM A;  2WPC A;  2GAH B;  1JNI A;  2YG4 A;  2EQ6 A;  3QVR A;  1YQZ A;  4B63 A;  2LFC A;  1ZOY A;  5BUK A;  3AE8 A;  3BNU A;  1OAH A;  2XDO A;  3L1T A;  2Y6R A;  3G5R A;  4X9N A;  3AB1 A;  1VQW A;  4ECH A;  1Q9I A;  2WET A;  1K0J A;  1M1R A;  2DKI A;  2FJD A;  2VOU A;  1GOS A;  3LB8 A;  5TR3 A;  2XFU A;  4Q4U A;  1OJA A;  4LII A;  1Q1R A;  4OPG A;  1NHQ A;  2Q0L A;  3K7T A;  2XCG A;  2WOW A;  3GSI A;  3RP8 A;  3V76 A;  4H2Q A;  3QSE A;  1N4U A;  1GRG A;  2XFN A;  5ER0 A;  2ARD A;  3H8I A;  1K0L A;  1MOK A;  3QFB A;  3RP7 A;  1E39 A;  1GAL A;  1GRF A;  2ACZ A;  2XLS A;  3GYI A;  4AOS A;  2VVL G;  2BCP A;  3GM6 A;  3BNJ A;  1PHH A;  2RGH A;  2Z5Y A;  3IC9 A;  3GRS A;  1LV0 A;  1FS7 A;  2GF3 A;  2YVF A;  2C70 A;  1GXF A;  4EQW A;  1F3P A;  2XVF A;  3CNJ A;  4IV9 A;  3NG7 X;  1OJ9 A;  3DME A;  4JNQ A;  2A87 A;  4CNJ A;  4U2L A;  2BS2 A;  1YQ3 A;  2K3V A;  5IQ1 A;  2GB0 A;  1NHS A;  2QA2 A;  4H2R A;  1MO9 A;  1W4X A;  3Q9T A;  4OCG A;  1L9D A;  2H88 A;  4KPR A;  1PBE A;  4YSY A;  1EL8 A;  4MJW A;  4J36 A;  4U8J A;  4BK2 A;  3C96 A;  1E1M A;  2ZBW A;  3ATR A;  3UP5 A;  2WHD A;  4CY8 A;  1FL2 A;  1GEU A;  2JB1 A;  1H84 A;  1PBB A;  4K22 A;  5KXJ A;  4TM0 A;  1REO A;  2XLP A;  1GET A;  3UTH A;  3UTF A;  1ZMC A;  3I6D A;  3R9U A;  4I58 A;  2V6O A;  3UOZ A;  1H7W A;  2FJB A;  1F8S A;  3NYF A;  4A6N B;  1TDO A;  3DGH A;  1N4W A;  1NG3 A;  4A7A A;  4Z26 A;  1LQT A;  4Z25 A;  2B9Y A;  2BA9 A;  1GV4 A;  2A89 A;  4RG3 A;  2WDR A;  4ICY A;  1GSN A;  2WEU A;  3NLC A;  4CBQ A;  3KKJ A;  5HY5 A;  4JNA A;  3C4A A;  3D1C A;  2R45 A;  1BKW A;  4Z2R A;  3DJE A;  4J33 A;  1PBC A;  2C76 A;  1D5T A;  4WX1 A;  3VR8 A;  3KPF A;  5JCL A;  2EQ8 A;  3NH3 X;  1NG4 A;  3NN6 X;  4TLZ A;  4TM4 A;  1TDE A;  2IVD A;  1FT5 A;  4I59 A;  4H4P A;  2BC1 A;  4JN9 A;  4J31 A;  4C74 A;  3SXQ A;  4Q5B A;  1NHP A;  2XLU A;  3AE3 A;  1SEZ A;  4J57 A;  4U8P A;  1S3B A;  3VRB A;  3I3L A;  2FJE A;  2YVG A;  4U8M A;  2Y6Q A;  3SFE A;  1H81 A;  1B8S A;  2X99 A;  3AD7 B;  1AOG A;  2OAM A;  1Y0P A;  1N4V A;  4DSH A;  1BWC A;  1M1Q A;  2YLW A;  5J60 A;  2W0H A;  3IWA A;  2YQU A;  1GT8 A;  1NEK A;  3NYE A;  4YKF A;  5C3J A;  1TDK A;  1PN0 A;  5GSN A;  1M6I A;  3BI5 A;  1ELI A;  1Q1W A;  2GQF A;  2X50 A;  1JRX A;  3ABV A;  3TTB A;  3DH9 A;  4C3X A;  4EIQ A;  1NEN A;  3UKA A;  2BC0 A;  1PXA A;  1M1P A;  1OJT A;  3DK4 A;  4FDC B;  1IUV A;  1OJD A;  1GPE A;  1TYT A;  1D7Y A;  3E1T A;  4AT0 A;  2XVH A;  3GWD A;  3AEF A;  5CQF A;  1VG0 A;  3CND A;  3ADA B;  3NIX A;  3QSM A;  4N9X A;  3FBS A;  4H7U A;  1SP3 A;  1DJN A;  4FX9 A;  3BHF A;  3G5S A;  2QCU A;  3ZDN A;  2RAB A;  3BNG A;  2V61 A;  2JB3 A;  4JQ9 A;  3G5Q A;  4NTE A;  1JNZ A;  2OLN A;  3GDN A;  4NTD A;  4NTC A;  5KWF A;  4Y4N A;  4C3Y A;  2C67 A;  3K7Q X;  4Z2T A;  3KLJ A;  1XDI A;  2GH5 A;  1JEH A;  3BI2 A;  4ZCC A;  2IID A;  2E81 A;  4CY6 A;  4ADW A;  3RKH A;  3ALL A;  3AEC A;  2OA1 A;  3CNT A;  3URH A;  4GDP A;  1XPQ A;  1TDN A;  2JK6 A;  3CTY A;  4B66 A;  3KVE A;  3GYX A;  3CIR A;  3FMW A;  3DGZ A;  2H89 A;  1NDA A;  4AP1 A;  3AEG A;  4OPL A;  1CF3 A;  1GER A;  2YG6 A;  5JCI A;  3NHO X;  4EQS A;  1VDC A;  2C7G A;  3AE9 A;  1DOC A;  4YTN A;  1S2Q A;  2YLX A;  4EIP A;  3AED A;  1ZY8 A;  3UKK A;  5IPY A;  1FS9 A;  4CRT A;  2FBW A;  3NK2 X;  1KNP A;  3KA7 A;  4WCT A;  4J56 A;  3P4Q A;  4H2P A;  3M13 A;  2R4E A;  3AE6 A;  1JRY A;  1L9C A;  2GQW A;  2X3N A;  3NRN A;  2BXR A;  3GD4 A;  4B68 A;  1GTE A;  