1JRXA

Crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FLAVOCYTOCHROME C
publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrxA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrxA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrxA01
4ZN0A 2IVDA 3OC4A 1JRZA 1H81A 1PJ5A 3SCEA 4B68A 1D4EA 4A65A 1OJ9A 1Q1WA 2VRMA 4TM0A 4TLZA 4U8LA 3LG1A 2R45A 1NHQA 3QFBA 2BA9A 1KFYA 2XVIA 1PJ7A 4H4YA 1TYTA 4LA1A 1F8SA 2XFNA 4B64A 3ATRA 3RP8A 2WU5A 4YT0A 5KVHA 1F8RA 4FK1C 4H7UA 2X99A 2FJDA 4H2RA 2C73A 2YG7A 2YM2A 2C64A 2C76A 3SFEA 1O5WA 4AP3A 4Z25A 4UP3A 1FS7A 3F8DA 2AAQA 1GRHA 4AP1A 3FMWA 3CTYA 3KD9A 3AEGA 2OA1A 1MOKA 2E81A 2BK3A 3VRDB 3NHOX 2BXSA 2ZO5A 1GRBA 3RP7A 1H84A 3DA1A 4RG4A 4D03A 1K4QA 3K7MX 3REDA 1E1MA 4A9WA 4OVIA 4U8IA 3RKHA 5KVIA 4U2LA 4M52A 4GCMA 5LV9A 3NT6A 3K7QX 2EQ7A 1BVBA 3COXA 4C77A 4J33A 3Q9TA 4BK1A 1IUVA 2B9YA 2XVHA 3QVPA 1LQUA 4K2XA 5BUKA 5EBKA 5FS9A 2GQWA 2QCUA 1TYPA 5C3JA 1OJAA 3MMOA 4U8NA 3GWDA 1NG4A 2RGOA 2HQMA 1ZMDA 2WDRA 4YKGA 3NGCX 4I58A 1MO9A 3UCLA 2BK5A 3P1WA 5IQ4A 3QJ4A 1H6VA 3LOVA 2YLWA 3SM8A 4EMWA 3OWMA 1LQTA 2QA1A 2XFPA 3GDNA 2WPCA 1DJQA 2YLTA 3UOZA 3DH9A 2VVMA 5KXJA 3AEFA 1DNCA 1PXAA 3ALJA 3SFDA 4DSGA 2XYOA 1ZDLA 1IUXA 2WHDA 3IHGA 4EM3A 2DKIA 2YM1A 2J7AA 2Z5YA 3L1RA 3AEEA 3ITJA 4AOXA 2YG6A 2FBWA 1YQZA 1M1PA 4B66A 3DGHA 4L3ZA 3VQRA 3JSKA 1E1LA 5BRTA 4UDQA 4J31A 1GTHA 3AE5A 1QO8A 2H89A 2WOIA 5CKUA 5EOWA 4Z44A 2Q6UA 2V6OA 2YAUA 4DSHA 4Z43A 5CQFA 4WX1A 5U1OA 1CBOA 1F8WA 1UKVG 2IIDA 2YR4A 3C4NA 3NYFA 1BWCA 4I59A 4OPLA 3V3NA 3SQPA 3RNMA 1E39A 1GREA 3CNSA 2F5ZA 3BHFA 2GR1A 2E1MA 2XVEA 2ZBWA 1FCDA 4H4ZA 1Z6LA 1BGJA 3H8IA 3QFAA 3BNGA 3P4QA 1PBBA 3G5SA 5HYMA 4U8PA 1AOGA 4CNKA 4WCTA 3UTEA 3IWAA 4C3XA 2C65A 1RYIA 1GRFA 2YR6A 1D7LA 4Q5CA 1GT8A 2BS4A 4XWRA 5J7XA 1GU6A 2ZZBA 2WPEA 5C2TA 4CNJA 1H83A 4EQWA 3TTBA 1SP3A 3KLJA 4BK2A 4DGKA 1ELIA 4REKA 2B76A 4FDCB 5BULA 1S2YA 1YY5A 2Y6RA 3D1CA 3DGZA 3UKLA 1ZY8A 2R4EA 1EL8A 2Q0LA 2WESA 1YQ3A 5HY5A 1FOHA 2GR2A 4Z24A 3AYLA 3D1IA 3UBRA 2R9ZA 3UTFA 3GYJA 3ALMA 3UTHA 2YLZA 2W0HA 1S3BA 2WDVA 3QSEA 5JCNA 2H88A 5GSNA 4ZCDA 2GB0A 2WOWA 4XXGA 2Z5XA 4K5RA 2E4GA 2OT4A 3PO7A 1E7PA 1NEKA 2OALA 3DK4A 4YWOA 2C3DA 4B69A 3CNDA 2NPXA 3ALLA 1IUUA 2GH5A 1E1NA 1Q9IA 2GR0A 5KWFA 3F29A 1D4DA 1DOEA 1FS9A 2YG4A 1NG3A 2WU2A 3BI5A 3M0OA 5FS8A 4YTPA 4YTNA 3AYIA 4K22A 1L9DA 4EIPA 3NH3X 4H50A 5HHFA 2VVLA 2GAHB 1GOSA 3TORA 4GRTA 4H2NA 1GETA 2XFUA 3FO3A 1REOA 3ICTA 3UKFA 3EANA 3DJDA 2JK6A 3NN6X 4WJYA 1ZOVA 2X8HA 1FT6A 1JNIA 3FBSA 3R9UA 2RGHA 1YQ4A 2YVFA 5L46A 3LXDA 3AE3A 1VG9A 1P2EA 5JCLA 1Y56A 2NVKX 2A87A 2BK4A 3UU9A 1XANA 1ZK7A 3ISHA 2YLRA 1M1RA 4DNAA 4CCRA 1VG0A 4A6NA 2C70A 3BI2A 3V76A 2BS3A 3PVCA 1GNDA 3LZXA 3UKAA 3NIXA 3CGCA 3AE2A 4AT0A 1DJNA 1FT5A 3AEDA 2BS2A 2GRTA 4RG3A 4XWZA 5M0ZA 3H8LA 3AE1A 3VRBA 3UP4A 1MXTA 3GDPA 4NEWA 2C3CA 3P4RA 2WETA 4ICYA 2OAMA 3UKQA 4IV9A 1N4UA 1XDIA 2BXRA 2Q7VA 3E1TA 4Z2TA 3AE6A 1JEHA 3GYIA 5EB5A 1LVLA 4U8OA 2X8GA 1FEBA 4A7AA 4BJZA 5BVAA 2EQ8A 2RF7A 1PXCA 3AB1A 2K3VA 3ICSA 3M12A 4H4PA 4X4JA 4U8JA 2ZZCA 1NENA 2OLNA 4D04A 2GV8A 1XHCA 2WOVA 3AYJA 3BHKA 4H2QA 4U2TA 1SEZA 1PHHA 2B9WA 1JNRA 2GQFA 4U8KA 1QDBA 1GRGA 3WE0A 4FX9A 2XVFA 1IUWA 4JY3A 1ONFA 3C4AA 4PAAA 4X9MA 2XLPA 3SGLA 2FJAA 3UOXA 1FEAA 2E80A 1L9EA 3NLCA 3VRAA 1Q1RA 1GRTA 2YR5A 3I6DA 1EL9A 2WEUA 2WQYA 3DJJA 2V60A 2X3NA 2YWLA 3VR9A 3CNTA 1B5QA 1CJCA 3FPZA 3NG7X 1QJDA 2X8CA 4C3YA 3G5RA 4EQXA 2I0ZA 1CHUA 4K5SA 1KSSA 2WPFA 1O95A 3QVRA 2R0CA 2XDOA 3H4KA 3CGEA 3CGBA 4GDEA 3IC9A 1TRBA 1X31B 3SXQA 2V3BA 3KPFA 4GUVA 3K30A 4TLXA 4J56A 2V3AA 4YXDA 4NEVA 2A89A 3AECA 4PABA 2B7SA 2DKHA 1QLBA 3EF6A 3P4PA 1B8SA 2JBVA 1VQWA 1S3EA 4IA6A 1H7WA 3NYCA 1PBEA 3UKHA 2ZZ0A 3BNUA 4YKFA 2ACZA 4Y4NA 1DOBA 2O9ZA 5ER0A 5HXIA 2TMDA 3M13A 4USQA 3UKPA 1OJDA 2WP6A 4X9NA 1BKWA 4B65A 1CC4A 4FK1A 3G5QA 3CN8A 4K7ZA 4H2PA 3LZWA 2C7GA 3UP5A 4YSYA 3P9UA 4APNA 2R46A 4Q5BA 1PBFA 4IVOB 4EQRA 4H4RA 2BC1A 4B63A 2FJBA 3CPJG 4JN9A 1EL7A 2VZ2A 4CRTA 3I3LA 1LV0A 3BNJA 1CC6A 3PS9A 2VRLA 4JQ9A 4MJWA 4U2SA 2LFCA 2GMHA 5FS6A 3P4SA 1JU2A 3T37A 1GEUA 3KKJA 1IJHA 1GALA 2VQBA 2BABA 2VVLG 5KOXA 2WBAA 3GM6A 3F8RA 1P2HA 4Z2RA 1JRXA 3AE4A 1IUTA 3CNPA 3GD3A 2QA2A 5EB4A 5IQ1A 3EPTA 4J36A 4GR1A 1B37A 1GPEA 3ABVA 3F8PA 4GF7A 5U63A 4HB9A 1M64A 4OPCA 1FS8A 2YG3A 3B6DA 4H4WA 4CY8A 1M6IA 3S5WA 2QAEA 2RDZA 4L3YA 3NK0X 2WDQA 1N1PA 1PS9A 1FECA 1RSGA 1ZOYA 4KPRA 4H4UA 1IUSA 2XLUA 3AD9B 2IVEA 1PJ6A 3CGDA 2VR0A 3KA7A 4N9XA 3GMCA 3DK8A 4EM4A 3L1TA 1CJ2A 1K0JA 2GVCA 2XFOA 3UKKA 1NHRA 2V61A 2JKCA 1Y0PA 4OPIA 4AT2A 2CDUA 4TM4A 1ZKQA 2YVGA 2XLRA 1CF3A 1PBCA 4RSLA 4OPDA 1N4VA 1RP0A 4HA6A 3AXBA 4IVMB 4O5QA 2C75A 4AOSA 4C74A 3URHA 4CCQA 2Q0KA 1H7XA 1KDGA 1ZMCA 3LADA 4Y4MA 2BYBA 4ZCCA 5IPYA 2CFYA 4J57A 1L9CA 1KNPA 1DXLA 3FG2P 1NPXA 4U8MA 3GYXA 2YLSA 1GV4A 1F6MA 4GDPA 4NTEA 1GSNA 3II4A 5TR3A 5JCIA 1CL0A 1BGNA 3LJPA 1VDCA 4TM3A 1PBDA 4JNAA 1KF6A 1DOCA 3K7TA 2E5VA 1H86A 2GMJA 2J3NA 3O0HA 4H4QA 4USRA 4YTMA 4EMJA 1TDKA 1NHPA 2JAEA 4UDPA 4Z26A 2BACA 2PYXA 2CULA 1CJ3A 4A5LA 3OZ2A 2PHHA 2WP9A 1LJ1A 2CVJA 4A79A 1OJTA 2GR3A 5DBJA 3AE7A 2BC0A 3NRNA 2YG5A 2EQ9A 3CNJA 4J2WA 4LU6A 4NTDA 1K0LA 3NYEA 1BF3A 3UOVA 1FL2A 1F3PA 1W4XA 3DJGX 4H4TA 4H4VA 2TPRA 3NTAA 3RP6A 3NK2X 1L0VA 3NN0X 1OJCA 4JY2A 1TDEA 2XVJA 1H82A 1E6EA 5FMHA 5JCMA 3AWIA 2APGA 3BNFA 3GRSA 4YSZA 5J60A 3VR8A 1JNZA 2V5ZA 1TDFA 4A99A 3KVEA 3C96A 2XCGA 1KNRA 2YVJA 4ADWA 3BNMA 1Y56B 2WS3A 1COYA 4EMIA 2R0PA 5U25A 2AR8A 5FS7A 2AQJA 3AEBA 5GRTA 4A6NB 1LTXR 2FJEA 4B1BA 3CPIG 2YLXA 4OPGA 4UDRA 4E0VA 1ZP0A 2XFQA 4YSXA 1JOAA 1K0IA 1TDNA 4LIIA 2JB3A 3V3OA 3ZDNA 1KSUA 1TDOA 3LGQA 2C66A 2RABA 4P9SA 3B3RA 2BCPA 1ZX9A 1NHSA 1D5TA 4ECHA 1O94A 4CY6A 1B4VA 2A8XA 2GEWA 2Y6QA 3GD4A 3ICRA 2B7RA 1JRYA 3CPHG 2GAGB 4IA5A 4EQSA 4Z2UA 2OLOA 1D4CA 2B9XA 1EBDA 4C5OA 3ADAB 3EAOA 3ZYXA 4EIQA 2BCGG 3FIMB 4J34A 1GRAA 1XPQA 5JCKA 4O5UA 3DK9A 3CIRA 3GRTA 4JDRA 1D7YA 4OCGA 1S2QA 1LPFA 1YKJA 1OAHA 1PN0A 3AE8A 3UOYA 4H4XA 2VQ7A 3IF9A 2C72A 2ARDA 4BJYA 1GESA 1PDHA 3Q6JA 4K8DA 1N4WA 2X50A 1GERA 4H4SA 3AEAA 4Q17A 1EL5A 4L3XA 1V59A 1NDAA 2RGJA 1CJ4A 4BK3A 3NNEA 1CC2A 4JNQA 1BZLA 3LB8A 2UZZA 4NZHA 4YSHA 3L8KA 3NTDA 1M1QA 4L38A 2VOUA 4Y4LA 3AD8B 3BI4A 2JB1A 2EQ6A 1E1KA 3KU9A 3UTGA 3BNHA 3ATQA 4BURA 3DMEA 3NKSA 4B67A 2C67A 3QSMA 4KX6A 5M10A 3HZLA 3RHAA 4CBQA 1GTEA 3DJEA 1NAAA 3AE9A 4Q1OA 4Q4UA 3GMBA 2WP5A 2R0GA 3IHMA 4NTCA 5KRQA 1PXBA 4TM1A 3NK1X 1GXFA 3AD7B 3S61A 4OPUA 2GF3A 2XLSA 4BV6A 3D8XA 3S7WA 1DODA 2JB2A 2R4JA 3GSIA 3GWFA 1HYUA 4Q0TA 4OPTA 5KOWA 1VRQB 2YQUA 3QSSA 2XLTA
