1JRXA

Crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrxA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrxA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrxA01
3NRNA 4KPRA 1VG9A 2FJEA 1H82A 2DKIA 3E1TA 4GR1A 5FS6A 1BWCA 1PBCA 1PDHA 2YM2A 4JNAA 3UKQA 4EQRA 1ZP0A 2A87A 3V3OA 1D7YA 1TDNA 3NNEA 5C3JA 1OAHA 1JRXA 3P4PA 2ZZBA 2BXSA 4NEVA 3CNTA 4NTDA 2R0GA 4A7AA 3BNFA 1FOHA 1XPQA 4Y4LA 2VVLG 2HQMA 4DSGA 1D7LA 2V5ZA 3CPIG 4BK1A 4IVMB 2ZZ0A 2JBVA 1M1PA 1PN0A 3NYEA 4L3ZA 3M12A 3UTEA 4UP3A 3RP7A 1D4EA 4B64A 2BK4A 4H2RA 3CN8A 1TDFA 3CNJA 2RDZA 4U8MA 3BI5A 3IF9A 3VQRA 1NENA 4B69A 4A65A 1FT5A 2YLTA 4EQXA 1DJNA 1L9EA 1E39A 2GR2A 2FBWA 2WS3A 3KA7A 1V59A 4H4QA 1DOBA 1GREA 1CC6A 2YM1A 3GDPA 4WJYA 5FS9A 3AE3A 1YY5A 2B9WA 3QSSA 3GSIA 2B7SA 4J33A 2B9YA 2WDQA 2WOWA 3GYIA 1GRGA 2WU2A 3AWIA 3L1RA 3NGCX 5JCKA 1FS8A 3DK9A 5TR3A 5IPYA 2VQ7A 1PHHA 3DMEA 4TM4A 2QCUA 4IA6A 1CC2A 1NEKA 4EQSA 2XVFA 4WCTA 2R0CA 3P4SA 2IVDA 3V76A 1NG4A 4OVIA 3FPZA 4A9WA 3ALMA 2GH5A 1COYA 3BNHA 1PJ6A 1SEZA 3TTBA 2XVJA 4YXDA 2YQUA 5FS8A 2YG4A 2VVMA 3VRBA 2FJAA 1TRBA 1IUSA 2C65A 4C77A 3LJPA 5BULA 1Y56A 3S61A 1XHCA 1PJ7A 1JOAA 4EQWA 1BGNA 4DSHA 2R4JA 2V61A 4C3XA 1KF6A 1Q1WA 4DGKA 5C2TA 5JCMA 1W4XA 3CGBA 1MO9A 1ZX9A 1MXTA 4Y4NA 1L0VA 1PXCA 3WE0A 2X3NA 2XFNA 1UKVG 3GMCA 3IWAA 4FK1A 3ATRA 4X9NA 3AYLA 1NPXA 4GF7A 3OC4A 2GAGB 4TLXA 4TM3A 3Q9TA 4N9XA 5IQ1A 2EQ9A 1IUUA 1FL2A 3EAOA 3I6DA 1GTEA 1NG3A 3G5QA 3ICSA 4YT0A 1GRFA 1KDGA 2NPXA 3FBSA 3HZLA 4BK2A 1ELIA 4Q5CA 3F8PA 3UOXA 1PBBA 3VRAA 1SP3A 2XYOA 1D5TA 3AEDA 1JNRA 2GR0A 2E4GA 1BKWA 4H4VA 2Y6RA 3RKHA 1LTXR 1BVBA 4D04A 4YWOA 3S7WA 3QJ4A 4UDPA 4DNAA 3VRDB 3EANA 3IHGA 3RHAA 3H8LA 1QLBA 3NHOX 1RSGA 2YLRA 4J2WA 1M1QA 1P2EA 2OLOA 3B6DA 2GMHA 4JNQA 3P4RA 4OPTA 1DODA 1S2YA 3RNMA 4J56A 1B5QA 2BACA 2XVIA 3AE6A 3CTYA 3KLJA 4ICYA 4K5RA 2RGOA 1IUXA 1JRZA 3CNPA 2XFQA 3DH9A 4Y4MA 4FDCB 4CNKA 1KNPA 2BS2A 2VZ2A 3K7QX 4U2TA 1PXBA 2GR1A 2IVEA 3GD3A 3UCLA 1E1LA 4BJYA 4K5SA 5JCNA 3NTAA 3SFDA 5EB5A 3C4NA 5IQ4A 1CL0A 1OJDA 2WPCA 5JCLA 1QJDA 3AE7A 3F8RA 2YG3A 4H4XA 1CC4A 1DJQA 4CCRA 2C72A 4Z25A 3IHMA 5HYMA 2VQBA 2Q0LA 2EQ7A 2JB1A 1XDIA 4U8JA 2EQ6A 1FCDA 2GRTA 5KVIA 4A79A 4ZCDA 2WETA 2LFCA 1Y56B 1CF3A 4H50A 2NVKX 2WQYA 3M0OA 3C96A 3VR9A 2ZBWA 4B66A 1JNZA 1IJHA 4H4UA 4Z2RA 3BI2A 3UKHA 1B4VA 3AEEA 4Q5BA 2C66A 2R9ZA 5HY5A 2APGA 3Q6JA 2GQFA 2YR4A 2CFYA 4Z24A 3FO3A 1BGJA 3UKAA 3NG7X 3T37A 2C3DA 1TDOA 1FEAA 4ECHA 1XANA 2C76A 1H81A 3DGZA 4WX1A 1TDKA 1GERA 2YLWA 2GB0A 1N1PA 2RGJA 3OWMA 1GSNA 4L3YA 2OT4A 2Q0KA 4Q4UA 1VG0A 3UTHA 2FJBA 3ATQA 4B67A 2BS4A 3ZYXA 1REOA 4YSXA 1JEHA 3QVPA 3QVRA 5EOWA 1Y0PA 3AE8A 3UTGA 4CBQA 5M10A 1E6EA 3NK0X 2XVEA 4LIIA 1LVLA 2C73A 2ACZA 2C75A 2WBAA 4PAAA 2OAMA 2E5VA 4A6NA 3H4KA 1GALA 4EMJA 3O0HA 1YQZA 2WOVA 4H4YA 3H8IA 2C67A 2OALA 2J3NA 1O94A 1ZMDA 3NN6X 4CY6A 3NN0X 1NHRA 1OJCA 4H7UA 2BCGG 3AB1A 2WDRA 3QFAA 2WP9A 3GDNA 4BURA 2WP6A 2JKCA 3BHFA 4H4ZA 4EM3A 1EBDA 2VVLA 1D4DA 1CBOA 5M0ZA 3SGLA 4OPIA 3II4A 2R4EA 5KOWA 1FEBA 4L3XA 2XLSA 3CNDA 3UOVA 3DJEA 1EL8A 3G5SA 1YQ4A 3AXBA 1E7PA 3CGDA 3KD9A 4CCQA 1ZMCA 2YAUA 3ADAB 1Q9IA 4EM4A 3URHA 1NAAA 5U1OA 3GMBA 1E1MA 4AP3A 2I0ZA 1L9DA 4H4WA 1L9CA 3UKFA 5HXIA 1E1NA 1F8SA 1H86A 1FECA 1D4CA 1MOKA 1M1RA 2JB3A 3DA1A 1IUVA 4AP1A 2JK6A 4CRTA 4EIQA 4GCMA 4YTPA 5EBKA 4REKA 2XFOA 2Y6QA 1GETA 1K0JA 1NHQA 3C4AA 4RG3A 1NHPA 2CDUA 4LA1A 3NIXA 3RP8A 4TLZA 3R9UA 4YSZA 5J60A 1HYUA 3LXDA 4OCGA 1GRHA 2XCGA 4JQ9A 1S2QA 2GV8A 3K7MX 3LGQA 2X50A 2E81A 2XLPA 3AE5A 3GRSA 3NH3X 3QSMA 5CKUA 2WDVA 1FT6A 4J57A 3UTFA 1JNIA 4H4PA 3GYJA 1PS9A 1EL7A 4Z26A 3UOYA 1S3EA 2YLXA 1O95A 1ZK7A 2R0PA 3QSEA 3VR8A 3GYXA 1GEUA 3UU9A 1PBFA 4U2SA 1OJ9A 1F8RA 3AE4A 2BS3A 1LV0A 4USQA 4Q1OA 4C74A 2WHDA 2VR0A 2BA9A 2WP5A 1OJAA 2EQ8A 2C3CA 3AEGA 4TM0A 1H6VA 1VQWA 4EMIA 3KU9A 3KVEA 2GR3A 3PVCA 3NT6A 4ADWA 1K4QA 3CPJG 4H2NA 4L38A 4YSHA 2YG6A 3S5WA 3ABVA 2OA1A 4CY8A 1F3PA 1CJ3A 1PBEA 5BRTA 5GRTA 3FMWA 1IUWA 1PBDA 3CNSA 3NTDA 1H84A 4PABA 4GDPA 4B68A 2BC1A 5KWFA 1EL9A 3AE1A 5BUKA 3LZWA 3LB8A 1NHSA 2AAQA 2K3VA 1JU2A 2X8CA 4LU6A 4YTNA 3SM8A 1CJ2A 4KX6A 1QDBA 3DJDA 1OJTA 3FG2P 4P9SA 2Q6UA 5FS7A 3AEAA 2C70A 2WEUA 4U8PA 5ER0A 4OPDA 5EB4A 4Q17A 2WPEA 3BNGA 1K0IA 2O9ZA 4UDQA 2V6OA 2YVFA 4NTEA 4AT0A 4RG4A 1GRTA 1LJ1A 1E1KA 1PJ5A 2F5ZA 3AD7B 2YWLA 1K0LA 3SQPA 2PHHA 4D03A 2H88A 2X8HA 3REDA 3SCEA 1B8SA 1GOSA 1S3BA 2GMJA 4B63A 5KXJA 3RP6A 1ZY8A 2JAEA 4Z2TA 1LPFA 1NDAA 4YSYA 2VRMA 4A5LA 3TORA 1H7XA 2RABA 4I58A 1GT8A 5BVAA 4FK1C 1AOGA 4J34A 1H83A 1GRBA 5GSNA 4U8NA 3ICTA 2CVJA 4NEWA 1CJCA 4USRA 2ZO5A 1ONFA 4B65A 3ALLA 3L8KA 2PYXA 4H2QA 5FMHA 2YG5A 1TDEA 3UOZA 1GU6A 3UKKA 4CNJA 2XFUA 2Z5XA 3AD8B 1F8WA 4J36A 2BK5A 2TMDA 2Q7VA 4GRTA 4JY3A 4Z2UA 3UP4A 4Z43A 3GWFA 1GXFA 4C3YA 5HHFA 1GESA 1N4VA 2QA2A 3ICRA 4YKGA 3SFEA 1TYTA 4GUVA 3AD9B 2BCPA 5U25A 4IA5A 1B37A 4BJZA 1X31B 4RSLA 1GNDA 1QO8A 4FX9A 1EL5A 1DXLA 3P9UA 4APNA 4B1BA 3JSKA 4AOSA 1PXAA 4H4RA 4C5OA 3KPFA 1ZDLA 4Z44A 3SXQA 2R45A 3EPTA 2YLZA 1DOEA 2H89A 3BNUA 2QAEA 5CQFA 2GVCA 3V3NA 1KFYA 2YLSA 2E1MA 3BHKA 2B9XA 4M52A 3NYFA 3D1CA 2RF7A 1FS7A 4O5UA 1YKJA 4K7ZA 3KKJA 2BABA 2OLNA 2GAHB 2C64A 2CULA 2YR6A 3BI4A 2TPRA 3IC9A 4XWZA 1BZLA 4ZN0A 3P4QA 2A8XA 4A6NB 2W0HA 4IVOB 2WU5A 4NZHA 3GWDA 2Z5YA 4XWRA 2E80A 3K30A 4UDRA 4H4SA 1CJ4A 2XFPA 4BV6A 2YR5A 1TYPA 2V3BA 3GD4A 2R46A 3B3RA 4JN9A 2BK3A 1IUTA 4HB9A 2WOIA 3CPHG 4H4TA 4TM1A 1GTHA 2XLUA 3F8DA 4OPCA 3NKSA 4NTCA 5KOXA 4A99A 3LADA 3D8XA 3LOVA 1JRYA 3AEBA 3AYJA 3ZDNA 2XDOA 3ITJA 1FS9A 2AR8A 1VRQB 1LQTA 4AOXA 1VDCA 2C7GA 1BF3A 2B76A 3AYIA 1ZOVA 4U8KA 5DBJA 1ZKQA 3GM6A 3PO7A 4XXGA 5U63A 4J31A 3M13A 3FIMB 4AT2A 2VOUA 3NK2X 3AEFA 3I3LA 4BK3A 1DOCA 5JCIA 2XVHA 3D1IA 4JDRA 3UP5A 2XLTA 1GPEA 4JY2A 1YQ3A 4OPLA 2WESA 3UKPA 2GF3A 2GEWA 3P1WA 2IIDA 4K22A 4X9MA 3CGEA 3LG1A 3DK4A 2XLRA 2V60A 3DJGX 4HA6A 2BXRA 3CIRA 4OPGA 4I59A 2UZZA 1Z6LA 2VRLA 1O5WA 3DGHA 2V3AA 3BNMA 1CHUA 3MMOA 2AQJA 3QFBA 2J7AA 4EIPA 4U8IA 4YTMA 2A89A 3CGCA 2ZZCA 3F29A 3L1TA 4Q0TA 1N4WA 3AECA 4K2XA 2GQWA 4U8OA 4EMWA 1KSSA 4U8LA 3UKLA 2BC0A 2RGHA 5KVHA 1DNCA 1N4UA 2YVGA 3AE9A 4U2LA 5J7XA 3LZXA 2B7RA 3DJJA 1M64A 2BYBA 2DKHA 2JB2A 3EF6A 3GRTA 2QA1A 3NYCA 5KRQA 1GRAA 4E0VA 3NLCA 3BNJA 4H2PA 3K7TA 3AE2A 1KSUA 5L46A 1Q1RA 3PS9A 1RP0A 3DK8A 2ARDA 2FJDA 3ISHA 5LV9A 1KNRA 1ZOYA 2X99A 2WPFA 2YG7A 1LQUA 3OZ2A 4MJWA 2X8GA 4OPUA 1F6MA 1P2HA 4K8DA 4X4JA 4GDEA 3COXA 4YKFA 1GV4A 3UBRA 2YVJA 1H7WA 3ALJA 4O5QA 4ZCCA 1RYIA 4IV9A 3NK1X 1M6IA 3G5RA