3B6D A;  2O9Z A;  3F8D A;  3IHM A;  1IUX A;  3QSS A;  1F8W A;  1IUT A;  4H4X A;  4HA6 A;  3CGC A;  4BUR A;  4YTP A;  5HYM A;  3M12 A;  4EMI A;  2AR8 A;  4JY2 A;  3AYL A;  4P9S A;  5C2T A;  5KOX A;  2GR0 A;  2WDQ A;  3LOV A;  1GTH A;  4TLX A;  1CJC A;  1GRT A;  4CNK A;  1PJ7 A;  1ZKQ A;  4UDQ A;  3ICS A;  2JKC A;  4Y4M A;  4Q5C A;  1CL0 A;  4AOX A;  3EPT A;  3LJP A;  3GWF A;  1FT6 A;  4YT0 A;  1E1L A;  1EBD A;  2BXS A;  1IUU A;  1VRQ B;  3CPI G;  2C3C A;  1QDB A;  3ZYX A;  2E80 A;  4B65 A;  1JNR A;  2I0Z A;  1ZK7 A;  2RGO A;  2WU2 A;  2CVJ A;  3CGE A;  1M64 A;  3SCE A;  4EM4 A;  1PS9 A;  2VQ7 A;  3UBR A;  4U8K A;  3IHG A;  3NYC A;  1KDG A;  3ICR A;  3O0H A;  4H4Y A;  3SQP A;  3GRT A;  2GAG B;  4K5S A;  2GV8 A;  2WS3 A;  3OWM A;  4OPT A;  3UOX A;  4YTM A;  1V59 A;  3NTD A;  5FMH A;  4XWR A;  1DJQ A;  1B37 A;  1ZMD A;  2RF7 A;  4EQR A;  2YR4 A;  1O94 A;  2XVI A;  3NNE A;  1RP0 A;  4LU6 A;  4OPD A;  1FCD A;  4U8N A;  3IF9 A;  3UCL A;  5BRT A;  4CCQ A;  3TOR A;  3AYI A;  1X31 B;  4YWO A;  2ZO5 A;  2WP5 A;  3FPZ A;  5M0Z A;  3RP6 A;  2VVL A;  2XYO A;  3WE0 A;  1E7P A;  2F5Z A;  2QA1 A;  4REK A;  4U2S A;  1GRA A;  2Q7V A;  2XFQ A;  4E0V A;  3T37 A;  2RGJ A;  3FG2 P;  5U1O A;  3VRA A;  2BK3 A;  4DNA A;  3EAO A;  1L0V A;  2R0C A;  2V5Z A;  1ZOV A;  1KNR A;  4H50 A;  4JY3 A;  1Z6L A;  4LA1 A;  1BGJ A;  3FO3 A;  2WES A;  4EMW A;  1BZL A;  4OPC A;  2VRM A;  4Z44 A;  4Q0T A;  5EB4 A;  4EM3 A;  1NPX A;  1MXT A;  3AE2 A;  5L46 A;  3DK9 A;  4H4R A;  5JCN A;  2C3D A;  2GRT A;  3UKH A;  2B7R A;  2YLT A;  2TMD A;  5KRQ A;  4BK3 A;  2BK5 A;  3PVC A;  2CFY A;  4IVO B;  3NGC X;  1YKJ A;  1O95 A;  1GRB A;  3II4 A;  2ZZ0 A;  3AXB A;  4H4U A;  1FEB A;  4Z43 A;  5M10 A;  1QO8 A;  3GYJ A;  5KVI A;  2ZZC A;  3ITJ A;  4A79 A;  1CHU A;  3LGQ A;  2E4G A;  2CDU A;  2R46 A;  2C65 A;  3AEB A;  3QVP A;  2V60 A;  5KVH A;  1FOH A;  2WP6 A;  3LZX A;  2R9Z A;  3BI4 A;  1EL9 A;  4NEV A;  3V3O A;  2XLR A;  1GRE A;  3BNF A;  1PXC A;  3UKP A;  5EOW A;  1RSG A;  1D4C A;  1FEA A;  1ZX9 A;  1VG9 A;  2YVJ A;  4GUV A;  4X4J A;  4IA5 A;  4UP3 A;  1KSS A;  1S3E A;  1B4V A;  3H8L A;  1O5W A;  3EF6 A;  1PXB A;  3M0O A;  2RDZ A;  4YKG A;  5FS7 A;  1NAA A;  2VZ2 A;  2BAB A;  2YLR A;  3ICT A;  3ATQ A;  4C77 A;  4YSZ A;  2QAE A;  3AD8 B;  2YM2 A;  1NHR A;  1K4Q A;  2ZZB A;  3P1W A;  3CNP A;  3NT6 A;  2YWL A;  1E1N A;  2XVE A;  3P9U A;  4YSX A;  2YR6 A;  4PAA A;  4FK1 C;  4K2X A;  1D7L A;  4ZN0 A;  4IVM B;  5DBJ A;  2C66 A;  2XVJ A;  5HHF A;  4U2T A;  3K7M X;  3MMO A;  3QJ4 A;  4JDR A;  3UTE A;  4B67 A;  5GRT A;  3CPJ G;  2J7A A;  3ALJ A;  2YLZ A;  1P2E A;  3VQR A;  4BV6 A;  2WDV A;  2C75 A;  1YQ4 A;  3KD9 A;  2NVK X;  2GMJ A;  3DJJ A;  3BNM A;  1CJ3 A;  3UKF A;  1TYP A;  2VR0 A;  1FEC A;  4B1B A;  2Q6U A;  4A9W A;  4DSG A;  4Q17 A;  2YLS A;  4KX6 A;  5HXI A;  1JRZ A;  1GND A;  4YXD A;  3GD3 A;  2YG3 A;  2V3B A;  1JU2 A;  1EL7 A;  4GR1 A;  3P4S A;  2JB2 A;  4Y4L A;  5IQ4 A;  2GR2 A;  3LAD A;  2WBA A;  3NN0 X;  1D4D A;  3AE5 A;  5JCK A;  1H7X A;  1DOE A;  3LG1 A;  4PAB A;  3S5W A;  5FS8 A;  3AYJ A;  3UKL A;  1KF6 A;  3UTG A;  3VRD B;  4U8O A;  3LZW A;  3COX A;  4A65 A;  2X8H A;  2B9X A;  1L9E A;  5EB5 A;  5U63 A;  4ZCD A;  1PDH A;  2GR1 A;  4YSH A;  2C64 A;  2BK4 A;  3NTA A;  4D04 A;  4A6N A;  3UOV A;  1DOB A;  3NK0 X;  4XWZ A;  1CC6 A;  4H2N A;  4U8I A;  3C4N A;  4DGK A;  3BNH A;  2GEW A;  3AWI A;  3LXD A;  2IVE A;  4H4W A;  3F29 A;  3L1R A;  1KSU