chains in the Genus database with same CATH superfamily
4ZN0A 2IVDA 3OC4A 1JRZA 1H81A 1PJ5A 3SCEA 4B68A 1D4EA 4NWZA 4A65A 1OJ9A 1Q1WA 2VRMA 4TM0A 4TLZA 3SZFA 4U8LA 4GAVA 3LG1A 2R45A 1NHQA 3QFBA 2BA9A 1KFYA 2XVIA 1PJ7A 4H4YA 1TYTA 4LA1A 1F8SA 2XFNA 4B64A 3ATRA 3RP8A 2WU5A 4YT0A 5KVHA 1F8RA 4FK1C 4H7UA 2X99A 2FJDA 4H2RA 3T2KA 2C73A 2YG7A 2YM2A 2C64A 2C76A 3SFEA 1O5WA 4AP3A 4Z25A 4UP3A 1FS7A 3F8DA 2AAQA 1GRHA 4AP1A 3FMWA 3CTYA 3KD9A 3AEGA 2OA1A 1MOKA 2E81A 2BK3A 3VRDB 3NHOX 2BXSA 2ZO5A 1GRBA 3RP7A 1H84A 3DA1A 4RG4A 4D03A 4G73A 1K4QA 3K7MX 3REDA 1E1MA 4A9WA 4OVIA 4U8IA 3RKHA 5KVIA 3SY4A 4U2LA 4M52A 4GCMA 5LV9A 3NT6A 3K7QX 2EQ7A 1BVBA 3COXA 4C77A 4J33A 3Q9TA 4BK1A 1IUVA 2B9YA 2XVHA 3QVPA 1LQUA 4K2XA 5BUKA 5EBKA 3SZCA 5FS9A 2GQWA 2QCUA 1TYPA 5C3JA 1OJAA 3MMOA 4U8NA 3GWDA 1NG4A 2RGOA 2HQMA 1ZMDA 2WDRA 4YKGA 3NGCX 4I58A 1MO9A 3UCLA 2BK5A 3P1WA 5IQ4A 5KMPA 3QJ4A 1H6VA 4G6HA 3LOVA 2YLWA 3SM8A 4EMWA 3OWMA 1LQTA 2QA1A 2XFPA 3GDNA 2WPCA 1DJQA 2YLTA 3UOZA 3DH9A 2VVMA 5KXJA 3AEFA 1DNCA 1PXAA 3ALJA 3SFDA 4DSGA 2XYOA 5KMSA 1ZDLA 1IUXA 2WHDA 3IHGA 3SZ0A 4EM3A 2DKIA 2YM1A 2J7AA 2Z5YA 3L1RA 3AEEA 3ITJA 4AOXA 2YG6A 2FBWA 1YQZA 1M1PA 4B66A 3DGHA 4L3ZA 3VQRA 3JSKA 1E1LA 5BRTA 4UDQA 4J31A 1GTHA 3AE5A 1QO8A 2H89A 2WOIA 5CKUA 5EOWA 4Z44A 2Q6UA 2V6OA 2YAUA 4DSHA 4Z43A 5CQFA 4WX1A 5U1OA 1CBOA 1F8WA 1UKVG 2IIDA 2YR4A 3C4NA 3NYFA 1BWCA 4I59A 4OPLA 3V3NA 3SQPA 3RNMA 1E39A 1GREA 3CNSA 2F5ZA 3BHFA 2GR1A 2E1MA 2XVEA 2ZBWA 1FCDA 4H4ZA 1Z6LA 1BGJA 3H8IA 3QFAA 3BNGA 3P4QA 1PBBA 3G5SA 5HYMA 4U8PA 1AOGA 4CNKA 4WCTA 3UTEA 3IWAA 4C3XA 2C65A 1RYIA 1GRFA 2YR6A 1D7LA 4Q5CA 1GT8A 2BS4A 4XWRA 5J7XA 1GU6A 2ZZBA 2WPEA 5C2TA 4CNJA 1H83A 4EQWA 3TTBA 1SP3A 3KLJA 4BK2A 4DGKA 1ELIA 4REKA 2B76A 4FDCB 5BULA 1S2YA 1YY5A 2Y6RA 3D1CA 3DGZA 3UKLA 1ZY8A 4II2A 2R4EA 1EL8A 2Q0LA 2WESA 1YQ3A 3T2YA 5HY5A 1FOHA 2GR2A 4Z24A 3AYLA 3D1IA 3UBRA 2R9ZA 3UTFA 3GYJA 3ALMA 3UTHA 2YLZA 2W0HA 1S3BA 2WDVA 3QSEA 5JCNA 2H88A 5GSNA 3T0KA 4ZCDA 2GB0A 2WOWA 4XXGA 2Z5XA 4K5RA 2E4GA 2OT4A 3PO7A 1E7PA 1NEKA 2OALA 3DK4A 4YWOA 2C3DA 4B69A 3CNDA 2NPXA 3ALLA 1IUUA 2GH5A 1E1NA 1Q9IA 2CZSA 2GR0A 3F29A 5KWFA 1D4DA 1DOEA 1FS9A 2YG4A 1NG3A 2WU2A 3BI5A 3M0OA 4G9KA 5FS8A 4YTPA 4YTNA 3AYIA 4K22A 3T14A 1L9DA 4EIPA 3NH3X 4H50A 5HHFA 2VVLA 2GAHB 1GOSA 3TORA 4GRTA 4H2NA 4II3A 1GETA 2XFUA 3FO3A 1REOA 3ICTA 3UKFA 3EANA 3DJDA 2JK6A 3NN6X 4WJYA 1ZOVA 2X8HA 1FT6A 1JNIA 3FBSA 3R9UA 2RGHA 1YQ4A 2YVFA 5L46A 3CMMA 3LXDA 3AE3A 1VG9A 1P2EA 5JCLA 1Y56A 2NVKX 2A87A 2BK4A 3UU9A 1XANA 1ZK7A 3ISHA 2YLRA 1M1RA 4DNAA 4CCRA 1VG0A 3HYXA 4A6NA 2C70A 3BI2A 3V76A 2BS3A 3PVCA 1GNDA 3LZXA 3UKAA 3NIXA 3CGCA 3AE2A 4AT0A 1DJNA 1FT5A 3AEDA 2BS2A 2GRTA 4RG3A 4XWZA 5M0ZA 3H8LA 3AE1A 3VRBA 3UP4A 1MXTA 3GDPA 4NEWA 2C3CA 3P4RA 2WETA 4ICYA 2OAMA 3SXIA 3UKQA 4IV9A 1N4UA 1XDIA 2BXRA 2Q7VA 3E1TA 4Z2TA 3AE6A 1JEHA 3GYIA 5EB5A 1LVLA 4U8OA 2X8GA 1FEBA 3KPKA 4A7AA 4BJZA 5BVAA 2EQ8A 2RF7A 1PXCA 3AB1A 2K3VA 3ICSA 3M12A 4H4PA 4X4JA 4U8JA 4GAPA 2ZZCA 1NENA 2OLNA 4D04A 2GV8A 1XHCA 2WOVA 3AYJA 3BHKA 4H2QA 4U2TA 5KNLA 1SEZA 1PHHA 2B9WA 1JNRA 2GQFA 4U8KA 1QDBA 1GRGA 3WE0A 4FX9A 2XVFA 1IUWA 4JY3A 1ONFA 3C4AA 4PAAA 4X9MA 2XLPA 3SGLA 2FJAA 3SZWA 3UOXA 1FEAA 2E80A 1L9EA 3NLCA 3VRAA 1Q1RA 1GRTA 2YR5A 3I6DA 1EL9A 2WEUA 2WQYA 3DJJA 2V60A 2X3NA 2YWLA 3VR9A 3CNTA 1B5QA 1CJCA 3FPZA 3NG7X 1QJDA 2X8CA 4C3YA 3G5RA 4EQXA 2I0ZA 1CHUA 4K5SA 1KSSA 2WPFA 1O95A 3QVRA 2R0CA 2XDOA 3H4KA 3CGEA 3CGBA 4GDEA 3IC9A 1TRBA 1X31B 3SXQA 2V3BA 3HYVA 3KPFA 3K30A 4GUVA 4J56A 2V3AA 4TLXA 4YXDA 4NEVA 2A89A 3AECA 4PABA 2B7SA 2DKHA 1QLBA 3EF6A 3P4PA 1B8SA 2JBVA 1VQWA 1S3EA 4IA6A 1H7WA 3NYCA 1PBEA 3UKHA 2ZZ0A 3BNUA 4YKFA 2ACZA 4Y4NA 1DOBA 2O9ZA 5ER0A 5HXIA 2TMDA 3M13A 4USQA 3UKPA 1OJDA 2WP6A 4X9NA 1BKWA 4B65A 1CC4A 4FK1A 3G5QA 3CN8A 4K7ZA 4H2PA 3LZWA 2C7GA 3UP5A 4YSYA 3P9UA 4APNA 2R46A 4Q5BA 1PBFA 4IVOB 4EQRA 4H4RA 2BC1A 4B63A 2FJBA 3CPJG 4JN9A 1EL7A 2VZ2A 4CRTA 3I3LA 1LV0A 3BNJA 1CC6A 3PS9A 2VRLA 4JQ9A 4MJWA 4U2SA 2LFCA 2GMHA 5FS6A 3P4SA 1JU2A 3T37A 1GEUA 3KKJA 1IJHA 1GALA 2VQBA 2BABA 2VVLG 5KOXA 2WBAA 3GM6A 3F8RA 1P2HA 4Z2RA 1JRXA 3AE4A 1IUTA 3CNPA 3GD3A 2QA2A 5EB4A 5IQ1A 3EPTA 4J36A 4GR1A 1B37A 1GPEA 3ABVA 3F8PA 4GF7A 5U63A 4HB9A 1M64A 4OPCA 1FS8A 2YG3A 3B6DA 4H4WA 4CY8A 1M6IA 3S5WA 2QAEA 2RDZA 4L3YA 3NK0X 4NNJA 2WDQA 1N1PA 1PS9A 1FECA 1RSGA 1ZOYA 4KPRA 4H4UA 1IUSA 2XLUA 3AD9B 2IVEA 1PJ6A 3CGDA 2VR0A 4G6GA 3KA7A 4N9XA 3GMCA 3DK8A 4EM4A 3L1TA 1CJ2A 1K0JA 2GVCA 2XFOA 3UKKA 1NHRA 2V61A 2JKCA 1Y0PA 4OPIA 4AT2A 2CDUA 4TM4A 1ZKQA 2YVGA 2XLRA 5KMRA 1CF3A 1PBCA 4RSLA 4OPDA 1N4VA 1RP0A 4HA6A 3AXBA 4IVMB 4O5QA 2C75A 4AOSA 4C74A 3URHA 4CCQA 2Q0KA 1H7XA 1KDGA 1ZMCA 3LADA 4Y4MA 2BYBA 4ZCCA 5IPYA 2CFYA 4J57A 1L9CA 1KNPA 1DXLA 3FG2P 1NPXA 4U8MA 3GYXA 2YLSA 1GV4A 4G74A 1F6MA 4GDPA 4NTEA 1GSNA 3II4A 5TR3A 5JCIA 1CL0A 1BGNA 3SX6A 3LJPA 1VDCA 4TM3A 1PBDA 4JNAA 1KF6A 1DOCA 3K7TA 2E5VA 1H86A 2GMJA 2J3NA 3O0HA 4H4QA 4USRA 4YTMA 3T2ZA 4EMJA 1TDKA 1NHPA 2JAEA 4UDPA 4Z26A 3SYIA 2BACA 2PYXA 2CULA 1CJ3A 4A5LA 3OZ2A 2PHHA 2WP9A 1LJ1A 2CVJA 4A79A 1OJTA 2GR3A 5DBJA 3AE7A 2BC0A 3NRNA 2YG5A 2EQ9A 3CNJA 4J2WA 4LU6A 4NTDA 1K0LA 3NYEA 1BF3A 3UOVA 1FL2A 1F3PA 1W4XA 3DJGX 4H4TA 4H4VA 2TPRA 3NTAA 3RP6A 3NK2X 1L0VA 3NN0X 1OJCA 4JY2A 1TDEA 2XVJA 1H82A 1E6EA 5FMHA 5KMQA 5JCMA 3AWIA 2APGA 3BNFA 3GRSA 4YSZA 5J60A 3VR8A 1JNZA 2V5ZA 1TDFA 4A99A 3KVEA 3C96A 2XCGA 1KNRA 2YVJA 4ADWA 3BNMA 1Y56B 2WS3A 1COYA 4EMIA 2R0PA 5U25A 2AR8A 5FS7A 3T31A 2AQJA 3AEBA 5GRTA 4A6NB 1LTXR 2FJEA 4B1BA 3CPIG 2YLXA 4OPGA 4UDRA 4E0VA 1ZP0A 2C4CA 2XFQA 1JOAA 1K0IA 1TDNA 4YSXA 4LIIA 2JB3A 3V3OA 3ZDNA 1KSUA 1TDOA 3LGQA 2C66A 2RABA 4P9SA 3B3RA 2BCPA 1ZX9A 1NHSA 1D5TA 4ECHA 1O94A 4CY6A 1B4VA 2A8XA 2GEWA 2Y6QA 3GD4A 3ICRA 2B7RA 1JRYA 3CPHG 2GAGB 4IA5A 4EQSA 3HYWA 4Z2UA 2OLOA 1D4CA 2B9XA 1EBDA 4C5OA 3ADAB 3EAOA 3ZYXA 2BRYA 4EIQA 2BCGG 3FIMB 4J34A 1GRAA 1XPQA 5JCKA 4O5UA 3DK9A 3CIRA 3GRTA 4JDRA 1D7YA 4OCGA 1S2QA 1LPFA 1YKJA 1OAHA 1PN0A 3AE8A 3UOYA 4H4XA 2VQ7A 3IF9A 2C72A 2ARDA 4BJYA 1GESA 1PDHA 3Q6JA 4K8DA 1N4WA 2X50A 1GERA 4H4SA 3AEAA 4Q17A 1EL5A 4L3XA 1V59A 1NDAA 2RGJA 1CJ4A 4BK3A 3NNEA 1CC2A 4JNQA 1BZLA 3LB8A 2UZZA 4NZHA 4YSHA 3L8KA 3NTDA 1M1QA 4L38A 2VOUA 4Y4LA 3AD8B 3BI4A 2JB1A 2EQ6A 1E1KA 3KU9A 3UTGA 3BNHA 3ATQA 4BURA 3DMEA 3NKSA 4B67A 2C67A 3QSMA 4KX6A 5M10A 3HZLA 3RHAA 4CBQA 1GTEA 3DJEA 1NAAA 3AE9A 4Q1OA 4Q4UA 3GMBA 2WP5A 2R0GA 3IHMA 4NTCA 5KRQA 1PXBA 4TM1A 3NK1X 1GXFA 3AD7B 3S61A 4OPUA 2GF3A 2XLSA 4BV6A 3D8XA 3S7WA 1DODA 2JB2A 2R4JA 3GSIA 3GWFA 1HYUA 4Q0TA 2BRAA 4OPTA 5KOWA 1VRQB 2YQUA 3QSSA 2XLTA
