1JRXA

Crystal structure of arg402ala mutant flavocytochrome c3 from shewanella frigidimarina
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
sequence length
568
structure length
568
Chain Sequence
ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLAEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWLRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTADKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Kinetic and crystallographic analysis of the key active site acid/base arginine in a soluble fumarate reductase.
pubmed doi rcsb
source organism Shewanella frigidimarina
molecule tags Oxidoreductase
molecule keywords FLAVOCYTOCHROME C
total genus 199
structure length 568
sequence length 568
chains with identical sequence B
ec nomenclature ec 1.3.5.4: Fumarate reductase (quinol).
pdb deposition date 2001-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF14537 Cytochrom_c3_2 Cytochrome c3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1130.10 Mainly Alpha Orthogonal Bundle Flavocytochrome C3; Chain A, domain 2 Flavocytochrome C3; Chain A 1jrxA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1jrxA03
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1jrxA01
4EQSA 3F8DA 3UKLA 3S61A 2ZZ0A 3NYCA 4X9MA 1FOHA 1GSNA 1DJNA 1H82A 2VZ2A 3ZYXA 4K7ZA 3NT6A 3SFDA 5HYMA 4Y4NA 1NG3A 1IUXA 1E7PA 3QVRA 1XANA 3CN8A 5BUKA 5HHFA 2BK5A 3ABVA 4C77A 3QVPA 1NPXA 5DBJA 5KRQA 3D1CA 4GR1A 1TDKA 2X3NA 1JOAA 2X8CA 4UDQA 4AT0A 3PS9A 2WPFA 1N4VA 1YQZA 3ALMA 4J33A 3G5SA 5U25A 3BI5A 4BK3A 4DGKA 4EMIA 5HY5A 3DGHA 2EQ7A 1DNCA 1NHPA 5IPYA 5IQ4A 4GDPA 4C3XA 4D03A 3NIXA 4TM3A 2GF3A 3JSKA 1JNIA 1SEZA 3R9UA 3D1IA 3VRAA 4J2WA 4NTDA 4UDRA 2Q0KA 3DJDA 2B9WA 3L1RA 2FJDA 3F29A 4A9WA 1L0VA 3O0HA 4RG4A 4Z43A 1Q1RA 1Y56B 4HA6A 4USQA 3KA7A 3P1WA 4A7AA 4U2SA 2GR0A 4CBQA 3G5QA 4OPDA 4J34A 2RABA 1S2YA 2BC0A 2C7GA 4AOXA 4Z44A 3SQPA 3NGCX 2C70A 2XFUA 1PDHA 2CVJA 1ELIA 2WU2A 1FL2A 2Y6QA 1E39A 3P9UA 4B65A 1GRHA 3P4PA 4U8IA 1GEUA 2GRTA 4EMJA 2BA9A 2QA2A 1LVLA 2YM1A 4D04A 3GMCA 3CPIG 3BI4A 3QFAA 2XVIA 2V3AA 2YG4A 4WJYA 3AE1A 3KKJA 1QLBA 1B8SA 1F8WA 3IHGA 1D7YA 2C75A 1ZOYA 2WU5A 3H4KA 5GRTA 3GRSA 3RHAA 2GEWA 1OJ9A 2UZZA 1VG9A 3DJEA 2K3VA 1FEAA 4LU6A 3UKHA 1YKJA 1PJ5A 4EQXA 4B63A 1GREA 1E6EA 1E1LA 2VVMA 3UBRA 4YSHA 1CJ4A 1LQUA 1GTHA 1OJAA 1LPFA 2XFOA 4B67A 3UTGA 2R46A 2XVEA 1Y0PA 2B9YA 1Z6LA 5C2TA 2XFPA 5J60A 4Z2UA 2AR8A 2WOVA 3IHMA 3G5RA 2BK3A 4PAAA 2BS4A 2R0CA 5FS9A 2WHDA 1XPQA 3NN0X 2QAEA 4UDPA 2WEUA 4Q17A 3SGLA 3VRBA 2DKHA 3RP8A 1NENA 4L3YA 2JKCA 4JNAA 3AYLA 2GR3A 3RNMA 1D5TA 3BNJA 3BNMA 3IF9A 3QFBA 3SXQA 3NN6X 4P9SA 3ATRA 3GMBA 3DA1A 3FBSA 3AE2A 1DOEA 3S5WA 4BJZA 3GM6A 3CPHG 1PBCA 4YTNA 3ALJA 3FIMB 2IVEA 4C3YA 3NLCA 4Q0TA 1NHRA 4O5QA 3LGQA 2EQ6A 2XYOA 3K30A 2W0HA 4GRTA 2XCGA 2E80A 5LV9A 4K5RA 1NG4A 3TORA 1PBFA 5JCNA 3I6DA 4XWRA 3Q6JA 2F5ZA 1H86A 2YM2A 3P4RA 3GSIA 2GAHB 1ZX9A 2GV8A 4FDCB 3FO3A 1IUUA 1FS8A 4K22A 3BHKA 2GQFA 3ZDNA 1PHHA 3NTAA 5C3JA 4FX9A 2OALA 4CY6A 3EPTA 3NK2X 4AP3A 3NK0X 2YR5A 3LJPA 4GCMA 2V3BA 4YSZA 2CFYA 3C96A 2ZO5A 3GDNA 4X9NA 2O9ZA 2JBVA 4KX6A 4OPIA 4L38A 3COXA 1PJ6A 5FS6A 2H88A 3GYIA 5BVAA 4N9XA 2ZZBA 1DOCA 1ZMDA 1SP3A 4LA1A 4MJWA 1NAAA 4I58A 3REDA 3C4AA 1KDGA 3AXBA 3ISHA 4OCGA 2YLWA 4EIPA 3UTEA 2BS2A 4Z25A 4EMWA 4YSXA 3LOVA 1H6VA 3LZWA 1LJ1A 4ICYA 1KSSA 2R9ZA 4FK1C 3UTHA 4B68A 3LG1A 1ZOVA 1DOBA 1H81A 2WOWA 4DSGA 3CNPA 2VVLG 1IJHA 3MMOA 1E1KA 1FS9A 4Q5CA 2GMJA 2J7AA 2BC1A 3DGZA 1O5WA 1ZP0A 1JRXA 1EL7A 2V61A 1VG0A 1JEHA 1N1PA 2GMHA 3C4NA 4YTMA 3GWFA 1W4XA 4B66A 5KVHA 1FEBA 2A87A 3TTBA 3AEFA 2DKIA 4H50A 4Q4UA 5GSNA 1FT6A 1NHQA 4H2PA 2CULA 4TM0A 5U63A 4RSLA 2EQ9A 3AD9B 3NKSA 5CKUA 4B69A 3WE0A 4Z2TA 1NHSA 2WP6A 2BCGG 3OZ2A 4H4RA 3LXDA 4K5SA 1V59A 2WDQA 4J56A 4PABA 1O94A 3B6DA 4Y4LA 2A8XA 2YVFA 2GB0A 3UOYA 1FCDA 1LTXR 5FS8A 5EB5A 1F6MA 1D4DA 1KNPA 1X31B 3QSSA 4IVMB 3H8IA 2XVJA 1K0JA 3ALLA 3D8XA 1O95A 3NTDA 5KVIA 5JCMA 1GU6A 4H4XA 2YVGA 1GV4A 3AD8B 1QDBA 3NG7X 2JB3A 4ZCCA 3ICRA 2H89A 2R0GA 1H7XA 2GR1A 2VR0A 1GETA 1IUVA 3CNJA 1S2QA 4C5OA 2XLRA 1Q1WA 2YWLA 4NEVA 2FJEA 3NYFA 3KVEA 4OPLA 4U8PA 1M64A 2OLOA 1H84A 1EL9A 2RGJA 3PVCA 4Z24A 5J7XA 4H4PA 2EQ8A 2XVHA 4NEWA 1N4UA 3AE6A 4Q1OA 1ZKQA 3F8RA 3NH3X 4YKFA 4BURA 4YT0A 1CJ3A 2Y6RA 2APGA 2WP5A 2XLTA 1PBBA 3QJ4A 1AOGA 3EANA 4JDRA 2FJBA 4Q5BA 2VOUA 3KPFA 4H4QA 4Z26A 2OA1A 4DSHA 4L3ZA 4A99A 2E1MA 4CNJA 1BF3A 4TLZA 5FMHA 4K8DA 2FJAA 4APNA 1LV0A 1KF6A 2RGOA 4B1BA 4U8JA 3KLJA 1NEKA 1S3BA 4USRA 3HZLA 2WS3A 2IIDA 1QJDA 1GT8A 2X8GA 4ZN0A 1OAHA 3GYJA 1RYIA 1E1MA 5JCLA 2GQWA 2X99A 3V3OA 3E1TA 4H4ZA 1JNZA 2QA1A 1BVBA 4E0VA 4WCTA 3T37A 2B7SA 1PS9A 1VRQB 4A6NB 1CL0A 3DK9A 3AEDA 4JY2A 5KWFA 2E81A 3AWIA 2GH5A 1EL8A 2VQBA 4H2RA 3LB8A 2R0PA 5L46A 2E5VA 5BRTA 1CBOA 2YVJA 5M10A 3AECA 4J57A 3UP4A 2Q0LA 1GESA 1LQTA 3BI2A 3IWAA 4H2QA 1H7WA 3BNFA 2VRMA 1CC6A 1JU2A 2CDUA 1M1RA 3H8LA 5U1OA 4NTEA 4ADWA 1ZY8A 1H83A 3F8PA 1IUSA 2GAGB 4U8MA 3UOZA 4FK1A 3UOVA 3VRDB 2RDZA 2QCUA 1JRZA 4H4WA 2YG7A 3L8KA 1TDEA 1PBEA 2YG6A 3UKKA 2BK4A 4CCQA 1VQWA 3FMWA 1BGJA 1F8RA 4GDEA 4H4SA 4M52A 3CGBA 3EF6A 4TLXA 4JNQA 3GD4A 3K7QX 2Q6UA 5KOXA 1YQ4A 2BYBA 4U2LA 3UOXA 3UKFA 2PHHA 4ZCDA 4YWOA 3AD7B 1M1PA 2NVKX 4XXGA 4U2TA 4TM4A 3UTFA 3NYEA 3DJGX 2NPXA 4DNAA 1CHUA 3CGCA 3DMEA 5EOWA 2YG5A 5M0ZA 2YQUA 3AE9A 2C76A 2AQJA 2C64A 4GF7A 3K7TA 4H4UA 3NNEA 4J36A 2Z5XA 2Z5YA 1GERA 1M6IA 4JY3A 3BNHA 4K2XA 1PXAA 2ZBWA 3M12A 1GRBA 5KXJA 3GYXA 4BK2A 3NHOX 1TYPA 3CNDA 1DXLA 3CGEA 4RG3A 2LFCA 1GNDA 4CCRA 1PN0A 3AEAA 2OLNA 1D4CA 1OJCA 1GXFA 4GUVA 3CIRA 2VQ7A 5JCIA 2YR6A 4OPTA 4L3XA 2B9XA 2HQMA 2WPCA 2XLPA 1IUTA 4EQWA 1D4EA 4H4YA 1TDFA 2WQYA 3KD9A 4Z2RA 1XDIA 2C67A 2WDRA 3NK1X 2BXRA 2X8HA 5KOWA 1TRBA 1L9EA 3ICSA 2C3DA 1CJ2A 2V60A 1E1NA 4NTCA 3K7MX 3GDPA 4EQRA 2WOIA 2BCPA 3ITJA 4O5UA 1JRYA 3VQRA 3UKPA 1FECA 3NRNA 4A65A 4BV6A 2C65A 3OWMA 2XDOA 1FT5A 1COYA 1PJ7A 2XLUA 2YLTA 3SM8A 4XWZA 2TMDA 2R4EA 4U8KA 2OT4A 3AB1A 3IC9A 3QSEA 3UU9A 3LZXA 5JCKA 2BXSA 4AP1A 1PXCA 2BACA 4IA5A 4TM1A 3M0OA 3VR8A 1BWCA 3AE3A 1GRFA 1K0LA 3FG2P 3OC4A 3GD3A 5TR3A 3V3NA 4KPRA 3GRTA 3CTYA 3M13A 5ER0A 1PXBA 4BJYA 4YXDA 4NZHA 1TDOA 2OAMA 4AT2A 3Q9TA 1B4VA 1CJCA 4Y4MA 4CRTA 2JB1A 2WPEA 1JNRA 1GALA 