A;  4K7Z A;  1GES A;  1Y56 A;  1CC4 A;  4TM3 A;  1ZDL A;  3RNM A;  4A99 A;  4XXG A;  4IA6 A;  4M52 A;  1B5Q A;  4BK1 A;  4H4Q A;  4J34 A;  4X9M A;  4TM1 A;  3BHK A;  4NEW A;  3CNS A;  4OVI A;  5JCM A;  4RSL A;  4J2W A;  1DNC A;  3SGL A;  3OC4 A;  4H4S A;  1CBO A;  1P2H A;  1FS8 A;  4L3Y A;  1H83 A;  1QLB A;  3CPH G;  2OLO A;  3ISH A;  1IJH A;  1IUW A;  5J7X A;  4B69 A;  3Q6J A;  3FIM B;  1GRH A;  3AEA A;  4UDR A;  4APN A;  2GR3 A;  4O5U A;  2JBV A;  1BGN A;  1ZP0 A;  3UP4 A;  2WU5 A;  3DJG X;  3PS9 A;  4NZH A;  4K8D A;  2B9W A;  3DK8 A;  4Z2U A;  3AD9 B;  3UKQ A;  4USR A;  3GDP A;  2PHH A;  1PBD A;  4H4T A;  4D03 A;  2AQJ A;  1XAN A;  2VRL A;  1OJC A;  1PBF A;  2C73 A;  2EQ9 A;  1RYI A;  1EL5 A;  2X8C A;  2R4J A;  3F8R A;  4A5L A;  2E1M A;  2B7S A;  3GMC A;  4H4Z A;  4Q1O A;  3NKS A;  2YAU A;  1UKV G;  3AE4 A;  3EAN A;  1COY A;  4BJZ A;  2C72 A;  2BS4 A;  1Y56 B;  4USQ A;  4L3X A;  2YM1 A;  2Z5X A;  2BAC A;  4U8L A;  4AP3 A;  2NPX A;  2EQ7 A;  2CUL A;  1KFY A;  3B3R A;  3P4R A;  3S61 A;  5U25 A;  2BYB A;  1LJ1 A;  1BF3 A;  1BVB A;  3PO7 A;  1LQU A;  5LV9 A;  2GVC A;  2X8G A;  3AE1 A;  3JSK A;  3KU9 A;  2VQB A;  3RHA A;  2J3N A;  4AT2 A;  4EQX A;  3S7W A;  3D1I A;  5FS6 A;  2GMH A;  2R0P A;  4L38 A;  3HZL A;  1H6V A;  4H4V A;  3CGB A;  3AEE A;  1PJ5 A;  4FK1 A;  4L3Z A;  4K5R A;  2DKH A;  2XFO A;  2AAQ A;  3L8K A; 
#chains in the Genus database with same CATH topology
 1IUS A;  2OAL A;  3DA1 A;  3P4P A;  3NK1 X;  3VR9 A;  1H86 A;  2YG5 A;  2YR5 A;  3SM8 A;  4GRT A;  4B64 A;  2TPR A;  5BUL A;  2WPE A;  5KOW A;  4OPU A;  1LPF A;  3UOY A;  4C5O A;  3CGD A;  1CJ2 A;  4RG4 A;  2WPF A;  2UZZ A;  1E1K A;  4GF7 A;  1S2Y A;  1DOD A;  1N1P A;  1QJD A;  4GDE A;  1F6M A;  3D8X A;  3DJD A;  3QFA A;  1HYU A;  4OPI A;  2BS3 A;  3F8P A;  1PJ6 A;  2FJA A;  2WQY A;  1TRB A;  1XHC A;  2JAE A;  2VVM A;  3SZF A;  2APG A;  3H4K A;  5CKU A;  2R0G A;  2A8X A;  3SZ0 A;  2Q0K A;  4Z24 A;  2OT4 A;  1YY5 A;  2WOI A;  4WJY A;  2XFP A;  4BJY A;  5BVA A;  2E5V A;  3CN8 A;  1JOA A;  3SFD A;  1LVL A;  1CJ4 A;  1GU6 A;  1CC2 A;  2HQM A;  4HB9 A;  1DXL A;  2WP9 A;  3V3N A;  1ONF A;  4UDP A;  1E6E A;  1K0I A;  2WOV A;  4GCM A;  2B76 A;  3RED A;  5EBK A;  4EMJ A;  1LTX R;  2XLT A;  3K30 A;  5FS9 A;  1F8R A;  1D4E A;  3AE7 A;  4CCR A;  1TDF A;  2YG7 A;  2PYX A;  3GMB A;  3UU9 A;  2BCG G;  2V3A A;  3OZ2 A;  4O5Q A;  1H82 A;  3ALM A;  2WPC A;  2GAH B;  1JNI A;  4II2 A;  2YG4 A;  2EQ6 A;  3QVR A;  1YQZ A;  3HYV A;  4B63 A;  1ZOY A;  5BUK A;  2LFC A;  3AE8 A;  3BNU A;  1OAH A;  2XDO A;  3L1T A;  2Y6R A;  3G5R A;  4X9N A;  3AB1 A;  1VQW A;  4ECH A;  1Q9I A;  2WET A;  1K0J A;  1M1R A;  2DKI A;  2FJD A;  2VOU A;  4NWZ A;  1GOS A;  3LB8 A;  5TR3 A;  3T31 A;  2XFU A;  5KMP A;  4Q4U A;  1OJA A;  4LII A;  1Q1R A;  3T2Y A;  4OPG A;  1NHQ A;  3T0K A;  2Q0L A;  4GAV A;  3K7T A;  2XCG A;  2WOW A;  3GSI A;  3RP8 A;  3V76 A;  4H2Q A;  3QSE A;  1N4U A;  1GRG A;  2XFN A;  5ER0 A;  2ARD A;  3H8I A;  1K0L A;  1MOK A;  3QFB A;  3RP7 A;  1E39 A;  1GAL A;  1GRF A;  2ACZ A;  2XLS A;  3GYI A;  4AOS A;  2VVL G;  2BCP A;  3GM6 A;  3BNJ A;  1PHH A;  2RGH A;  2Z5Y A;  3IC9 A;  3GRS A;  1LV0 A;  1FS7 A;  3SXI A;  2GF3 A;  2YVF A;  2C70 A;  1GXF A;  4EQW A;  1F3P A;  2XVF A;  3CNJ A;  4IV9 A;  3NG7 X;  1OJ9 A;  3DME A;  4JNQ A;  2A87 A;  4CNJ A;  4U2L A;  2BS2 A;  1YQ3 A;  2K3V A;  5IQ1 A;  2GB0 A;  1NHS A;  2QA2 A;  4H2R A;  1MO9 A;  1W4X A;  3Q9T A;  4OCG A;  