chains in the Genus database with same CATH topology
4ZN0A 2IVDA 3OC4A 1JRZA 1H81A 1PJ5A 3SCEA 4B68A 1D4EA 4NWZA 4A65A 1OJ9A 1Q1WA 2VRMA 4TM0A 4TLZA 3SZFA 4U8LA 4GAVA 3LG1A 2R45A 1NHQA 3QFBA 2BA9A 1KFYA 2XVIA 1PJ7A 4H4YA 1TYTA 4LA1A 1F8SA 2XFNA 4B64A 3ATRA 3RP8A 2WU5A 4YT0A 5KVHA 1F8RA 4FK1C 4H7UA 2X99A 2FJDA 4H2RA 3T2KA 2C73A 2YG7A 2YM2A 2C64A 2C76A 3SFEA 1O5WA 4AP3A 4Z25A 4UP3A 1FS7A 3F8DA 2AAQA 1GRHA 4AP1A 3FMWA 3CTYA 3KD9A 3AEGA 2OA1A 1MOKA 2E81A 2BK3A 3VRDB 3NHOX 2BXSA 2ZO5A 1GRBA 3RP7A 1H84A 3DA1A 4RG4A 4D03A 4G73A 1K4QA 3K7MX 3REDA 1E1MA 4A9WA 4OVIA 4U8IA 3RKHA 5KVIA 3SY4A 4U2LA 4M52A 4GCMA 5LV9A 3NT6A 3K7QX 2EQ7A 1BVBA 3COXA 4C77A 4J33A 3Q9TA 4BK1A 1IUVA 2B9YA 2XVHA 3QVPA 1LQUA 4K2XA 5BUKA 5EBKA 3SZCA 5FS9A 2GQWA 2QCUA 1TYPA 5C3JA 1OJAA 3MMOA 4U8NA 3GWDA 1NG4A 2RGOA 2HQMA 1ZMDA 2WDRA 4YKGA 3NGCX 4I58A 1MO9A 3UCLA 2BK5A 3P1WA 5IQ4A 5KMPA 3QJ4A 1H6VA 4G6HA 3LOVA 2YLWA 3SM8A 4EMWA 3OWMA 1LQTA 2QA1A 2XFPA 3GDNA 2WPCA 1DJQA 2YLTA 3UOZA 3DH9A 2VVMA 5KXJA 3AEFA 1DNCA 1PXAA 3ALJA 3SFDA 4DSGA 2XYOA 5KMSA 1ZDLA 1IUXA 2WHDA 3IHGA 3SZ0A 4EM3A 2DKIA 2YM1A 2J7AA 2Z5YA 3L1RA 3AEEA 3ITJA 4AOXA 2YG6A 2FBWA 1YQZA 1M1PA 4B66A 3DGHA 4L3ZA 3VQRA 3JSKA 1E1LA 5BRTA 4UDQA 4J31A 1GTHA 3AE5A 1QO8A 2H89A 2WOIA 5CKUA 5EOWA 4Z44A 2Q6UA 2V6OA 2YAUA 4DSHA 4Z43A 5CQFA 4WX1A 5U1OA 1CBOA 1F8WA 1UKVG 2IIDA 2YR4A 3C4NA 3NYFA 1BWCA 4I59A 4OPLA 3V3NA 3SQPA 3RNMA 1E39A 1GREA 3CNSA 2F5ZA 3BHFA 2GR1A 2E1MA 2XVEA 2ZBWA 1FCDA 4H4ZA 1Z6LA 1BGJA 3H8IA 3QFAA 3BNGA 3P4QA 1PBBA 3G5SA 5HYMA 4U8PA 1AOGA 4CNKA 4WCTA 3UTEA 3IWAA 4C3XA 2C65A 1RYIA 1GRFA 2YR6A 1D7LA 4Q5CA 1GT8A 2BS4A 4XWRA 5J7XA 1GU6A 2ZZBA 2WPEA 5C2TA 4CNJA 1H83A 4EQWA 3TTBA 1SP3A 3KLJA 4BK2A 4DGKA 1ELIA 4REKA 2B76A 4FDCB 5BULA 1S2YA 1YY5A 2Y6RA 3D1CA 3DGZA 3UKLA 1ZY8A 4II2A 2R4EA 1EL8A 2Q0LA 2WESA 1YQ3A 3T2YA 5HY5A 1FOHA 2GR2A 4Z24A 3AYLA 3D1IA 3UBRA 2R9ZA 3UTFA 3GYJA 3ALMA 3UTHA 2YLZA 2W0HA 1S3BA 2WDVA 3QSEA 5JCNA 2H88A 5GSNA 3T0KA 4ZCDA 2GB0A 2WOWA 4XXGA 2Z5XA 4K5RA 2E4GA 2OT4A 3PO7A 1E7PA 1NEKA 2OALA 3DK4A 4YWOA 2C3DA 4B69A 3CNDA 2NPXA 3ALLA 1IUUA 2GH5A 1E1NA 1Q9IA 2GR0A 5KWFA 3F29A 1D4DA 1DOEA 1FS9A 2YG4A 1NG3A 2WU2A 3BI5A 3M0OA 4G9KA 5FS8A 4YTPA 4YTNA 3AYIA 4K22A 3T14A 1L9DA 4EIPA 3NH3X 4H50A 5HHFA 2VVLA 2GAHB 1GOSA 3TORA 4GRTA 4H2NA 4II3A 1GETA 2XFUA 3FO3A 1REOA 3ICTA 3UKFA 3EANA 3DJDA 2JK6A 3NN6X 4WJYA 1ZOVA 2X8HA 1FT6A 1JNIA 3FBSA 3R9UA 2RGHA 1YQ4A 2YVFA 5L46A 3CMMA 3LXDA 3AE3A 1VG9A 1P2EA 5JCLA 1Y56A 2NVKX 2A87A 2BK4A 3UU9A 1XANA 1ZK7A 3ISHA 2YLRA 1M1RA 4DNAA 4CCRA 1VG0A 3HYXA 4A6NA 2C70A 3BI2A 3V76A 2BS3A 3PVCA 1GNDA 3LZXA 3UKAA 3NIXA 3CGCA 3AE2A 4AT0A 1DJNA 1FT5A 3AEDA 2BS2A 2GRTA 4RG3A 4XWZA 5M0ZA 3H8LA 3AE1A 3VRBA 3UP4A 1MXTA 3GDPA 4NEWA 2C3CA 3P4RA 2WETA 4ICYA 2OAMA 3SXIA 3UKQA 4IV9A 1N4UA 1XDIA 2BXRA 2Q7VA 3E1TA 4Z2TA 3AE6A 1JEHA 3GYIA 5EB5A 1LVLA 4U8OA 2X8GA 1FEBA 3KPKA 4A7AA 4BJZA 5BVAA 2EQ8A 2RF7A 1PXCA 3AB1A 2K3VA 3ICSA 3M12A 4H4PA 4X4JA 4U8JA 4GAPA 2ZZCA 1NENA 2OLNA 4D04A 2GV8A 1XHCA 2WOVA 3AYJA 3BHKA 4H2QA 4U2TA 5KNLA 1SEZA 1PHHA 2B9WA 1JNRA 2GQFA 4U8KA 1QDBA 1GRGA 3WE0A 4FX9A 2XVFA 1IUWA 4JY3A 1ONFA 3C4AA 4PAAA 4X9MA 2XLPA 3SGLA 2FJAA 3SZWA 3UOXA 1FEAA 2E80A 1L9EA 3NLCA 3VRAA 1Q1RA 1GRTA 2YR5A 3I6DA 1EL9A 2WEUA 2WQYA 3DJJA 2V60A 2X3NA 2YWLA 3VR9A 3CNTA 1B5QA 1CJCA 3FPZA 3NG7X 1QJDA 2X8CA 4C3YA 3G5RA 4EQXA 2I0ZA 1CHUA 4K5SA 1KSSA 2WPFA 1O95A 3QVRA 2R0CA 2XDOA 3H4KA 3CGEA 3CGBA 4GDEA 3IC9A 1TRBA 1X31B 3SXQA 2V3BA 3HYVA 3KPFA 3K30A 4GUVA 4J56A 2V3AA 4TLXA 4YXDA 4NEVA 2A89A 3AECA 4PABA 2B7SA 2DKHA 1QLBA 3EF6A 3P4PA 1B8SA 2JBVA 1VQWA 1S3EA 4IA6A 1H7WA 3NYCA 1PBEA 3UKHA 2ZZ0A 3BNUA 4YKFA 2ACZA 4Y4NA 1DOBA 2O9ZA 5ER0A 5HXIA 2TMDA 3M13A 4USQA 3UKPA 1OJDA 2WP6A 4X9NA 1BKWA 4B65A 1CC4A 4FK1A 3G5QA 3CN8A 4K7ZA 4H2PA 3LZWA 2C7GA 3UP5A 4YSYA 3P9UA 4APNA 2R46A 4Q5BA 1PBFA 4IVOB 4EQRA 4H4RA 2BC1A 4B63A 2FJBA 3CPJG 4JN9A 1EL7A 2VZ2A 4CRTA 3I3LA 1LV0A 3BNJA 1CC6A 3PS9A 2VRLA 4JQ9A 4MJWA 4U2SA 2LFCA 2GMHA 5FS6A 3P4SA 1JU2A 3T37A 1GEUA 3KKJA 1IJHA 1GALA 2VQBA 2BABA 2VVLG 5KOXA 2WBAA 3GM6A 3F8RA 1P2HA 4Z2RA 1JRXA 3AE4A 1IUTA 3CNPA 3GD3A 2QA2A 5EB4A 5IQ1A 3EPTA 4J36A 4GR1A 1B37A 1GPEA 3ABVA 3F8PA 4GF7A 5U63A 4HB9A 1M64A 4OPCA 1FS8A 2YG3A 3B6DA 4H4WA 4CY8A 1M6IA 3S5WA 2QAEA 2RDZA 4L3YA 3NK0X 4NNJA 2WDQA 1N1PA 1PS9A 1FECA 1RSGA 1ZOYA 4KPRA 4H4UA 1IUSA 2XLUA 3AD9B 2IVEA 1PJ6A 3CGDA 2VR0A 4G6GA 3KA7A 4N9XA 3GMCA 3DK8A 4EM4A 3L1TA 1CJ2A 1K0JA 2GVCA 2XFOA 3UKKA 1NHRA 2V61A 2JKCA 1Y0PA 4OPIA 4AT2A 2CDUA 4TM4A 1ZKQA 2YVGA 2XLRA 5KMRA 1CF3A 1PBCA 4RSLA 4OPDA 1N4VA 1RP0A 4HA6A 3AXBA 4IVMB 4O5QA 2C75A 4AOSA 4C74A 3URHA 4CCQA 2Q0KA 1H7XA 1KDGA 1ZMCA 3LADA 4Y4MA 2BYBA 4ZCCA 5IPYA 2CFYA 4J57A 1L9CA 1KNPA 1DXLA 3FG2P 1NPXA 4U8MA 3GYXA 2YLSA 1GV4A 4G74A 1F6MA 4GDPA 4NTEA 1GSNA 3II4A 5TR3A 5JCIA 1CL0A 1BGNA 3SX6A 3LJPA 1VDCA 4TM3A 1PBDA 4JNAA 1KF6A 1DOCA 3K7TA 2E5VA 1H86A 2GMJA 2J3NA 3O0HA 4H4QA 4USRA 4YTMA 3T2ZA 4EMJA 1TDKA 1NHPA 2JAEA 4UDPA 4Z26A 3SYIA 2BACA 2PYXA 2CULA 1CJ3A 4A5LA 3OZ2A 2PHHA 2WP9A 1LJ1A 2CVJA 4A79A 1OJTA 2GR3A 5DBJA 3AE7A 2BC0A 3NRNA 2YG5A 2EQ9A 3CNJA 4J2WA 4LU6A 4NTDA 1K0LA 3NYEA 1BF3A 3UOVA 1FL2A 1F3PA 1W4XA 3DJGX 4H4TA 4H4VA 2TPRA 3NTAA 