1YY5A 2J3NA 2BS3A 3DK4A 2GVCA 2X50A 2AAQA 1KFYA 4CY8A 5HXIA 2YR4A 3BNUA 4X4JA 1GRTA 2V5ZA 4I59A 2TPRA 1CC2A 2XFQA 2C66A 2JK6A 3EAOA 1L9DA 1ONFA 4REKA 4U8NA 2WDVA 1DJQA 3SFEA 3VR9A 2B7RA 1CF3A 2R45A 2FBWA 3UCLA 1L9CA 4A79A 4A5LA 3CNSA 1B5QA 2E4GA 2ACZA 4U8LA 4EM3A 3AEGA 2YG3A 1MXTA 4OPUA 3AE5A 4JN9A 4A6NA 1HYUA 3BHFA 2PYXA 1NDAA 4HB9A 3URHA 1TYTA 3DH9A 4YSYA 3AE4A 2XFNA 3GWDA 3UKAA 1GTEA 5FS7A 1XHCA 1REOA 2JB2A 2YLRA 4EM4A 1EBDA 3CPJG 2IVDA 1KSUA 1BZLA 3CNTA 3I3LA 3P4SA 1P2EA 1KNRA 3CGDA 4OPCA 1FS7A 1EL5A 2XVFA 3DJJA 5EB4A 1UKVG 1GRAA 4B64A 2C73A 3AYJA 1RSGA 3AEBA 4WX1A 1M1QA 2BABA 5IQ1A 1CC4A 4AOSA 1YQ3A 2RF7A 1K4QA 1QO8A 1OJTA 1GPEA 1RP0A 3SCEA 1S3EA 1VDCA 2XLSA 3B3RA 4U8OA 4UP3A 5BULA 2RGHA 3AEEA 2WP9A 4H4TA 1ZK7A 1MOKA 1N4WA 2ARDA 4OPGA 3DK8A 5EBKA 1TDNA 4H2NA 4BK1A 4YKGA 3UP5A 2JAEA 2A89A 4IVOB 3L1TA 2WESA 4JQ9A 2WBAA 1B37A 1ZDLA 4YTPA 2YLSA 2VRLA 2I0ZA 1IUWA 4C74A 3RP7A 1K0IA 1D7LA 2ZZCA 3ICTA 1F8SA 3II4A 3PO7A 4EIQA 1MO9A 2YLXA 2C3CA 2B76A 3AYIA 3AE7A 3AE8A 4ECHA 3RKHA 1GRGA 3QSMA 4H7UA 2VVLA 4J31A 1GOSA 1PBDA 2R4JA 3LADA 3V76A 2C72A 1ZMCA 4CNKA 2WETA 1OJDA 4IV9A 4OVIA 3KU9A 3FPZA 1BGNA 2GR2A 4IA6A 4H4VA 2YLZA 1F3PA 1Y56A 5CQFA 2V6OA 4LIIA 3RP6A 3UKQA 2Q7VA 2YAUA 3ADAB 1DODA 1Q9IA 1BKWA 3ATQA 3S7WA 1P2HA 3P4QA 3BNGA
chains in the Genus database with same CATH superfamily
4EQSA 3F8DA 3UKLA 3S61A 2ZZ0A 3NYCA 4X9MA 1FOHA 1GSNA 1DJNA 1H82A 2VZ2A 3ZYXA 4G9KA 4K7ZA 3NT6A 3SFDA 5HYMA 4Y4NA 1NG3A 1IUXA 1E7PA 3QVRA 1XANA 3CN8A 5BUKA 5HHFA 2BK5A 3ABVA 4C77A 3HYWA 3QVPA 1NPXA 5DBJA 5KRQA 3D1CA 4GR1A 1TDKA 2X3NA 1JOAA 2X8CA 4UDQA 4AT0A 3PS9A 2WPFA 1N4VA 1YQZA 3ALMA 4J33A 3G5SA 5U25A 3BI5A 4GAPA 4BK3A 4DGKA 4EMIA 5HY5A 3DGHA 2EQ7A 1DNCA 1NHPA 5IPYA 5IQ4A 4GDPA 4C3XA 4D03A 3NIXA 4TM3A 2GF3A 3JSKA 1JNIA 1SEZA 3R9UA 3D1IA 3VRAA 4J2WA 4NTDA 5KMQA 4UDRA 2Q0KA 3DJDA 2B9WA 3L1RA 2FJDA 3F29A 4A9WA 1L0VA 3O0HA 4RG4A 4Z43A 1Q1RA 1Y56B 4HA6A 4USQA 3KA7A 3P1WA 4A7AA 4U2SA 2GR0A 4CBQA 3G5QA 4OPDA 4J34A 2RABA 1S2YA 2BC0A 2C7GA 4AOXA 4Z44A 3SQPA 3NGCX 2C70A 2XFUA 1PDHA 2CVJA 1ELIA 2WU2A 1FL2A 2Y6QA 1E39A 3P9UA 4B65A 1GRHA 3P4PA 4U8IA 1GEUA 2GRTA 4EMJA 2BA9A 2QA2A 1LVLA 2YM1A 4D04A 3GMCA 3CPIG 3BI4A 3QFAA 2XVIA 2V3AA 2YG4A 4WJYA 3AE1A 3KKJA 1QLBA 1B8SA 1F8WA 3IHGA 1D7YA 2C75A 1ZOYA 2WU5A 3H4KA 5GRTA 3HYVA 3GRSA 3RHAA 2GEWA 1OJ9A 2UZZA 1VG9A 3DJEA 2K3VA 1FEAA 4LU6A 3UKHA 1YKJA 1PJ5A 4EQXA 4B63A 1GREA 1E6EA 1E1LA 2VVMA 4NNJA 3UBRA 4YSHA 1CJ4A 1LQUA 1GTHA 1OJAA 1LPFA 2XFOA 4B67A 3UTGA 2R46A 2XVEA 1Y0PA 2B9YA 1Z6LA 5C2TA 2XFPA 5J60A 4Z2UA 2AR8A 2WOVA 3IHMA 3G5RA 2BK3A 4PAAA 2BS4A 2R0CA 5FS9A 2WHDA 1XPQA 3NN0X 2QAEA 4G73A 4UDPA 2WEUA 4Q17A 3SGLA 3VRBA 2DKHA 3RP8A 1NENA 4L3YA 2JKCA 4JNAA 3AYLA 2GR3A 3RNMA 1D5TA 3BNJA 3BNMA 3IF9A 3QFBA 3SXQA 3NN6X 4P9SA 3ATRA 3GMBA 3DA1A 3FBSA 3AE2A 1DOEA 3S5WA 4BJZA 3GM6A 3CPHG 1PBCA 4YTNA 3ALJA 3FIMB 2IVEA 4C3YA 3NLCA 4Q0TA 1NHRA 4O5QA 3LGQA 2EQ6A 2XYOA 3K30A 2W0HA 4GRTA 2XCGA 2E80A 5LV9A 4K5RA 1NG4A 3TORA 1PBFA 5JCNA 3I6DA 4XWRA 3Q6JA 2F5ZA 1H86A 2YM2A 3P4RA 3GSIA 2GAHB 1ZX9A 2GV8A 4FDCB 3FO3A 1IUUA 1FS8A 4K22A 3BHKA 2GQFA 3ZDNA 1PHHA 3NTAA 5C3JA 4FX9A 2OALA 4CY6A 3EPTA 3NK2X 4G6HA 4AP3A 3NK0X 2YR5A 3LJPA 4GCMA 2V3BA 4YSZA 2CFYA 3C96A 2ZO5A 3GDNA 4X9NA 2O9ZA 2JBVA 4KX6A 4OPIA 4L38A 3COXA 4NWZA 1PJ6A 5FS6A 2H88A 3GYIA 5BVAA 5KMRA 4N9XA 2ZZBA 1DOCA 1ZMDA 1SP3A 4LA1A 4MJWA 1NAAA 4I58A 3REDA 3T0KA 3C4AA 1KDGA 3AXBA 3ISHA 4OCGA 2YLWA 4EIPA 3UTEA 2BS2A 4Z25A 4EMWA 4YSXA 3LOVA 1H6VA 3LZWA 1LJ1A 4ICYA 1KSSA 2R9ZA 4FK1C 3UTHA 4B68A 3LG1A 1ZOVA 1DOBA 1H81A 2WOWA 4DSGA 3CNPA 2VVLG 1IJHA 3MMOA 1E1KA 2BRAA 1FS9A 4Q5CA 2GMJA 2J7AA 3T2ZA 2BC1A 3DGZA 1O5WA 1ZP0A 1JRXA 1EL7A 2V61A 1VG0A 1JEHA 1N1PA 2GMHA 3C4NA 4YTMA 3GWFA 1W4XA 4B66A 5KVHA 1FEBA 2A87A 3TTBA 3AEFA 2DKIA 4H50A 4Q4UA 5GSNA 1FT6A 1NHQA 4H2PA 2CULA 4TM0A 5U63A 4RSLA 2EQ9A 3AD9B 3NKSA 5CKUA 4B69A 3WE0A 4Z2TA 1NHSA 2WP6A 2BCGG 3OZ2A 4H4RA 3LXDA 4K5SA 1V59A 2WDQA 4J56A 4PABA 3CMMA 1O94A 3B6DA 4Y4LA 2A8XA 2YVFA 3T14A 2GB0A 3UOYA 1FCDA 1LTXR 4II2A 5EB5A 5FS8A 3SZCA 1F6MA 1D4DA 1KNPA 1X31B 3QSSA 4IVMB 3H8IA 2XVJA 1K0JA 3ALLA 3D8XA 1O95A 3NTDA 5KVIA 5JCMA 1GU6A 4G6GA 4H4XA 2YVGA 1GV4A 3AD8B 1QDBA 3NG7X 2JB3A 4ZCCA 3ICRA 2H89A 4G74A 2R0GA 1H7XA 2GR1A 2VR0A 1GETA 1IUVA 3CNJA 1S2QA 4C5OA 2XLRA 1Q1WA 2YWLA 4NEVA 2FJEA 3NYFA 3KVEA 4OPLA 4U8PA 1M64A 2OLOA 1H84A 1EL9A 2RGJA 3PVCA 4Z24A 5J7XA 4H4PA 2EQ8A 2XVHA 4NEWA 1N4UA 3AE6A 4Q1OA 1ZKQA 3F8RA 3NH3X 4YKFA 4BURA 4YT0A 1CJ3A 2Y6RA 2APGA 2WP5A 2XLTA 1PBBA 3QJ4A 1AOGA 3EANA 4JDRA 2FJBA 4Q5BA 2VOUA 3KPFA 4H4QA 4Z26A 2OA1A 4DSHA 4L3ZA 4A99A 2E1MA 4CNJA 1BF3A 4TLZA 5FMHA 4K8DA 2FJAA 4APNA 1LV0A 1KF6A 2RGOA 4B1BA 4U8JA 3KLJA 1NEKA 1S3BA 4USRA 3HZLA 2WS3A 2IIDA 1QJDA 1GT8A 2X8GA 4ZN0A 1OAHA 3GYJA 1RYIA 1E1MA 5JCLA 2GQWA 2X99A 3V3OA 2BRYA 3E1TA 4H4ZA 1JNZA 2QA1A 1BVBA 4II3A 4E0VA 3SXIA 4WCTA 3T37A 2B7SA 1PS9A 1VRQB 4A6NB 1CL0A 3DK9A 3AEDA 4JY2A 5KWFA 2E81A 3AWIA 2GH5A 1EL8A 2VQBA 4H2RA 3T31A 3LB8A 2R0PA 5L46A 2E5VA 5BRTA 1CBOA 2YVJA 5M10A 3AECA 4J57A 3UP4A 2Q0LA 1GESA 1LQTA 3BI2A 3IWAA 4H2QA 1H7WA 3BNFA 2VRMA 1CC6A 3SX6A 1JU2A 2CDUA 1M1RA 3H8LA 5U1OA 4NTEA 4ADWA 1ZY8A 1H83A 3F8PA 1IUSA 2GAGB 4U8MA 3UOZA 4FK1A 3UOVA 3VRDB 2RDZA 2QCUA 1JRZA 4H4WA 2YG7A 3L8KA 1TDEA 1PBEA 2YG6A 3UKKA 2BK4A 4CCQA 1VQWA 3FMWA 1BGJA 1F8RA 4GDEA 4H4SA 4M52A 3CGBA 3EF6A 4TLXA 4JNQA 3GD4A 3K7QX 2Q6UA 5KOXA 1YQ4A 2BYBA 4U2LA 3UOXA 3UKFA 2PHHA 4ZCDA 4YWOA 3AD7B 1M1PA 2NVKX 4XXGA 4U2TA 4TM4A 3UTFA 3NYEA 3DJGX 2CZSA 2NPXA 3SZFA 4DNAA 1CHUA 3CGCA 3DMEA 5EOWA 2YG5A 5M0ZA 2YQUA 3AE9A 2C76A 2AQJA 2C64A 4GF7A 3K7TA 4H4UA 3NNEA 3SZWA 4J36A 2Z5XA 2Z5YA 1GERA 1M6IA 4JY3A 3BNHA 4K2XA 1PXAA 2ZBWA 3M12A 5KMPA 1GRBA 5KXJA 3GYXA 4BK2A 3NHOX 1TYPA 3CNDA 1DXLA 3CGEA 4RG3A 2LFCA 1GNDA 4CCRA 1PN0A 3AEAA 2OLNA 1D4CA 1OJCA 1GXFA 4GUVA 3CIRA 2VQ7A 5JCIA 2YR6A 4OPTA 4L3XA 2B9XA 2HQMA 2WPCA 2XLPA 1IUTA 4EQWA 1D4EA 4H4YA 3KPKA 1TDFA 2WQYA 3KD9A 4Z2RA 1XDIA 2C67A 2WDRA 3NK1X 2BXRA 2X8HA 3SYIA 5KOWA 1TRBA 1L9EA 3ICSA 2C3DA 1CJ2A 2V60A 1E1NA 4NTCA 3K7MX 3GDPA 4EQRA 2WOIA 2BCPA 3ITJA 4O5UA 1JRYA 3VQRA 3UKPA 1FECA 3NRNA 4A65A 4BV6A 2C65A 3OWMA 2XDOA 1FT5A 1COYA 1PJ7A 2XLUA 2YLTA 3SM8A 4XWZA 2TMDA 2R4EA 