chains in the Genus database with same CATH superfamily
3NRNA 4KPRA 1VG9A 2FJEA 1H82A 2DKIA 3E1TA 4GR1A 5FS6A 1BWCA 1PBCA 1PDHA 2YM2A 4JNAA 3UKQA 4G74A 4EQRA 1ZP0A 2A87A 3V3OA 1D7YA 1TDNA 3NNEA 5C3JA 1OAHA 1JRXA 3P4PA 2ZZBA 2BXSA 4NEVA 3CNTA 4NTDA 2R0GA 4A7AA 3BNFA 1FOHA 1XPQA 4Y4LA 2VVLG 2HQMA 4DSGA 1D7LA 2V5ZA 3CPIG 4BK1A 4IVMB 2ZZ0A 2JBVA 1M1PA 1PN0A 3NYEA 4L3ZA 3M12A 3SZFA 3UTEA 4UP3A 3RP7A 1D4EA 4B64A 2BK4A 4H2RA 3CN8A 1TDFA 3CNJA 2RDZA 4U8MA 3BI5A 3IF9A 3VQRA 1NENA 4B69A 4A65A 1FT5A 2YLTA 4EQXA 1DJNA 1L9EA 1E39A 2GR2A 2FBWA 2WS3A 3KA7A 1V59A 4H4QA 1DOBA 1GREA 1CC6A 2YM1A 3GDPA 4WJYA 5FS9A 3AE3A 1YY5A 3SX6A 2B9WA 3QSSA 3GSIA 2B7SA 4J33A 2B9YA 2WDQA 2WOWA 3GYIA 1GRGA 2WU2A 3AWIA 3L1RA 3NGCX 5JCKA 1FS8A 3DK9A 5TR3A 4II3A 2VQ7A 1PHHA 3DMEA 4TM4A 2QCUA 5IPYA 4IA6A 1CC2A 1NEKA 4EQSA 2XVFA 4WCTA 2R0CA 3P4SA 2IVDA 3V76A 1NG4A 4OVIA 3FPZA 4A9WA 3ALMA 2GH5A 1COYA 3BNHA 1PJ6A 1SEZA 3TTBA 2XVJA 4YXDA 2YQUA 5FS8A 2YG4A 2VVMA 3VRBA 2FJAA 1TRBA 1IUSA 2C65A 4C77A 3LJPA 5BULA 1Y56A 3S61A 1XHCA 1PJ7A 1JOAA 4EQWA 1BGNA 4DSHA 2R4JA 2V61A 4C3XA 1KF6A 1Q1WA 4DGKA 4GAVA 5C2TA 5JCMA 3HYWA 1W4XA 3CGBA 1MO9A 1ZX9A 1MXTA 4Y4NA 1L0VA 1PXCA 3WE0A 2X3NA 2XFNA 1UKVG 3GMCA 3IWAA 4FK1A 3ATRA 4X9NA 3AYLA 1NPXA 4GF7A 2BRYA 3OC4A 2GAGB 4TLXA 4TM3A 3Q9TA 4N9XA 5IQ1A 2EQ9A 1IUUA 1FL2A 3EAOA 3I6DA 1GTEA 1NG3A 3G5QA 3ICSA 4YT0A 1GRFA 1KDGA 2NPXA 3FBSA 3HZLA 3T0KA 3SYIA 1ELIA 4BK2A 4Q5CA 3F8PA 3UOXA 1PBBA 3VRAA 1SP3A 2XYOA 1D5TA 3AEDA 1JNRA 2GR0A 4G9KA 3SZWA 2E4GA 1BKWA 4H4VA 2Y6RA 3RKHA 1LTXR 1BVBA 4D04A 4YWOA 3S7WA 3QJ4A 4UDPA 4DNAA 3VRDB 3EANA 3IHGA 3RHAA 3H8LA 1QLBA 3NHOX 1RSGA 2YLRA 4J2WA 1M1QA 1P2EA 2OLOA 3B6DA 2GMHA 4JNQA 4II2A 3P4RA 4OPTA 1DODA 1S2YA 3RNMA 4J56A 1B5QA 2BACA 2XVIA 4YTPA 3AE6A 3CTYA 3KLJA 4ICYA 4K5RA 2RGOA 1IUXA 1JRZA 3CNPA 2XFQA 3DH9A 4Y4MA 4FDCB 4CNKA 1KNPA 2BS2A 2VZ2A 3K7QX 4U2TA 1PXBA 2GR1A 2IVEA 3GD3A 3UCLA 1E1LA 4BJYA 4K5SA 5JCNA 3NTAA 3SFDA 5EB5A 3C4NA 5IQ4A 1CL0A 1OJDA 2WPCA 5JCLA 1QJDA 3AE7A 3F8RA 2YG3A 4H4XA 1CC4A 1DJQA 4CCRA 2C72A 4Z25A 3IHMA 5HYMA 2VQBA 2Q0LA 2EQ7A 2JB1A 1XDIA 4U8JA 2EQ6A 1FCDA 2GRTA 5KVIA 4A79A 4ZCDA 2WETA 2LFCA 1Y56B 1CF3A 4H50A 2NVKX 2WQYA 3M0OA 3T2YA 3C96A 3VR9A 2ZBWA 4B66A 1JNZA 1IJHA 4H4UA 4Z2RA 3BI2A 3UKHA 1B4VA 3AEEA 4Q5BA 2C66A 2R9ZA 5HY5A 2APGA 3Q6JA 2GQFA 2YR4A 2CFYA 4Z24A 3FO3A 1BGJA 3UKAA 3NG7X 3T37A 2C3DA 1TDOA 1FEAA 4ECHA 1XANA 2C76A 1H81A 3DGZA 4WX1A 1TDKA 4GAPA 1GERA 2YLWA 2GB0A 1N1PA 2RGJA 3OWMA 1GSNA 4L3YA 2OT4A 2Q0KA 4Q4UA 1VG0A 3UTHA 2FJBA 3ATQA 4B67A 2BS4A 3ZYXA 1REOA 4G73A 4YSXA 1JEHA 3QVPA 3QVRA 5EOWA 4NNJA 5KNLA 1Y0PA 3HYXA 3AE8A 3UTGA 4CBQA 5KMQA 4NWZA 5M10A 1E6EA 3NK0X 2XVEA 4LIIA 1LVLA 2C73A 2ACZA 2C75A 2WBAA 4PAAA 2OAMA 2E5VA 4A6NA 3H4KA 1GALA 4EMJA 3O0HA 5KMSA 5KMPA 1YQZA 2WOVA 4H4YA 3H8IA 2C67A 2OALA 2J3NA 1O94A 1ZMDA 3NN6X 4CY6A 3NN0X 1NHRA 1OJCA 4H7UA 2BCGG 3AB1A 2WDRA 3QFAA 2WP9A 3GDNA 4BURA 2WP6A 2JKCA 3BHFA 4H4ZA 4EM3A 1EBDA 2VVLA 3HYVA 3CMMA 1D4DA 1CBOA 5M0ZA 3SGLA 4OPIA 3II4A 2R4EA 3T31A 5KOWA 1FEBA 4L3XA 2XLSA 3CNDA 3UOVA 3DJEA 1EL8A 3G5SA 3KPKA 1YQ4A 3AXBA 1E7PA 3CGDA 3KD9A 4CCQA 1ZMCA 2YAUA 3ADAB 1Q9IA 4EM4A 3URHA 1NAAA 5U1OA 3GMBA 1E1MA 4AP3A 2I0ZA 1L9DA 4H4WA 1L9CA 3UKFA 5HXIA 1E1NA 1F8SA 1H86A 1FECA 1D4CA 1MOKA 1M1RA 2JB3A 3DA1A 1IUVA 4AP1A 2JK6A 4CRTA 3T2ZA 4GCMA 4EIQA 5EBKA 4REKA 2XFOA 2Y6QA 1GETA 1K0JA 1NHQA 3C4AA 4RG3A 1NHPA 2CDUA 4LA1A 3NIXA 3RP8A 4TLZA 3R9UA 4YSZA 5J60A 1HYUA 3LXDA 4OCGA 1GRHA 2XCGA 4JQ9A 1S2QA 2GV8A 3K7MX 3LGQA 2X50A 2E81A 2XLPA 3AE5A 3GRSA 3NH3X 3QSMA 5CKUA 2WDVA 1FT6A 4J57A 3UTFA 1JNIA 4H4PA 3GYJA 1PS9A 1EL7A 4Z26A 3UOYA 1S3EA 2YLXA 1O95A 1ZK7A 2R0PA 3QSEA 3T2KA 3VR8A 3GYXA 1GEUA 3UU9A 1PBFA 4U2SA 1OJ9A 1F8RA 3AE4A 2BS3A 1LV0A 4USQA 4Q1OA 4C74A 2WHDA 2VR0A 2BA9A 2WP5A 1OJAA 2EQ8A 2C3CA 3AEGA 4TM0A 2BRAA 1H6VA 1VQWA 4EMIA 3KU9A 3KVEA 2GR3A 3PVCA 3NT6A 4ADWA 1K4QA 3CPJG 4H2NA 4L38A 4YSHA 2YG6A 3S5WA 3ABVA 2OA1A 4CY8A 1F3PA 1CJ3A 1PBEA 5BRTA 5GRTA 3FMWA 1IUWA 1PBDA 3CNSA 3NTDA 1H84A 4PABA 4GDPA 4B68A 2BC1A 5KWFA 1EL9A 3AE1A 5BUKA 3LZWA 3LB8A 1NHSA 2AAQA 2K3VA 1JU2A 2X8CA 4LU6A 4YTNA 3SM8A 1CJ2A 4KX6A 1QDBA 3DJDA 1OJTA 3FG2P 4P9SA 2Q6UA 5FS7A 3AEAA 2C70A 2WEUA 4G6HA 4U8PA 4OPDA 5ER0A 5EB4A 4Q17A 2WPEA 3BNGA 1K0IA 2O9ZA 4UDQA 2V6OA 2YVFA 4NTEA 4AT0A 4RG4A 1GRTA 1LJ1A 1E1KA 1PJ5A 2F5ZA 3AD7B 2YWLA 1K0LA 3SQPA 2PHHA 4D03A 2H88A 2X8HA 3REDA 3SCEA 1B8SA 1GOSA 1S3BA 2GMJA 4B63A 2CZSA 2C4CA 3RP6A 1ZY8A 2JAEA 4Z2TA 1LPFA 1NDAA 4YSYA 2VRMA 4A5LA 3TORA 1H7XA 2RABA 4I58A 1GT8A 3T14A 4FK1C 5BVAA 4J34A 1H83A 1AOGA 1GRBA 5GSNA 4U8NA 3ICTA 2CVJA 4NEWA 1CJCA 4USRA 2ZO5A 1ONFA 4B65A 3ALLA 3L8KA 4G6GA 2PYXA 4H2QA 5FMHA 2YG5A 1TDEA 3UOZA 1GU6A 3UKKA 4CNJA 2XFUA 2Z5XA 3AD8B 1F8WA 4J36A 2BK5A 2TMDA 2Q7VA 4GRTA 4JY3A 4Z2UA 3UP4A 4Z43A 3SY4A 3GWFA 1GXFA 4C3YA 5HHFA 1GESA 1N4VA 5KMRA 2QA2A 3ICRA 4YKGA 3SFEA 1TYTA 4GUVA 3AD9B 2BCPA 5U25A 4IA5A 1B37A 4BJZA 1X31B 4RSLA 1GNDA 3SXIA 1QO8A 4FX9A 1EL5A 1DXLA 3P9UA 4APNA 4B1BA 3JSKA 4AOSA 1PXAA 4H4RA 4C5OA 3KPFA 1ZDLA 4Z44A 3SXQA 2R45A 3EPTA 2YLZA 1DOEA 2H89A 3BNUA 2QAEA 5CQFA 2GVCA 3V3NA 1KFYA 2YLSA 2E1MA 3BHKA 2B9XA 4M52A 3NYFA 3D1CA 2RF7A 1FS7A 4O5UA 1YKJA 4K7ZA 3KKJA 2BABA 2OLNA 2GAHB 2C64A 2CULA 2YR6A 3BI4A 2TPRA 3IC9A 4XWZA 1BZLA 4ZN0A 3P4QA 2A8XA 4A6NB 2W0HA 4IVOB 2WU5A 4NZHA 3GWDA 2Z5YA 4XWRA 2E80A 3K30A 4UDRA 4H4SA 1CJ4A 2XFPA 4BV6A 2YR5A 1TYPA 2V3BA 3GD4A 2R46A 3B3RA 4JN9A 2BK3A 1IUTA 4HB9A 2WOIA 3CPHG 4H4TA 4TM1A 1GTHA 2XLUA 3F8DA 4OPCA 3NKSA 4NTCA 5KOXA 4A99A 3LADA 3D8XA 3LOVA 1JRYA 3AEBA 3AYJA 3ZDNA 2XDOA 3ITJA 1FS9A 2AR8A 1VRQB 1LQTA 4AOXA 1VDCA 2C7GA 1BF3A 2B76A 3AYIA 1ZOVA 4U8KA 5DBJA 1ZKQA 3GM6A 3PO7A 4XXGA 5U63A 4J31A 3M13A 3FIMB 4AT2A 2VOUA 3NK2X 3AEFA 3I3LA 4BK3A 1DOCA 5JCIA 2XVHA 3D1IA 4JDRA 3UP5A 2XLTA 1GPEA 4JY2A 1YQ3A 4OPLA 2WESA 3SZCA 2GF3A 3UKPA 2GEWA 3P1WA 2IIDA 4K22A 4X9MA 3CGEA 3LG1A 3DK4A 2XLRA 2V60A 3DJGX 4HA6A 2BXRA 3CIRA 4OPGA 4I59A 2UZZA 1Z6LA 2VRLA 1O5WA 3SZ0A 3DGHA 2V3AA 3BNMA 1CHUA 3MMOA 2AQJA 3QFBA 2J7AA 4EIPA 4U8IA 4YTMA 2A89A 3CGCA 2ZZCA 3F29A 3L1TA 4Q0TA 1N4WA 3AECA 4K2XA 2GQWA 4U8OA 4EMWA 1KSSA 4U8LA 3UKLA 2BC0A 2RGHA 5KVHA 1DNCA 1N4UA 2YVGA 3AE9A 4U2LA 5J7XA 3LZXA 2B7RA 3DJJA 1M64A 2BYBA 2DKHA 2JB2A 3EF6A 3GRTA 2QA1A 3NYCA 5KRQA 1GRAA 4E0VA 3NLCA 3BNJA 4H2PA 3K7TA 3AE2A 1KSUA 5L46A 1Q1RA 3PS9A 1RP0A 3DK8A 2ARDA 2FJDA 3ISHA 5LV9A 1KNRA 1ZOYA 2X99A 2WPFA 2YG7A 5KXJA 1LQUA 3OZ2A 4MJWA 2X8GA 4OPUA 1F6MA 1P2HA 4K8DA 4X4JA 4GDEA 3COXA 4YKFA 1GV4A 3UBRA 2YVJA 1H7WA 3ALJA 4O5QA 4ZCCA 1RYIA 4IV9A 3NK1X 1M6IA 3G5RA