3RP6A 3NK2X 1L0VA 3NN0X 1OJCA 4JY2A 1TDEA 2XVJA 1H82A 1E6EA 5FMHA 5KMQA 5JCMA 3AWIA 2APGA 3BNFA 3GRSA 4YSZA 5J60A 3VR8A 1JNZA 2V5ZA 1TDFA 4A99A 3KVEA 3C96A 2XCGA 1KNRA 2YVJA 4ADWA 3BNMA 1Y56B 2WS3A 1COYA 4EMIA 2R0PA 5U25A 2AR8A 5FS7A 3T31A 2AQJA 3AEBA 5GRTA 4A6NB 1LTXR 2FJEA 4B1BA 3CPIG 2YLXA 4OPGA 4UDRA 4E0VA 1ZP0A 2C4CA 2XFQA 1JOAA 1K0IA 1TDNA 4YSXA 4LIIA 2JB3A 3V3OA 3ZDNA 1KSUA 1TDOA 3LGQA 2C66A 2RABA 4P9SA 3B3RA 2BCPA 1ZX9A 1NHSA 1D5TA 4ECHA 1O94A 4CY6A 1B4VA 2A8XA 2GEWA 2Y6QA 3GD4A 3ICRA 2B7RA 1JRYA 3CPHG 2GAGB 4IA5A 4EQSA 3HYWA 4Z2UA 2OLOA 1D4CA 2B9XA 1EBDA 4C5OA 3ADAB 3EAOA 3ZYXA 2BRYA 4EIQA 2BCGG 3FIMB 4J34A 1GRAA 1XPQA 5JCKA 4O5UA 3DK9A 3CIRA 3GRTA 4JDRA 1D7YA 4OCGA 1S2QA 1LPFA 1YKJA 1OAHA 1PN0A 3AE8A 3UOYA 4H4XA 2VQ7A 3IF9A 2C72A 2ARDA 4BJYA 1GESA 1PDHA 3Q6JA 4K8DA 1N4WA 2X50A 1GERA 4H4SA 3AEAA 4Q17A 1EL5A 4L3XA 1V59A 1NDAA 2RGJA 1CJ4A 4BK3A 3NNEA 1CC2A 4JNQA 1BZLA 3LB8A 2UZZA 4NZHA 4YSHA 3L8KA 3NTDA 1M1QA 4L38A 2VOUA 4Y4LA 3AD8B 3BI4A 2JB1A 2EQ6A 1E1KA 3KU9A 3UTGA 3BNHA 3ATQA 4BURA 3DMEA 3NKSA 4B67A 2C67A 3QSMA 4KX6A 5M10A 3HZLA 3RHAA 4CBQA 1GTEA 3DJEA 1NAAA 3AE9A 4Q1OA 4Q4UA 3GMBA 2WP5A 2R0GA 3IHMA 4NTCA 5KRQA 1PXBA 4TM1A 3NK1X 1GXFA 3AD7B 3S61A 4OPUA 2GF3A 2XLSA 4BV6A 3D8XA 3S7WA 1DODA 2JB2A 2R4JA 3GSIA 3GWFA 1HYUA 4Q0TA 2BRAA 4OPTA 5KOWA 1VRQB 2YQUA 3QSSA 2XLTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZN0 A;  2IVD A;  3OC4 A;  1JRZ A;  1H81 A;  1PJ5 A;  3SCE A;  4B68 A;  1D4E A;  4A65 A;  1OJ9 A;  1Q1W A;  2VRM A;  4TM0 A;  4TLZ A;  4U8L A;  3LG1 A;  2R45 A;  1NHQ A;  3QFB A;  2BA9 A;  1KFY A;  2XVI A;  1PJ7 A;  4H4Y A;  1TYT A;  4LA1 A;  1F8S A;  2XFN A;  4B64 A;  3ATR A;  3RP8 A;  2WU5 A;  4YT0 A;  5KVH A;  1F8R A;  4FK1 C;  4H7U A;  2X99 A;  2FJD A;  4H2R A;  2C73 A;  2YG7 A;  2YM2 A;  2C64 A;  2C76 A;  3SFE A;  1O5W A;  4AP3 A;  4Z25 A;  4UP3 A;  1FS7 A;  3F8D A;  2AAQ A;  1GRH A;  4AP1 A;  3FMW A;  3CTY A;  3KD9 A;  3AEG A;  2OA1 A;  1MOK A;  2E81 A;  2BK3 A;  3VRD B;  3NHO X;  2BXS A;  2ZO5 A;  1GRB A;  3RP7 A;  1H84 A;  3DA1 A;  4RG4 A;  4D03 A;  1K4Q A;  3K7M X;  3RED A;  1E1M A;  4A9W A;  4OVI A;  4U8I A;  3RKH A;  5KVI A;  4U2L A;  4M52 A;  4GCM A;  5LV9 A;  3NT6 A;  3K7Q X;  2EQ7 A;  1BVB A;  3COX A;  4C77 A;  4J33 A;  3Q9T A;  4BK1 A;  1IUV A;  2B9Y A;  2XVH A;  3QVP A;  1LQU A;  4K2X A;  5BUK A;  5EBK A;  5FS9 A;  2GQW A;  2QCU A;  1TYP A;  5C3J A;  1OJA A;  3MMO A;  4U8N A;  3GWD A;  1NG4 A;  2RGO A;  2HQM A;  1ZMD A;  2WDR A;  4YKG A;  3NGC X;  4I58 A;  1MO9 A;  3UCL A;  2BK5 A;  3P1W A;  5IQ4 A;  3QJ4 A;  1H6V A;  3LOV A;  2YLW A;  3SM8 A;  4EMW A;  3OWM A;  1LQT A;  2QA1 A;  2XFP A;  3GDN A;  2WPC A;  1DJQ A;  2YLT A;  3UOZ A;  3DH9 A;  2VVM A;  5KXJ A;  3AEF A;  1DNC A;  1PXA A;  3ALJ A;  3SFD A;  4DSG A;  2XYO A;  1ZDL A;  1IUX A;  2WHD A;  3IHG A;  4EM3 A;  2DKI A;  2YM1 A;  2J7A A;  2Z5Y A;  3L1R A;  3AEE A;  3ITJ A;  4AOX A;  2YG6 A;  2FBW A;  1YQZ A;  1M1P A;  4B66 A;  3DGH A;  4L3Z A;  3VQR A;  3JSK A;  1E1L A;  5BRT A;  4UDQ A;  4J31 A;  1GTH A;  3AE5 A;  1QO8 A;  2H89 A;  2WOI A;  5CKU A;  5EOW A;  4Z44 A;  2Q6U A;  2V6O A;  2YAU A;  4DSH A;  4Z43 A;  5CQF A;  4WX1 A;  5U1O A;  1CBO A;  1F8W A;  1UKV G;  2IID A;  2YR4 A;  3C4N A;  3NYF A;  1BWC A;  4I59 A;  4OPL A;  3V3N A;  3SQP A;  3RNM A;  1E39 A;  1GRE A;  3CNS A;  2F5Z A;  3BHF A;  2GR1 A;  2E1M A;  2XVE A;  2ZBW A;  1FCD A;  4H4Z A;  1Z6L A;  1BGJ A;  3H8I A;  3QFA A;  3BNG A;  3P4Q A;  1PBB A;  3G5S A;  5HYM A;  4U8P A;  1AOG A;  4CNK A;  4WCT A;  3UTE A;  3IWA A;  4C3X A;  2C65 A;  1RYI A;  1GRF A;  2YR6 A;  1D7L A;  4Q5C A;  1GT8 A;  2BS4 A;  4XWR A;  5J7X A;  1GU6 A;  2ZZB A;  2WPE A;  5C2T A;  4CNJ A;  1H83 A;  4EQW A;  3TTB A;  1SP3 A;  3KLJ A;  4BK2 A;  4DGK A;  1ELI A;  4REK A;  2B76 A;  4FDC B;  5BUL A;  1S2Y A;  1YY5 A;  2Y6R A;  3D1C A;  3DGZ A;  3UKL A;  1ZY8 A;  2R4E A;  1EL8 A;  2Q0L A;  2WES A;  1YQ3 A;  5HY5 A;  1FOH A;  2GR2 A;  4Z24 A;  3AYL A;  3D1I A;  3UBR A;  2R9Z A;  3UTF A;  3GYJ A;  3ALM A;  3UTH A;  2YLZ A;  2W0H A;  1S3B A;  2WDV A;  3QSE A;  5JCN A;  2H88 A;  5GSN A;  4ZCD A;  2GB0 A;  2WOW A;  4XXG A;  2Z5X A;  4K5R A;  2E4G A;  2OT4 A;  3PO7 A;  1E7P A;  1NEK A;  2OAL A;  3DK4 A;  4YWO A;  2C3D A;  4B69 A;  3CND A;  2NPX A;  3ALL A;  1IUU A;  2GH5 A;  1E1N A;  1Q9I A;  2GR0 A;  5KWF A;  3F29 A;  1D4D A;  1DOE A;  1FS9 A;  2YG4 A;  1NG3 A;  2WU2 A;  3BI5 A;  3M0O A;  5FS8 A;  4YTP A;  4YTN A;  3AYI A;  4K22 A;  1L9D A;  4EIP A;  3NH3 X;  4H50 A;  5HHF A;  2VVL A;  2GAH B;  1GOS A;  3TOR A;  4GRT A;  4H2N A;  1GET A;  2XFU A;  3FO3 A;  1REO A;  3ICT A;  3UKF A;  3EAN A;  3DJD A;  2JK6 A;  3NN6 X;  4WJY A;  1ZOV A;  2X8H A;  1FT6 A;  1JNI A;  3FBS A;  3R9U A;  2RGH A;  1YQ4 A;  2YVF A;  5L46 A;  3LXD A;  3AE3 A;  1VG9 A;  1P2E A;  5JCL A;  1Y56 A;  2NVK X;  2A87 A;  2BK4 A;  3UU9 A;  1XAN A;  1ZK7 A;  3ISH A;  2YLR A;  1M1R A;  4DNA A;  4CCR A;  1VG0 A;  4A6N A;  2C70 A;  3BI2 A;  3V76 A;  2BS3 A;  3PVC A;  1GND A;  3LZX A;  3UKA A;  3NIX A;  3CGC A;  3AE2 A;  4AT0 A;  1DJN A;  1FT5 A;  3AED A;  2BS2 A;  2GRT A;  4RG3 A;  4XWZ A;  5M0Z A;  3H8L A;  3AE1 A;  3VRB A;  3UP4 A;  1MXT A;  3GDP A;  4NEW A;  2C3C A;  3P4R A;  2WET A;  4ICY A;  2OAM A;  3UKQ A;  4IV9 A;  1N4U A;  1XDI A;  2BXR A;  2Q7V A;  3E1T A;  4Z2T A;  3AE6 A;  1JEH A;  3GYI A;  5EB5 A;  1LVL A;  4U8O A;  2X8G A;  1FEB A;  4A7A A;  4BJZ A;  5BVA A;  2EQ8 A;  2RF7 A;  1PXC A;  3AB1 A;  2K3V A;  3ICS A;  3M12 A;  4H4P A;  4X4J A;  4U8J A;  2ZZC A;  1NEN A;  2OLN A;  4D04 A;  2GV8 A;  1XHC A;  2WOV A;  3AYJ A;  3BHK A;  4H2Q A;  4U2T A;  1SEZ A;  1PHH A;  2B9W A;  1JNR A;  2GQF A;  4U8K A;  1QDB A;  1GRG A;  3WE0 A;  4FX9 A;  2XVF A;  1IUW A;  4JY3 A;  1ONF A;  3C4A A;  4PAA A;  4X9M A;  2XLP A;  3SGL A;  2FJA A;  3UOX A;  1FEA A;  2E80 A;  1L9E A;  3NLC A;  3VRA A;  1Q1R A;  1GRT A;  2YR5 A;  3I6D A;  1EL9 A;  2WEU A;  2WQY A;  3DJJ A;  2V60 A;  2X3N A;  2YWL A;  3VR9 A;  3CNT A;  1B5Q A;  1CJC A;  3FPZ A;  3NG7 