4U8KA 2OT4A 3AB1A 3IC9A 3QSEA 3UU9A 3LZXA 5JCKA 2BXSA 4AP1A 1PXCA 2BACA 4IA5A 5KNLA 4TM1A 3M0OA 3VR8A 1BWCA 3AE3A 1GRFA 1K0LA 3FG2P 3OC4A 3GD3A 5TR3A 3V3NA 4KPRA 3GRTA 3CTYA 3M13A 5ER0A 1PXBA 4BJYA 4YXDA 4NZHA 1TDOA 2OAMA 4AT2A 3Q9TA 1B4VA 1CJCA 4Y4MA 4CRTA 3T2YA 2JB1A 2WPEA 1JNRA 1GALA 1YY5A 2J3NA 2BS3A 3DK4A 2GVCA 2X50A 2AAQA 1KFYA 4CY8A 5HXIA 4GAVA 2YR4A 3BNUA 2C4CA 4X4JA 1GRTA 2V5ZA 4I59A 2TPRA 1CC2A 2XFQA 2C66A 2JK6A 3EAOA 1L9DA 1ONFA 4REKA 4U8NA 2WDVA 1DJQA 3SFEA 3VR9A 2B7RA 1CF3A 2R45A 2FBWA 3UCLA 1L9CA 4A79A 4A5LA 3CNSA 1B5QA 2E4GA 2ACZA 4U8LA 4EM3A 3AEGA 2YG3A 1MXTA 4OPUA 3AE5A 4JN9A 4A6NA 1HYUA 3BHFA 2PYXA 1NDAA 4HB9A 3URHA 1TYTA 3DH9A 4YSYA 3AE4A 2XFNA 3GWDA 5KMSA 3UKAA 1GTEA 5FS7A 1XHCA 1REOA 2JB2A 2YLRA 4EM4A 1EBDA 3CPJG 2IVDA 1KSUA 1BZLA 3CNTA 3I3LA 3P4SA 1P2EA 1KNRA 3CGDA 4OPCA 1FS7A 1EL5A 2XVFA 3DJJA 5EB4A 1UKVG 1GRAA 4B64A 2C73A 3AYJA 1RSGA 3AEBA 4WX1A 1M1QA 2BABA 5IQ1A 1CC4A 4AOSA 1YQ3A 2RF7A 1K4QA 1QO8A 1OJTA 1GPEA 1RP0A 3SCEA 1S3EA 1VDCA 2XLSA 3B3RA 4U8OA 4UP3A 5BULA 2RGHA 3AEEA 2WP9A 4H4TA 1ZK7A 1MOKA 1N4WA 2ARDA 4OPGA 3DK8A 5EBKA 1TDNA 3HYXA 4H2NA 4BK1A 4YKGA 3UP5A 2JAEA 2A89A 4IVOB 3L1TA 2WESA 4JQ9A 2WBAA 1B37A 1ZDLA 4YTPA 2YLSA 2VRLA 2I0ZA 1IUWA 3SY4A 4C74A 3RP7A 1K0IA 1D7LA 2ZZCA 3ICTA 1F8SA 3II4A 3PO7A 4EIQA 1MO9A 2YLXA 2C3CA 2B76A 3AYIA 3AE7A 3AE8A 4ECHA 3RKHA 1GRGA 3QSMA 4H7UA 2VVLA 4J31A 1GOSA 1PBDA 2R4JA 3LADA 3V76A 2C72A 1ZMCA 4CNKA 2WETA 1OJDA 4IV9A 4OVIA 3KU9A 3FPZA 3T2KA 1BGNA 2GR2A 4IA6A 4H4VA 2YLZA 1F3PA 1Y56A 5CQFA 2V6OA 4LIIA 3RP6A 3SZ0A 2Q7VA 3UKQA 2YAUA 3ADAB 1DODA 1Q9IA 1BKWA 3ATQA 3S7WA 1P2HA 3P4QA 3BNGA
chains in the Genus database with same CATH topology
4EQSA 3F8DA 3UKLA 3S61A 2ZZ0A 3NYCA 4X9MA 1FOHA 1GSNA 1DJNA 1H82A 2VZ2A 3ZYXA 4G9KA 4K7ZA 3NT6A 3SFDA 5HYMA 4Y4NA 1NG3A 1IUXA 1E7PA 3QVRA 1XANA 3CN8A 5BUKA 5HHFA 2BK5A 3ABVA 4C77A 3HYWA 3QVPA 1NPXA 5DBJA 5KRQA 3D1CA 4GR1A 1TDKA 2X3NA 1JOAA 2X8CA 4UDQA 4AT0A 3PS9A 2WPFA 1N4VA 1YQZA 3ALMA 4J33A 3G5SA 5U25A 3BI5A 4GAPA 4BK3A 4DGKA 4EMIA 5HY5A 3DGHA 2EQ7A 1DNCA 1NHPA 5IPYA 5IQ4A 4GDPA 4C3XA 4D03A 3NIXA 4TM3A 2GF3A 3JSKA 1JNIA 1SEZA 3R9UA 3D1IA 3VRAA 4J2WA 4NTDA 5KMQA 4UDRA 2Q0KA 3DJDA 2B9WA 3L1RA 2FJDA 3F29A 4A9WA 1L0VA 3O0HA 4RG4A 4Z43A 1Q1RA 1Y56B 4HA6A 4USQA 3KA7A 3P1WA 4A7AA 4U2SA 2GR0A 4CBQA 3G5QA 4OPDA 4J34A 2RABA 1S2YA 2BC0A 2C7GA 4AOXA 4Z44A 3SQPA 3NGCX 2C70A 2XFUA 1PDHA 2CVJA 1ELIA 2WU2A 1FL2A 2Y6QA 1E39A 3P9UA 4B65A 1GRHA 3P4PA 4U8IA 1GEUA 2GRTA 4EMJA 2BA9A 2QA2A 1LVLA 2YM1A 4D04A 3GMCA 3CPIG 3BI4A 3QFAA 2XVIA 2V3AA 2YG4A 4WJYA 3AE1A 3KKJA 1QLBA 1B8SA 1F8WA 3IHGA 1D7YA 2C75A 1ZOYA 2WU5A 3H4KA 5GRTA 3HYVA 3GRSA 3RHAA 2GEWA 1OJ9A 2UZZA 1VG9A 3DJEA 2K3VA 1FEAA 4LU6A 3UKHA 1YKJA 1PJ5A 4EQXA 4B63A 1GREA 1E6EA 1E1LA 2VVMA 4NNJA 3UBRA 4YSHA 1CJ4A 1LQUA 1GTHA 1OJAA 1LPFA 2XFOA 4B67A 3UTGA 2R46A 2XVEA 1Y0PA 2B9YA 1Z6LA 5C2TA 2XFPA 5J60A 4Z2UA 2AR8A 2WOVA 3IHMA 3G5RA 2BK3A 4PAAA 2BS4A 2R0CA 5FS9A 2WHDA 1XPQA 3NN0X 2QAEA 4G73A 4UDPA 2WEUA 4Q17A 3SGLA 3VRBA 2DKHA 3RP8A 1NENA 4L3YA 2JKCA 4JNAA 3AYLA 2GR3A 3RNMA 1D5TA 3BNJA 3BNMA 3IF9A 3QFBA 3SXQA 3NN6X 4P9SA 3ATRA 3GMBA 3DA1A 3FBSA 3AE2A 1DOEA 3S5WA 4BJZA 3GM6A 3CPHG 1PBCA 4YTNA 3ALJA 3FIMB 2IVEA 4C3YA 3NLCA 4Q0TA 1NHRA 4O5QA 3LGQA 2EQ6A 2XYOA 3K30A 2W0HA 4GRTA 2XCGA 2E80A 5LV9A 4K5RA 1NG4A 3TORA 1PBFA 5JCNA 3I6DA 4XWRA 3Q6JA 2F5ZA 1H86A 2YM2A 3P4RA 3GSIA 2GAHB 1ZX9A 2GV8A 4FDCB 3FO3A 1IUUA 1FS8A 4K22A 3BHKA 2GQFA 3ZDNA 1PHHA 3NTAA 5C3JA 4FX9A 2OALA 4CY6A 3EPTA 3NK2X 4G6HA 4AP3A 3NK0X 2YR5A 3LJPA 4GCMA 2V3BA 4YSZA 2CFYA 3C96A 2ZO5A 3GDNA 4X9NA 2O9ZA 2JBVA 4KX6A 4OPIA 4L38A 3COXA 4NWZA 1PJ6A 5FS6A 2H88A 3GYIA 5BVAA 5KMRA 4N9XA 2ZZBA 1DOCA 1ZMDA 1SP3A 4LA1A 4MJWA 1NAAA 4I58A 3REDA 3T0KA 3C4AA 1KDGA 3AXBA 3ISHA 4OCGA 2YLWA 4EIPA 3UTEA 2BS2A 4Z25A 4EMWA 4YSXA 3LOVA 1H6VA 3LZWA 1LJ1A 4ICYA 1KSSA 2R9ZA 4FK1C 3UTHA 4B68A 3LG1A 1ZOVA 1DOBA 1H81A 2WOWA 4DSGA 3CNPA 2VVLG 1IJHA 3MMOA 1E1KA 2BRAA 1FS9A 4Q5CA 2GMJA 2J7AA 3T2ZA 2BC1A 3DGZA 1O5WA 1ZP0A 1JRXA 1EL7A 2V61A 1VG0A 1JEHA 1N1PA 2GMHA 3C4NA 4YTMA 3GWFA 1W4XA 4B66A 5KVHA 1FEBA 2A87A 3TTBA 3AEFA 2DKIA 4H50A 4Q4UA 5GSNA 1FT6A 1NHQA 4H2PA 2CULA 4TM0A 5U63A 4RSLA 2EQ9A 3AD9B 3NKSA 5CKUA 4B69A 3WE0A 4Z2TA 1NHSA 2WP6A 2BCGG 3OZ2A 4H4RA 3LXDA 4K5SA 1V59A 2WDQA 4J56A 4PABA 3CMMA 1O94A 3B6DA 4Y4LA 2A8XA 2YVFA 3T14A 2GB0A 3UOYA 1FCDA 1LTXR 4II2A 5EB5A 5FS8A 3SZCA 1F6MA 1D4DA 1KNPA 1X31B 3QSSA 4IVMB 3H8IA 2XVJA 1K0JA 3ALLA 3D8XA 1O95A 3NTDA 5KVIA 5JCMA 1GU6A 4G6GA 4H4XA 2YVGA 1GV4A 3AD8B 1QDBA 3NG7X 2JB3A 4ZCCA 3ICRA 2H89A 4G74A 2R0GA 1H7XA 2GR1A 2VR0A 1GETA 1IUVA 3CNJA 1S2QA 4C5OA 2XLRA 1Q1WA 2YWLA 4NEVA 2FJEA 3NYFA 3KVEA 4OPLA 4U8PA 1M64A 2OLOA 1H84A 1EL9A 2RGJA 3PVCA 4Z24A 5J7XA 4H4PA 2EQ8A 2XVHA 4NEWA 1N4UA 3AE6A 4Q1OA 1ZKQA 3F8RA 3NH3X 4YKFA 4BURA 4YT0A 1CJ3A 2Y6RA 2APGA 2WP5A 2XLTA 1PBBA 3QJ4A 1AOGA 3EANA 4JDRA 2FJBA 4Q5BA 2VOUA 3KPFA 4H4QA 4Z26A 2OA1A 4DSHA 4L3ZA 4A99A 2E1MA 4CNJA 1BF3A 4TLZA 5FMHA 4K8DA 2FJAA 4APNA 1LV0A 1KF6A 2RGOA 4B1BA 4U8JA 3KLJA 1NEKA 1S3BA 4USRA 3HZLA 2WS3A 2IIDA 1QJDA 1GT8A 2X8GA 4ZN0A 1OAHA 3GYJA 1RYIA 1E1MA 5JCLA 2GQWA 2X99A 3V3OA 2BRYA 3E1TA 4H4ZA 1JNZA 2QA1A 1BVBA 4II3A 4E0VA 3SXIA 4WCTA 3T37A 2B7SA 1PS9A 1VRQB 4A6NB 1CL0A 3DK9A 3AEDA 4JY2A 5KWFA 2E81A 3AWIA 2GH5A 1EL8A 2VQBA 4H2RA 3T31A 3LB8A 2R0PA 5L46A 2E5VA 5BRTA 1CBOA 2YVJA 5M10A 3AECA 4J57A 3UP4A 2Q0LA 1GESA 1LQTA 3BI2A 3IWAA 4H2QA 1H7WA 3BNFA 2VRMA 1CC6A 3SX6A 1JU2A 2CDUA 1M1RA 3H8LA 5U1OA 4NTEA 4ADWA 1ZY8A 1H83A 3F8PA 1IUSA 2GAGB 4U8MA 3UOZA 4FK1A 3UOVA 3VRDB 2RDZA 2QCUA 1JRZA 4H4WA 2YG7A 3L8KA 1TDEA 1PBEA 2YG6A 3UKKA 2BK4A 4CCQA 1VQWA 3FMWA 1BGJA 1F8RA 4GDEA 4H4SA 4M52A 3CGBA 3EF6A 4TLXA 4JNQA 3GD4A 3K7QX 2Q6UA 5KOXA 1YQ4A 2BYBA 4U2LA 3UOXA 3UKFA 2PHHA 4ZCDA 4YWOA 3AD7B 1M1PA 2NVKX 4XXGA 4U2TA 4TM4A 3UTFA 3NYEA 3DJGX 2NPXA 3SZFA 4DNAA 1CHUA 3CGCA 3DMEA 5EOWA 2YG5A 5M0ZA 2YQUA 3AE9A 2C76A 2AQJA 2C64A 4GF7A 3K7TA 4H4UA 3NNEA 3SZWA 4J36A 2Z5XA 2Z5YA 1GERA 1M6IA 4JY3A 3BNHA 4K2XA 1PXAA 2ZBWA 3M12A 5KMPA 1GRBA 5KXJA 3GYXA 4BK2A 3NHOX 1TYPA 3CNDA 1DXLA 3CGEA 4RG3A 2LFCA 1GNDA 4CCRA 1PN0A 3AEAA 2OLNA 1D4CA 1OJCA 1GXFA 4GUVA 3CIRA 2VQ7A 5JCIA 2YR6A 4OPTA 4L3XA 2B9XA 