1L9D A;  2H88 A;  4KPR A;  5KMS A;  1PBE A;  4YSY A;  1EL8 A;  4MJW A;  4J36 A;  4U8J A;  4BK2 A;  3C96 A;  1E1M A;  2ZBW A;  3ATR A;  3UP5 A;  2WHD A;  4CY8 A;  1FL2 A;  1GEU A;  2JB1 A;  1H84 A;  1PBB A;  4K22 A;  5KXJ A;  4TM0 A;  1REO A;  2XLP A;  1GET A;  3UTH A;  3UTF A;  1ZMC A;  3I6D A;  3R9U A;  4I58 A;  2V6O A;  3UOZ A;  1H7W A;  2FJB A;  1F8S A;  3NYF A;  4A6N B;  1TDO A;  3DGH A;  1N4W A;  1NG3 A;  4A7A A;  4Z26 A;  1LQT A;  4Z25 A;  2B9Y A;  2BA9 A;  1GV4 A;  2A89 A;  4RG3 A;  2WDR A;  4ICY A;  1GSN A;  2WEU A;  3NLC A;  4CBQ A;  3KKJ A;  5HY5 A;  4JNA A;  3C4A A;  3D1C A;  2R45 A;  1BKW A;  4Z2R A;  3DJE A;  4J33 A;  1PBC A;  2C76 A;  1D5T A;  4WX1 A;  3VR8 A;  3KPF A;  5JCL A;  2EQ8 A;  3NH3 X;  1NG4 A;  3NN6 X;  4TLZ A;  4TM4 A;  1TDE A;  2IVD A;  3SX6 A;  1FT5 A;  4I59 A;  4H4P A;  2BC1 A;  4JN9 A;  4J31 A;  4C74 A;  4II3 A;  3SXQ A;  4Q5B A;  1NHP A;  2XLU A;  3AE3 A;  1SEZ A;  4J57 A;  4U8P A;  1S3B A;  3VRB A;  3I3L A;  2FJE A;  2YVG A;  4U8M A;  2Y6Q A;  3SFE A;  1H81 A;  1B8S A;  2X99 A;  3AD7 B;  1AOG A;  2OAM A;  1Y0P A;  1N4V A;  4DSH A;  1BWC A;  1M1Q A;  2YLW A;  5J60 A;  2W0H A;  3IWA A;  2YQU A;  1GT8 A;  1NEK A;  3NYE A;  4YKF A;  5C3J A;  1TDK A;  1PN0 A;  5GSN A;  1M6I A;  3BI5 A;  1ELI A;  1Q1W A;  2GQF A;  2X50 A;  1JRX A;  3ABV A;  3TTB A;  3DH9 A;  4C3X A;  4EIQ A;  1NEN A;  3KPK A;  3UKA A;  2BC0 A;  1PXA A;  1M1P A;  1OJT A;  3DK4 A;  4FDC B;  1IUV A;  1OJD A;  1GPE A;  1TYT A;  1D7Y A;  3E1T A;  4AT0 A;  2XVH A;  3GWD A;  3AEF A;  5CQF A;  1VG0 A;  3CND A;  3ADA B;  3NIX A;  3QSM A;  4N9X A;  3FBS A;  4H7U A;  1SP3 A;  1DJN A;  4FX9 A;  3BHF A;  3G5S A;  2QCU A;  3ZDN A;  2RAB A;  3BNG A;  2V61 A;  2JB3 A;  4JQ9 A;  3G5Q A;  4NTE A;  1JNZ A;  2OLN A;  3GDN A;  4NTD A;  4NTC A;  3SZC A;  5KWF A;  4Y4N A;  4C3Y A;  2C67 A;  3K7Q X;  4Z2T A;  3KLJ A;  1XDI A;  2GH5 A;  1JEH A;  3BI2 A;  4ZCC A;  2IID A;  2E81 A;  4CY6 A;  4ADW A;  3RKH A;  3ALL A;  3AEC A;  2OA1 A;  3CNT A;  3HYX A;  3URH A;  4GDP A;  1XPQ A;  1TDN A;  2JK6 A;  3CTY A;  4B66 A;  3KVE A;  3GYX A;  3CIR A;  4G73 A;  3FMW A;  3DGZ A;  2H89 A;  1NDA A;  4AP1 A;  3AEG A;  4OPL A;  1CF3 A;  1GER A;  2YG6 A;  5JCI A;  3NHO X;  3SY4 A;  1VDC A;  4EQS A;  2C7G A;  3AE9 A;  1DOC A;  4YTN A;  1S2Q A;  2YLX A;  4EIP A;  3AED A;  1ZY8 A;  3UKK A;  5IPY A;  1FS9 A;  4CRT A;  2FBW A;  3NK2 X;  1KNP A;  3KA7 A;  4WCT A;  4J56 A;  3P4Q A;  4H2P A;  3M13 A;  2R4E A;  3AE6 A;  1JRY A;  1L9C A;  2GQW A;  2X3N A;  3NRN A;  2BXR A;  3GD4 A;  4B68 A;  1GTE A;  2C4C A;  5KMQ A;  3B6D A;  2O9Z A;  3F8D A;  3IHM A;  1IUX A;  3QSS A;  1F8W A;  1IUT A;  4H4X A;  4HA6 A;  3CGC A;  4BUR A;  4YTP A;  5HYM A;  3M12 A;  4EMI A;  2AR8 A;  4JY2 A;  3AYL A;  4P9S A;  5C2T A;  5KOX A;  2GR0 A;  2WDQ A;  3LOV A;  1GTH A;  4TLX A;  1CJC A;  1GRT A;  2CZS A;  1PJ7 A;  1ZKQ A;  4UDQ A;  4CNK A;  3ICS A;  2JKC A;  4Y4M A;  4Q5C A;  1CL0 A;  4AOX A;  3EPT A;  3LJP A;  3GWF A;  1FT6 A;  4YT0 A;  1E1L A;  1EBD A;  2BXS A;  1IUU A;  1VRQ B;  3CPI G;  2C3C A;  1QDB A;  3ZYX A;  2E80 A;  4B65 A;  1JNR A;  2I0Z A;  1ZK7 A;  2RGO A;  2WU2 A;  4G6G A;  2CVJ A;  3CGE A;  1M64 A;  3SCE A;  4EM4 A;  1PS9 A;  2BRA A;  2VQ7 A;  3UBR A;  4U8K A;  3HYW A;  3IHG A;  3NYC A;  1KDG A;  3ICR A;  3O0H A;  4H4Y A;  3SQP A;  2BRY A;  3GRT A;  2GAG B;  4K5S A;  2GV8 A;  2WS3 A;  3OWM A;  4OPT A;  3UOX A;  4YTM A;  1V59 A;  3NTD A;  5FMH A;  4XWR A;  1DJQ A;  1B37 A;  1ZMD A;  2RF7 A;  4EQR A;  2YR4 A;  1O94 A;  2XVI A;  3NNE A;  1RP0 A;  4LU6 A;  4OPD A;  1FCD A;  4U8N A;  3IF9 A;  3UCL A;  5BRT A;  4G74 A;  3TOR A;  3AYI A;  4CCQ A;  1X31 B;  4YWO A;  2ZO5 A;  2WP5 A;  3FPZ A;  5M0Z A;  3RP6 A;  2VVL A;  2XYO A;  3WE0 A;  1E7P A;  2F5Z A;  2QA1 A;  4REK A;  4U2S A;  1GRA A;  2Q7V A;  2XFQ A;  4E0V A;  3T37 A;  2RGJ A;  3FG2 P;  5U1O A;  3VRA A;  2BK3 A;  4DNA A;  3EAO A;  1L0V A;  2R0C A;  2V5Z A;  1ZOV A;  1KNR A;  4H50 A;  4JY3 A;  1Z6L A;  4LA1 A;  1BGJ A;  3FO3 A;  2WES A;  4EMW A;  1BZL A;  4OPC A;  2VRM A;  4Z44 A;  4Q0T A;  5EB4 A;  4EM3 A;  1NPX A;  1MXT A;  3AE2 A;  5L46 A;  3DK9 A;  4H4R A;  5JCN A;  2C3D A;  2GRT A;  3UKH A;  2B7R A;  2YLT A;  2TMD A;  5KRQ A;  4BK3 A;  2BK5 A;  3PVC A;  2CFY A;  4IVO B;  3NGC X;  1YKJ A;  1O95 A;  1GRB A;  3II4 A;  5KMR A;  2ZZ0 A;  3AXB A;  4H4U A;  1FEB A;  4Z43 A;  4NNJ A;  5M10 A;  1QO8 A;  3GYJ A;  5KVI A;  2ZZC A;  3ITJ A;  4A79 A;  1CHU A;  3LGQ A;  2E4G A;  2CDU A;  2R46 A;  2C65 A;  3AEB A;  3QVP A;  2V60 A;  3T2K A;  5KVH A;  1FOH A;  2WP6 A;  3LZX A;  2R9Z A;  3BI4 A;  1EL9 A;  4NEV A;  3V3O A;  2XLR A;  1GRE A;  3SZW A;  3BNF A;  1PXC A;  3UKP A;  5EOW A;  1RSG A;  1D4C A;  1FEA A;  1ZX9 A;  1VG9 A;  2YVJ A;  4GUV A;  4X4J A;  4IA5 A;  4UP3 A;  1KSS A;  1S3E A;  1B4V A;  3H8L A;  1O5W A;  3EF6 A;  1PXB A;  3M0O A;  2RDZ A;  4YKG A;  5FS7 A;  1NAA A;  2VZ2 A;  2BAB A;  2YLR A;  3ICT A;  3ATQ A;  4C77 A;  4YSZ A;  2QAE A;  3AD8 B;  2YM2 A;  1NHR A;  1K4Q A;  2ZZB A;  3P1W A;  3SYI A;  3CNP A;  3NT6 A;  2YWL A;  1E1N A;  2XVE A;  3P9U A;  4YSX A;  2YR6 A;  4PAA A;  4FK1 C;  4K2X A;  1D7L A;  4ZN0 A;  4IVM B;  5DBJ A;  2C66 A;  2XVJ A;  5HHF A;  4U2T A;  3K7M X;  3MMO A;  3QJ4 A;  4JDR A;  3UTE A;  4B67 A;  5GRT A;  3CPJ G;  2J7A A;  3ALJ A;  2YLZ A;  1P2E A;  3VQR A;  4BV6 A;  2WDV A;  2C75 A;  1YQ4 A;  3KD9 A;  2NVK X;  2GMJ A;  3DJJ A;  3BNM A;  1CJ3 A;  3UKF A;  1TYP A;  2VR0 A;  1FEC A;  4B1B A;  2Q6U A;  4A9W A;  4DSG A;  4Q17 A;  2YLS A;  4KX6 A;  5HXI A;  1JRZ A;  1GND A;  4YXD A;  3GD3 A;  2YG3 A;  2V3B A;  1JU2 A;  1EL7 A;  4GR1 A;  3P4S A;  2JB2 A;  4Y4L A;  5IQ4 A;  2GR2 A;  3LAD A;  2WBA A;  3NN0 X;  1D4D A;  3AE5 A;  4G6H A;  1H7X A;  1DOE A;  3LG1 A;  4PAB A;  3S5W A;  5JCK A;  5FS8 A;  5KNL A;  3AYJ A;  3UKL A;  1KF6 A;  3UTG A;  3VRD B;  4U8O A;  3LZW A;  3COX A;  4A65 A;  2X8H A;  2B9X A;  1L9E A;  5EB5 A;  5U63 A;  4ZCD A;  1PDH A;  2GR1 A;  4YSH A;  2C64 A;  2BK4 A;  3NTA A;  4D04 A;  4A6N A;  3UOV A;  1DOB A;  3NK0 X;  4XWZ A;  1CC6 A;  4H2N A;  4U8I A;  3C4N A;  4DGK A;  3BNH A;  2GEW A;  3AWI A;  3LXD A;  2IVE A;  4H4W A;  3T14 A;  3F29 A;  3L1R A;  1KSU A;  4K7Z A;  1GES A;  1Y56 A;  1CC4 A;  4TM3 A;  1ZDL A;  3RNM A;  4A99 A;  4XXG A;  4IA6 A;  4M52 A;  1B5Q A;  4BK1 A;  4H4Q A;  4J34 A;  4X9M A;  4TM1 A;  3CMM A;  3BHK A;  4NEW A;  3CNS A;  4OVI A;  5JCM A;  4RSL A;  4J2W A;  1DNC A;  3SGL A;  3OC4 A;  4H4S A;  1CBO A;  1P2H A;  4G9K A;  1FS8 A;  4L3Y A;  1H83 A;  1QLB A;  3CPH G;  2OLO A;  3ISH A;  1IJH A;  1IUW A;  5J7X A;  4B69 A;  3Q6J A;  3FIM B;  1GRH A;  3AEA A;  4UDR A;  4APN A;  2GR3 A;  4O5U A;  2JBV A;  1BGN A;  1ZP0 A;  3UP4 A;  2WU5 A;  3DJG X;  3PS9 A;  4NZH A;  4K8D A;  2B9W A;  3DK8 A;  4Z2U A;  3AD9 B;  3UKQ A;  4USR A;  3GDP A;  2PHH A;  1PBD A;  4H4T A;  4D03 A;  2AQJ A;  1XAN A;  2VRL A;  1OJC A;  1PBF A;  2C73 A;  2EQ9 A;  1RYI A;  1EL5 A;  