X;  1QJD A;  2X8C A;  4C3Y A;  3G5R A;  4EQX A;  2I0Z A;  1CHU A;  4K5S A;  1KSS A;  2WPF A;  1O95 A;  3QVR A;  2R0C A;  2XDO A;  3H4K A;  3CGE A;  3CGB A;  4GDE A;  3IC9 A;  1TRB A;  1X31 B;  3SXQ A;  2V3B A;  3KPF A;  4GUV A;  3K30 A;  4TLX A;  4J56 A;  2V3A A;  4YXD A;  4NEV A;  2A89 A;  3AEC A;  4PAB A;  2B7S A;  2DKH A;  1QLB A;  3EF6 A;  3P4P A;  1B8S A;  2JBV A;  1VQW A;  1S3E A;  4IA6 A;  1H7W A;  3NYC A;  1PBE A;  3UKH A;  2ZZ0 A;  3BNU A;  4YKF A;  2ACZ A;  4Y4N A;  1DOB A;  2O9Z A;  5ER0 A;  5HXI A;  2TMD A;  3M13 A;  4USQ A;  3UKP A;  1OJD A;  2WP6 A;  4X9N A;  1BKW A;  4B65 A;  1CC4 A;  4FK1 A;  3G5Q A;  3CN8 A;  4K7Z A;  4H2P A;  3LZW A;  2C7G A;  3UP5 A;  4YSY A;  3P9U A;  4APN A;  2R46 A;  4Q5B A;  1PBF A;  4IVO B;  4EQR A;  4H4R A;  2BC1 A;  4B63 A;  2FJB A;  3CPJ G;  4JN9 A;  1EL7 A;  2VZ2 A;  4CRT A;  3I3L A;  1LV0 A;  3BNJ A;  1CC6 A;  3PS9 A;  2VRL A;  4JQ9 A;  4MJW A;  4U2S A;  2LFC A;  2GMH A;  5FS6 A;  3P4S A;  1JU2 A;  3T37 A;  1GEU A;  3KKJ A;  1IJH A;  1GAL A;  2VQB A;  2BAB A;  2VVL G;  5KOX A;  2WBA A;  3GM6 A;  3F8R A;  1P2H A;  4Z2R A;  1JRX A;  3AE4 A;  1IUT A;  3CNP A;  3GD3 A;  2QA2 A;  5EB4 A;  5IQ1 A;  3EPT A;  4J36 A;  4GR1 A;  1B37 A;  1GPE A;  3ABV A;  3F8P A;  4GF7 A;  5U63 A;  4HB9 A;  1M64 A;  4OPC A;  1FS8 A;  2YG3 A;  3B6D A;  4H4W A;  4CY8 A;  1M6I A;  3S5W A;  2QAE A;  2RDZ A;  4L3Y A;  3NK0 X;  2WDQ A;  1N1P A;  1PS9 A;  1FEC A;  1RSG A;  1ZOY A;  4KPR A;  4H4U A;  1IUS A;  2XLU A;  3AD9 B;  2IVE A;  1PJ6 A;  3CGD A;  2VR0 A;  3KA7 A;  4N9X A;  3GMC A;  3DK8 A;  4EM4 A;  3L1T A;  1CJ2 A;  1K0J A;  2GVC A;  2XFO A;  3UKK A;  1NHR A;  2V61 A;  2JKC A;  1Y0P A;  4OPI A;  4AT2 A;  2CDU A;  4TM4 A;  1ZKQ A;  2YVG A;  2XLR A;  1CF3 A;  1PBC A;  4RSL A;  4OPD A;  1N4V A;  1RP0 A;  4HA6 A;  3AXB A;  4IVM B;  4O5Q A;  2C75 A;  4AOS A;  4C74 A;  3URH A;  4CCQ A;  2Q0K A;  1H7X A;  1KDG A;  1ZMC A;  3LAD A;  4Y4M A;  2BYB A;  4ZCC A;  5IPY A;  2CFY A;  4J57 A;  1L9C A;  1KNP A;  1DXL A;  3FG2 P;  1NPX A;  4U8M A;  3GYX A;  2YLS A;  1GV4 A;  1F6M A;  4GDP A;  4NTE A;  1GSN A;  3II4 A;  5TR3 A;  5JCI A;  1CL0 A;  1BGN A;  3LJP A;  1VDC A;  4TM3 A;  1PBD A;  4JNA A;  1KF6 A;  1DOC A;  3K7T A;  2E5V A;  1H86 A;  2GMJ A;  2J3N A;  3O0H A;  4H4Q A;  4USR A;  4YTM A;  4EMJ A;  1TDK A;  1NHP A;  2JAE A;  4UDP A;  4Z26 A;  2BAC A;  2PYX A;  2CUL A;  1CJ3 A;  4A5L A;  3OZ2 A;  2PHH A;  2WP9 A;  1LJ1 A;  2CVJ A;  4A79 A;  1OJT A;  2GR3 A;  5DBJ A;  3AE7 A;  2BC0 A;  3NRN A;  2YG5 A;  2EQ9 A;  3CNJ A;  4J2W A;  4LU6 A;  4NTD A;  1K0L A;  3NYE A;  1BF3 A;  3UOV A;  1FL2 A;  1F3P A;  1W4X A;  3DJG X;  4H4T A;  4H4V A;  2TPR A;  3NTA A;  3RP6 A;  3NK2 X;  1L0V A;  3NN0 X;  1OJC A;  4JY2 A;  1TDE A;  2XVJ A;  1H82 A;  1E6E A;  5FMH A;  5JCM A;  3AWI A;  2APG A;  3BNF A;  3GRS A;  4YSZ A;  5J60 A;  3VR8 A;  1JNZ A;  2V5Z A;  1TDF A;  4A99 A;  3KVE A;  3C96 A;  2XCG A;  1KNR A;  2YVJ A;  4ADW A;  3BNM A;  1Y56 B;  2WS3 A;  1COY A;  4EMI A;  2R0P A;  5U25 A;  2AR8 A;  5FS7 A;  2AQJ A;  3AEB A;  5GRT A;  4A6N B;  1LTX R;  2FJE A;  4B1B A;  3CPI G;  2YLX A;  4OPG A;  4UDR A;  4E0V A;  1ZP0 A;  2XFQ A;  4YSX A;  1JOA A;  1K0I A;  1TDN A;  4LII A;  2JB3 A;  3V3O A;  3ZDN A;  1KSU A;  1TDO A;  3LGQ A;  2C66 A;  2RAB A;  4P9S A;  3B3R A;  2BCP A;  1ZX9 A;  1NHS A;  1D5T A;  4ECH A;  1O94 A;  4CY6 A;  1B4V A;  2A8X A;  2GEW A;  2Y6Q A;  3GD4 A;  3ICR A;  2B7R A;  1JRY A;  3CPH G;  2GAG B;  4IA5 A;  4EQS A;  4Z2U A;  2OLO A;  1D4C A;  2B9X A;  1EBD A;  4C5O A;  3ADA B;  3EAO A;  3ZYX A;  4EIQ A;  2BCG G;  3FIM B;  4J34 A;  1GRA A;  1XPQ A;  5JCK A;  4O5U A;  3DK9 A;  3CIR A;  3GRT A;  4JDR A;  1D7Y A;  4OCG A;  1S2Q A;  1LPF A;  1YKJ A;  1OAH A;  1PN0 A;  3AE8 A;  3UOY A;  4H4X A;  2VQ7 A;  3IF9 A;  2C72 A;  2ARD A;  4BJY A;  1GES A;  1PDH A;  3Q6J A;  4K8D A;  1N4W A;  2X50 A;  1GER A;  4H4S A;  3AEA A;  4Q17 A;  1EL5 A;  4L3X A;  1V59 A;  1NDA A;  2RGJ A;  1CJ4 A;  4BK3 A;  3NNE A;  1CC2 A;  4JNQ A;  1BZL A;  3LB8 A;  2UZZ A;  4NZH A;  4YSH A;  3L8K A;  3NTD A;  1M1Q A;  4L38 A;  2VOU A;  4Y4L A;  3AD8 B;  3BI4 A;  2JB1 A;  2EQ6 A;  1E1K A;  3KU9 A;  3UTG A;  3BNH A;  3ATQ A;  4BUR A;  3DME A;  3NKS A;  4B67 A;  2C67 A;  3QSM A;  4KX6 A;  5M10 A;  3HZL A;  3RHA A;  4CBQ A;  1GTE A;  3DJE A;  1NAA A;  3AE9 A;  4Q1O A;  4Q4U A;  3GMB A;  2WP5 A;  2R0G A;  3IHM A;  4NTC A;  5KRQ A;  1PXB A;  4TM1 A;  3NK1 X;  1GXF A;  3AD7 B;  3S61 A;  4OPU A;  2GF3 A;  2XLS A;  4BV6 A;  3D8X A;  3S7W A;  1DOD A;  2JB2 A;  2R4J A;  3GSI A;  3GWF A;  1HYU A;  4Q0T A;  4OPT A;  5KOW A;  1VRQ B;  2YQU A;  3QSS A;  2XLT A; 
#chains in the Genus database with same CATH topology
 4ZN0 A;  2IVD A;  3OC4 A;  1JRZ A;  1H81 A;  1PJ5 A;  3SCE A;  4B68 A;  1D4E A;  4NWZ A;  4A65 A;  1OJ9 A;  1Q1W A;  2VRM A;  4TM0 A;  4TLZ A;  3SZF A;  4U8L A;  4GAV A;  3LG1 A;  2R45 A;  1NHQ A;  3QFB A;  2BA9 A;  1KFY A;  2XVI A;  1PJ7 A;  4H4Y A;  1TYT A;  4LA1 A;  1F8S A;  2XFN A;  4B64 A;  3ATR A;  3RP8 A;  2WU5 A;  4YT0 A;  5KVH A;  1F8R A;  4FK1 C;  4H7U A;  2X99 A;  2FJD A;  4H2R A;  3T2K A;  2C73 A;  2YG7 A;  2YM2 A;  2C64 A;  2C76 A;  3SFE A;  1O5W A;  4AP3 A;  4Z25 A;  4UP3 A;  1FS7 A;  3F8D A;  2AAQ A;  1GRH A;  4AP1 A;  3FMW A;  3CTY A;  3KD9 A;  3AEG A;  2OA1 A;  1MOK A;  2E81 A;  2BK3 A;  3VRD B;  3NHO X;  2BXS A;  2ZO5 A;  1GRB A;  3RP7 A;  1H84 A;  3DA1 A;  4RG4 A;  4D03 A;  4G73 A;  1K4Q A;  3K7M X;  3RED A;  1E1M A;  4A9W A;  4OVI A;  4U8I A;  3RKH A;  5KVI A;  3SY4 A;  4U2L A;  4M52 A;  4GCM A;  5LV9 A;  3NT6 A;  3K7Q X;  2EQ7 A;  1BVB A;  3COX A;  4C77 A;  4J33 A;  3Q9T A;  4BK1 A;  1IUV A;  2B9Y A;  2XVH A;  3QVP A;  1LQU A;  4K2X A;  5BUK A;  5EBK A;  3SZC A;  5FS9 A;  2GQW A;  2QCU A;  1TYP A;  5C3J A;  1OJA A;  3MMO A;  4U8N A;  3GWD A;  1NG4 A;  2RGO A;  2HQM A;  1ZMD A;  2WDR A;  4YKG A;  3NGC X;  4I58 A;  1MO9 A;  3UCL A;  2BK5 A;  3P1W A;  5IQ4 A;  5KMP A;  3QJ4 A;  1H6V A;  4G6H A;  3LOV A;  2YLW A;  3SM8 A;  4EMW A;  