2HQMA 2WPCA 2XLPA 1IUTA 4EQWA 1D4EA 4H4YA 3KPKA 1TDFA 2WQYA 3KD9A 4Z2RA 1XDIA 2C67A 2WDRA 3NK1X 2BXRA 2X8HA 3SYIA 5KOWA 1TRBA 1L9EA 3ICSA 2C3DA 1CJ2A 2V60A 1E1NA 4NTCA 3K7MX 3GDPA 4EQRA 2WOIA 2BCPA 3ITJA 4O5UA 1JRYA 3VQRA 3UKPA 1FECA 3NRNA 4A65A 4BV6A 2C65A 3OWMA 2XDOA 1FT5A 1COYA 1PJ7A 2XLUA 2YLTA 3SM8A 4XWZA 2TMDA 2R4EA 4U8KA 2OT4A 3AB1A 3IC9A 3QSEA 3UU9A 3LZXA 5JCKA 2BXSA 4AP1A 1PXCA 2BACA 4IA5A 5KNLA 4TM1A 3M0OA 3VR8A 1BWCA 3AE3A 1GRFA 1K0LA 3FG2P 3OC4A 3GD3A 5TR3A 3V3NA 4KPRA 3GRTA 3CTYA 3M13A 5ER0A 1PXBA 4BJYA 4YXDA 4NZHA 1TDOA 2OAMA 4AT2A 3Q9TA 1B4VA 1CJCA 4Y4MA 4CRTA 3T2YA 2JB1A 2WPEA 1JNRA 1GALA 1YY5A 2J3NA 2BS3A 3DK4A 2GVCA 2X50A 2AAQA 1KFYA 4CY8A 5HXIA 4GAVA 2YR4A 3BNUA 2C4CA 4X4JA 1GRTA 2V5ZA 4I59A 2TPRA 1CC2A 2XFQA 2C66A 2JK6A 3EAOA 1L9DA 1ONFA 4REKA 4U8NA 2WDVA 1DJQA 3SFEA 3VR9A 2B7RA 1CF3A 2R45A 2FBWA 3UCLA 1L9CA 4A79A 4A5LA 3CNSA 1B5QA 2E4GA 2ACZA 4U8LA 4EM3A 3AEGA 2YG3A 1MXTA 4OPUA 3AE5A 4JN9A 4A6NA 1HYUA 3BHFA 2PYXA 1NDAA 4HB9A 3URHA 1TYTA 3DH9A 4YSYA 3AE4A 2XFNA 3GWDA 5KMSA 3UKAA 1GTEA 5FS7A 1XHCA 1REOA 2JB2A 2YLRA 4EM4A 1EBDA 3CPJG 2IVDA 1KSUA 1BZLA 3CNTA 3I3LA 3P4SA 1P2EA 1KNRA 3CGDA 4OPCA 1FS7A 1EL5A 2XVFA 3DJJA 5EB4A 1UKVG 1GRAA 4B64A 2C73A 3AYJA 1RSGA 3AEBA 4WX1A 1M1QA 2BABA 5IQ1A 1CC4A 4AOSA 1YQ3A 2RF7A 1K4QA 1QO8A 1OJTA 1GPEA 1RP0A 3SCEA 1S3EA 1VDCA 2XLSA 3B3RA 4U8OA 4UP3A 5BULA 2RGHA 3AEEA 2WP9A 4H4TA 1ZK7A 1MOKA 1N4WA 2ARDA 4OPGA 3DK8A 5EBKA 1TDNA 3HYXA 4H2NA 4BK1A 4YKGA 3UP5A 2JAEA 2A89A 4IVOB 3L1TA 2WESA 4JQ9A 2WBAA 1B37A 1ZDLA 4YTPA 2YLSA 2VRLA 2I0ZA 1IUWA 3SY4A 4C74A 3RP7A 1K0IA 1D7LA 2ZZCA 3ICTA 1F8SA 3II4A 3PO7A 4EIQA 1MO9A 2YLXA 2C3CA 2B76A 3AYIA 3AE7A 3AE8A 4ECHA 3RKHA 1GRGA 3QSMA 4H7UA 2VVLA 4J31A 1GOSA 1PBDA 2R4JA 3LADA 3V76A 2C72A 1ZMCA 4CNKA 2WETA 1OJDA 4IV9A 4OVIA 3KU9A 3FPZA 3T2KA 1BGNA 2GR2A 4IA6A 4H4VA 2YLZA 1F3PA 1Y56A 5CQFA 2V6OA 4LIIA 3RP6A 3SZ0A 2Q7VA 3UKQA 2YAUA 3ADAB 1DODA 1Q9IA 1BKWA 3ATQA 3S7WA 1P2HA 3P4QA 3BNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQS A;  3F8D A;  3UKL A;  3S61 A;  2ZZ0 A;  3NYC A;  4X9M A;  1FOH A;  1GSN A;  1DJN A;  1H82 A;  2VZ2 A;  3ZYX A;  4K7Z A;  3NT6 A;  3SFD A;  5HYM A;  4Y4N A;  1NG3 A;  1IUX A;  1E7P A;  3QVR A;  1XAN A;  3CN8 A;  5BUK A;  5HHF A;  2BK5 A;  3ABV A;  4C77 A;  3QVP A;  1NPX A;  5DBJ A;  5KRQ A;  3D1C A;  4GR1 A;  1TDK A;  2X3N A;  1JOA A;  2X8C A;  4UDQ A;  4AT0 A;  3PS9 A;  2WPF A;  1N4V A;  1YQZ A;  3ALM A;  4J33 A;  3G5S A;  5U25 A;  3BI5 A;  4BK3 A;  4DGK A;  4EMI A;  5HY5 A;  3DGH A;  2EQ7 A;  1DNC A;  1NHP A;  5IPY A;  5IQ4 A;  4GDP A;  4C3X A;  4D03 A;  3NIX A;  4TM3 A;  2GF3 A;  3JSK A;  1JNI A;  1SEZ A;  3R9U A;  3D1I A;  3VRA A;  4J2W A;  4NTD A;  4UDR A;  2Q0K A;  3DJD A;  2B9W A;  3L1R A;  2FJD A;  3F29 A;  4A9W A;  1L0V A;  3O0H A;  4RG4 A;  4Z43 A;  1Q1R A;  1Y56 B;  4HA6 A;  4USQ A;  3KA7 A;  3P1W A;  4A7A A;  4U2S A;  2GR0 A;  4CBQ A;  3G5Q A;  4OPD A;  4J34 A;  2RAB A;  1S2Y A;  2BC0 A;  2C7G A;  4AOX A;  4Z44 A;  3SQP A;  3NGC X;  2C70 A;  2XFU A;  1PDH A;  2CVJ A;  1ELI A;  2WU2 A;  1FL2 A;  2Y6Q A;  1E39 A;  3P9U A;  4B65 A;  1GRH A;  3P4P A;  4U8I A;  1GEU A;  2GRT A;  4EMJ A;  2BA9 A;  2QA2 A;  1LVL A;  2YM1 A;  4D04 A;  3GMC A;  3CPI G;  3BI4 A;  3QFA A;  2XVI A;  2V3A A;  2YG4 A;  4WJY A;  3AE1 A;  3KKJ A;  1QLB A;  1B8S A;  1F8W A;  3IHG A;  1D7Y A;  2C75 A;  1ZOY A;  2WU5 A;  3H4K A;  5GRT A;  3GRS A;  3RHA A;  2GEW A;  1OJ9 A;  2UZZ A;  1VG9 A;  3DJE A;  2K3V A;  1FEA A;  4LU6 A;  3UKH A;  1YKJ A;  1PJ5 A;  4EQX A;  4B63 A;  1GRE A;  1E6E A;  1E1L A;  2VVM A;  3UBR A;  4YSH A;  1CJ4 A;  1LQU A;  1GTH A;  1OJA A;  1LPF A;  2XFO A;  4B67 A;  3UTG A;  2R46 A;  2XVE A;  1Y0P A;  2B9Y A;  1Z6L A;  5C2T A;  2XFP A;  5J60 A;  4Z2U A;  2AR8 A;  2WOV A;  3IHM A;  3G5R A;  2BK3 A;  4PAA A;  2BS4 A;  2R0C A;  5FS9 A;  2WHD A;  1XPQ A;  3NN0 X;  2QAE A;  4UDP A;  2WEU A;  4Q17 A;  3SGL A;  3VRB A;  2DKH A;  3RP8 A;  1NEN A;  4L3Y A;  2JKC A;  4JNA A;  3AYL A;  2GR3 A;  3RNM A;  1D5T A;  3BNJ A;  3BNM A;  3IF9 A;  3QFB A;  3SXQ A;  3NN6 X;  4P9S A;  3ATR A;  3GMB A;  3DA1 A;  3FBS A;  3AE2 A;  1DOE A;  3S5W A;  4BJZ A;  3GM6 A;  3CPH G;  1PBC A;  4YTN A;  3ALJ A;  3FIM B;  2IVE A;  4C3Y A;  3NLC A;  4Q0T A;  1NHR A;  4O5Q A;  3LGQ A;  2EQ6 A;  2XYO A;  3K30 A;  2W0H A;  4GRT A;  2XCG A;  2E80 A;  5LV9 A;  4K5R A;  1NG4 A;  3TOR A;  1PBF A;  5JCN A;  3I6D A;  4XWR A;  3Q6J A;  2F5Z A;  1H86 A;  2YM2 A;  3P4R A;  3GSI A;  2GAH B;  1ZX9 A;  2GV8 A;  4FDC B;  3FO3 A;  1IUU A;  1FS8 A;  4K22 A;  3BHK A;  2GQF A;  3ZDN A;  1PHH A;  3NTA A;  5C3J A;  4FX9 A;  2OAL A;  4CY6 A;  3EPT A;  3NK2 X;  4AP3 A;  3NK0 X;  2YR5 A;  3LJP A;  4GCM A;  2V3B A;  4YSZ A;  2CFY A;  3C96 A;  2ZO5 A;  3GDN A;  4X9N A;  2O9Z A;  2JBV A;  4KX6 A;  4OPI A;  4L38 A;  3COX A;  1PJ6 A;  5FS6 A;  2H88 A;  3GYI A;  5BVA A;  4N9X A;  2ZZB A;  1DOC A;  1ZMD A;  1SP3 A;  4LA1 A;  4MJW A;  1NAA A;  4I58 A;  3RED A;  3C4A A;  1KDG A;  3AXB A;  3ISH A;  4OCG A;  2YLW A;  4EIP A;  3UTE A;  2BS2 A;  4Z25 A;  4EMW A;  4YSX A;  3LOV A;  1H6V A;  3LZW A;  1LJ1 A;  4ICY A;  1KSS A;  2R9Z A;  4FK1 C;  3UTH A;  4B68 A;  3LG1 A;  1ZOV A;  1DOB A;  1H81 A;  2WOW A;  4DSG A;  3CNP A;  2VVL G;  1IJH A;  3MMO A;  1E1K A;  1FS9 A;  4Q5C A;  2GMJ A;  2J7A A;  2BC1 A;  3DGZ A;  1O5W A;  1ZP0 A;  1JRX A;  1EL7 A;  2V61 A;  1VG0 A;  1JEH A;  1N1P A;  2GMH A;  3C4N A;  4YTM A;  3GWF A;  1W4X A;  4B66 A;  5KVH A;  1FEB A;  2A87 A;  3TTB A;  3AEF A;  2DKI A;  4H50 A;  4Q4U A;  5GSN A;  1FT6 A;  1NHQ A;  4H2P A;  2CUL A;  4TM0 A;  5U63 A;  4RSL A;  2EQ9 A;  3AD9 B;  3NKS A;  5CKU A;  4B69 A;  3WE0 A;  4Z2T A;  1NHS A;  2WP6 A;  2BCG G;  3OZ2 A;  4H4R A;  3LXD A;  4K5S A;  1V59 A;  2WDQ A;  4J56 A;  4PAB A;  1O94 A;  3B6D A;  4Y4L A;  2A8X A;  2YVF A;  2GB0 A;  3UOY A;  1FCD A;  1LTX R;  5FS8 A;  5EB5 A;  1F6M A;  1D4D A;  1KNP A;  1X31 B;  3QSS A;  4IVM B;  3H8I A;  2XVJ A;  1K0J A;  3ALL A;  3D8X A;  1O95 A;  3NTD A;  5KVI A;  5JCM A;  1GU6 A;  4H4X A;  2YVG A;  1GV4 A;  3AD8 B;  1QDB A;  3NG7 X;  2JB3 A;  4ZCC A;  3ICR A;  2H89 A;  2R0G A;  1H7X A;  2GR1 A;  2VR0 A;  