chains in the Genus database with same CATH topology
3NRNA 4KPRA 1VG9A 2FJEA 1H82A 2DKIA 3E1TA 4GR1A 5FS6A 1BWCA 1PBCA 1PDHA 2YM2A 4JNAA 3UKQA 4G74A 4EQRA 1ZP0A 2A87A 3V3OA 1D7YA 1TDNA 3NNEA 5C3JA 1OAHA 1JRXA 3P4PA 2ZZBA 2BXSA 4NEVA 3CNTA 4NTDA 2R0GA 4A7AA 3BNFA 1FOHA 1XPQA 4Y4LA 2VVLG 2HQMA 4DSGA 1D7LA 2V5ZA 3CPIG 4BK1A 4IVMB 2ZZ0A 2JBVA 1M1PA 1PN0A 3NYEA 4L3ZA 3M12A 3SZFA 3UTEA 4UP3A 3RP7A 1D4EA 4B64A 2BK4A 4H2RA 3CN8A 1TDFA 3CNJA 2RDZA 4U8MA 3BI5A 3IF9A 3VQRA 1NENA 4B69A 4A65A 1FT5A 2YLTA 4EQXA 1DJNA 1L9EA 1E39A 2GR2A 2FBWA 2WS3A 3KA7A 1V59A 4H4QA 1DOBA 1GREA 1CC6A 2YM1A 3GDPA 4WJYA 5FS9A 3AE3A 1YY5A 3SX6A 2B9WA 3QSSA 3GSIA 2B7SA 4J33A 2B9YA 2WDQA 2WOWA 3GYIA 1GRGA 2WU2A 3AWIA 3L1RA 3NGCX 5JCKA 1FS8A 3DK9A 5TR3A 4II3A 2VQ7A 1PHHA 3DMEA 4TM4A 2QCUA 5IPYA 4IA6A 1CC2A 1NEKA 4EQSA 2XVFA 4WCTA 2R0CA 3P4SA 2IVDA 3V76A 1NG4A 4OVIA 3FPZA 4A9WA 3ALMA 2GH5A 1COYA 3BNHA 1PJ6A 1SEZA 3TTBA 2XVJA 4YXDA 2YQUA 5FS8A 2YG4A 2VVMA 3VRBA 2FJAA 1TRBA 1IUSA 2C65A 4C77A 3LJPA 5BULA 1Y56A 3S61A 1XHCA 1PJ7A 1JOAA 4EQWA 1BGNA 4DSHA 2R4JA 2V61A 4C3XA 1KF6A 1Q1WA 4DGKA 4GAVA 5C2TA 5JCMA 3HYWA 1W4XA 3CGBA 1MO9A 1ZX9A 1MXTA 4Y4NA 1L0VA 1PXCA 3WE0A 2X3NA 2XFNA 1UKVG 3GMCA 3IWAA 4FK1A 3ATRA 4X9NA 3AYLA 1NPXA 4GF7A 2BRYA 3OC4A 2GAGB 4TLXA 4TM3A 3Q9TA 4N9XA 5IQ1A 2EQ9A 1IUUA 1FL2A 3EAOA 3I6DA 1GTEA 1NG3A 3G5QA 3ICSA 4YT0A 1GRFA 1KDGA 2NPXA 3FBSA 3HZLA 3T0KA 3SYIA 1ELIA 4BK2A 4Q5CA 3F8PA 3UOXA 1PBBA 3VRAA 1SP3A 2XYOA 1D5TA 3AEDA 1JNRA 2GR0A 4G9KA 3SZWA 2E4GA 1BKWA 4H4VA 2Y6RA 3RKHA 1LTXR 1BVBA 4D04A 4YWOA 3S7WA 3QJ4A 4UDPA 4DNAA 3VRDB 3EANA 3IHGA 3RHAA 3H8LA 1QLBA 3NHOX 1RSGA 2YLRA 4J2WA 1M1QA 1P2EA 2OLOA 3B6DA 2GMHA 4JNQA 4II2A 3P4RA 4OPTA 1DODA 1S2YA 3RNMA 4J56A 1B5QA 2BACA 2XVIA 4YTPA 3AE6A 3CTYA 3KLJA 4ICYA 4K5RA 2RGOA 1IUXA 1JRZA 3CNPA 2XFQA 3DH9A 4Y4MA 4FDCB 4CNKA 1KNPA 2BS2A 2VZ2A 3K7QX 4U2TA 1PXBA 2GR1A 2IVEA 3GD3A 3UCLA 1E1LA 4BJYA 4K5SA 5JCNA 3NTAA 3SFDA 5EB5A 3C4NA 5IQ4A 1CL0A 1OJDA 2WPCA 5JCLA 1QJDA 3AE7A 3F8RA 2YG3A 4H4XA 1CC4A 1DJQA 4CCRA 2C72A 4Z25A 3IHMA 5HYMA 2VQBA 2Q0LA 2EQ7A 2JB1A 1XDIA 4U8JA 2EQ6A 1FCDA 2GRTA 5KVIA 4A79A 4ZCDA 2WETA 2LFCA 1Y56B 1CF3A 4H50A 2NVKX 2WQYA 3M0OA 3T2YA 3C96A 3VR9A 2ZBWA 4B66A 1JNZA 1IJHA 4H4UA 4Z2RA 3BI2A 3UKHA 1B4VA 3AEEA 4Q5BA 2C66A 2R9ZA 5HY5A 2APGA 3Q6JA 2GQFA 2YR4A 2CFYA 4Z24A 3FO3A 1BGJA 3UKAA 3NG7X 3T37A 2C3DA 1TDOA 1FEAA 4ECHA 1XANA 2C76A 1H81A 3DGZA 4WX1A 1TDKA 4GAPA 1GERA 2YLWA 2GB0A 1N1PA 2RGJA 3OWMA 1GSNA 4L3YA 2OT4A 2Q0KA 4Q4UA 1VG0A 3UTHA 2FJBA 3ATQA 4B67A 2BS4A 3ZYXA 1REOA 4G73A 4YSXA 1JEHA 3QVPA 3QVRA 5EOWA 4NNJA 5KNLA 1Y0PA 3HYXA 3AE8A 3UTGA 4CBQA 5KMQA 4NWZA 5M10A 1E6EA 3NK0X 2XVEA 4LIIA 1LVLA 2C73A 2ACZA 2C75A 2WBAA 4PAAA 2OAMA 2E5VA 4A6NA 3H4KA 1GALA 4EMJA 3O0HA 5KMSA 5KMPA 1YQZA 2WOVA 4H4YA 3H8IA 2C67A 2OALA 2J3NA 1O94A 1ZMDA 3NN6X 4CY6A 3NN0X 1NHRA 1OJCA 4H7UA 2BCGG 3AB1A 2WDRA 3QFAA 2WP9A 3GDNA 4BURA 2WP6A 2JKCA 3BHFA 4H4ZA 4EM3A 1EBDA 2VVLA 3HYVA 3CMMA 1D4DA 1CBOA 5M0ZA 3SGLA 4OPIA 3II4A 2R4EA 3T31A 5KOWA 1FEBA 4L3XA 2XLSA 3CNDA 3UOVA 3DJEA 1EL8A 3G5SA 3KPKA 1YQ4A 3AXBA 1E7PA 3CGDA 3KD9A 4CCQA 1ZMCA 2YAUA 3ADAB 1Q9IA 4EM4A 3URHA 1NAAA 5U1OA 3GMBA 1E1MA 4AP3A 2I0ZA 1L9DA 4H4WA 1L9CA 3UKFA 5HXIA 1E1NA 1F8SA 1H86A 1FECA 1D4CA 1MOKA 1M1RA 2JB3A 3DA1A 1IUVA 4AP1A 2JK6A 4CRTA 3T2ZA 4GCMA 4EIQA 5EBKA 4REKA 2XFOA 2Y6QA 1GETA 1K0JA 1NHQA 3C4AA 4RG3A 1NHPA 2CDUA 4LA1A 3NIXA 3RP8A 4TLZA 3R9UA 4YSZA 5J60A 1HYUA 3LXDA 4OCGA 1GRHA 2XCGA 4JQ9A 1S2QA 2GV8A 3K7MX 3LGQA 2X50A 2E81A 2XLPA 3AE5A 3GRSA 3NH3X 3QSMA 5CKUA 2WDVA 1FT6A 4J57A 3UTFA 1JNIA 4H4PA 3GYJA 1PS9A 1EL7A 4Z26A 3UOYA 1S3EA 2YLXA 1O95A 1ZK7A 2R0PA 3QSEA 3T2KA 3VR8A 3GYXA 1GEUA 3UU9A 1PBFA 4U2SA 1OJ9A 1F8RA 3AE4A 2BS3A 1LV0A 4USQA 4Q1OA 4C74A 2WHDA 2VR0A 2BA9A 2WP5A 1OJAA 2EQ8A 2C3CA 3AEGA 4TM0A 2BRAA 1H6VA 1VQWA 4EMIA 3KU9A 3KVEA 2GR3A 3PVCA 3NT6A 4ADWA 1K4QA 3CPJG 4H2NA 4L38A 4YSHA 2YG6A 3S5WA 3ABVA 2OA1A 4CY8A 1F3PA 1CJ3A 1PBEA 5BRTA 5GRTA 3FMWA 1IUWA 1PBDA 3CNSA 3NTDA 1H84A 4PABA 4GDPA 4B68A 2BC1A 5KWFA 1EL9A 3AE1A 5BUKA 3LZWA 3LB8A 1NHSA 2AAQA 2K3VA 1JU2A 2X8CA 4LU6A 4YTNA 3SM8A 1CJ2A 4KX6A 1QDBA 3DJDA 1OJTA 3FG2P 4P9SA 2Q6UA 5FS7A 3AEAA 2C70A 2WEUA 4G6HA 4U8PA 4OPDA 5ER0A 5EB4A 4Q17A 2WPEA 3BNGA 1K0IA 2O9ZA 4UDQA 2V6OA 2YVFA 4NTEA 4AT0A 4RG4A 1GRTA 1LJ1A 1E1KA 1PJ5A 2F5ZA 3AD7B 2YWLA 1K0LA 3SQPA 2PHHA 4D03A 2H88A 2X8HA 3REDA 3SCEA 1B8SA 1GOSA 1S3BA 2GMJA 4B63A 2C4CA 5KXJA 3RP6A 1ZY8A 2JAEA 4Z2TA 1LPFA 1NDAA 4YSYA 2VRMA 4A5LA 3TORA 1H7XA 2RABA 4I58A 1GT8A 3T14A 4FK1C 5BVAA 4J34A 1H83A 1AOGA 1GRBA 5GSNA 4U8NA 3ICTA 2CVJA 4NEWA 1CJCA 4USRA 2ZO5A 1ONFA 4B65A 3ALLA 3L8KA 4G6GA 2PYXA 4H2QA 5FMHA 2YG5A 1TDEA 3UOZA 1GU6A 3UKKA 4CNJA 2XFUA 2Z5XA 3AD8B 1F8WA 4J36A 2BK5A 2TMDA 2Q7VA 4GRTA 4JY3A 4Z2UA 3UP4A 4Z43A 3SY4A 3GWFA 1GXFA 4C3YA 5HHFA 1GESA 1N4VA 5KMRA 2QA2A 3ICRA 4YKGA 3SFEA 1TYTA 4GUVA 3AD9B 2BCPA 5U25A 4IA5A 1B37A 4BJZA 1X31B 4RSLA 1GNDA 3SXIA 1QO8A 4FX9A 1EL5A 1DXLA 3P9UA 4APNA 4B1BA 3JSKA 4AOSA 1PXAA 4H4RA 4C5OA 3KPFA 1ZDLA 4Z44A 3SXQA 2R45A 3EPTA 2YLZA 1DOEA 2H89A 3BNUA 2QAEA 5CQFA 2GVCA 3V3NA 1KFYA 2YLSA 2E1MA 3BHKA 2B9XA 4M52A 3NYFA 3D1CA 2RF7A 1FS7A 4O5UA 1YKJA 4K7ZA 3KKJA 2BABA 2OLNA 2GAHB 2C64A 2CULA 2YR6A 3BI4A 