2X8C A;  2R4J A;  3F8R A;  4A5L A;  2E1M A;  2B7S A;  3GMC A;  4H4Z A;  4Q1O A;  3NKS A;  2YAU A;  1UKV G;  3AE4 A;  3EAN A;  1COY A;  4BJZ A;  2C72 A;  2BS4 A;  1Y56 B;  4USQ A;  4L3X A;  2YM1 A;  2Z5X A;  2BAC A;  4U8L A;  4AP3 A;  2NPX A;  2EQ7 A;  2CUL A;  1KFY A;  3B3R A;  3P4R A;  3S61 A;  5U25 A;  2BYB A;  1LJ1 A;  1BF3 A;  1BVB A;  3PO7 A;  1LQU A;  5LV9 A;  2GVC A;  2X8G A;  3AE1 A;  3JSK A;  3KU9 A;  2VQB A;  3RHA A;  2J3N A;  4AT2 A;  4EQX A;  3S7W A;  3D1I A;  5FS6 A;  2GMH A;  4GAP A;  2R0P A;  3T2Z A;  4L38 A;  3HZL A;  1H6V A;  4H4V A;  3CGB A;  3AEE A;  1PJ5 A;  4FK1 A;  4L3Z A;  4K5R A;  2DKH A;  2XFO A;  2AAQ A;  3L8K A; 
#chains in the Genus database with same CATH homology
 1IUS A;  2OAL A;  3DA1 A;  3P4P A;  3NK1 X;  3VR9 A;  1H86 A;  2YG5 A;  2YR5 A;  3SM8 A;  4GRT A;  4B64 A;  2TPR A;  5BUL A;  2WPE A;  5KOW A;  4OPU A;  1LPF A;  3UOY A;  4C5O A;  3CGD A;  1CJ2 A;  4RG4 A;  2WPF A;  2UZZ A;  1E1K A;  4GF7 A;  1S2Y A;  1DOD A;  1N1P A;  1QJD A;  4GDE A;  1F6M A;  3D8X A;  3DJD A;  3QFA A;  1HYU A;  4OPI A;  2BS3 A;  3F8P A;  1PJ6 A;  2FJA A;  2WQY A;  1TRB A;  1XHC A;  2JAE A;  2VVM A;  3SZF A;  2APG A;  3H4K A;  5CKU A;  2R0G A;  2A8X A;  3SZ0 A;  2Q0K A;  4Z24 A;  2OT4 A;  1YY5 A;  2WOI A;  4WJY A;  2XFP A;  4BJY A;  5BVA A;  2E5V A;  3CN8 A;  1JOA A;  3SFD A;  1LVL A;  1CJ4 A;  1GU6 A;  1CC2 A;  2HQM A;  4HB9 A;  1DXL A;  2WP9 A;  3V3N A;  1ONF A;  4UDP A;  1E6E A;  1K0I A;  2WOV A;  4GCM A;  2B76 A;  3RED A;  5EBK A;  4EMJ A;  1LTX R;  2XLT A;  3K30 A;  5FS9 A;  1F8R A;  1D4E A;  3AE7 A;  4CCR A;  1TDF A;  2YG7 A;  2PYX A;  3GMB A;  3UU9 A;  2BCG G;  2V3A A;  3OZ2 A;  4O5Q A;  1H82 A;  3ALM A;  2WPC A;  2GAH B;  1JNI A;  4II2 A;  2YG4 A;  2EQ6 A;  3QVR A;  1YQZ A;  3HYV A;  4B63 A;  1ZOY A;  5BUK A;  2LFC A;  3AE8 A;  3BNU A;  1OAH A;  2XDO A;  3L1T A;  2Y6R A;  3G5R A;  4X9N A;  3AB1 A;  1VQW A;  4ECH A;  1Q9I A;  2WET A;  1K0J A;  1M1R A;  2DKI A;  2FJD A;  2VOU A;  4NWZ A;  1GOS A;  3LB8 A;  5TR3 A;  3T31 A;  2XFU A;  5KMP A;  4Q4U A;  1OJA A;  4LII A;  1Q1R A;  3T2Y A;  4OPG A;  1NHQ A;  3T0K A;  2Q0L A;  4GAV A;  3K7T A;  2XCG A;  2WOW A;  3GSI A;  3RP8 A;  3V76 A;  4H2Q A;  3QSE A;  1N4U A;  1GRG A;  2XFN A;  5ER0 A;  2ARD A;  3H8I A;  1K0L A;  1MOK A;  3QFB A;  3RP7 A;  1E39 A;  1GAL A;  1GRF A;  2ACZ A;  2XLS A;  3GYI A;  4AOS A;  2VVL G;  2BCP A;  3GM6 A;  3BNJ A;  1PHH A;  2RGH A;  2Z5Y A;  3IC9 A;  3GRS A;  1LV0 A;  1FS7 A;  3SXI A;  2GF3 A;  2YVF A;  2C70 A;  1GXF A;  4EQW A;  1F3P A;  2XVF A;  3CNJ A;  4IV9 A;  3NG7 X;  1OJ9 A;  3DME A;  4JNQ A;  2A87 A;  4CNJ A;  4U2L A;  2BS2 A;  1YQ3 A;  2K3V A;  5IQ1 A;  2GB0 A;  1NHS A;  2QA2 A;  4H2R A;  1MO9 A;  1W4X A;  3Q9T A;  4OCG A;  1L9D A;  2H88 A;  4KPR A;  5KMS A;  1PBE A;  4YSY A;  1EL8 A;  4MJW A;  4J36 A;  4U8J A;  4BK2 A;  3C96 A;  1E1M A;  2ZBW A;  3ATR A;  3UP5 A;  2WHD A;  4CY8 A;  1FL2 A;  1GEU A;  2JB1 A;  1H84 A;  1PBB A;  4K22 A;  5KXJ A;  4TM0 A;  1REO A;  2XLP A;  1GET A;  3UTH A;  3UTF A;  1ZMC A;  3I6D A;  3R9U A;  4I58 A;  2V6O A;  3UOZ A;  1H7W A;  2FJB A;  1F8S A;  3NYF A;  4A6N B;  1TDO A;  3DGH A;  1N4W A;  1NG3 A;  4A7A A;  4Z26 A;  1LQT A;  4Z25 A;  2B9Y A;  2BA9 A;  1GV4 A;  2A89 A;  4RG3 A;  2WDR A;  4ICY A;  1GSN A;  2WEU A;  3NLC A;  4CBQ A;  3KKJ A;  5HY5 A;  4JNA A;  3C4A A;  3D1C A;  2R45 A;  1BKW A;  4Z2R A;  3DJE A;  4J33 A;  1PBC A;  2C76 A;  1D5T A;  4WX1 A;  3VR8 A;  3KPF