1GET A;  1IUV A;  3CNJ A;  1S2Q A;  4C5O A;  2XLR A;  1Q1W A;  2YWL A;  4NEV A;  2FJE A;  3NYF A;  3KVE A;  4OPL A;  4U8P A;  1M64 A;  2OLO A;  1H84 A;  1EL9 A;  2RGJ A;  3PVC A;  4Z24 A;  5J7X A;  4H4P A;  2EQ8 A;  2XVH A;  4NEW A;  1N4U A;  3AE6 A;  4Q1O A;  1ZKQ A;  3F8R A;  3NH3 X;  4YKF A;  4BUR A;  4YT0 A;  1CJ3 A;  2Y6R A;  2APG A;  2WP5 A;  2XLT A;  1PBB A;  3QJ4 A;  1AOG A;  3EAN A;  4JDR A;  2FJB A;  4Q5B A;  2VOU A;  3KPF A;  4H4Q A;  4Z26 A;  2OA1 A;  4DSH A;  4L3Z A;  4A99 A;  2E1M A;  4CNJ A;  1BF3 A;  4TLZ A;  5FMH A;  4K8D A;  2FJA A;  4APN A;  1LV0 A;  1KF6 A;  2RGO A;  4B1B A;  4U8J A;  3KLJ A;  1NEK A;  1S3B A;  4USR A;  3HZL A;  2WS3 A;  2IID A;  1QJD A;  1GT8 A;  2X8G A;  4ZN0 A;  1OAH A;  3GYJ A;  1RYI A;  1E1M A;  5JCL A;  2GQW A;  2X99 A;  3V3O A;  3E1T A;  4H4Z A;  1JNZ A;  2QA1 A;  1BVB A;  4E0V A;  4WCT A;  3T37 A;  2B7S A;  1PS9 A;  1VRQ B;  4A6N B;  1CL0 A;  3DK9 A;  3AED A;  4JY2 A;  5KWF A;  2E81 A;  3AWI A;  2GH5 A;  1EL8 A;  2VQB A;  4H2R A;  3LB8 A;  2R0P A;  5L46 A;  2E5V A;  5BRT A;  1CBO A;  2YVJ A;  5M10 A;  3AEC A;  4J57 A;  3UP4 A;  2Q0L A;  1GES A;  1LQT A;  3BI2 A;  3IWA A;  4H2Q A;  1H7W A;  3BNF A;  2VRM A;  1CC6 A;  1JU2 A;  2CDU A;  1M1R A;  3H8L A;  5U1O A;  4NTE A;  4ADW A;  1ZY8 A;  1H83 A;  3F8P A;  1IUS A;  2GAG B;  4U8M A;  3UOZ A;  4FK1 A;  3UOV A;  3VRD B;  2RDZ A;  2QCU A;  1JRZ A;  4H4W A;  2YG7 A;  3L8K A;  1TDE A;  1PBE A;  2YG6 A;  3UKK A;  2BK4 A;  4CCQ A;  1VQW A;  3FMW A;  1BGJ A;  1F8R A;  4GDE A;  4H4S A;  4M52 A;  3CGB A;  3EF6 A;  4TLX A;  4JNQ A;  3GD4 A;  3K7Q X;  2Q6U A;  5KOX A;  1YQ4 A;  2BYB A;  4U2L A;  3UOX A;  3UKF A;  2PHH A;  4ZCD A;  4YWO A;  3AD7 B;  1M1P A;  2NVK X;  4XXG A;  4U2T A;  4TM4 A;  3UTF A;  3NYE A;  3DJG X;  2NPX A;  4DNA A;  1CHU A;  3CGC A;  3DME A;  5EOW A;  2YG5 A;  5M0Z A;  2YQU A;  3AE9 A;  2C76 A;  2AQJ A;  2C64 A;  4GF7 A;  3K7T A;  4H4U A;  3NNE A;  4J36 A;  2Z5X A;  2Z5Y A;  1GER A;  1M6I A;  4JY3 A;  3BNH A;  4K2X A;  1PXA A;  2ZBW A;  3M12 A;  1GRB A;  5KXJ A;  3GYX A;  4BK2 A;  3NHO X;  1TYP A;  3CND A;  1DXL A;  3CGE A;  4RG3 A;  2LFC A;  1GND A;  4CCR A;  1PN0 A;  3AEA A;  2OLN A;  1D4C A;  1OJC A;  1GXF A;  4GUV A;  3CIR A;  2VQ7 A;  5JCI A;  2YR6 A;  4OPT A;  4L3X A;  2B9X A;  2HQM A;  2WPC A;  2XLP A;  1IUT A;  4EQW A;  1D4E A;  4H4Y A;  1TDF A;  2WQY A;  3KD9 A;  4Z2R A;  1XDI A;  2C67 A;  2WDR A;  3NK1 X;  2BXR A;  2X8H A;  5KOW A;  1TRB A;  1L9E A;  3ICS A;  2C3D A;  1CJ2 A;  2V60 A;  1E1N A;  4NTC A;  3K7M X;  3GDP A;  4EQR A;  2WOI A;  2BCP A;  3ITJ A;  4O5U A;  1JRY A;  3VQR A;  3UKP A;  1FEC A;  3NRN A;  4A65 A;  4BV6 A;  2C65 A;  3OWM A;  2XDO A;  1FT5 A;  1COY A;  1PJ7 A;  2XLU A;  2YLT A;  3SM8 A;  4XWZ A;  2TMD A;  2R4E A;  4U8K A;  2OT4 A;  3AB1 A;  3IC9 A;  3QSE A;  3UU9 A;  3LZX A;  5JCK A;  2BXS A;  4AP1 A;  1PXC A;  2BAC A;  4IA5 A;  4TM1 A;  3M0O A;  3VR8 A;  1BWC A;  3AE3 A;  1GRF A;  1K0L A;  3FG2 P;  3OC4 A;  3GD3 A;  5TR3 A;  3V3N A;  4KPR A;  3GRT A;  3CTY A;  3M13 A;  5ER0 A;  1PXB A;  4BJY A;  4YXD A;  4NZH A;  1TDO A;  2OAM A;  4AT2 A;  3Q9T A;  1B4V A;  1CJC A;  4Y4M A;  4CRT A;  2JB1 A;  2WPE A;  1JNR A;  1GAL A;  1YY5 A;  2J3N A;  2BS3 A;  3DK4 A;  2GVC A;  2X50 A;  2AAQ A;  1KFY A;  4CY8 A;  5HXI A;  2YR4 A;  3BNU A;  4X4J A;  1GRT A;  2V5Z A;  4I59 A;  2TPR A;  1CC2 A;  2XFQ A;  2C66 A;  2JK6 A;  3EAO A;  1L9D A;  1ONF A;  4REK A;  4U8N A;  2WDV A;  1DJQ A;  3SFE A;  3VR9 A;  2B7R A;  1CF3 A;  2R45 A;  2FBW A;  3UCL A;  1L9C A;  4A79 A;  4A5L A;  3CNS A;  1B5Q A;  2E4G A;  2ACZ A;  4U8L A;  4EM3 A;  3AEG A;  2YG3 A;  1MXT A;  4OPU A;  3AE5 A;  4JN9 A;  4A6N A;  1HYU A;  3BHF A;  2PYX A;  1NDA A;  4HB9 A;  3URH A;  1TYT A;  3DH9 A;  4YSY A;  3AE4 A;  2XFN A;  3GWD A;  3UKA A;  1GTE A;  5FS7 A;  1XHC A;  1REO A;  2JB2 A;  2YLR A;  4EM4 A;  1EBD A;  3CPJ G;  2IVD A;  1KSU A;  1BZL A;  3CNT A;  3I3L A;  3P4S A;  1P2E A;  1KNR A;  3CGD A;  4OPC A;  1FS7 A;  1EL5 A;  2XVF A;  3DJJ A;  5EB4 A;  1UKV G;  1GRA A;  4B64 A;  2C73 A;  3AYJ A;  1RSG A;  3AEB A;  4WX1 A;  1M1Q A;  2BAB A;  5IQ1 A;  1CC4 A;  4AOS A;  1YQ3 A;  2RF7 A;  1K4Q A;  1QO8 A;  1OJT A;  1GPE A;  1RP0 A;  3SCE A;  1S3E A;  1VDC A;  2XLS A;  3B3R A;  4U8O A;  4UP3 A;  5BUL A;  2RGH A;  3AEE A;  2WP9 A;  4H4T A;  1ZK7 A;  1MOK A;  1N4W A;  2ARD A;  4OPG A;  3DK8 A;  5EBK A;  1TDN A;  4H2N A;  4BK1 A;  4YKG A;  3UP5 A;  2JAE A;  2A89 A;  4IVO B;  3L1T A;  2WES A;  4JQ9 A;  2WBA A;  1B37 A;  1ZDL A;  4YTP A;  2YLS A;  2VRL A;  2I0Z A;  1IUW A;  4C74 A;  3RP7 A;  1K0I A;  1D7L A;  2ZZC A;  3ICT A;  1F8S A;  3II4 A;  3PO7 A;  4EIQ A;  1MO9 A;  2YLX A;  2C3C A;  2B76 A;  3AYI A;  3AE7 A;  3AE8 A;  4ECH A;  3RKH A;  1GRG A;  3QSM A;  4H7U A;  2VVL A;  4J31 A;  1GOS A;  1PBD A;  2R4J A;  3LAD A;  3V76 A;  2C72 A;  1ZMC A;  4CNK A;  2WET A;  1OJD A;  4IV9 A;  4OVI A;  3KU9 A;  3FPZ A;  1BGN A;  2GR2 A;  4IA6 A;  4H4V A;  2YLZ A;  1F3P A;  1Y56 A;  5CQF A;  2V6O A;  4LII A;  3RP6 A;  3UKQ A;  2Q7V A;  2YAU A;  3ADA B;  1DOD A;  1Q9I A;  1BKW A;  3ATQ A;  3S7W A;  1P2H A;  3P4Q A;  3BNG A; 
#chains in the Genus database with same CATH topology
 4EQS A;  3F8D A;  3UKL A;  3S61 A;  2ZZ0 A;  3NYC A;  4X9M A;  1FOH A;  1GSN A;  1DJN A;  1H82 A;  2VZ2 A;  3ZYX A;  4G9K A;  4K7Z A;  3NT6 A;  3SFD A;  5HYM A;  4Y4N A;  1NG3 A;  1IUX A;  1E7P A;  3QVR A;  1XAN A;  3CN8 A;  5BUK A;  5HHF A;  2BK5 A;  3ABV A;  4C77 A;  3HYW A;  3QVP A;  1NPX A;  5DBJ A;  5KRQ A;  3D1C A;  4GR1 A;  1TDK A;  2X3N A;  1JOA A;  2X8C A;  4UDQ A;  4AT0 A;  3PS9 A;  2WPF A;  1N4V A;  1YQZ A;  3ALM A;  4J33 A;  3G5S A;  5U25 A;  3BI5 A;  4GAP A;  4BK3 A;  4DGK A;  4EMI A;  5HY5 A;  3DGH A;  2EQ7 A;  1DNC A;  1NHP A;  5IPY A;  5IQ4 A;  4GDP A;  4C3X A;  4D03 A;  3NIX A;  4TM3 A;  2GF3 A;  3JSK A;  1JNI A;  1SEZ A;  3R9U A;  3D1I A;  3VRA A;  4J2W A;  4NTD A;  5KMQ A;  4UDR A;  2Q0K A;  3DJD A;  2B9W A;  3L1R A;  2FJD A;  3F29 A;  4A9W A;  1L0V A;  3O0H A;  4RG4 A;  4Z43 A;  1Q1R A;  1Y56 B;  4HA6 A;  4USQ A;  3KA7 A;  3P1W A;  4A7A A;  4U2S A;  2GR0 A;  4CBQ A;  3G5Q A;  4OPD