2TPRA 3IC9A 4XWZA 1BZLA 4ZN0A 3P4QA 2A8XA 4A6NB 2W0HA 4IVOB 2WU5A 4NZHA 3GWDA 2Z5YA 4XWRA 2E80A 3K30A 4UDRA 4H4SA 1CJ4A 2XFPA 4BV6A 2YR5A 1TYPA 2V3BA 3GD4A 2R46A 3B3RA 4JN9A 2BK3A 1IUTA 4HB9A 2WOIA 3CPHG 4H4TA 4TM1A 1GTHA 2XLUA 3F8DA 4OPCA 3NKSA 4NTCA 5KOXA 4A99A 3LADA 3D8XA 3LOVA 1JRYA 3AEBA 3AYJA 3ZDNA 2XDOA 3ITJA 1FS9A 2AR8A 1VRQB 1LQTA 4AOXA 1VDCA 2C7GA 1BF3A 2B76A 3AYIA 1ZOVA 4U8KA 5DBJA 1ZKQA 3GM6A 3PO7A 4XXGA 5U63A 4J31A 3M13A 3FIMB 4AT2A 2VOUA 3NK2X 3AEFA 3I3LA 4BK3A 1DOCA 5JCIA 2XVHA 3D1IA 4JDRA 3UP5A 2XLTA 1GPEA 4JY2A 1YQ3A 4OPLA 2WESA 3SZCA 2GF3A 3UKPA 2GEWA 3P1WA 2IIDA 4K22A 4X9MA 3CGEA 3LG1A 3DK4A 2XLRA 2V60A 3DJGX 4HA6A 2BXRA 3CIRA 4OPGA 4I59A 2UZZA 1Z6LA 2VRLA 1O5WA 3SZ0A 3DGHA 2V3AA 3BNMA 1CHUA 3MMOA 2AQJA 3QFBA 2J7AA 4EIPA 4U8IA 4YTMA 2A89A 3CGCA 2ZZCA 3F29A 3L1TA 4Q0TA 1N4WA 3AECA 4K2XA 2GQWA 4U8OA 4EMWA 1KSSA 4U8LA 3UKLA 2BC0A 2RGHA 5KVHA 1DNCA 1N4UA 2YVGA 3AE9A 4U2LA 5J7XA 3LZXA 2B7RA 3DJJA 1M64A 2BYBA 2DKHA 2JB2A 3EF6A 3GRTA 2QA1A 3NYCA 5KRQA 1GRAA 4E0VA 3NLCA 3BNJA 4H2PA 3K7TA 3AE2A 1KSUA 5L46A 1Q1RA 3PS9A 1RP0A 3DK8A 2ARDA 2FJDA 3ISHA 5LV9A 1KNRA 1ZOYA 2X99A 2WPFA 2YG7A 1LQUA 3OZ2A 4MJWA 2X8GA 4OPUA 1F6MA 1P2HA 4K8DA 4X4JA 4GDEA 3COXA 4YKFA 1GV4A 3UBRA 2YVJA 1H7WA 3ALJA 4O5QA 4ZCCA 1RYIA 4IV9A 3NK1X 1M6IA 3G5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NRN A;  4KPR A;  1VG9 A;  2FJE A;  1H82 A;  2DKI A;  3E1T A;  4GR1 A;  5FS6 A;  1BWC A;  1PBC A;  1PDH A;  2YM2 A;  4JNA A;  3UKQ A;  4EQR A;  1ZP0 A;  2A87 A;  3V3O A;  1D7Y A;  1TDN A;  3NNE A;  5C3J A;  1OAH A;  1JRX A;  3P4P A;  2ZZB A;  2BXS A;  4NEV A;  3CNT A;  4NTD A;  2R0G A;  4A7A A;  3BNF A;  1FOH A;  1XPQ A;  4Y4L A;  2VVL G;  2HQM A;  4DSG A;  1D7L A;  2V5Z A;  3CPI G;  4BK1 A;  4IVM B;  2ZZ0 A;  2JBV A;  1M1P A;  1PN0 A;  3NYE A;  4L3Z A;  3M12 A;  3UTE A;  4UP3 A;  3RP7 A;  1D4E A;  4B64 A;  2BK4 A;  4H2R A;  3CN8 A;  1TDF A;  3CNJ A;  2RDZ A;  4U8M A;  3BI5 A;  3IF9 A;  3VQR A;  1NEN A;  4B69 A;  4A65 A;  1FT5 A;  2YLT A;  4EQX A;  1DJN A;  1L9E A;  1E39 A;  2GR2 A;  2FBW A;  2WS3 A;  3KA7 A;  1V59 A;  4H4Q A;  1DOB A;  1GRE A;  1CC6 A;  2YM1 A;  3GDP A;  4WJY A;  5FS9 A;  3AE3 A;  1YY5 A;  2B9W A;  3QSS A;  3GSI A;  2B7S A;  4J33 A;  2B9Y A;  2WDQ A;  2WOW A;  3GYI A;  1GRG A;  2WU2 A;  3AWI A;  3L1R A;  3NGC X;  5JCK A;  1FS8 A;  3DK9 A;  5TR3 A;  5IPY A;  2VQ7 A;  1PHH A;  3DME A;  4TM4 A;  2QCU A;  4IA6 A;  1CC2 A;  1NEK A;  4EQS A;  2XVF A;  4WCT A;  2R0C A;  3P4S A;  2IVD A;  3V76 A;  1NG4 A;  4OVI A;  3FPZ A;  4A9W A;  3ALM A;  2GH5 A;  1COY A;  3BNH A;  1PJ6 A;  1SEZ A;  3TTB A;  2XVJ A;  4YXD A;  2YQU A;  5FS8 A;  2YG4 A;  2VVM A;  3VRB A;  2FJA A;  1TRB A;  1IUS A;  2C65 A;  4C77 A;  3LJP A;  5BUL A;  1Y56 A;  3S61 A;  1XHC A;  1PJ7 A;  1JOA A;  4EQW A;  1BGN A;  4DSH A;  2R4J A;  2V61 A;  4C3X A;  1KF6 A;  1Q1W A;  4DGK A;  5C2T A;  5JCM A;  1W4X A;  3CGB A;  1MO9 A;  1ZX9 A;  1MXT A;  4Y4N A;  1L0V A;  1PXC A;  3WE0 A;  2X3N A;  2XFN A;  1UKV G;  3GMC A;  3IWA A;  4FK1 A;  3ATR A;  4X9N A;  3AYL A;  1NPX A;  4GF7 A;  3OC4 A;  2GAG B;  4TLX A;  4TM3 A;  3Q9T A;  4N9X A;  5IQ1 A;  2EQ9 A;  1IUU A;  1FL2 A;  3EAO A;  3I6D A;  1GTE A;  1NG3 A;  3G5Q A;  3ICS A;  4YT0 A;  1GRF A;  1KDG A;  2NPX A;  3FBS A;  3HZL A;  4BK2 A;  1ELI A;  4Q5C A;  3F8P A;  3UOX A;  1PBB A;  3VRA A;  1SP3 A;  2XYO A;  1D5T A;  3AED A;  1JNR A;  2GR0 A;  2E4G A;  1BKW A;  4H4V A;  2Y6R A;  3RKH A;  1LTX R;  1BVB A;  4D04 A;  4YWO A;  3S7W A;  3QJ4 A;  4UDP A;  4DNA A;  3VRD B;  3EAN A;  3IHG A;  3RHA A;  3H8L A;  1QLB A;  3NHO X;  1RSG A;  2YLR A;  4J2W A;  1M1Q A;  1P2E A;  2OLO A;  3B6D A;  2GMH A;  4JNQ A;  3P4R A;  4OPT A;  1DOD A;  1S2Y A;  3RNM A;  4J56 A;  1B5Q A;  2BAC A;  2XVI A;  3AE6 A;  3CTY A;  3KLJ A;  4ICY A;  4K5R A;  2RGO A;  1IUX A;  1JRZ A;  3CNP A;  2XFQ A;  3DH9 A;  4Y4M A;  4FDC B;  4CNK A;  1KNP A;  2BS2 A;  2VZ2 A;  3K7Q X;  4U2T A;  1PXB A;  2GR1 A;  2IVE A;  3GD3 A;  3UCL A;  1E1L A;  4BJY A;  4K5S A;  5JCN A;  3NTA A;  3SFD A;  5EB5 A;  3C4N A;  5IQ4 A;  1CL0 A;  1OJD A;  2WPC A;  5JCL A;  1QJD A;  3AE7 A;  3F8R A;  2YG3 A;  4H4X A;  1CC4 A;  1DJQ A;  4CCR A;  2C72 A;  4Z25 A;  3IHM A;  5HYM A;  2VQB A;  2Q0L A;  2EQ7 A;  2JB1 A;  1XDI A;  4U8J A;  2EQ6 A;  1FCD A;  2GRT A;  5KVI A;  4A79 A;  4ZCD A;  2WET A;  2LFC A;  1Y56 B;  1CF3 A;  4H50 A;  2NVK X;  2WQY A;  3M0O A;  3C96 A;  3VR9 A;  2ZBW A;  4B66 A;  1JNZ A;  1IJH A;  4H4U A;  4Z2R A;  3BI2 A;  3UKH A;  1B4V A;  3AEE A;  4Q5B A;  2C66 A;  2R9Z A;  5HY5 A;  2APG A;  3Q6J A;  2GQF A;  2YR4 A;  2CFY A;  4Z24 A;  3FO3 A;  1BGJ A;  3UKA A;  3NG7 X;  3T37 A;  2C3D A;  1TDO A;  1FEA A;  4ECH A;  1XAN A;  2C76 A;  1H81 A;  3DGZ A;  4WX1 A;  1TDK A;  1GER A;  2YLW A;  2GB0 A;  1N1P A;  2RGJ A;  3OWM A;  1GSN A;  4L3Y A;  2OT4 A;  2Q0K A;  4Q4U A;  1VG0 A;  3UTH A;  2FJB A;  3ATQ A;  4B67 A;  2BS4 A;  3ZYX A;  1REO A;  4YSX A;  1JEH A;  3QVP A;  3QVR A;  5EOW A;  1Y0P A;  3AE8 A;  3UTG A;  4CBQ A;  5M10 A;  1E6E A;  3NK0 X;  2XVE A;  4LII A;  1LVL A;  2C73 A;  2ACZ A;  2C75 A;  2WBA A;  4PAA A;  2OAM A;  2E5V A;  4A6N A;  3H4K A;  1GAL A;  4EMJ A;  3O0H A;  1YQZ A;  2WOV A;  4H4Y A;  3H8I A;  2C67 A;  2OAL A;  2J3N A;  1O94 A;  1ZMD A;  3NN6 X;  4CY6 A;  3NN0 X;  1NHR A;  1OJC A;  4H7U A;  2BCG G;  3AB1 A;  2WDR A;  3QFA A;  2WP9 A;  3GDN A;  4BUR A;  2WP6 A;  2JKC A;  3BHF A;  4H4Z A;  4EM3 A;  1EBD A;  2VVL A;  1D4D A;  1CBO A;  5M0Z A;  3SGL A;  4OPI A;  3II4 A;  2R4E A;  5KOW A;  1FEB A;  4L3X A;  2XLS A;  3CND A;  3UOV A;  3DJE A;  1EL8 A;  3G5S A;  1YQ4 A;  3AXB A;  1E7P A;  3CGD A;  3KD9 A;  4CCQ A;  1ZMC A;  2YAU A;  3ADA B;  1Q9I A;  4EM4 A;  3URH A;  1NAA A;  5U1O A;  3GMB A;  1E1M A;  4AP3 A;  2I0Z A;  1L9D A;  4H4W A;  1L9C A;  3UKF A;  5HXI A;  1E1N A;  1F8S A;  1H86 A;  1FEC A;  1D4C A;  1MOK A;  1M1R A;  2JB3 A;  3DA1 A;  1IUV A;  4AP1 A;  2JK6 A;  4CRT A;  4EIQ A;  4GCM A;  4YTP A;  5EBK A;  4REK A;  2XFO A;  2Y6Q A;  1GET A;  1K0J A;  