A;  5JCL A;  2EQ8 A;  3NH3 X;  1NG4 A;  3NN6 X;  4TLZ A;  4TM4 A;  1TDE A;  2IVD A;  3SX6 A;  1FT5 A;  4I59 A;  4H4P A;  2BC1 A;  4JN9 A;  4J31 A;  4C74 A;  4II3 A;  3SXQ A;  4Q5B A;  1NHP A;  2XLU A;  3AE3 A;  1SEZ A;  4J57 A;  4U8P A;  1S3B A;  3VRB A;  3I3L A;  2FJE A;  2YVG A;  4U8M A;  2Y6Q A;  3SFE A;  1H81 A;  1B8S A;  2X99 A;  3AD7 B;  1AOG A;  2OAM A;  1Y0P A;  1N4V A;  4DSH A;  1BWC A;  1M1Q A;  2YLW A;  5J60 A;  2W0H A;  3IWA A;  2YQU A;  1GT8 A;  1NEK A;  3NYE A;  4YKF A;  5C3J A;  1TDK A;  1PN0 A;  5GSN A;  1M6I A;  3BI5 A;  1ELI A;  1Q1W A;  2GQF A;  2X50 A;  1JRX A;  3ABV A;  3TTB A;  3DH9 A;  4C3X A;  4EIQ A;  1NEN A;  3KPK A;  3UKA A;  2BC0 A;  1PXA A;  1M1P A;  1OJT A;  3DK4 A;  4FDC B;  1IUV A;  1OJD A;  1GPE A;  1TYT A;  1D7Y A;  3E1T A;  4AT0 A;  2XVH A;  3GWD A;  3AEF A;  5CQF A;  1VG0 A;  3CND A;  3ADA B;  3NIX A;  3QSM A;  4N9X A;  3FBS A;  4H7U A;  1SP3 A;  1DJN A;  4FX9 A;  3BHF A;  3G5S A;  2QCU A;  3ZDN A;  2RAB A;  3BNG A;  2V61 A;  2JB3 A;  4JQ9 A;  3G5Q A;  4NTE A;  1JNZ A;  2OLN A;  3GDN A;  4NTD A;  4NTC A;  3SZC A;  5KWF A;  4Y4N A;  4C3Y A;  2C67 A;  3K7Q X;  4Z2T A;  3KLJ A;  1XDI A;  2GH5 A;  1JEH A;  3BI2 A;  4ZCC A;  2IID A;  2E81 A;  4CY6 A;  4ADW A;  3RKH A;  3ALL A;  3AEC A;  2OA1 A;  3CNT A;  3HYX A;  3URH A;  4GDP A;  1XPQ A;  1TDN A;  2JK6 A;  3CTY A;  4B66 A;  3KVE A;  3GYX A;  3CIR A;  4G73 A;  3FMW A;  3DGZ A;  2H89 A;  1NDA A;  4AP1 A;  3AEG A;  4OPL A;  1CF3 A;  1GER A;  2YG6 A;  5JCI A;  3NHO X;  3SY4 A;  1VDC A;  4EQS A;  2C7G A;  3AE9 A;  1DOC A;  4YTN A;  1S2Q A;  2YLX A;  4EIP A;  3AED A;  1ZY8 A;  3UKK A;  5IPY A;  1FS9 A;  4CRT A;  2FBW A;  3NK2 X;  1KNP A;  3KA7 A;  4WCT A;  4J56 A;  3P4Q A;  4H2P A;  3M13 A;  2R4E A;  3AE6 A;  1JRY A;  1L9C A;  2GQW A;  2X3N A;  3NRN A;  2BXR A;  3GD4 A;  4B68 A;  1GTE A;  2C4C A;  5KMQ A;  3B6D A;  2O9Z A;  3F8D A;  3IHM A;  1IUX A;  3QSS A;  1F8W A;  1IUT A;  4H4X A;  4HA6 A;  3CGC A;  4BUR A;  4YTP A;  5HYM A;  3M12 A;  4EMI A;  2AR8 A;  4JY2 A;  3AYL A;  4P9S A;  5C2T A;  5KOX A;  2GR0 A;  2WDQ A;  3LOV A;  1GTH A;  4TLX A;  1CJC A;  1GRT A;  4CNK A;  1PJ7 A;  1ZKQ A;  4UDQ A;  3ICS A;  2JKC A;  4Y4M A;  4Q5C A;  1CL0 A;  4AOX A;  3EPT A;  3LJP A;  3GWF A;  1FT6 A;  4YT0 A;  1E1L A;  1EBD A;  2BXS A;  1IUU A;  1VRQ B;  3CPI G;  2C3C A;  1QDB A;  3ZYX A;  2E80 A;  4B65 A;  1JNR A;  2I0Z A;  1ZK7 A;  2RGO A;  2WU2 A;  4G6G A;  2CVJ A;  3CGE A;  1M64 A;  3SCE A;  4EM4 A;  1PS9 A;  2BRA A;  2VQ7 A;  3UBR A;  4U8K A;  3HYW A;  3IHG A;  3NYC A;  1KDG A;  3ICR A;  3O0H A;  4H4Y A;  3SQP A;  2BRY A;  3GRT A;  2GAG B;  4K5S A;  2GV8 A;  2WS3 A;  3OWM A;  4OPT A;  3UOX A;  4YTM A;  1V59 A;  3NTD A;  5FMH A;  4XWR A;  1DJQ A;  1B37 A;  1ZMD A;  2RF7 A;  4EQR A;  2YR4 A;  1O94 A;  2XVI A;  3NNE A;  1RP0 A;  4LU6 A;  4OPD A;  1FCD A;  4U8N A;  3IF9 A;  3UCL A;  5BRT A;  4G74 A;  3TOR A;  3AYI A;  4CCQ A;  1X31 B;  4YWO A;  2ZO5 A;  2WP5 A;  3FPZ A;  5M0Z A;  3RP6 A;  2VVL A;  2XYO A;  3WE0 A;  1E7P A;  2F5Z A;  2QA1 A;  4REK A;  4U2S A;  1GRA A;  2Q7V A;  2XFQ A;  4E0V A;  3T37 A;  2RGJ A;  3FG2 P;  5U1O A;  3VRA A;  2BK3 A;  4DNA A;  3EAO A;  1L0V A;  2R0C A;  2V5Z A;  1ZOV A;  1KNR A;  4H50 A;  4JY3 A;  1Z6L A;  4LA1 A;  1BGJ A;  3FO3 A;  2WES A;  4EMW A;  1BZL A;  4OPC A;  2VRM A;  4Z44 A;  4Q0T A;  5EB4 A;  4EM3 A;  1NPX A;  1MXT A;  3AE2 A;  5L46 A;  3DK9 A;  4H4R A;  5JCN A;  2C3D A;  2GRT A;  3UKH A;  