3OWM A;  1LQT A;  2QA1 A;  2XFP A;  3GDN A;  2WPC A;  1DJQ A;  2YLT A;  3UOZ A;  3DH9 A;  2VVM A;  5KXJ A;  3AEF A;  1DNC A;  1PXA A;  3ALJ A;  3SFD A;  4DSG A;  2XYO A;  5KMS A;  1ZDL A;  1IUX A;  2WHD A;  3IHG A;  3SZ0 A;  4EM3 A;  2DKI A;  2YM1 A;  2J7A A;  2Z5Y A;  3L1R A;  3AEE A;  3ITJ A;  4AOX A;  2YG6 A;  2FBW A;  1YQZ A;  1M1P A;  4B66 A;  3DGH A;  4L3Z A;  3VQR A;  3JSK A;  1E1L A;  5BRT A;  4UDQ A;  4J31 A;  1GTH A;  3AE5 A;  1QO8 A;  2H89 A;  2WOI A;  5CKU A;  5EOW A;  4Z44 A;  2Q6U A;  2V6O A;  2YAU A;  4DSH A;  4Z43 A;  5CQF A;  4WX1 A;  5U1O A;  1CBO A;  1F8W A;  1UKV G;  2IID A;  2YR4 A;  3C4N A;  3NYF A;  1BWC A;  4I59 A;  4OPL A;  3V3N A;  3SQP A;  3RNM A;  1E39 A;  1GRE A;  3CNS A;  2F5Z A;  3BHF A;  2GR1 A;  2E1M A;  2XVE A;  2ZBW A;  1FCD A;  4H4Z A;  1Z6L A;  1BGJ A;  3H8I A;  3QFA A;  3BNG A;  3P4Q A;  1PBB A;  3G5S A;  5HYM A;  4U8P A;  1AOG A;  4CNK A;  4WCT A;  3UTE A;  3IWA A;  4C3X A;  2C65 A;  1RYI A;  1GRF A;  2YR6 A;  1D7L A;  4Q5C A;  1GT8 A;  2BS4 A;  4XWR A;  5J7X A;  1GU6 A;  2ZZB A;  2WPE A;  5C2T A;  4CNJ A;  1H83 A;  4EQW A;  3TTB A;  1SP3 A;  3KLJ A;  4BK2 A;  4DGK A;  1ELI A;  4REK A;  2B76 A;  4FDC B;  5BUL A;  1S2Y A;  1YY5 A;  2Y6R A;  3D1C A;  3DGZ A;  3UKL A;  1ZY8 A;  4II2 A;  2R4E A;  1EL8 A;  2Q0L A;  2WES A;  1YQ3 A;  3T2Y A;  5HY5 A;  1FOH A;  2GR2 A;  4Z24 A;  3AYL A;  3D1I A;  3UBR A;  2R9Z A;  3UTF A;  3GYJ A;  3ALM A;  3UTH A;  2YLZ A;  2W0H A;  1S3B A;  2WDV A;  3QSE A;  5JCN A;  2H88 A;  5GSN A;  3T0K A;  4ZCD A;  2GB0 A;  2WOW A;  4XXG A;  2Z5X A;  4K5R A;  2E4G A;  2OT4 A;  3PO7 A;  1E7P A;  1NEK A;  2OAL A;  3DK4 A;  4YWO A;  2C3D A;  4B69 A;  3CND A;  2NPX A;  3ALL A;  1IUU A;  2GH5 A;  1E1N A;  1Q9I A;  2CZS A;  2GR0 A;  3F29 A;  5KWF A;  1D4D A;  1DOE A;  1FS9 A;  2YG4 A;  1NG3 A;  2WU2 A;  3BI5 A;  3M0O A;  4G9K A;  5FS8 A;  4YTP A;  4YTN A;  3AYI A;  4K22 A;  3T14 A;  1L9D A;  4EIP A;  3NH3 X;  4H50 A;  5HHF A;  2VVL A;  2GAH B;  1GOS A;  3TOR A;  4GRT A;  4H2N A;  4II3 A;  1GET A;  2XFU A;  3FO3 A;  1REO A;  3ICT A;  3UKF A;  3EAN A;  3DJD A;  2JK6 A;  3NN6 X;  4WJY A;  1ZOV A;  2X8H A;  1FT6 A;  1JNI A;  3FBS A;  3R9U A;  2RGH A;  1YQ4 A;  2YVF A;  5L46 A;  3CMM A;  3LXD A;  3AE3 A;  1VG9 A;  1P2E A;  5JCL A;  1Y56 A;  2NVK X;  2A87 A;  2BK4 A;  3UU9 A;  1XAN A;  1ZK7 A;  3ISH A;  2YLR A;  1M1R A;  4DNA A;  4CCR A;  1VG0 A;  3HYX A;  4A6N A;  2C70 A;  3BI2 A;  3V76 A;  2BS3 A;  3PVC A;  1GND A;  3LZX A;  3UKA A;  3NIX A;  3CGC A;  3AE2 A;  4AT0 A;  1DJN A;  1FT5 A;  3AED A;  2BS2 A;  2GRT A;  4RG3 A;  4XWZ A;  5M0Z A;  3H8L A;  3AE1 A;  3VRB A;  3UP4 A;  1MXT A;  3GDP A;  4NEW A;  2C3C A;  3P4R A;  2WET A;  4ICY A;  2OAM A;  3SXI A;  3UKQ A;  4IV9 A;  1N4U A;  1XDI A;  2BXR A;  2Q7V A;  3E1T A;  4Z2T A;  3AE6 A;  1JEH A;  3GYI A;  5EB5 A;  1LVL A;  4U8O A;  2X8G A;  1FEB A;  3KPK A;  4A7A A;  4BJZ A;  5BVA A;  2EQ8 A;  2RF7 A;  1PXC A;  3AB1 A;  2K3V A;  3ICS A;  3M12 A;  4H4P A;  4X4J A;  4U8J A;  4GAP A;  2ZZC A;  1NEN A;  2OLN A;  4D04 A;  2GV8 A;  1XHC A;  2WOV A;  3AYJ A;  3BHK A;  4H2Q A;  4U2T A;  5KNL A;  1SEZ A;  1PHH A;  2B9W A;  1JNR A;  2GQF A;  4U8K A;  1QDB A;  1GRG A;  3WE0 A;  4FX9 A;  2XVF A;  1IUW A;  4JY3 A;  1ONF A;  3C4A A;  4PAA A;  4X9M A;  2XLP A;  3SGL A;  2FJA A;  3SZW A;  3UOX A;  1FEA A;  2E80 A;  1L9E A;  3NLC A;  3VRA A;  1Q1R A;  1GRT A;  2YR5 A;  3I6D A;  1EL9 A;  2WEU A;  2WQY A;  3DJJ A;  2V60 A;  2X3N A;  2YWL A;  3VR9 A;  3CNT A;  1B5Q A;  1CJC A;  3FPZ A;  3NG7 X;  1QJD A;  2X8C A;  4C3Y A;  3G5R A;  4EQX A;  2I0Z A;  1CHU A;  4K5S A;  1KSS A;  2WPF A;  1O95 A;  3QVR A;  2R0C A;  2XDO A;  3H4K A;  3CGE A;  3CGB A;  4GDE A;  3IC9 A;  1TRB A;  1X31 B;  3SXQ A;  2V3B A;  3HYV A;  3KPF A;  3K30 A;  4GUV A;  4J56 A;  2V3A A;  4TLX A;  4YXD A;  4NEV A;  2A89 A;  3AEC A;  4PAB A;  2B7S A;  2DKH A;  1QLB A;  3EF6 A;  3P4P A;  1B8S A;  2JBV A;  1VQW A;  1S3E A;  4IA6 A;  1H7W A;  3NYC A;  1PBE A;  3UKH A;  2ZZ0 A;  3BNU A;  4YKF A;  2ACZ A;  4Y4N A;  1DOB A;  2O9Z A;  5ER0 A;  5HXI A;  2TMD A;  3M13 A;  4USQ A;  3UKP A;  1OJD A;  2WP6 A;  4X9N A;  1BKW A;  4B65 A;  1CC4 A;  4FK1 A;  3G5Q A;  3CN8 A;  4K7Z A;  4H2P A;  3LZW A;  2C7G A;  3UP5 A;  4YSY A;  3P9U A;  4APN A;  2R46 A;  4Q5B A;  1PBF A;  4IVO B;  4EQR A;  4H4R A;  2BC1 A;  4B63 A;  2FJB A;  3CPJ G;  4JN9 A;  1EL7 A;  2VZ2 A;  4CRT A;  3I3L A;  1LV0 A;  3BNJ A;  1CC6 A;  3PS9 A;  2VRL A;  4JQ9 A;  4MJW A;  4U2S A;  2LFC A;  2GMH A;  5FS6 A;  3P4S A;  1JU2 A;  3T37 A;  1GEU A;  3KKJ A;  1IJH A;  1GAL A;  2VQB A;  2BAB A;  2VVL G;  5KOX A;  2WBA A;  3GM6 A;  3F8R A;  1P2H A;  4Z2R A;  1JRX A;  3AE4 A;  1IUT A;  3CNP A;  3GD3 A;  2QA2 A;  5EB4 A;  5IQ1 A;  3EPT A;  4J36 A;  4GR1 A;  1B37 A;  1GPE A;  3ABV A;  3F8P A;  4GF7 A;  5U63 A;  4HB9 A;  1M64 A;  4OPC A;  1FS8 A;  2YG3 A;  3B6D A;  4H4W A;  4CY8 A;  1M6I A;  3S5W A;  2QAE A;  2RDZ A;  4L3Y A;  3NK0 X;  4NNJ A;  2WDQ A;  1N1P A;  1PS9 A;  1FEC A;  1RSG A;  1ZOY A;  4KPR A;  4H4U A;  1IUS A;  2XLU A;  3AD9 B;  2IVE A;  1PJ6 A;  3CGD A;  2VR0 A;  4G6G A;  3KA7 A;  4N9X A;  3GMC A;  3DK8 A;  4EM4 A;  3L1T A;  1CJ2 A;  1K0J A;  2GVC A;  2XFO A;  3UKK A;  1NHR A;  2V61 A;  2JKC A;  1Y0P A;  4OPI A;  4AT2 A;  2CDU A;  4TM4 A;  1ZKQ A;  2YVG A;  2XLR A;  5KMR A;  1CF3 A;  1PBC A;  4RSL A;  4OPD A;  1N4V A;  1RP0 A;  4HA6 A;  3AXB A;  4IVM B;  4O5Q A;  2C75 A;  4AOS A;  4C74 A;  3URH A;  4CCQ A;  2Q0K A;  1H7X A;  1KDG A;  1ZMC A;  3LAD A;  4Y4M A;  2BYB A;  4ZCC A;  5IPY A;  2CFY A;  4J57 A;  1L9C A;  1KNP A;  1DXL A;  3FG2 P;  1NPX A;  4U8M A;  3GYX A;  2YLS A;  1GV4 A;  4G74 A;  1F6M A;  4GDP A;  4NTE A;  1GSN A;  3II4 A;  5TR3 A;  5JCI A;  1CL0 A;  1BGN A;  3SX6 A;  3LJP A;  1VDC A;  4TM3 A;  1PBD A;  4JNA A;  1KF6 A;  1DOC A;  3K7T A;  2E5V A;  1H86 A;  2GMJ A;  2J3N A;  3O0H A;  4H4Q A;  4USR A;  4YTM A;  3T2Z A;  4EMJ A;  1TDK A;  1NHP A;  2JAE A;  4UDP A;  4Z26 A;  3SYI A;  2BAC A;  2PYX A;  2CUL A;  1CJ3 