1NHQ A;  3C4A A;  4RG3 A;  1NHP A;  2CDU A;  4LA1 A;  3NIX A;  3RP8 A;  4TLZ A;  3R9U A;  4YSZ A;  5J60 A;  1HYU A;  3LXD A;  4OCG A;  1GRH A;  2XCG A;  4JQ9 A;  1S2Q A;  2GV8 A;  3K7M X;  3LGQ A;  2X50 A;  2E81 A;  2XLP A;  3AE5 A;  3GRS A;  3NH3 X;  3QSM A;  5CKU A;  2WDV A;  1FT6 A;  4J57 A;  3UTF A;  1JNI A;  4H4P A;  3GYJ A;  1PS9 A;  1EL7 A;  4Z26 A;  3UOY A;  1S3E A;  2YLX A;  1O95 A;  1ZK7 A;  2R0P A;  3QSE A;  3VR8 A;  3GYX A;  1GEU A;  3UU9 A;  1PBF A;  4U2S A;  1OJ9 A;  1F8R A;  3AE4 A;  2BS3 A;  1LV0 A;  4USQ A;  4Q1O A;  4C74 A;  2WHD A;  2VR0 A;  2BA9 A;  2WP5 A;  1OJA A;  2EQ8 A;  2C3C A;  3AEG A;  4TM0 A;  1H6V A;  1VQW A;  4EMI A;  3KU9 A;  3KVE A;  2GR3 A;  3PVC A;  3NT6 A;  4ADW A;  1K4Q A;  3CPJ G;  4H2N A;  4L38 A;  4YSH A;  2YG6 A;  3S5W A;  3ABV A;  2OA1 A;  4CY8 A;  1F3P A;  1CJ3 A;  1PBE A;  5BRT A;  5GRT A;  3FMW A;  1IUW A;  1PBD A;  3CNS A;  3NTD A;  1H84 A;  4PAB A;  4GDP A;  4B68 A;  2BC1 A;  5KWF A;  1EL9 A;  3AE1 A;  5BUK A;  3LZW A;  3LB8 A;  1NHS A;  2AAQ A;  2K3V A;  1JU2 A;  2X8C A;  4LU6 A;  4YTN A;  3SM8 A;  1CJ2 A;  4KX6 A;  1QDB A;  3DJD A;  1OJT A;  3FG2 P;  4P9S A;  2Q6U A;  5FS7 A;  3AEA A;  2C70 A;  2WEU A;  4U8P A;  5ER0 A;  4OPD A;  5EB4 A;  4Q17 A;  2WPE A;  3BNG A;  1K0I A;  2O9Z A;  4UDQ A;  2V6O A;  2YVF A;  4NTE A;  4AT0 A;  4RG4 A;  1GRT A;  1LJ1 A;  1E1K A;  1PJ5 A;  2F5Z A;  3AD7 B;  2YWL A;  1K0L A;  3SQP A;  2PHH A;  4D03 A;  2H88 A;  2X8H A;  3RED A;  3SCE A;  1B8S A;  1GOS A;  1S3B A;  2GMJ A;  4B63 A;  5KXJ A;  3RP6 A;  1ZY8 A;  2JAE A;  4Z2T A;  1LPF A;  1NDA A;  4YSY A;  2VRM A;  4A5L A;  3TOR A;  1H7X A;  2RAB A;  4I58 A;  1GT8 A;  5BVA A;  4FK1 C;  1AOG A;  4J34 A;  1H83 A;  1GRB A;  5GSN A;  4U8N A;  3ICT A;  2CVJ A;  4NEW A;  1CJC A;  4USR A;  2ZO5 A;  1ONF A;  4B65 A;  3ALL A;  3L8K A;  2PYX A;  4H2Q A;  5FMH A;  2YG5 A;  1TDE A;  3UOZ A;  1GU6 A;  3UKK A;  4CNJ A;  2XFU A;  2Z5X A;  3AD8 B;  1F8W A;  4J36 A;  2BK5 A;  2TMD A;  2Q7V A;  4GRT A;  4JY3 A;  4Z2U A;  3UP4 A;  4Z43 A;  3GWF A;  1GXF A;  4C3Y A;  5HHF A;  1GES A;  1N4V A;  2QA2 A;  3ICR A;  4YKG A;  3SFE A;  1TYT A;  4GUV A;  3AD9 B;  2BCP A;  5U25 A;  4IA5 A;  1B37 A;  4BJZ A;  1X31 B;  4RSL A;  1GND A;  1QO8 A;  4FX9 A;  1EL5 A;  1DXL A;  3P9U A;  4APN A;  4B1B A;  3JSK A;  4AOS A;  1PXA A;  4H4R A;  4C5O A;  3KPF A;  1ZDL A;  4Z44 A;  3SXQ A;  2R45 A;  3EPT A;  2YLZ A;  1DOE A;  2H89 A;  3BNU A;  2QAE A;  5CQF A;  2GVC A;  3V3N A;  1KFY A;  2YLS A;  2E1M A;  3BHK A;  2B9X A;  4M52 A;  3NYF A;  3D1C A;  2RF7 A;  1FS7 A;  4O5U A;  1YKJ A;  4K7Z A;  3KKJ A;  2BAB A;  2OLN A;  2GAH B;  2C64 A;  2CUL A;  2YR6 A;  3BI4 A;  2TPR A;  3IC9 A;  4XWZ A;  1BZL A;  4ZN0 A;  3P4Q A;  2A8X A;  4A6N B;  2W0H A;  4IVO B;  2WU5 A;  4NZH A;  3GWD A;  2Z5Y A;  4XWR A;  2E80 A;  3K30 A;  4UDR A;  4H4S A;  1CJ4 A;  2XFP A;  4BV6 A;  2YR5 A;  1TYP A;  2V3B A;  3GD4 A;  2R46 A;  3B3R A;  4JN9 A;  2BK3 A;  1IUT A;  4HB9 A;  2WOI A;  3CPH G;  4H4T A;  4TM1 A;  1GTH A;  2XLU A;  3F8D A;  4OPC A;  3NKS A;  4NTC A;  5KOX A;  4A99 A;  3LAD A;  3D8X A;  3LOV A;  1JRY A;  3AEB A;  3AYJ A;  3ZDN A;  2XDO A;  3ITJ A;  1FS9 A;  2AR8 A;  1VRQ B;  1LQT A;  4AOX A;  1VDC A;  2C7G A;  1BF3 A;  2B76 A;  3AYI A;  1ZOV A;  4U8K A;  5DBJ A;  1ZKQ A;  3GM6 A;  3PO7 A;  4XXG A;  5U63 A;  4J31 A;  3M13 A;  3FIM B;  4AT2 A;  2VOU A;  3NK2 X;  3AEF A;  3I3L A;  4BK3 A;  1DOC A;  5JCI A;  2XVH A;  3D1I A;  4JDR A;  3UP5 A;  2XLT A;  1GPE A;  4JY2 A;  1YQ3 A;  4OPL A;  2WES A;  3UKP A;  2GF3 A;  2GEW A;  3P1W A;  2IID A;  4K22 A;  4X9M A;  3CGE A;  3LG1 A;  3DK4 A;  2XLR A;  2V60 A;  3DJG X;  4HA6 A;  2BXR A;  3CIR A;  4OPG A;  4I59 A;  2UZZ A;  1Z6L A;  2VRL A;  1O5W A;  3DGH A;  2V3A A;  3BNM A;  1CHU A;  3MMO A;  2AQJ A;  3QFB A;  2J7A A;  4EIP A;  4U8I A;  4YTM A;  2A89 A;  3CGC A;  2ZZC A;  3F29 A;  3L1T A;  4Q0T A;  1N4W A;  3AEC A;  4K2X A;  2GQW A;  4U8O A;  4EMW A;  1KSS A;  4U8L A;  3UKL A;  2BC0 A;  2RGH A;  5KVH A;  1DNC A;  1N4U A;  2YVG A;  3AE9 A;  4U2L A;  5J7X A;  3LZX A;  2B7R A;  3DJJ A;  1M64 A;  2BYB A;  2DKH A;  2JB2 A;  3EF6 A;  3GRT A;  2QA1 A;  3NYC A;  5KRQ A;  1GRA A;  4E0V A;  3NLC A;  3BNJ A;  4H2P A;  3K7T A;  3AE2 A;  1KSU A;  5L46 A;  1Q1R A;  3PS9 A;  1RP0 A;  3DK8 A;  2ARD A;  2FJD A;  3ISH A;  5LV9 A;  1KNR A;  1ZOY A;  2X99 A;  2WPF A;  2YG7 A;  1LQU A;  3OZ2 A;  4MJW A;  2X8G A;  4OPU A;  1F6M A;  1P2H A;  4K8D A;  4X4J A;  4GDE A;  3COX A;  4YKF A;  1GV4 A;  3UBR A;  2YVJ A;  1H7W A;  3ALJ A;  4O5Q A;  4ZCC A;  1RYI A;  4IV9 A;  3NK1 X;  1M6I A;  3G5R A; 
#chains in the Genus database with same CATH topology
 3NRN A;  4KPR A;  1VG9 A;  2FJE A;  1H82 A;  2DKI A;  3E1T A;  4GR1 A;  5FS6 A;  1BWC A;  1PBC A;  1PDH A;  2YM2 A;  4JNA A;  3UKQ A;  4G74 A;  4EQR A;  1ZP0 A;  2A87 A;  3V3O A;  1D7Y A;  1TDN A;  3NNE A;  5C3J A;  1OAH A;  1JRX A;  3P4P A;  2ZZB A;  2BXS A;  4NEV A;  3CNT A;  4NTD A;  2R0G A;  4A7A A;  3BNF A;  1FOH A;  1XPQ A;  4Y4L A;  2VVL G;  2HQM A;  4DSG A;  1D7L A;  2V5Z A;  3CPI G;  4BK1 A;  4IVM B;  2ZZ0 A;  2JBV A;  1M1P A;  1PN0 A;  3NYE A;  4L3Z A;  3M12 A;  3SZF A;  3UTE A;  4UP3 A;  3RP7 A;  1D4E A;  4B64 A;  2BK4 A;  4H2R A;  3CN8 A;  1TDF A;  3CNJ A;  2RDZ A;  4U8M A;  3BI5 A;  3IF9 A;  3VQR A;  1NEN A;  4B69 A;  4A65 A;  1FT5 A;  2YLT A;  4EQX A;  1DJN A;  1L9E A;  1E39 A;  2GR2 A;  2FBW A;  2WS3 A;  3KA7 A;  1V59 A;  4H4Q A;  1DOB A;  1GRE A;  1CC6 A;  2YM1 A;  3GDP A;  4WJY A;  5FS9 A;  3AE3 A;  1YY5 A;  3SX6 A;  2B9W A;  3QSS A;  3GSI A;  2B7S A;  4J33 A;  2B9Y A;  2WDQ A;  2WOW A;  3GYI A;  1GRG A;  2WU2 A;  3AWI A;  3L1R A;  3NGC X;  5JCK A;  1FS8 A;  3DK9 A;  5TR3 A;  4II3 A;  2VQ7 A;  1PHH A;  3DME A;  4TM4 A;  2QCU A;  5IPY A;  4IA6 A;  1CC2 A;  1NEK A;  4EQS A;  2XVF A;  4WCT A;  2R0C A;  3P4S A;  2IVD A;  3V76 A;  1NG4 A;  4OVI A;  3FPZ A;  4A9W A;  3ALM A;  2GH5 A;  1COY A;  3BNH A;  1PJ6 A;  1SEZ A;  3TTB A;  2XVJ A;  4YXD A;  2YQU A;  5FS8 A;  2YG4 