A;  4J34 A;  2RAB A;  1S2Y A;  2BC0 A;  2C7G A;  4AOX A;  4Z44 A;  3SQP A;  3NGC X;  2C70 A;  2XFU A;  1PDH A;  2CVJ A;  1ELI A;  2WU2 A;  1FL2 A;  2Y6Q A;  1E39 A;  3P9U A;  4B65 A;  1GRH A;  3P4P A;  4U8I A;  1GEU A;  2GRT A;  4EMJ A;  2BA9 A;  2QA2 A;  1LVL A;  2YM1 A;  4D04 A;  3GMC A;  3CPI G;  3BI4 A;  3QFA A;  2XVI A;  2V3A A;  2YG4 A;  4WJY A;  3AE1 A;  3KKJ A;  1QLB A;  1B8S A;  1F8W A;  3IHG A;  1D7Y A;  2C75 A;  1ZOY A;  2WU5 A;  3H4K A;  5GRT A;  3HYV A;  3GRS A;  3RHA A;  2GEW A;  1OJ9 A;  2UZZ A;  1VG9 A;  3DJE A;  2K3V A;  1FEA A;  4LU6 A;  3UKH A;  1YKJ A;  1PJ5 A;  4EQX A;  4B63 A;  1GRE A;  1E6E A;  1E1L A;  2VVM A;  4NNJ A;  3UBR A;  4YSH A;  1CJ4 A;  1LQU A;  1GTH A;  1OJA A;  1LPF A;  2XFO A;  4B67 A;  3UTG A;  2R46 A;  2XVE A;  1Y0P A;  2B9Y A;  1Z6L A;  5C2T A;  2XFP A;  5J60 A;  4Z2U A;  2AR8 A;  2WOV A;  3IHM A;  3G5R A;  2BK3 A;  4PAA A;  2BS4 A;  2R0C A;  5FS9 A;  2WHD A;  1XPQ A;  3NN0 X;  2QAE A;  4G73 A;  4UDP A;  2WEU A;  4Q17 A;  3SGL A;  3VRB A;  2DKH A;  3RP8 A;  1NEN A;  4L3Y A;  2JKC A;  4JNA A;  3AYL A;  2GR3 A;  3RNM A;  1D5T A;  3BNJ A;  3BNM A;  3IF9 A;  3QFB A;  3SXQ A;  3NN6 X;  4P9S A;  3ATR A;  3GMB A;  3DA1 A;  3FBS A;  3AE2 A;  1DOE A;  3S5W A;  4BJZ A;  3GM6 A;  3CPH G;  1PBC A;  4YTN A;  3ALJ A;  3FIM B;  2IVE A;  4C3Y A;  3NLC A;  4Q0T A;  1NHR A;  4O5Q A;  3LGQ A;  2EQ6 A;  2XYO A;  3K30 A;  2W0H A;  4GRT A;  2XCG A;  2E80 A;  5LV9 A;  4K5R A;  1NG4 A;  3TOR A;  1PBF A;  5JCN A;  3I6D A;  4XWR A;  3Q6J A;  2F5Z A;  1H86 A;  2YM2 A;  3P4R A;  3GSI A;  2GAH B;  1ZX9 A;  2GV8 A;  4FDC B;  3FO3 A;  1IUU A;  1FS8 A;  4K22 A;  3BHK A;  2GQF A;  3ZDN A;  1PHH A;  3NTA A;  5C3J A;  4FX9 A;  2OAL A;  4CY6 A;  3EPT A;  3NK2 X;  4G6H A;  4AP3 A;  3NK0 X;  2YR5 A;  3LJP A;  4GCM A;  2V3B A;  4YSZ A;  2CFY A;  3C96 A;  2ZO5 A;  3GDN A;  4X9N A;  2O9Z A;  2JBV A;  4KX6 A;  4OPI A;  4L38 A;  3COX A;  4NWZ A;  1PJ6 A;  5FS6 A;  2H88 A;  3GYI A;  5BVA A;  5KMR A;  4N9X A;  2ZZB A;  1DOC A;  1ZMD A;  1SP3 A;  4LA1 A;  4MJW A;  1NAA A;  4I58 A;  3RED A;  3T0K A;  3C4A A;  1KDG A;  3AXB A;  3ISH A;  4OCG A;  2YLW A;  4EIP A;  3UTE A;  2BS2 A;  4Z25 A;  4EMW A;  4YSX A;  3LOV A;  1H6V A;  3LZW A;  1LJ1 A;  4ICY A;  1KSS A;  2R9Z A;  4FK1 C;  3UTH A;  4B68 A;  3LG1 A;  1ZOV A;  1DOB A;  1H81 A;  2WOW A;  4DSG A;  3CNP A;  2VVL G;  1IJH A;  3MMO A;  1E1K A;  2BRA A;  1FS9 A;  4Q5C A;  2GMJ A;  2J7A A;  3T2Z A;  2BC1 A;  3DGZ A;  1O5W A;  1ZP0 A;  1JRX A;  1EL7 A;  2V61 A;  1VG0 A;  1JEH A;  1N1P A;  2GMH A;  3C4N A;  4YTM A;  3GWF A;  1W4X A;  4B66 A;  5KVH A;  1FEB A;  2A87 A;  3TTB A;  3AEF A;  2DKI A;  4H50 A;  4Q4U A;  5GSN A;  1FT6 A;  1NHQ A;  4H2P A;  2CUL A;  4TM0 A;  5U63 A;  4RSL A;  2EQ9 A;  3AD9 B;  3NKS A;  5CKU A;  4B69 A;  3WE0 A;  4Z2T A;  1NHS A;  2WP6 A;  2BCG G;  3OZ2 A;  4H4R A;  3LXD A;  4K5S A;  1V59 A;  2WDQ A;  4J56 A;  4PAB A;  3CMM A;  1O94 A;  3B6D A;  4Y4L A;  2A8X A;  2YVF A;  3T14 A;  2GB0 A;  3UOY A;  1FCD A;  1LTX R;  4II2 A;  5EB5 A;  5FS8 A;  3SZC A;  1F6M A;  1D4D A;  1KNP A;  1X31 B;  3QSS A;  4IVM B;  3H8I A;  2XVJ A;  1K0J A;  3ALL A;  3D8X A;  1O95 A;  3NTD A;  5KVI A;  5JCM A;  1GU6 A;  4G6G A;  4H4X A;  2YVG A;  1GV4 A;  3AD8 B;  1QDB A;  3NG7 X;  2JB3 A;  4ZCC A;  3ICR A;  2H89 A;  4G74 A;  2R0G A;  1H7X A;  2GR1 A;  2VR0 A;  1GET A;  1IUV A;  3CNJ A;  1S2Q A;  4C5O A;  2XLR A;  1Q1W A;  2YWL A;  4NEV A;  2FJE A;  3NYF A;  3KVE A;  4OPL A;  4U8P A;  1M64 A;  2OLO A;  1H84 A;  1EL9 A;  2RGJ A;  3PVC A;  4Z24 A;  5J7X A;  4H4P A;  2EQ8 A;  2XVH A;  4NEW A;  1N4U A;  3AE6 A;  4Q1O A;  1ZKQ A;  3F8R A;  3NH3 X;  4YKF A;  4BUR A;  4YT0 A;  1CJ3 A;  2Y6R A;  2APG A;  2WP5 A;  2XLT A;  1PBB A;  3QJ4 A;  1AOG A;  3EAN A;  4JDR A;  2FJB A;  4Q5B A;  2VOU A;  3KPF A;  4H4Q A;  4Z26 A;  2OA1 A;  4DSH A;  4L3Z A;  4A99 A;  2E1M A;  4CNJ A;  1BF3 A;  4TLZ A;  5FMH A;  4K8D A;  2FJA A;  4APN A;  1LV0 A;  1KF6 A;  2RGO A;  4B1B A;  4U8J A;  3KLJ A;  1NEK A;  1S3B A;  4USR A;  3HZL A;  2WS3 A;  2IID A;  1QJD A;  1GT8 A;  2X8G A;  4ZN0 A;  1OAH A;  3GYJ A;  1RYI A;  1E1M A;  5JCL A;  2GQW A;  2X99 A;  3V3O A;  2BRY A;  3E1T A;  4H4Z A;  1JNZ A;  2QA1 A;  1BVB A;  4II3 A;  4E0V A;  3SXI A;  4WCT A;  3T37 A;  2B7S A;  1PS9 A;  1VRQ B;  4A6N B;  1CL0 A;  3DK9 A;  3AED A;  4JY2 A;  5KWF A;  2E81 A;  3AWI A;  2GH5 A;  1EL8 A;  2VQB A;  4H2R A;  3T31 A;  3LB8 A;  2R0P A;  5L46 A;  2E5V A;  5BRT A;  1CBO A;  2YVJ A;  5M10 A;  3AEC A;  4J57 A;  3UP4 A;  2Q0L A;  1GES A;  1LQT A;  3BI2 A;  3IWA A;  4H2Q A;  1H7W A;  3BNF A;  2VRM A;  1CC6 A;  3SX6 A;  1JU2 A;  2CDU A;  1M1R A;  3H8L A;  5U1O A;  4NTE A;  4ADW A;  1ZY8 A;  1H83 A;  3F8P A;  1IUS A;  2GAG B;  4U8M A;  3UOZ A;  4FK1 A;  3UOV A;  3VRD B;  2RDZ A;  2QCU A;  1JRZ A;  4H4W A;  2YG7 A;  3L8K A;  1TDE A;  1PBE A;  2YG6 A;  3UKK A;  2BK4 A;  4CCQ A;  1VQW A;  3FMW A;  1BGJ A;  1F8R A;  4GDE A;  4H4S A;  4M52 A;  3CGB A;  3EF6 A;  4TLX A;  4JNQ A;  3GD4 A;  3K7Q X;  2Q6U A;  5KOX A;  1YQ4 A;  2BYB A;  4U2L A;  3UOX A;  3UKF A;  2PHH A;  4ZCD A;  4YWO A;  3AD7 B;  1M1P A;  2NVK X;  4XXG A;  4U2T A;  4TM4 A;  3UTF A;  3NYE A;  3DJG X;  2CZS A;  2NPX A;  3SZF A;  4DNA A;  1CHU A;  3CGC A;  3DME A;  5EOW A;  2YG5 A;  5M0Z A;  2YQU A;  3AE9 A;  2C76 A;  2AQJ A;  2C64 A;  4GF7 A;  3K7T A;  4H4U A;  3NNE A;  3SZW A;  4J36 A;  2Z5X A;  2Z5Y A;  1GER A;  1M6I A;  4JY3 A;  3BNH A;  4K2X A;  1PXA A;  2ZBW A;  3M12 A;  5KMP A;  1GRB A;  5KXJ A;  3GYX A;  4BK2 A;  3NHO X;  1TYP A;  3CND A;  1DXL A;  3CGE A;  4RG3 A;  2LFC A;  1GND A;  4CCR A;  1PN0 A;  3AEA A;  2OLN A;  1D4C A;  1OJC A;  1GXF A;  4GUV A;  3CIR A;  2VQ7 A;  5JCI A;  2YR6 A;  4OPT A;  4L3X A;  2B9X A;  2HQM A;  2WPC A;  2XLP A;  1IUT A;  4EQW A;  1D4E A;  4H4Y A;  3KPK A;  1TDF A;  2WQY A;  3KD9 A;  4Z2R A;  1XDI A;  2C67 A;  2WDR A;  3NK1 X;  2BXR A;  2X8H A;  3SYI A;  5KOW A;  1TRB A;  1L9E A;  3ICS A;  2C3D A;  1CJ2 A;  2V60 A;  1E1N A;  4NTC A;  3K7M X;  3GDP A;  4EQR A;  2WOI A;  2BCP A;  3ITJ A;  4O5U A;  1JRY A;  3VQR A;  3UKP A;  1FEC A;  3NRN A;  4A65 A;  4BV6 A;  