2B7R A;  2YLT A;  2TMD A;  5KRQ A;  4BK3 A;  2BK5 A;  3PVC A;  2CFY A;  4IVO B;  3NGC X;  1YKJ A;  1O95 A;  1GRB A;  3II4 A;  5KMR A;  2ZZ0 A;  3AXB A;  4H4U A;  1FEB A;  4Z43 A;  4NNJ A;  5M10 A;  1QO8 A;  3GYJ A;  5KVI A;  2ZZC A;  3ITJ A;  4A79 A;  1CHU A;  3LGQ A;  2E4G A;  2CDU A;  2R46 A;  2C65 A;  3AEB A;  3QVP A;  2V60 A;  3T2K A;  5KVH A;  1FOH A;  2WP6 A;  3LZX A;  2R9Z A;  3BI4 A;  1EL9 A;  4NEV A;  3V3O A;  2XLR A;  1GRE A;  3SZW A;  3BNF A;  1PXC A;  3UKP A;  5EOW A;  1RSG A;  1D4C A;  1FEA A;  1ZX9 A;  1VG9 A;  2YVJ A;  4GUV A;  4X4J A;  4IA5 A;  4UP3 A;  1KSS A;  1S3E A;  1B4V A;  3H8L A;  1O5W A;  3EF6 A;  1PXB A;  3M0O A;  2RDZ A;  4YKG A;  5FS7 A;  1NAA A;  2VZ2 A;  2BAB A;  2YLR A;  3ICT A;  3ATQ A;  4C77 A;  4YSZ A;  2QAE A;  3AD8 B;  2YM2 A;  1NHR A;  1K4Q A;  2ZZB A;  3P1W A;  3SYI A;  3CNP A;  3NT6 A;  2YWL A;  1E1N A;  2XVE A;  3P9U A;  4YSX A;  2YR6 A;  4PAA A;  4FK1 C;  4K2X A;  1D7L A;  4ZN0 A;  4IVM B;  5DBJ A;  2C66 A;  2XVJ A;  5HHF A;  4U2T A;  3K7M X;  3MMO A;  3QJ4 A;  4JDR A;  3UTE A;  4B67 A;  5GRT A;  3CPJ G;  2J7A A;  3ALJ A;  2YLZ A;  1P2E A;  3VQR A;  4BV6 A;  2WDV A;  2C75 A;  1YQ4 A;  3KD9 A;  2NVK X;  2GMJ A;  3DJJ A;  3BNM A;  1CJ3 A;  3UKF A;  1TYP A;  2VR0 A;  1FEC A;  4B1B A;  2Q6U A;  4A9W A;  4DSG A;  4Q17 A;  2YLS A;  4KX6 A;  5HXI A;  1JRZ A;  1GND A;  4YXD A;  3GD3 A;  2YG3 A;  2V3B A;  1JU2 A;  1EL7 A;  4GR1 A;  3P4S A;  2JB2 A;  4Y4L A;  5IQ4 A;  2GR2 A;  3LAD A;  2WBA A;  3NN0 X;  1D4D A;  3AE5 A;  4G6H A;  1H7X A;  1DOE A;  3LG1 A;  4PAB A;  3S5W A;  5JCK A;  5FS8 A;  5KNL A;  3AYJ A;  3UKL A;  1KF6 A;  3UTG A;  3VRD B;  4U8O A;  3LZW A;  3COX A;  4A65 A;  2X8H A;  2B9X A;  1L9E A;  5EB5 A;  5U63 A;  4ZCD A;  1PDH A;  2GR1 A;  4YSH A;  2C64 A;  2BK4 A;  3NTA A;  4D04 A;  4A6N A;  3UOV A;  1DOB A;  3NK0 X;  4XWZ A;  1CC6 A;  4H2N A;  4U8I A;  3C4N A;  4DGK A;  3BNH A;  2GEW A;  3AWI A;  3LXD A;  2IVE A;  4H4W A;  3T14 A;  3F29 A;  3L1R A;  1KSU A;  4K7Z A;  1GES A;  1Y56 A;  1CC4 A;  4TM3 A;  1ZDL A;  3RNM A;  4A99 A;  4XXG A;  4IA6 A;  4M52 A;  1B5Q A;  4BK1 A;  4H4Q A;  4J34 A;  4X9M A;  4TM1 A;  3CMM A;  3BHK A;  4NEW A;  3CNS A;  4OVI A;  5JCM A;  4RSL A;  4J2W A;  1DNC A;  3SGL A;  3OC4 A;  4H4S A;  1CBO A;  1P2H A;  4G9K A;  1FS8 A;  4L3Y A;  1H83 A;  1QLB A;  3CPH G;  2OLO A;  3ISH A;  1IJH A;  1IUW A;  5J7X A;  4B69 A;  3Q6J A;  3FIM B;  1GRH A;  3AEA A;  4UDR A;  4APN A;  2GR3 A;  4O5U A;  2JBV A;  1BGN A;  1ZP0 A;  3UP4 A;  2WU5 A;  3DJG X;  3PS9 A;  4NZH A;  4K8D A;  2B9W A;  3DK8 A;  4Z2U A;  3AD9 B;  3UKQ A;  4USR A;  3GDP A;  2PHH A;  1PBD A;  4H4T A;  4D03 A;  2AQJ A;  1XAN A;  2VRL A;  1OJC A;  1PBF A;  2C73 A;  2EQ9 A;  1RYI A;  1EL5 A;  2X8C A;  2R4J A;  3F8R A;  4A5L A;  2E1M A;  2B7S A;  3GMC A;  4H4Z A;  4Q1O A;  3NKS A;  2YAU A;  1UKV G;  3AE4 A;  3EAN A;  1COY A;  4BJZ A;  2C72 A;  2BS4 A;  1Y56 B;  4USQ A;  4L3X A;  2YM1 A;  2Z5X A;  2BAC A;  4U8L A;  4AP3 A;  2NPX A;  2EQ7 A;  2CUL A;  1KFY A;  3B3R A;  3P4R A;  3S61 A;  5U25 A;  2BYB A;  1LJ1 A;  1BF3 A;  1BVB A;  3PO7 A;  1LQU A;  5LV9 A;  2GVC A;  2X8G A;  3AE1 A;  3JSK A;  3KU9 A;  2VQB A;  3RHA A;  2J3N A;  4AT2 A;  4EQX A;  3S7W A;  3D1I A;  5FS6 A;  2GMH A;  4GAP A;  2R0P A;  3T2Z A;  4L38 A;  3HZL A;  1H6V A;  4H4V A;  3CGB A;  3AEE A;  1PJ5 A;  4FK1 A;  4L3Z A;  4K5R A;  2DKH A;  2XFO A;  2AAQ A;  3L8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...