A;  2VVM A;  3VRB A;  2FJA A;  1TRB A;  1IUS A;  2C65 A;  4C77 A;  3LJP A;  5BUL A;  1Y56 A;  3S61 A;  1XHC A;  1PJ7 A;  1JOA A;  4EQW A;  1BGN A;  4DSH A;  2R4J A;  2V61 A;  4C3X A;  1KF6 A;  1Q1W A;  4DGK A;  4GAV A;  5C2T A;  5JCM A;  3HYW A;  1W4X A;  3CGB A;  1MO9 A;  1ZX9 A;  1MXT A;  4Y4N A;  1L0V A;  1PXC A;  3WE0 A;  2X3N A;  2XFN A;  1UKV G;  3GMC A;  3IWA A;  4FK1 A;  3ATR A;  4X9N A;  3AYL A;  1NPX A;  4GF7 A;  2BRY A;  3OC4 A;  2GAG B;  4TLX A;  4TM3 A;  3Q9T A;  4N9X A;  5IQ1 A;  2EQ9 A;  1IUU A;  1FL2 A;  3EAO A;  3I6D A;  1GTE A;  1NG3 A;  3G5Q A;  3ICS A;  4YT0 A;  1GRF A;  1KDG A;  2NPX A;  3FBS A;  3HZL A;  3T0K A;  3SYI A;  1ELI A;  4BK2 A;  4Q5C A;  3F8P A;  3UOX A;  1PBB A;  3VRA A;  1SP3 A;  2XYO A;  1D5T A;  3AED A;  1JNR A;  2GR0 A;  4G9K A;  3SZW A;  2E4G A;  1BKW A;  4H4V A;  2Y6R A;  3RKH A;  1LTX R;  1BVB A;  4D04 A;  4YWO A;  3S7W A;  3QJ4 A;  4UDP A;  4DNA A;  3VRD B;  3EAN A;  3IHG A;  3RHA A;  3H8L A;  1QLB A;  3NHO X;  1RSG A;  2YLR A;  4J2W A;  1M1Q A;  1P2E A;  2OLO A;  3B6D A;  2GMH A;  4JNQ A;  4II2 A;  3P4R A;  4OPT A;  1DOD A;  1S2Y A;  3RNM A;  4J56 A;  1B5Q A;  2BAC A;  2XVI A;  4YTP A;  3AE6 A;  3CTY A;  3KLJ A;  4ICY A;  4K5R A;  2RGO A;  1IUX A;  1JRZ A;  3CNP A;  2XFQ A;  3DH9 A;  4Y4M A;  4FDC B;  4CNK A;  1KNP A;  2BS2 A;  2VZ2 A;  3K7Q X;  4U2T A;  1PXB A;  2GR1 A;  2IVE A;  3GD3 A;  3UCL A;  1E1L A;  4BJY A;  4K5S A;  5JCN A;  3NTA A;  3SFD A;  5EB5 A;  3C4N A;  5IQ4 A;  1CL0 A;  1OJD A;  2WPC A;  5JCL A;  1QJD A;  3AE7 A;  3F8R A;  2YG3 A;  4H4X A;  1CC4 A;  1DJQ A;  4CCR A;  2C72 A;  4Z25 A;  3IHM A;  5HYM A;  2VQB A;  2Q0L A;  2EQ7 A;  2JB1 A;  1XDI A;  4U8J A;  2EQ6 A;  1FCD A;  2GRT A;  5KVI A;  4A79 A;  4ZCD A;  2WET A;  2LFC A;  1Y56 B;  1CF3 A;  4H50 A;  2NVK X;  2WQY A;  3M0O A;  3T2Y A;  3C96 A;  3VR9 A;  2ZBW A;  4B66 A;  1JNZ A;  1IJH A;  4H4U A;  4Z2R A;  3BI2 A;  3UKH A;  1B4V A;  3AEE A;  4Q5B A;  2C66 A;  2R9Z A;  5HY5 A;  2APG A;  3Q6J A;  2GQF A;  2YR4 A;  2CFY A;  4Z24 A;  3FO3 A;  1BGJ A;  3UKA A;  3NG7 X;  3T37 A;  2C3D A;  1TDO A;  1FEA A;  4ECH A;  1XAN A;  2C76 A;  1H81 A;  3DGZ A;  4WX1 A;  1TDK A;  4GAP A;  1GER A;  2YLW A;  2GB0 A;  1N1P A;  2RGJ A;  3OWM A;  1GSN A;  4L3Y A;  2OT4 A;  2Q0K A;  4Q4U A;  1VG0 A;  3UTH A;  2FJB A;  3ATQ A;  4B67 A;  2BS4 A;  3ZYX A;  1REO A;  4G73 A;  4YSX A;  1JEH A;  3QVP A;  3QVR A;  5EOW A;  4NNJ A;  5KNL A;  1Y0P A;  3HYX A;  3AE8 A;  3UTG A;  4CBQ A;  5KMQ A;  4NWZ A;  5M10 A;  1E6E A;  3NK0 X;  2XVE A;  4LII A;  1LVL A;  2C73 A;  2ACZ A;  2C75 A;  2WBA A;  4PAA A;  2OAM A;  2E5V A;  4A6N A;  3H4K A;  1GAL A;  4EMJ A;  3O0H A;  5KMS A;  5KMP A;  1YQZ A;  2WOV A;  4H4Y A;  3H8I A;  2C67 A;  2OAL A;  2J3N A;  1O94 A;  1ZMD A;  3NN6 X;  4CY6 A;  3NN0 X;  1NHR A;  1OJC A;  4H7U A;  2BCG G;  3AB1 A;  2WDR A;  3QFA A;  2WP9 A;  3GDN A;  4BUR A;  2WP6 A;  2JKC A;  3BHF A;  4H4Z A;  4EM3 A;  1EBD A;  2VVL A;  3HYV A;  3CMM A;  1D4D A;  1CBO A;  5M0Z A;  3SGL A;  4OPI A;  3II4 A;  2R4E A;  3T31 A;  5KOW A;  1FEB A;  4L3X A;  2XLS A;  3CND A;  3UOV A;  3DJE A;  1EL8 A;  3G5S A;  3KPK A;  1YQ4 A;  3AXB A;  1E7P A;  3CGD A;  3KD9 A;  4CCQ A;  1ZMC A;  2YAU A;  3ADA B;  1Q9I A;  4EM4 A;  3URH A;  1NAA A;  5U1O A;  3GMB A;  1E1M A;  4AP3 A;  2I0Z A;  1L9D A;  4H4W A;  1L9C A;  3UKF A;  5HXI A;  1E1N A;  1F8S A;  1H86 A;  1FEC A;  1D4C A;  1MOK A;  1M1R A;  2JB3 A;  3DA1 A;  1IUV A;  4AP1 A;  2JK6 A;  4CRT A;  3T2Z A;  4GCM A;  4EIQ A;  5EBK A;  4REK A;  2XFO A;  2Y6Q A;  1GET A;  1K0J A;  1NHQ A;  3C4A A;  4RG3 A;  1NHP A;  2CDU A;  4LA1 A;  3NIX A;  3RP8 A;  4TLZ A;  3R9U A;  4YSZ A;  5J60 A;  1HYU A;  3LXD A;  4OCG A;  1GRH A;  2XCG A;  4JQ9 A;  1S2Q A;  2GV8 A;  3K7M X;  3LGQ A;  2X50 A;  2E81 A;  2XLP A;  3AE5 A;  3GRS A;  3NH3 X;  3QSM A;  5CKU A;  2WDV A;  1FT6 A;  4J57 A;  3UTF A;  1JNI A;  4H4P A;  3GYJ A;  1PS9 A;  1EL7 A;  4Z26 A;  3UOY A;  1S3E A;  2YLX A;  1O95 A;  1ZK7 A;  2R0P A;  3QSE A;  3T2K A;  3VR8 A;  3GYX A;  1GEU A;  3UU9 A;  1PBF A;  4U2S A;  1OJ9 A;  1F8R A;  3AE4 A;  2BS3 A;  1LV0 A;  4USQ A;  4Q1O A;  4C74 A;  2WHD A;  2VR0 A;  2BA9 A;  2WP5 A;  1OJA A;  2EQ8 A;  2C3C A;  3AEG A;  4TM0 A;  2BRA A;  1H6V A;  1VQW A;  4EMI A;  3KU9 A;  3KVE A;  2GR3 A;  3PVC A;  3NT6 A;  4ADW A;  1K4Q A;  3CPJ G;  4H2N A;  4L38 A;  4YSH A;  2YG6 A;  3S5W A;  3ABV A;  2OA1 A;  4CY8 A;  1F3P A;  1CJ3 A;  1PBE A;  5BRT A;  5GRT A;  3FMW A;  1IUW A;  1PBD A;  3CNS A;  3NTD A;  1H84 A;  4PAB A;  4GDP A;  4B68 A;  2BC1 A;  5KWF A;  1EL9 A;  3AE1 A;  5BUK A;  3LZW A;  3LB8 A;  1NHS A;  2AAQ A;  2K3V A;  1JU2 A;  2X8C A;  4LU6 A;  4YTN A;  3SM8 A;  1CJ2 A;  4KX6 A;  1QDB A;  3DJD A;  1OJT A;  3FG2 P;  4P9S A;  2Q6U A;  5FS7 A;  3AEA A;  2C70 A;  2WEU A;  4G6H A;  4U8P A;  4OPD A;  5ER0 A;  5EB4 A;  4Q17 A;  2WPE A;  3BNG A;  1K0I A;  2O9Z A;  4UDQ A;  2V6O A;  2YVF A;  4NTE A;  4AT0 A;  4RG4 A;  1GRT A;  1LJ1 A;  1E1K A;  1PJ5 A;  2F5Z A;  3AD7 B;  2YWL A;  1K0L A;  3SQP A;  2PHH A;  4D03 A;  2H88 A;  2X8H A;  3RED A;  3SCE A;  1B8S A;  1GOS A;  1S3B A;  2GMJ A;  4B63 A;  2CZS A;  2C4C A;  3RP6 A;  1ZY8 A;  2JAE A;  4Z2T A;  1LPF A;  1NDA A;  4YSY A;  2VRM A;  4A5L A;  3TOR A;  1H7X A;  2RAB A;  4I58 A;  1GT8 A;  3T14 A;  4FK1 C;  5BVA A;  4J34 A;  1H83 A;  1AOG A;  1GRB A;  5GSN A;  4U8N A;  3ICT A;  2CVJ A;  4NEW A;  1CJC A;  4USR A;  2ZO5 A;  1ONF A;  4B65 A;  3ALL A;  3L8K A;  4G6G A;  2PYX A;  4H2Q A;  5FMH A;  2YG5 A;  1TDE A;  3UOZ A;  1GU6 A;  3UKK A;  4CNJ A;  2XFU A;  2Z5X A;  3AD8 B;  1F8W A;  4J36 A;  2BK5 A;  2TMD A;  2Q7V A;  4GRT A;  4JY3 A;  4Z2U A;  3UP4 A;  4Z43 A;  3SY4 A;  3GWF A;  1GXF A;  4C3Y A;  5HHF A;  1GES A;  1N4V A;  5KMR A;  2QA2 A;  3ICR A;  4YKG A;  3SFE A;  1TYT A;  4GUV A;  3AD9 B;  2BCP A;  5U25 A;  4IA5 A;  1B37 A;  4BJZ A;  1X31 B;  4RSL A;  1GND A;  3SXI A;  1QO8 A;  4FX9 A;  1EL5 A;  1DXL A;  3P9U A;  4APN A;  4B1B A;  3JSK A;  4AOS A;  1PXA A;  4H4R A;  4C5O A;  3KPF A;  1ZDL A;  4Z44 A;  3SXQ A;  2R45 A;  3EPT A;  2YLZ A;  1DOE A;  2H89 A;  3BNU A;  2QAE A;  5CQF A;  2GVC A;  3V3N A;  1KFY A;  2YLS A;  2E1M A;  3BHK A;  2B9X A;  4M52 A;  3NYF A;  3D1C A;  2RF7 A;  1FS7 A;  4O5U A;  1YKJ A;  4K7Z A;  3KKJ A;  2BAB A;  2OLN A;  2GAH B;  2C64 A;  2CUL A;  2YR6 A;  3BI4 A;  2TPR A;  3IC9 A;  4XWZ A;  1BZL A;  4ZN0 A;  3P4Q A;  2A8X A;  4A6N B;  2W0H A;  4IVO B;  2WU5 A;  4NZH A;  3GWD A;  2Z5Y A;  4XWR A;  2E80 A;  3K30 A;  4UDR A;  4H4S A;  1CJ4 A;  2XFP A;  4BV6 A;  2YR5 A;  1TYP A;  2V3B A;  3GD4 A;  2R46 A;  3B3R A;  4JN9 A;  2BK3 A;  1IUT A;  4HB9 A;  2WOI A;  3CPH G;  4H4T A;  4TM1 A;  1GTH A;  2XLU A;  3F8D A;  4OPC A;  3NKS A;  4NTC A;  5KOX A;  4A99 A;  3LAD A;  3D8X A;  3LOV A;  1JRY A;  3AEB A;  3AYJ A;  3ZDN A;  2XDO A;  3ITJ A;  1FS9 A;  2AR8 A;  1VRQ B;  1LQT A;  4AOX A;  1VDC A;  2C7G A;  1BF3 A;  2B76 A;  3AYI A;  1ZOV A;  4U8K A;  5DBJ A;  1ZKQ A;  3GM6 A;  3PO7 A;  4XXG A;  5U63 A;  4J31 A;  3M13 A;  3FIM B;  4AT2 A;  2VOU A;  3NK2 X;  3AEF A;  3I3L A;  4BK3 A;  1DOC A;  5JCI A;  2XVH A;  3D1I A;  4JDR A;  3UP5 A;  2XLT A;  1GPE A;  4JY2 A;  1YQ3 A;  4OPL A;  2WES A;  3SZC A;  2GF3 A;  3UKP A;  2GEW A;  3P1W A;  2IID A;  4K22 A;  4X9M A;  3CGE A;  3LG1 A;  3DK4 A;  2XLR A;  2V60 A;  3DJG X;  4HA6 A;  2BXR A;  3CIR A;  4OPG A;  4I59 A;  2UZZ A;  1Z6L A;  2VRL A;  1O5W A;  3SZ0 A;  3DGH A;  2V3A A;  3BNM A;  1CHU A;  3MMO A;  2AQJ A;  3QFB A;  2J7A A;  4EIP A;  4U8I A;  4YTM A;  2A89 A;  3CGC A;  2ZZC A;  3F29 A;  3L1T A;  4Q0T A;  1N4W A;  3AEC A;  4K2X A;  2GQW A;  4U8O A;  4EMW A;  1KSS A;  4U8L A;  3UKL A;  2BC0 A;  2RGH A;  5KVH A;  1DNC A;  1N4U A;  2YVG A;  3AE9 A;  4U2L A;  5J7X A;  3LZX A;  2B7R A;  3DJJ A;  1M64 A;  2BYB A;  2DKH A;  2JB2 A;  3EF6 A;  3GRT A;  2QA1 A;  3NYC A;  5KRQ A;  1GRA A;  4E0V A;  3NLC A;  3BNJ A;  4H2P A;  3K7T A;  3AE2 A;  1KSU A;  5L46 A;  1Q1R A;  3PS9 A;  1RP0 A;  3DK8 A;  2ARD A;  2FJD A;  3ISH A;  5LV9 A;  1KNR A;  1ZOY A;  2X99 A;  2WPF A;  2YG7 A;  5KXJ A;  1LQU A;  3OZ2 A;  4MJW A;  2X8G A;  4OPU A;  1F6M A;  1P2H A;  4K8D A;  4X4J A;  4GDE A;  3COX A;  4YKF A;  1GV4 A;  3UBR A;  2YVJ A;  1H7W A;  3ALJ A;  4O5Q A;  4ZCC A;  1RYI A;  4IV9 A;  3NK1 X;  1M6I A;  3G5R A; 
#chains in the Genus database with same CATH homology
 3NRN A;  4KPR A;  1VG9 A;  2FJE A;  1H82 A;  2DKI A;  3E1T A;  4GR1 A;  5FS6 A;  1BWC A;  1PBC A;  1PDH A;  2YM2 A;  4JNA A;  3UKQ A;  4G74 A;  4EQR A;  1ZP0 A;  2A87 A;  3V3O A;  1D7Y A;  1TDN A;  3NNE A;  5C3J A;  1OAH A;  1JRX A;  3P4P A;  2ZZB A;  2BXS A;  4NEV A;  3CNT A;  4NTD A;  2R0G A;  4A7A A;  3BNF A;  1FOH A;  1XPQ A;  4Y4L A;  2VVL G;  2HQM A;  4DSG A;  1D7L A;  2V5Z A;  3CPI G;  4BK1 A;  4IVM B;  2ZZ0 A;  2JBV A;  1M1P A;  1PN0 A;  3NYE A;  4L3Z A;  3M12 A;  3SZF A;  3UTE A;  4UP3 A;  3RP7 A;  1D4E A;  4B64 A;  2BK4 A;  4H2R A;  3CN8 A;  1TDF A;  3CNJ A;  2RDZ A;  4U8M A;  3BI5 A;  3IF9 A;  3VQR A;  1NEN A;  4B69 A;  4A65 A;  1FT5 A;  2YLT A;  4EQX A;  1DJN A;  1L9E A;  1E39 A;  2GR2 A;  2FBW A;  2WS3 A;  3KA7 A;  1V59 A;  4H4Q A;  1DOB A;  1GRE A;  1CC6 A;  2YM1 A;  3GDP A;  4WJY A;  5FS9 A;  3AE3 A;  1YY5 A;  3SX6 A;  2B9W A;  3QSS A;  3GSI A;  2B7S A;  4J33 A;  2B9Y A;  2WDQ A;  2WOW A;  3GYI A;  1GRG A;  2WU2 A;  3AWI A;  3L1R A;  3NGC X;  5JCK A;  1FS8 A;  3DK9 A;  5TR3 A;  4II3 A;  2VQ7 A;  1PHH A;  3DME A;  4TM4 A;  2QCU A;  5IPY A;  4IA6 A;  1CC2 A;  1NEK A;  4EQS A;  2XVF A;  4WCT A;  2R0C A;  3P4S A;  2IVD A;  3V76 A;  1NG4 A;  4OVI A;  3FPZ A;  4A9W A;  3ALM A;  2GH5 A;  1COY A;  3BNH A;  1PJ6 A;  1SEZ A;  3TTB A;  2XVJ A;  4YXD A;  2YQU A;  5FS8 A;  2YG4 A;  2VVM A;  3VRB A;  2FJA A;  1TRB A;  1IUS A;  2C65 A;  4C77 A;  3LJP A;  5BUL A;  1Y56 A;  3S61 A;  1XHC A;  1PJ7 A;  1JOA A;  4EQW A;  1BGN A;  4DSH A;  2R4J A;  2V61 A;  4C3X A;  1KF6 A;  1Q1W A;  4DGK A;  4GAV A;  5C2T A;  5JCM A;  3HYW A;  1W4X A;  3CGB A;  1MO9 A;  1ZX9 A;  1MXT A;  4Y4N A;  1L0V A;  1PXC A;  3WE0 A;  2X3N A;  2XFN A;  1UKV G;  3GMC A;  3IWA A;  4FK1 A;  3ATR A;  4X9N A;  3AYL A;  1NPX A;  4GF7 A;  2BRY A;  3OC4 A;  2GAG B;  4TLX A;  4TM3 A;  3Q9T A;  4N9X A;  5IQ1 A;  2EQ9 A;  1IUU A;  1FL2 A;  3EAO A;  3I6D A;  1GTE A;  1NG3 A;  3G5Q A;  3ICS A;  4YT0 A;  1GRF A;  1KDG A;  2NPX A;  3FBS A;  3HZL A;  3T0K A;  3SYI A;  1ELI A;  4BK2 A;  4Q5C A;  3F8P A;  3UOX A;  1PBB A;  3VRA A;  1SP3 A;  2XYO A;  1D5T A;  3AED A;  1JNR A;  2GR0 A;  4G9K A;  3SZW A;  2E4G A;  1BKW A;  4H4V A;  2Y6R A;  3RKH A;  1LTX R;  1BVB A;  4D04 A;  4YWO A;  3S7W A;  3QJ4 A;  4UDP A;  4DNA A;  3VRD B;  3EAN A;  3IHG A;  3RHA A;  3H8L A;  1QLB A;  3NHO X;  1RSG A;  2YLR A;  4J2W A;  1M1Q A;  1P2E A;  2OLO A;  3B6D A;  2GMH A;  4JNQ A;  4II2 A;  3P4R A;  4OPT A;  1DOD A;  1S2Y A;  3RNM A;  4J56 A;  1B5Q A;  2BAC A;  2XVI A;  4YTP A;  3AE6 A;  3CTY A;  3KLJ A;  4ICY A;  4K5R A;  2RGO A;  1IUX A;  1JRZ A;  3CNP A;  2XFQ A;  3DH9 A;  4Y4M A;  4FDC B;  4CNK A;  1KNP A;  2BS2 A;  2VZ2 A;  3K7Q X;  4U2T A;  1PXB A;  2GR1 A;  2IVE A;  3GD3 A;  3UCL A;  1E1L A;  4BJY A;  4K5S A;  5JCN A;  3NTA A;  3SFD A;  5EB5 A;  3C4N A;  5IQ4 A;  1CL0 A;  1OJD A;  2WPC A;  5JCL A;  1QJD A;  3AE7 A;  3F8R A;  2YG3 A;  4H4X A;  1CC4 A;  1DJQ A;  4CCR A;  2C72 A;  4Z25 A;  3IHM A;  5HYM A;  2VQB A;  2Q0L A;  2EQ7 A;  2JB1 A;  1XDI A;  4U8J A;  2EQ6 A;  1FCD A;  2GRT A;  5KVI A;  4A79 A;  4ZCD A;  2WET A;  2LFC A;  1Y56 B;  1CF3 A;  4H50 A;  2NVK X;  2WQY A;  3M0O A;  3T2Y A;  3C96 A;  3VR9 A;  2ZBW A;  4B66 A;  1JNZ A;  1IJH A;  4H4U A;  4Z2R A;  3BI2 A;  3UKH A;  1B4V A;  3AEE A;  4Q5B A;  2C66 A;  2R9Z A;  5HY5 A;  2APG A;  3Q6J A;  2GQF A;  2YR4 A;  2CFY A;  4Z24 A;  3FO3 A;  1BGJ A;  3UKA A;  3NG7 X;  3T37 A;  2C3D A;  1TDO A;  1FEA A;  4ECH A;  1XAN A;  2C76 A;  1H81 A;  3DGZ A;  4WX1 A;  1TDK A;  4GAP A;  1GER A;  2YLW A;  2GB0 A;  1N1P A;  2RGJ A;  3OWM A;  1GSN A;  4L3Y A;  2OT4 A;  2Q0K A;  4Q4U A;  1VG0 A;  3UTH A;  2FJB A;  