2C65 A;  3OWM A;  2XDO A;  1FT5 A;  1COY A;  1PJ7 A;  2XLU A;  2YLT A;  3SM8 A;  4XWZ A;  2TMD A;  2R4E A;  4U8K A;  2OT4 A;  3AB1 A;  3IC9 A;  3QSE A;  3UU9 A;  3LZX A;  5JCK A;  2BXS A;  4AP1 A;  1PXC A;  2BAC A;  4IA5 A;  5KNL A;  4TM1 A;  3M0O A;  3VR8 A;  1BWC A;  3AE3 A;  1GRF A;  1K0L A;  3FG2 P;  3OC4 A;  3GD3 A;  5TR3 A;  3V3N A;  4KPR A;  3GRT A;  3CTY A;  3M13 A;  5ER0 A;  1PXB A;  4BJY A;  4YXD A;  4NZH A;  1TDO A;  2OAM A;  4AT2 A;  3Q9T A;  1B4V A;  1CJC A;  4Y4M A;  4CRT A;  3T2Y A;  2JB1 A;  2WPE A;  1JNR A;  1GAL A;  1YY5 A;  2J3N A;  2BS3 A;  3DK4 A;  2GVC A;  2X50 A;  2AAQ A;  1KFY A;  4CY8 A;  5HXI A;  4GAV A;  2YR4 A;  3BNU A;  2C4C A;  4X4J A;  1GRT A;  2V5Z A;  4I59 A;  2TPR A;  1CC2 A;  2XFQ A;  2C66 A;  2JK6 A;  3EAO A;  1L9D A;  1ONF A;  4REK A;  4U8N A;  2WDV A;  1DJQ A;  3SFE A;  3VR9 A;  2B7R A;  1CF3 A;  2R45 A;  2FBW A;  3UCL A;  1L9C A;  4A79 A;  4A5L A;  3CNS A;  1B5Q A;  2E4G A;  2ACZ A;  4U8L A;  4EM3 A;  3AEG A;  2YG3 A;  1MXT A;  4OPU A;  3AE5 A;  4JN9 A;  4A6N A;  1HYU A;  3BHF A;  2PYX A;  1NDA A;  4HB9 A;  3URH A;  1TYT A;  3DH9 A;  4YSY A;  3AE4 A;  2XFN A;  3GWD A;  5KMS A;  3UKA A;  1GTE A;  5FS7 A;  1XHC A;  1REO A;  2JB2 A;  2YLR A;  4EM4 A;  1EBD A;  3CPJ G;  2IVD A;  1KSU A;  1BZL A;  3CNT A;  3I3L A;  3P4S A;  1P2E A;  1KNR A;  3CGD A;  4OPC A;  1FS7 A;  1EL5 A;  2XVF A;  3DJJ A;  5EB4 A;  1UKV G;  1GRA A;  4B64 A;  2C73 A;  3AYJ A;  1RSG A;  3AEB A;  4WX1 A;  1M1Q A;  2BAB A;  5IQ1 A;  1CC4 A;  4AOS A;  1YQ3 A;  2RF7 A;  1K4Q A;  1QO8 A;  1OJT A;  1GPE A;  1RP0 A;  3SCE A;  1S3E A;  1VDC A;  2XLS A;  3B3R A;  4U8O A;  4UP3 A;  5BUL A;  2RGH A;  3AEE A;  2WP9 A;  4H4T A;  1ZK7 A;  1MOK A;  1N4W A;  2ARD A;  4OPG A;  3DK8 A;  5EBK A;  1TDN A;  3HYX A;  4H2N A;  4BK1 A;  4YKG A;  3UP5 A;  2JAE A;  2A89 A;  4IVO B;  3L1T A;  2WES A;  4JQ9 A;  2WBA A;  1B37 A;  1ZDL A;  4YTP A;  2YLS A;  2VRL A;  2I0Z A;  1IUW A;  3SY4 A;  4C74 A;  3RP7 A;  1K0I A;  1D7L A;  2ZZC A;  3ICT A;  1F8S A;  3II4 A;  3PO7 A;  4EIQ A;  1MO9 A;  2YLX A;  2C3C A;  2B76 A;  3AYI A;  3AE7 A;  3AE8 A;  4ECH A;  3RKH A;  1GRG A;  3QSM A;  4H7U A;  2VVL A;  4J31 A;  1GOS A;  1PBD A;  2R4J A;  3LAD A;  3V76 A;  2C72 A;  1ZMC A;  4CNK A;  2WET A;  1OJD A;  4IV9 A;  4OVI A;  3KU9 A;  3FPZ A;  3T2K A;  1BGN A;  2GR2 A;  4IA6 A;  4H4V A;  2YLZ A;  1F3P A;  1Y56 A;  5CQF A;  2V6O A;  4LII A;  3RP6 A;  3SZ0 A;  2Q7V A;  3UKQ A;  2YAU A;  3ADA B;  1DOD A;  1Q9I A;  1BKW A;  3ATQ A;  3S7W A;  1P2H A;  3P4Q A;  3BNG A; 
#chains in the Genus database with same CATH homology
 4EQS A;  3F8D A;  3UKL A;  3S61 A;  2ZZ0 A;  3NYC A;  4X9M A;  1FOH A;  1GSN A;  1DJN A;  1H82 A;  2VZ2 A;  3ZYX A;  4G9K A;  4K7Z A;  3NT6 A;  3SFD A;  5HYM A;  4Y4N A;  1NG3 A;  1IUX A;  1E7P A;  3QVR A;  1XAN A;  3CN8 A;  5BUK A;  5HHF A;  2BK5 A;  3ABV A;  4C77 A;  3HYW A;  3QVP A;  1NPX A;  5DBJ A;  5KRQ A;  3D1C A;  4GR1 A;  1TDK A;  2X3N A;  1JOA A;  2X8C A;  4UDQ A;  4AT0 A;  3PS9 A;  2WPF A;  1N4V A;  1YQZ A;  3ALM A;  4J33 A;  3G5S A;  5U25 A;  3BI5 A;  4GAP A;  4BK3 A;  4DGK A;  4EMI A;  5HY5 A;  3DGH A;  2EQ7 A;  1DNC A;  1NHP A;  5IPY A;  5IQ4 A;  4GDP A;  4C3X A;  4D03 A;  3NIX A;  4TM3 A;  2GF3 A;  3JSK A;  1JNI A;  1SEZ A;  3R9U A;  3D1I A;  3VRA A;  4J2W A;  4NTD A;  5KMQ A;  4UDR A;  2Q0K A;  3DJD A;  2B9W A;  3L1R A;  2FJD A;  3F29 A;  4A9W A;  1L0V A;  3O0H A;  4RG4 A;  4Z43 A;  1Q1R A;  1Y56 B;  4HA6 A;  4USQ A;  3KA7 A;  3P1W A;  4A7A A;  4U2S A;  2GR0 A;  4CBQ A;  3G5Q A;  4OPD A;  4J34 A;  2RAB A;  1S2Y A;  2BC0 A;  2C7G A;  4AOX A;  4Z44 A;  3SQP A;  3NGC X;  2C70 A;  2XFU A;  1PDH A;  2CVJ A;  1ELI A;  2WU2 A;  1FL2 A;  2Y6Q A;  1E39 A;  3P9U A;  4B65 A;  1GRH A;  3P4P A;  4U8I A;  1GEU A;  2GRT A;  4EMJ A;  2BA9 A;  2QA2 A;  1LVL A;  2YM1 A;  4D04 A;  3GMC A;  3CPI G;  3BI4 A;  3QFA A;  2XVI A;  2V3A A;  2YG4 A;  4WJY A;  3AE1 A;  3KKJ A;  1QLB A;  1B8S A;  1F8W A;  3IHG A;  1D7Y A;  2C75 A;  1ZOY A;  2WU5 A;  3H4K A;  5GRT A;  3HYV A;  3GRS A;  3RHA A;  2GEW A;  1OJ9 A;  2UZZ A;  1VG9 A;  3DJE A;  2K3V A;  1FEA A;  4LU6 A;  3UKH A;  1YKJ A;  1PJ5 A;  4EQX A;  4B63 A;  1GRE A;  1E6E A;  1E1L A;  2VVM A;  4NNJ A;  3UBR A;  4YSH A;  1CJ4 A;  1LQU A;  1GTH A;  1OJA A;  1LPF A;  2XFO A;  4B67 A;  3UTG A;  2R46 A;  2XVE A;  1Y0P A;  2B9Y A;  1Z6L A;  5C2T A;  2XFP A;  5J60 A;  4Z2U A;  2AR8 A;  2WOV A;  3IHM A;  3G5R A;  2BK3 A;  4PAA A;  2BS4 A;  2R0C A;  5FS9 A;  2WHD A;  1XPQ A;  3NN0 X;  2QAE A;  4G73 A;  4UDP A;  2WEU A;  4Q17 A;  3SGL A;  3VRB A;  2DKH A;  3RP8 A;  1NEN A;  4L3Y A;  2JKC A;  4JNA A;  3AYL A;  2GR3 A;  3RNM A;  1D5T A;  3BNJ A;  3BNM A;  3IF9 A;  3QFB A;  3SXQ A;  3NN6 X;  4P9S A;  3ATR A;  3GMB A;  3DA1 A;  3FBS A;  3AE2 A;  1DOE A;  3S5W A;  4BJZ A;  3GM6 A;  3CPH G;  1PBC A;  4YTN A;  3ALJ A;  3FIM B;  2IVE A;  4C3Y A;  3NLC A;  4Q0T A;  1NHR A;  4O5Q A;  3LGQ A;  2EQ6 A;  2XYO A;  3K30 A;  2W0H A;  4GRT A;  2XCG A;  2E80 A;  5LV9 A;  4K5R A;  1NG4 A;  3TOR A;  1PBF A;  5JCN A;  3I6D A;  4XWR A;  3Q6J A;  2F5Z A;  1H86 A;  2YM2 A;  3P4R A;  3GSI A;  2GAH B;  1ZX9 A;  2GV8 A;  4FDC B;  3FO3 A;  1IUU A;  1FS8 A;  4K22 A;  3BHK A;  2GQF A;  3ZDN A;  1PHH A;  3NTA A;  5C3J A;  4FX9 A;  2OAL A;  4CY6 A;  3EPT A;  3NK2 X;  4G6H A;  4AP3 A;  3NK0 X;  2YR5 A;  3LJP A;  4GCM A;  2V3B A;  4YSZ A;  2CFY A;  3C96 A;  2ZO5 A;  3GDN A;  4X9N A;  2O9Z A;  2JBV A;  4KX6 A;  4OPI A;  4L38 A;  3COX A;  4NWZ A;  1PJ6 A;  5FS6 A;  2H88 A;  3GYI A;  5BVA A;  5KMR A;  4N9X A;  2ZZB A;  1DOC A;  1ZMD A;  1SP3 A;  4LA1 A;  4MJW A;  1NAA A;  4I58 A;  3RED A;  3T0K A;  3C4A A;  1KDG A;  3AXB A;  3ISH A;  4OCG A;  2YLW A;  4EIP A;  3UTE A;  2BS2 A;  4Z25 A;  4EMW A;  4YSX A;  3LOV A;  1H6V A;  3LZW A;  1LJ1 A;  4ICY A;  1KSS A;  2R9Z A;  4FK1 C;  3UTH A;  4B68 A;  3LG1 A;  1ZOV A;  1DOB A;  1H81 A;  2WOW A;  4DSG A;  3CNP A;  2VVL G;  1IJH A;  3MMO A;  1E1K A;  2BRA A;  1FS9 A;  4Q5C A;  2GMJ A;  2J7A A;  3T2Z A;  2BC1 A;  3DGZ A;  1O5W A;  1ZP0 A;  1JRX A;  1EL7 A;  2V61 A;  1VG0 A;  1JEH A;  1N1P A;  2GMH A;  3C4N A;  4YTM A;  3GWF A;  