A;  4A5L A;  3OZ2 A;  2PHH A;  2WP9 A;  1LJ1 A;  2CVJ A;  4A79 A;  1OJT A;  2GR3 A;  5DBJ A;  3AE7 A;  2BC0 A;  3NRN A;  2YG5 A;  2EQ9 A;  3CNJ A;  4J2W A;  4LU6 A;  4NTD A;  1K0L A;  3NYE A;  1BF3 A;  3UOV A;  1FL2 A;  1F3P A;  1W4X A;  3DJG X;  4H4T A;  4H4V A;  2TPR A;  3NTA A;  3RP6 A;  3NK2 X;  1L0V A;  3NN0 X;  1OJC A;  4JY2 A;  1TDE A;  2XVJ A;  1H82 A;  1E6E A;  5FMH A;  5KMQ A;  5JCM A;  3AWI A;  2APG A;  3BNF A;  3GRS A;  4YSZ A;  5J60 A;  3VR8 A;  1JNZ A;  2V5Z A;  1TDF A;  4A99 A;  3KVE A;  3C96 A;  2XCG A;  1KNR A;  2YVJ A;  4ADW A;  3BNM A;  1Y56 B;  2WS3 A;  1COY A;  4EMI A;  2R0P A;  5U25 A;  2AR8 A;  5FS7 A;  3T31 A;  2AQJ A;  3AEB A;  5GRT A;  4A6N B;  1LTX R;  2FJE A;  4B1B A;  3CPI G;  2YLX A;  4OPG A;  4UDR A;  4E0V A;  1ZP0 A;  2C4C A;  2XFQ A;  1JOA A;  1K0I A;  1TDN A;  4YSX A;  4LII A;  2JB3 A;  3V3O A;  3ZDN A;  1KSU A;  1TDO A;  3LGQ A;  2C66 A;  2RAB A;  4P9S A;  3B3R A;  2BCP A;  1ZX9 A;  1NHS A;  1D5T A;  4ECH A;  1O94 A;  4CY6 A;  1B4V A;  2A8X A;  2GEW A;  2Y6Q A;  3GD4 A;  3ICR A;  2B7R A;  1JRY A;  3CPH G;  2GAG B;  4IA5 A;  4EQS A;  3HYW A;  4Z2U A;  2OLO A;  1D4C A;  2B9X A;  1EBD A;  4C5O A;  3ADA B;  3EAO A;  3ZYX A;  2BRY A;  4EIQ A;  2BCG G;  3FIM B;  4J34 A;  1GRA A;  1XPQ A;  5JCK A;  4O5U A;  3DK9 A;  3CIR A;  3GRT A;  4JDR A;  1D7Y A;  4OCG A;  1S2Q A;  1LPF A;  1YKJ A;  1OAH A;  1PN0 A;  3AE8 A;  3UOY A;  4H4X A;  2VQ7 A;  3IF9 A;  2C72 A;  2ARD A;  4BJY A;  1GES A;  1PDH A;  3Q6J A;  4K8D A;  1N4W A;  2X50 A;  1GER A;  4H4S A;  3AEA A;  4Q17 A;  1EL5 A;  4L3X A;  1V59 A;  1NDA A;  2RGJ A;  1CJ4 A;  4BK3 A;  3NNE A;  1CC2 A;  4JNQ A;  1BZL A;  3LB8 A;  2UZZ A;  4NZH A;  4YSH A;  3L8K A;  3NTD A;  1M1Q A;  4L38 A;  2VOU A;  4Y4L A;  3AD8 B;  3BI4 A;  2JB1 A;  2EQ6 A;  1E1K A;  3KU9 A;  3UTG A;  3BNH A;  3ATQ A;  4BUR A;  3DME A;  3NKS A;  4B67 A;  2C67 A;  3QSM A;  4KX6 A;  5M10 A;  3HZL A;  3RHA A;  4CBQ A;  1GTE A;  3DJE A;  1NAA A;  3AE9 A;  4Q1O A;  4Q4U A;  3GMB A;  2WP5 A;  2R0G A;  3IHM A;  4NTC A;  5KRQ A;  1PXB A;  4TM1 A;  3NK1 X;  1GXF A;  3AD7 B;  3S61 A;  4OPU A;  2GF3 A;  2XLS A;  4BV6 A;  3D8X A;  3S7W A;  1DOD A;  2JB2 A;  2R4J A;  3GSI A;  3GWF A;  1HYU A;  4Q0T A;  2BRA A;  4OPT A;  5KOW A;  1VRQ B;  2YQU A;  3QSS A;  2XLT A; 
#chains in the Genus database with same CATH homology
 4ZN0 A;  2IVD A;  3OC4 A;  1JRZ A;  1H81 A;  1PJ5 A;  3SCE A;  4B68 A;  1D4E A;  4NWZ A;  4A65 A;  1OJ9 A;  1Q1W A;  2VRM A;  4TM0 A;  4TLZ A;  3SZF A;  4U8L A;  4GAV A;  3LG1 A;  2R45 A;  1NHQ A;  3QFB A;  2BA9 A;  1KFY A;  2XVI A;  1PJ7 A;  4H4Y A;  1TYT A;  4LA1 A;  1F8S A;  2XFN A;  4B64 A;  3ATR A;  3RP8 A;  2WU5 A;  4YT0 A;  5KVH A;  1F8R A;  4FK1 C;  4H7U A;  2X99 A;  2FJD A;  4H2R A;  3T2K A;  2C73 A;  2YG7 A;  2YM2 A;  2C64 A;  2C76 A;  3SFE A;  1O5W A;  4AP3 A;  4Z25 A;  4UP3 A;  1FS7 A;  3F8D A;  2AAQ A;  1GRH A;  4AP1 A;  3FMW A;  3CTY A;  3KD9 A;  3AEG A;  2OA1 A;  1MOK A;  2E81 A;  2BK3 A;  3VRD B;  3NHO X;  2BXS A;  2ZO5 A;  1GRB A;  3RP7 A;  1H84 A;  3DA1 A;  4RG4 A;  4D03 A;  4G73 A;  1K4Q A;  3K7M X;  3RED A;  1E1M A;  4A9W A;  4OVI A;  4U8I A;  3RKH A;  5KVI A;  3SY4 A;  4U2L A;  4M52 A;  4GCM A;  5LV9 A;  3NT6 A;  3K7Q X;  2EQ7 A;  1BVB A;  3COX A;  4C77 A;  4J33 A;  3Q9T A;  4BK1 A;  1IUV A;  2B9Y A;  2XVH A;  3QVP A;  1LQU A;  4K2X A;  5BUK A;  5EBK A;  3SZC A;  5FS9 A;  2GQW A;  2QCU A;  1TYP A;  5C3J A;  1OJA A;  3MMO A;  4U8N A;  3GWD A;  1NG4 A;  2RGO A;  2HQM A;  1ZMD A;  2WDR A;  4YKG A;  3NGC X;  4I58 A;  1MO9 A;  3UCL A;  2BK5 A;  3P1W A;  5IQ4 A;  5KMP A;  3QJ4 A;  1H6V A;  4G6H A;  3LOV A;  2YLW A;  3SM8 A;  4EMW A;  3OWM A;  1LQT A;  2QA1 A;  2XFP A;  3GDN A;  2WPC A;  1DJQ A;  2YLT A;  3UOZ A;  3DH9 A;  2VVM A;  5KXJ A;  3AEF A;  1DNC A;  1PXA A;  3ALJ A;  3SFD A;  4DSG A;  2XYO A;  5KMS A;  1ZDL A;  1IUX A;  2WHD A;  3IHG A;  3SZ0 A;  4EM3 A;  2DKI A;  2YM1 A;  2J7A A;  2Z5Y A;  3L1R A;  3AEE A;  3ITJ A;  4AOX A;  2YG6 A;  2FBW A;  1YQZ A;  1M1P A;  4B66 A;  3DGH A;  4L3Z A;  3VQR A;  3JSK A;  1E1L A;  5BRT A;  4UDQ A;  4J31 A;  1GTH A;  3AE5 A;  1QO8 A;  2H89 A;  2WOI A;  5CKU A;  5EOW A;  4Z44 A;  2Q6U A;  2V6O A;  2YAU A;  4DSH A;  4Z43 A;  5CQF A;  4WX1 A;  5U1O A;  1CBO A;  1F8W A;  1UKV G;  2IID A;  2YR4 A;  3C4N A;  3NYF A;  1BWC A;  4I59 A;  4OPL A;  3V3N A;  3SQP A;  3RNM A;  1E39 A;  1GRE A;  3CNS A;  2F5Z A;  3BHF A;  2GR1 A;  2E1M A;  2XVE A;  2ZBW A;  1FCD A;  4H4Z A;  1Z6L A;  1BGJ A;  3H8I A;  3QFA A;  3BNG A;  3P4Q A;  1PBB A;  3G5S A;  5HYM A;  4U8P A;  1AOG A;  4CNK A;  4WCT A;  3UTE A;  3IWA A;  4C3X A;  2C65 A;  1RYI A;  1GRF A;  2YR6 A;  1D7L A;  4Q5C A;  1GT8 A;  2BS4 A;  4XWR A;  5J7X A;  1GU6 A;  2ZZB A;  2WPE A;  5C2T A;  4CNJ A;  1H83 A;  4EQW A;  3TTB A;  1SP3 A;  3KLJ A;  4BK2 A;  4DGK A;  1ELI A;  4REK A;  2B76 A;  4FDC B;  5BUL A;  1S2Y A;  1YY5 A;  2Y6R A;  3D1C A;  3DGZ A;  3UKL A;  1ZY8 A;  4II2 A;  2R4E A;  1EL8 A;  2Q0L A;  2WES A;  1YQ3 A;  3T2Y A;  5HY5 A;  1FOH A;  2GR2 A;  4Z24 A;  3AYL A;  3D1I A;  3UBR A;  2R9Z A;  3UTF A;  3GYJ A;  3ALM A;  3UTH A;  2YLZ A;  2W0H A;  1S3B A;  2WDV A;  3QSE A;  5JCN A;  2H88 A;  5GSN A;  3T0K A;  4ZCD A;  2GB0 A;  2WOW A;  4XXG A;  2Z5X A;  4K5R A;  2E4G A;  2OT4 A;  3PO7 A;  1E7P A;  1NEK A;  2OAL A;  3DK4 A;  4YWO A;  2C3D A;  4B69 A;  3CND A;  2NPX A;  3ALL A;  1IUU A;  2GH5 A;  1E1N A;  1Q9I A;  2GR0 A;  5KWF A;  3F29 A;  1D4D A;  1DOE A;  1FS9 A;  2YG4 A;  1NG3 A;  2WU2 A;  3BI5 A;  3M0O A;  4G9K A;  5FS8 A;  4YTP A;  4YTN A;  3AYI A;  4K22 A;  3T14 A;  1L9D A;  4EIP A;  3NH3 X;  4H50 A;  5HHF A;  2VVL A;  2GAH B;  1GOS A;  3TOR A;  4GRT A;  4H2N A;  4II3 A;  1GET A;  2XFU A;  3FO3 A;  1REO A;  3ICT A;  3UKF A;  3EAN A;  3DJD A;  2JK6 A;  3NN6 X;  4WJY A;  1ZOV A;  2X8H A;  1FT6 A;  1JNI A;  3FBS A;  3R9U A;  2RGH A;  1YQ4 A;  2YVF A;  5L46 A;  3CMM A;  3LXD A;  3AE3 A;  1VG9 A;  1P2E A;  5JCL A;  1Y56 A;  2NVK X;  2A87 A;  2BK4 A;  3UU9 A;  1XAN A;  1ZK7 A;  