3ATQ A;  4B67 A;  2BS4 A;  3ZYX A;  1REO A;  4G73 A;  4YSX A;  1JEH A;  3QVP A;  3QVR A;  5EOW A;  4NNJ A;  5KNL A;  1Y0P A;  3HYX A;  3AE8 A;  3UTG A;  4CBQ A;  5KMQ A;  4NWZ A;  5M10 A;  1E6E A;  3NK0 X;  2XVE A;  4LII A;  1LVL A;  2C73 A;  2ACZ A;  2C75 A;  2WBA A;  4PAA A;  2OAM A;  2E5V A;  4A6N A;  3H4K A;  1GAL A;  4EMJ A;  3O0H A;  5KMS A;  5KMP A;  1YQZ A;  2WOV A;  4H4Y A;  3H8I A;  2C67 A;  2OAL A;  2J3N A;  1O94 A;  1ZMD A;  3NN6 X;  4CY6 A;  3NN0 X;  1NHR A;  1OJC A;  4H7U A;  2BCG G;  3AB1 A;  2WDR A;  3QFA A;  2WP9 A;  3GDN A;  4BUR A;  2WP6 A;  2JKC A;  3BHF A;  4H4Z A;  4EM3 A;  1EBD A;  2VVL A;  3HYV A;  3CMM A;  1D4D A;  1CBO A;  5M0Z A;  3SGL A;  4OPI A;  3II4 A;  2R4E A;  3T31 A;  5KOW A;  1FEB A;  4L3X A;  2XLS A;  3CND A;  3UOV A;  3DJE A;  1EL8 A;  3G5S A;  3KPK A;  1YQ4 A;  3AXB A;  1E7P A;  3CGD A;  3KD9 A;  4CCQ A;  1ZMC A;  2YAU A;  3ADA B;  1Q9I A;  4EM4 A;  3URH A;  1NAA A;  5U1O A;  3GMB A;  1E1M A;  4AP3 A;  2I0Z A;  1L9D A;  4H4W A;  1L9C A;  3UKF A;  5HXI A;  1E1N A;  1F8S A;  1H86 A;  1FEC A;  1D4C A;  1MOK A;  1M1R A;  2JB3 A;  3DA1 A;  1IUV A;  4AP1 A;  2JK6 A;  4CRT A;  3T2Z A;  4GCM A;  4EIQ A;  5EBK A;  4REK A;  2XFO A;  2Y6Q A;  1GET A;  1K0J A;  1NHQ A;  3C4A A;  4RG3 A;  1NHP A;  2CDU A;  4LA1 A;  3NIX A;  3RP8 A;  4TLZ A;  3R9U A;  4YSZ A;  5J60 A;  1HYU A;  3LXD A;  4OCG A;  1GRH A;  2XCG A;  4JQ9 A;  1S2Q A;  2GV8 A;  3K7M X;  3LGQ A;  2X50 A;  2E81 A;  2XLP A;  3AE5 A;  3GRS A;  3NH3 X;  3QSM A;  5CKU A;  2WDV A;  1FT6 A;  4J57 A;  3UTF A;  1JNI A;  4H4P A;  3GYJ A;  1PS9 A;  1EL7 A;  4Z26 A;  3UOY A;  1S3E A;  2YLX A;  1O95 A;  1ZK7 A;  2R0P A;  3QSE A;  3T2K A;  3VR8 A;  3GYX A;  1GEU A;  3UU9 A;  1PBF A;  4U2S A;  1OJ9 A;  1F8R A;  3AE4 A;  2BS3 A;  1LV0 A;  4USQ A;  4Q1O A;  4C74 A;  2WHD A;  2VR0 A;  2BA9 A;  2WP5 A;  1OJA A;  2EQ8 A;  2C3C A;  3AEG A;  4TM0 A;  2BRA A;  1H6V A;  1VQW A;  4EMI A;  3KU9 A;  3KVE A;  2GR3 A;  3PVC A;  3NT6 A;  4ADW A;  1K4Q A;  3CPJ G;  4H2N A;  4L38 A;  4YSH A;  2YG6 A;  3S5W A;  3ABV A;  2OA1 A;  4CY8 A;  1F3P A;  1CJ3 A;  1PBE A;  5BRT A;  5GRT A;  3FMW A;  1IUW A;  1PBD A;  3CNS A;  3NTD A;  1H84 A;  4PAB A;  4GDP A;  4B68 A;  2BC1 A;  5KWF A;  1EL9 A;  3AE1 A;  5BUK A;  3LZW A;  3LB8 A;  1NHS A;  2AAQ A;  2K3V A;  1JU2 A;  2X8C A;  4LU6 A;  4YTN A;  3SM8 A;  1CJ2 A;  4KX6 A;  1QDB A;  3DJD A;  1OJT A;  3FG2 P;  4P9S A;  2Q6U A;  5FS7 A;  3AEA A;  2C70 A;  2WEU A;  4G6H A;  4U8P A;  4OPD A;  5ER0 A;  5EB4 A;  4Q17 A;  2WPE A;  3BNG A;  1K0I A;  2O9Z A;  4UDQ A;  2V6O A;  2YVF A;  4NTE A;  4AT0 A;  4RG4 A;  1GRT A;  1LJ1 A;  1E1K A;  1PJ5 A;  2F5Z A;  3AD7 B;  2YWL A;  1K0L A;  3SQP A;  2PHH A;  4D03 A;  2H88 A;  2X8H A;  3RED A;  3SCE A;  1B8S A;  1GOS A;  1S3B A;  2GMJ A;  4B63 A;  2C4C A;  5KXJ A;  3RP6 A;  1ZY8 A;  2JAE A;  4Z2T A;  1LPF A;  1NDA A;  4YSY A;  2VRM A;  4A5L A;  3TOR A;  1H7X A;  2RAB A;  4I58 A;  1GT8 A;  3T14 A;  4FK1 C;  5BVA A;  4J34 A;  1H83 A;  1AOG A;  1GRB A;  5GSN A;  4U8N A;  3ICT A;  2CVJ A;  4NEW A;  1CJC A;  4USR A;  2ZO5 A;  1ONF A;  4B65 A;  3ALL A;  3L8K A;  4G6G A;  2PYX A;  4H2Q A;  5FMH A;  2YG5 A;  1TDE A;  3UOZ A;  1GU6 A;  3UKK A;  4CNJ A;  2XFU A;  2Z5X A;  3AD8 B;  1F8W A;  4J36 A;  2BK5 A;  2TMD A;  2Q7V A;  4GRT A;  4JY3 A;  4Z2U A;  3UP4 A;  4Z43 A;  3SY4 A;  3GWF A;  1GXF A;  4C3Y A;  5HHF A;  1GES A;  1N4V A;  5KMR A;  2QA2 A;  3ICR A;  4YKG A;  3SFE A;  1TYT A;  4GUV A;  3AD9 B;  2BCP A;  5U25 A;  4IA5 A;  1B37 A;  4BJZ A;  1X31 B;  4RSL A;  1GND A;  3SXI A;  1QO8 A;  4FX9 A;  1EL5 A;  1DXL A;  3P9U A;  4APN A;  4B1B A;  3JSK A;  4AOS A;  1PXA A;  4H4R A;  4C5O A;  3KPF A;  1ZDL A;  4Z44 A;  3SXQ A;  2R45 A;  3EPT A;  2YLZ A;  1DOE A;  2H89 A;  3BNU A;  2QAE A;  5CQF A;  2GVC A;  3V3N A;  1KFY A;  2YLS A;  2E1M A;  3BHK A;  2B9X A;  4M52 A;  3NYF A;  3D1C A;  2RF7 A;  1FS7 A;  4O5U A;  1YKJ A;  4K7Z A;  3KKJ A;  2BAB A;  2OLN A;  2GAH B;  2C64 A;  2CUL A;  2YR6 A;  3BI4 A;  2TPR A;  3IC9 A;  4XWZ A;  1BZL A;  4ZN0 A;  3P4Q A;  2A8X A;  4A6N B;  2W0H A;  4IVO B;  2WU5 A;  4NZH A;  3GWD A;  2Z5Y A;  4XWR A;  2E80 A;  3K30 A;  4UDR A;  4H4S A;  1CJ4 A;  2XFP A;  4BV6 A;  2YR5 A;  1TYP A;  2V3B A;  3GD4 A;  2R46 A;  3B3R A;  4JN9 A;  2BK3 A;  1IUT A;  4HB9 A;  2WOI A;  3CPH G;  4H4T A;  4TM1 A;  1GTH A;  2XLU A;  3F8D A;  4OPC A;  3NKS A;  4NTC A;  5KOX A;  4A99 A;  3LAD A;  3D8X A;  3LOV A;  1JRY A;  3AEB A;  3AYJ A;  3ZDN A;  2XDO A;  3ITJ A;  1FS9 A;  2AR8 A;  1VRQ B;  1LQT A;  4AOX A;  1VDC A;  2C7G A;  1BF3 A;  2B76 A;  3AYI A;  1ZOV A;  4U8K A;  5DBJ A;  1ZKQ A;  3GM6 A;  3PO7 A;  4XXG A;  5U63 A;  4J31 A;  3M13 A;  3FIM B;  4AT2 A;  2VOU A;  3NK2 X;  3AEF A;  3I3L A;  4BK3 A;  1DOC A;  5JCI A;  2XVH A;  3D1I A;  4JDR A;  3UP5 A;  2XLT A;  1GPE A;  4JY2 A;  1YQ3 A;  4OPL A;  2WES A;  3SZC A;  2GF3 A;  3UKP A;  2GEW A;  3P1W A;  2IID A;  4K22 A;  4X9M A;  3CGE A;  3LG1 A;  3DK4 A;  2XLR A;  2V60 A;  3DJG X;  4HA6 A;  2BXR A;  3CIR A;  4OPG A;  4I59 A;  2UZZ A;  1Z6L A;  2VRL A;  1O5W A;  3SZ0 A;  3DGH A;  2V3A A;  3BNM A;  1CHU A;  3MMO A;  2AQJ A;  3QFB A;  2J7A A;  4EIP A;  4U8I A;  4YTM A;  2A89 A;  3CGC A;  2ZZC A;  3F29 A;  3L1T A;  4Q0T A;  1N4W A;  3AEC A;  4K2X A;  2GQW A;  4U8O A;  4EMW A;  1KSS A;  4U8L A;  3UKL A;  2BC0 A;  2RGH A;  5KVH A;  1DNC A;  1N4U A;  2YVG A;  3AE9 A;  4U2L A;  5J7X A;  3LZX A;  2B7R A;  3DJJ A;  1M64 A;  2BYB A;  2DKH A;  2JB2 A;  3EF6 A;  3GRT A;  2QA1 A;  3NYC A;  5KRQ A;  1GRA A;  4E0V A;  3NLC A;  3BNJ A;  4H2P A;  3K7T A;  3AE2 A;  1KSU A;  5L46 A;  1Q1R A;  3PS9 A;  1RP0 A;  3DK8 A;  2ARD A;  2FJD A;  3ISH A;  5LV9 A;  1KNR A;  1ZOY A;  2X99 A;  2WPF A;  2YG7 A;  1LQU A;  3OZ2 A;  4MJW A;  2X8G A;  4OPU A;  1F6M A;  1P2H A;  4K8D A;  4X4J A;  4GDE A;  3COX A;  4YKF A;  1GV4 A;  3UBR A;  2YVJ A;  1H7W A;  3ALJ A;  4O5Q A;  4ZCC A;  1RYI A;  4IV9 A;  3NK1 X;  1M6I A;  3G5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...