1W4X A;  4B66 A;  5KVH A;  1FEB A;  2A87 A;  3TTB A;  3AEF A;  2DKI A;  4H50 A;  4Q4U A;  5GSN A;  1FT6 A;  1NHQ A;  4H2P A;  2CUL A;  4TM0 A;  5U63 A;  4RSL A;  2EQ9 A;  3AD9 B;  3NKS A;  5CKU A;  4B69 A;  3WE0 A;  4Z2T A;  1NHS A;  2WP6 A;  2BCG G;  3OZ2 A;  4H4R A;  3LXD A;  4K5S A;  1V59 A;  2WDQ A;  4J56 A;  4PAB A;  3CMM A;  1O94 A;  3B6D A;  4Y4L A;  2A8X A;  2YVF A;  3T14 A;  2GB0 A;  3UOY A;  1FCD A;  1LTX R;  4II2 A;  5EB5 A;  5FS8 A;  3SZC A;  1F6M A;  1D4D A;  1KNP A;  1X31 B;  3QSS A;  4IVM B;  3H8I A;  2XVJ A;  1K0J A;  3ALL A;  3D8X A;  1O95 A;  3NTD A;  5KVI A;  5JCM A;  1GU6 A;  4G6G A;  4H4X A;  2YVG A;  1GV4 A;  3AD8 B;  1QDB A;  3NG7 X;  2JB3 A;  4ZCC A;  3ICR A;  2H89 A;  4G74 A;  2R0G A;  1H7X A;  2GR1 A;  2VR0 A;  1GET A;  1IUV A;  3CNJ A;  1S2Q A;  4C5O A;  2XLR A;  1Q1W A;  2YWL A;  4NEV A;  2FJE A;  3NYF A;  3KVE A;  4OPL A;  4U8P A;  1M64 A;  2OLO A;  1H84 A;  1EL9 A;  2RGJ A;  3PVC A;  4Z24 A;  5J7X A;  4H4P A;  2EQ8 A;  2XVH A;  4NEW A;  1N4U A;  3AE6 A;  4Q1O A;  1ZKQ A;  3F8R A;  3NH3 X;  4YKF A;  4BUR A;  4YT0 A;  1CJ3 A;  2Y6R A;  2APG A;  2WP5 A;  2XLT A;  1PBB A;  3QJ4 A;  1AOG A;  3EAN A;  4JDR A;  2FJB A;  4Q5B A;  2VOU A;  3KPF A;  4H4Q A;  4Z26 A;  2OA1 A;  4DSH A;  4L3Z A;  4A99 A;  2E1M A;  4CNJ A;  1BF3 A;  4TLZ A;  5FMH A;  4K8D A;  2FJA A;  4APN A;  1LV0 A;  1KF6 A;  2RGO A;  4B1B A;  4U8J A;  3KLJ A;  1NEK A;  1S3B A;  4USR A;  3HZL A;  2WS3 A;  2IID A;  1QJD A;  1GT8 A;  2X8G A;  4ZN0 A;  1OAH A;  3GYJ A;  1RYI A;  1E1M A;  5JCL A;  2GQW A;  2X99 A;  3V3O A;  2BRY A;  3E1T A;  4H4Z A;  1JNZ A;  2QA1 A;  1BVB A;  4II3 A;  4E0V A;  3SXI A;  4WCT A;  3T37 A;  2B7S A;  1PS9 A;  1VRQ B;  4A6N B;  1CL0 A;  3DK9 A;  3AED A;  4JY2 A;  5KWF A;  2E81 A;  3AWI A;  2GH5 A;  1EL8 A;  2VQB A;  4H2R A;  3T31 A;  3LB8 A;  2R0P A;  5L46 A;  2E5V A;  5BRT A;  1CBO A;  2YVJ A;  5M10 A;  3AEC A;  4J57 A;  3UP4 A;  2Q0L A;  1GES A;  1LQT A;  3BI2 A;  3IWA A;  4H2Q A;  1H7W A;  3BNF A;  2VRM A;  1CC6 A;  3SX6 A;  1JU2 A;  2CDU A;  1M1R A;  3H8L A;  5U1O A;  4NTE A;  4ADW A;  1ZY8 A;  1H83 A;  3F8P A;  1IUS A;  2GAG B;  4U8M A;  3UOZ A;  4FK1 A;  3UOV A;  3VRD B;  2RDZ A;  2QCU A;  1JRZ A;  4H4W A;  2YG7 A;  3L8K A;  1TDE A;  1PBE A;  2YG6 A;  3UKK A;  2BK4 A;  4CCQ A;  1VQW A;  3FMW A;  1BGJ A;  1F8R A;  4GDE A;  4H4S A;  4M52 A;  3CGB A;  3EF6 A;  4TLX A;  4JNQ A;  3GD4 A;  3K7Q X;  2Q6U A;  5KOX A;  1YQ4 A;  2BYB A;  4U2L A;  3UOX A;  3UKF A;  2PHH A;  4ZCD A;  4YWO A;  3AD7 B;  1M1P A;  2NVK X;  4XXG A;  4U2T A;  4TM4 A;  3UTF A;  3NYE A;  3DJG X;  2NPX A;  3SZF A;  4DNA A;  1CHU A;  3CGC A;  3DME A;  5EOW A;  2YG5 A;  5M0Z A;  2YQU A;  3AE9 A;  2C76 A;  2AQJ A;  2C64 A;  4GF7 A;  3K7T A;  4H4U A;  3NNE A;  3SZW A;  4J36 A;  2Z5X A;  2Z5Y A;  1GER A;  1M6I A;  4JY3 A;  3BNH A;  4K2X A;  1PXA A;  2ZBW A;  3M12 A;  5KMP A;  1GRB A;  5KXJ A;  3GYX A;  4BK2 A;  3NHO X;  1TYP A;  3CND A;  1DXL A;  3CGE A;  4RG3 A;  2LFC A;  1GND A;  4CCR A;  1PN0 A;  3AEA A;  2OLN A;  1D4C A;  1OJC A;  1GXF A;  4GUV A;  3CIR A;  2VQ7 A;  5JCI A;  2YR6 A;  4OPT A;  4L3X A;  2B9X A;  2HQM A;  2WPC A;  2XLP A;  1IUT A;  4EQW A;  1D4E A;  4H4Y A;  3KPK A;  1TDF A;  2WQY A;  3KD9 A;  4Z2R A;  1XDI A;  2C67 A;  2WDR A;  3NK1 X;  2BXR A;  2X8H A;  3SYI A;  5KOW A;  1TRB A;  1L9E A;  3ICS A;  2C3D A;  1CJ2 A;  2V60 A;  1E1N A;  4NTC A;  3K7M X;  3GDP A;  4EQR A;  2WOI A;  2BCP A;  3ITJ A;  4O5U A;  1JRY A;  3VQR A;  3UKP A;  1FEC A;  3NRN A;  4A65 A;  4BV6 A;  2C65 A;  3OWM A;  2XDO A;  1FT5 A;  1COY A;  1PJ7 A;  2XLU A;  2YLT A;  3SM8 A;  4XWZ A;  2TMD A;  2R4E A;  4U8K A;  2OT4 A;  3AB1 A;  3IC9 A;  3QSE A;  3UU9 A;  3LZX A;  5JCK A;  2BXS A;  4AP1 A;  1PXC A;  2BAC A;  4IA5 A;  5KNL A;  4TM1 A;  3M0O A;  3VR8 A;  1BWC A;  3AE3 A;  1GRF A;  1K0L A;  3FG2 P;  3OC4 A;  3GD3 A;  5TR3 A;  3V3N A;  4KPR A;  3GRT A;  3CTY A;  3M13 A;  5ER0 A;  1PXB A;  4BJY A;  4YXD A;  4NZH A;  1TDO A;  2OAM A;  4AT2 A;  3Q9T A;  1B4V A;  1CJC A;  4Y4M A;  4CRT A;  3T2Y A;  2JB1 A;  2WPE A;  1JNR A;  1GAL A;  1YY5 A;  2J3N A;  2BS3 A;  3DK4 A;  2GVC A;  2X50 A;  2AAQ A;  1KFY A;  4CY8 A;  5HXI A;  4GAV A;  2YR4 A;  3BNU A;  2C4C A;  4X4J A;  1GRT A;  2V5Z A;  4I59 A;  2TPR A;  1CC2 A;  2XFQ A;  2C66 A;  2JK6 A;  3EAO A;  1L9D A;  1ONF A;  4REK A;  4U8N A;  2WDV A;  1DJQ A;  3SFE A;  3VR9 A;  2B7R A;  1CF3 A;  2R45 A;  2FBW A;  3UCL A;  1L9C A;  4A79 A;  4A5L A;  3CNS A;  1B5Q A;  2E4G A;  2ACZ A;  4U8L A;  4EM3 A;  3AEG A;  2YG3 A;  1MXT A;  4OPU A;  3AE5 A;  4JN9 A;  4A6N A;  1HYU A;  3BHF A;  2PYX A;  1NDA A;  4HB9 A;  3URH A;  1TYT A;  3DH9 A;  4YSY A;  3AE4 A;  2XFN A;  3GWD A;  5KMS A;  3UKA A;  1GTE A;  5FS7 A;  1XHC A;  1REO A;  2JB2 A;  2YLR A;  4EM4 A;  1EBD A;  3CPJ G;  2IVD A;  1KSU A;  1BZL A;  3CNT A;  3I3L A;  3P4S A;  1P2E A;  1KNR A;  3CGD A;  4OPC A;  1FS7 A;  1EL5 A;  2XVF A;  3DJJ A;  5EB4 A;  1UKV G;  1GRA A;  4B64 A;  2C73 A;  3AYJ A;  1RSG A;  3AEB A;  4WX1 A;  1M1Q A;  2BAB A;  5IQ1 A;  1CC4 A;  4AOS A;  1YQ3 A;  2RF7 A;  1K4Q A;  1QO8 A;  1OJT A;  1GPE A;  1RP0 A;  3SCE A;  1S3E A;  1VDC A;  2XLS A;  3B3R A;  4U8O A;  4UP3 A;  5BUL A;  2RGH A;  3AEE A;  2WP9 A;  4H4T A;  1ZK7 A;  1MOK A;  1N4W A;  2ARD A;  4OPG A;  3DK8 A;  5EBK A;  1TDN A;  3HYX A;  4H2N A;  4BK1 A;  4YKG A;  3UP5 A;  2JAE A;  2A89 A;  4IVO B;  3L1T A;  2WES A;  4JQ9 A;  2WBA A;  1B37 A;  1ZDL A;  4YTP A;  2YLS A;  2VRL A;  2I0Z A;  1IUW A;  3SY4 A;  4C74 A;  3RP7 A;  1K0I A;  1D7L A;  2ZZC A;  3ICT A;  1F8S A;  3II4 A;  3PO7 A;  4EIQ A;  1MO9 A;  2YLX A;  2C3C A;  2B76 A;  3AYI A;  3AE7 A;  3AE8 A;  4ECH A;  3RKH A;  1GRG A;  3QSM A;  4H7U A;  2VVL A;  4J31 A;  1GOS A;  1PBD A;  2R4J A;  3LAD A;  3V76 A;  2C72 A;  1ZMC A;  4CNK A;  2WET A;  1OJD A;  4IV9 A;  4OVI A;  3KU9 A;  3FPZ A;  3T2K A;  1BGN A;  2GR2 A;  4IA6 A;  4H4V A;  2YLZ A;  1F3P A;  1Y56 A;  5CQF A;  2V6O A;  4LII A;  3RP6 A;  3SZ0 A;  2Q7V A;  3UKQ A;  2YAU A;  3ADA B;  1DOD A;  1Q9I A;  1BKW A;  3ATQ A;  3S7W A;  1P2H A;  3P4Q A;  3BNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...