3ISH A;  2YLR A;  1M1R A;  4DNA A;  4CCR A;  1VG0 A;  3HYX A;  4A6N A;  2C70 A;  3BI2 A;  3V76 A;  2BS3 A;  3PVC A;  1GND A;  3LZX A;  3UKA A;  3NIX A;  3CGC A;  3AE2 A;  4AT0 A;  1DJN A;  1FT5 A;  3AED A;  2BS2 A;  2GRT A;  4RG3 A;  4XWZ A;  5M0Z A;  3H8L A;  3AE1 A;  3VRB A;  3UP4 A;  1MXT A;  3GDP A;  4NEW A;  2C3C A;  3P4R A;  2WET A;  4ICY A;  2OAM A;  3SXI A;  3UKQ A;  4IV9 A;  1N4U A;  1XDI A;  2BXR A;  2Q7V A;  3E1T A;  4Z2T A;  3AE6 A;  1JEH A;  3GYI A;  5EB5 A;  1LVL A;  4U8O A;  2X8G A;  1FEB A;  3KPK A;  4A7A A;  4BJZ A;  5BVA A;  2EQ8 A;  2RF7 A;  1PXC A;  3AB1 A;  2K3V A;  3ICS A;  3M12 A;  4H4P A;  4X4J A;  4U8J A;  4GAP A;  2ZZC A;  1NEN A;  2OLN A;  4D04 A;  2GV8 A;  1XHC A;  2WOV A;  3AYJ A;  3BHK A;  4H2Q A;  4U2T A;  5KNL A;  1SEZ A;  1PHH A;  2B9W A;  1JNR A;  2GQF A;  4U8K A;  1QDB A;  1GRG A;  3WE0 A;  4FX9 A;  2XVF A;  1IUW A;  4JY3 A;  1ONF A;  3C4A A;  4PAA A;  4X9M A;  2XLP A;  3SGL A;  2FJA A;  3SZW A;  3UOX A;  1FEA A;  2E80 A;  1L9E A;  3NLC A;  3VRA A;  1Q1R A;  1GRT A;  2YR5 A;  3I6D A;  1EL9 A;  2WEU A;  2WQY A;  3DJJ A;  2V60 A;  2X3N A;  2YWL A;  3VR9 A;  3CNT A;  1B5Q A;  1CJC A;  3FPZ A;  3NG7 X;  1QJD A;  2X8C A;  4C3Y A;  3G5R A;  4EQX A;  2I0Z A;  1CHU A;  4K5S A;  1KSS A;  2WPF A;  1O95 A;  3QVR A;  2R0C A;  2XDO A;  3H4K A;  3CGE A;  3CGB A;  4GDE A;  3IC9 A;  1TRB A;  1X31 B;  3SXQ A;  2V3B A;  3HYV A;  3KPF A;  3K30 A;  4GUV A;  4J56 A;  2V3A A;  4TLX A;  4YXD A;  4NEV A;  2A89 A;  3AEC A;  4PAB A;  2B7S A;  2DKH A;  1QLB A;  3EF6 A;  3P4P A;  1B8S A;  2JBV A;  1VQW A;  1S3E A;  4IA6 A;  1H7W A;  3NYC A;  1PBE A;  3UKH A;  2ZZ0 A;  3BNU A;  4YKF A;  2ACZ A;  4Y4N A;  1DOB A;  2O9Z A;  5ER0 A;  5HXI A;  2TMD A;  3M13 A;  4USQ A;  3UKP A;  1OJD A;  2WP6 A;  4X9N A;  1BKW A;  4B65 A;  1CC4 A;  4FK1 A;  3G5Q A;  3CN8 A;  4K7Z A;  4H2P A;  3LZW A;  2C7G A;  3UP5 A;  4YSY A;  3P9U A;  4APN A;  2R46 A;  4Q5B A;  1PBF A;  4IVO B;  4EQR A;  4H4R A;  2BC1 A;  4B63 A;  2FJB A;  3CPJ G;  4JN9 A;  1EL7 A;  2VZ2 A;  4CRT A;  3I3L A;  1LV0 A;  3BNJ A;  1CC6 A;  3PS9 A;  2VRL A;  4JQ9 A;  4MJW A;  4U2S A;  2LFC A;  2GMH A;  5FS6 A;  3P4S A;  1JU2 A;  3T37 A;  1GEU A;  3KKJ A;  1IJH A;  1GAL A;  2VQB A;  2BAB A;  2VVL G;  5KOX A;  2WBA A;  3GM6 A;  3F8R A;  1P2H A;  4Z2R A;  1JRX A;  3AE4 A;  1IUT A;  3CNP A;  3GD3 A;  2QA2 A;  5EB4 A;  5IQ1 A;  3EPT A;  4J36 A;  4GR1 A;  1B37 A;  1GPE A;  3ABV A;  3F8P A;  4GF7 A;  5U63 A;  4HB9 A;  1M64 A;  4OPC A;  1FS8 A;  2YG3 A;  3B6D A;  4H4W A;  4CY8 A;  1M6I A;  3S5W A;  2QAE A;  2RDZ A;  4L3Y A;  3NK0 X;  4NNJ A;  2WDQ A;  1N1P A;  1PS9 A;  1FEC A;  1RSG A;  1ZOY A;  4KPR A;  4H4U A;  1IUS A;  2XLU A;  3AD9 B;  2IVE A;  1PJ6 A;  3CGD A;  2VR0 A;  4G6G A;  3KA7 A;  4N9X A;  3GMC A;  3DK8 A;  4EM4 A;  3L1T A;  1CJ2 A;  1K0J A;  2GVC A;  2XFO A;  3UKK A;  1NHR A;  2V61 A;  2JKC A;  1Y0P A;  4OPI A;  4AT2 A;  2CDU A;  4TM4 A;  1ZKQ A;  2YVG A;  2XLR A;  5KMR A;  1CF3 A;  1PBC A;  4RSL A;  4OPD A;  1N4V A;  1RP0 A;  4HA6 A;  3AXB A;  4IVM B;  4O5Q A;  2C75 A;  4AOS A;  4C74 A;  3URH A;  4CCQ A;  2Q0K A;  1H7X A;  1KDG A;  1ZMC A;  3LAD A;  4Y4M A;  2BYB A;  4ZCC A;  5IPY A;  2CFY A;  4J57 A;  1L9C A;  1KNP A;  1DXL A;  3FG2 P;  1NPX A;  4U8M A;  3GYX A;  2YLS A;  1GV4 A;  4G74 A;  1F6M A;  4GDP A;  4NTE A;  1GSN A;  3II4 A;  5TR3 A;  5JCI A;  1CL0 A;  1BGN A;  3SX6 A;  3LJP A;  1VDC A;  4TM3 A;  1PBD A;  4JNA A;  1KF6 A;  1DOC A;  3K7T A;  2E5V A;  1H86 A;  2GMJ A;  2J3N A;  3O0H A;  4H4Q A;  4USR A;  4YTM A;  3T2Z A;  4EMJ A;  1TDK A;  1NHP A;  2JAE A;  4UDP A;  4Z26 A;  3SYI A;  2BAC A;  2PYX A;  2CUL A;  1CJ3 A;  4A5L A;  3OZ2 A;  2PHH A;  2WP9 A;  1LJ1 A;  2CVJ A;  4A79 A;  1OJT A;  2GR3 A;  5DBJ A;  3AE7 A;  2BC0 A;  3NRN A;  2YG5 A;  2EQ9 A;  3CNJ A;  4J2W A;  4LU6 A;  4NTD A;  1K0L A;  3NYE A;  1BF3 A;  3UOV A;  1FL2 A;  1F3P A;  1W4X A;  3DJG X;  4H4T A;  4H4V A;  2TPR A;  3NTA A;  3RP6 A;  3NK2 X;  1L0V A;  3NN0 X;  1OJC A;  4JY2 A;  1TDE A;  2XVJ A;  1H82 A;  1E6E A;  5FMH A;  5KMQ A;  5JCM A;  3AWI A;  2APG A;  3BNF A;  3GRS A;  4YSZ A;  5J60 A;  3VR8 A;  1JNZ A;  2V5Z A;  1TDF A;  4A99 A;  3KVE A;  3C96 A;  2XCG A;  1KNR A;  2YVJ A;  4ADW A;  3BNM A;  1Y56 B;  2WS3 A;  1COY A;  4EMI A;  2R0P A;  5U25 A;  2AR8 A;  5FS7 A;  3T31 A;  2AQJ A;  3AEB A;  5GRT A;  4A6N B;  1LTX R;  2FJE A;  4B1B A;  3CPI G;  2YLX A;  4OPG A;  4UDR A;  4E0V A;  1ZP0 A;  2C4C A;  2XFQ A;  1JOA A;  1K0I A;  1TDN A;  4YSX A;  4LII A;  2JB3 A;  3V3O A;  3ZDN A;  1KSU A;  1TDO A;  3LGQ A;  2C66 A;  2RAB A;  4P9S A;  3B3R A;  2BCP A;  1ZX9 A;  1NHS A;  1D5T A;  4ECH A;  1O94 A;  4CY6 A;  1B4V A;  2A8X A;  2GEW A;  2Y6Q A;  3GD4 A;  3ICR A;  2B7R A;  1JRY A;  3CPH G;  2GAG B;  4IA5 A;  4EQS A;  3HYW A;  4Z2U A;  2OLO A;  1D4C A;  2B9X A;  1EBD A;  4C5O A;  3ADA B;  3EAO A;  3ZYX A;  2BRY A;  4EIQ A;  2BCG G;  3FIM B;  4J34 A;  1GRA A;  1XPQ A;  5JCK A;  4O5U A;  3DK9 A;  3CIR A;  3GRT A;  4JDR A;  1D7Y A;  4OCG A;  1S2Q A;  1LPF A;  1YKJ A;  1OAH A;  1PN0 A;  3AE8 A;  3UOY A;  4H4X A;  2VQ7 A;  3IF9 A;  2C72 A;  2ARD A;  4BJY A;  1GES A;  1PDH A;  3Q6J A;  4K8D A;  1N4W A;  2X50 A;  1GER A;  4H4S A;  3AEA A;  4Q17 A;  1EL5 A;  4L3X A;  1V59 A;  1NDA A;  2RGJ A;  1CJ4 A;  4BK3 A;  3NNE A;  1CC2 A;  4JNQ A;  1BZL A;  3LB8 A;  2UZZ A;  4NZH A;  4YSH A;  3L8K A;  3NTD A;  1M1Q A;  4L38 A;  2VOU A;  4Y4L A;  3AD8 B;  3BI4 A;  2JB1 A;  2EQ6 A;  1E1K A;  3KU9 A;  3UTG A;  3BNH A;  3ATQ A;  4BUR A;  3DME A;  3NKS A;  4B67 A;  2C67 A;  3QSM A;  4KX6 A;  5M10 A;  3HZL A;  3RHA A;  4CBQ A;  1GTE A;  3DJE A;  1NAA A;  3AE9 A;  4Q1O A;  4Q4U A;  3GMB A;  2WP5 A;  2R0G A;  3IHM A;  4NTC A;  5KRQ A;  1PXB A;  4TM1 A;  3NK1 X;  1GXF A;  3AD7 B;  3S61 A;  4OPU A;  2GF3 A;  2XLS A;  4BV6 A;  3D8X A;  3S7W A;  1DOD A;  2JB2 A;  2R4J A;  3GSI A;  3GWF A;  1HYU A;  4Q0T A;  2BRA A;  4OPT A;  5KOW A;  1VRQ B;  2YQU A;  3QSS A;  2XLT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...