1JSXA

Crystal structure of the escherichia coli glucose-inhibited division protein b (gidb)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
207
structure length
193
Chain Sequence
MLNKLSLLLKDAGISLTDHQKNQLIAYVNMLHKWNEMLVRHILDSIVVAPYLQGERFIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHELKLENIEPVQSRVEEFPSEPPFDGVISRAFASLNDMVSWCHHLPGEQGRFYALKGQMPEDEIALLPEEYQVESVVKLQVPDGERHLVVIKANKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-inhibited division protein B
publication title Crystal structure of the Escherichia coli glucose-inhibited division protein B (GidB) reveals a methyltransferase fold.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 62
structure length 193
sequence length 207
ec nomenclature ec 2.1.1.170: 16S rRNA (guanine(527)-N(7))-methyltransferase.
pdb deposition date 2001-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02527 GidB rRNA small subunit methyltransferase G
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jsxA00
5HIJA 5K0BA 1X1AA 1WG8A 1N7JA 3EGVA 3FTCA 1SQGA 2ZWVA 3A26A 3GRVA 4CKBA 4RTMA 4YUVA 4CTJA 4DQ0A 5IKMA 5MHTA 2ZBPA 3GRYA 4PCLA 4DF3A 3FZGA 1JTFA 5EQJB 2JG3A 2GS9A 5CVDA 1D2HA 1RI2A 2HMYB 1R18A 3HCBA 3SSNA 3VC2A 2PWPA 2IH4A 5EOVA 5EPEA 5HZMA 3CJTA 5E1MA 2H11A 3EVDA 2Y1WA 5GIOE 3ER8A 3F4KA 10MHA 1YFJA 4HH4A 1JQDA 4XUDA 2ZULA 1TW2A 4P7JA 3E05A 3G2PA 1M6YA 2DULA 4AZSA 2WA2A 4PYOA 1FBNA 5K09A 4HRAA 4F85A 3EMDA 4GF5A 1R8YA 1RJDA 3A27A 4RTNA 1JQ3A 3PFHA 5IH3A 3T7TA 3ER9A 1XCJA 2AOVA 3FUWA 4QQKA 5K0FA 1QAOA 3P9NA 5E8JA 3BKWA 3I53A 3G88A 2O06A 3B7PA 1QAMA 4GOND 4KDRA 2IH5A 1WXXA 3GJYA 1ZG3A 2P41A 3B3GA 3DULA 2YXLA 2OB2A 1G55A 4CTKA 3UJ9A 5C9ZA 2IBSA 5FA5A 2AN3A 2IGTA 5HEKA 2HTEA 1UWVA 3HCDA 2PWYA 1KYZA 3GRUA 2UYQA 5LQRA 3EMBA 5JR3A 1G8SA 1IM8A 5FULA 4RVFA 3SX0A 3LBYA 1DCTA 3OPNA 2OB1A 4YUZA 2UZ4A 2F8LA 5DPMA 3KR0A 4BLUA 1QANA 1SUIA 4HSGA 5EEGA 2B2CA 2JHPA 5ICGA 3EVBA 5BW4A 4MQ4A 5EKXA 3UJDA 4GUAA 4PIMA 3DXYA 4E2WA 2VS1A 2HV9A 4ZTBA 3H2BA 4GOMD 3TKAA 5GOZA 1DUSA 3KQWA 2GB4A 3G5LA 4OX9Y 3NJRA 3DMHA 3EVCA 4QDJA 2A14A 2B9EA 3LCCA 3C6MA 3HEMA 2ZBRA 1R8XA 2AOUA 2VDWA 3IV6A 3K6RA 4QTTB 5DX8A 5FHRA 3EVZA 1JG3A 5H02A 5GP1A 5C0OE 2Z6AA 3P2KA 4FSDA 4RVDA 4RYLA 5P8WA 3KPJA 3LHDA 4O29A 4DMGA 3UBTA 2QE6A 1UFKA 2G72A 3PS9A 3NMUF 2C7OA 1O9HA 3G2OA 3C3PA 4CWAA 4M38A 5EVJA 3KR2A 5GM2A 2NP7A 8MHTA 3HCFA 4P7KA 3HNRA 2BH2A 4FZVA 2ONZA 3LECA 1X1BA 7MHTA 5BXYA 3GIWA 3ORHA 4XUCA 3K0BA 2AOXA 3P8ZA 3FRIA 1VP9A 3ME5A 3R24A 5ICEA 3R3HA 4JXJA 5CCBA 1Q0SA 4RTLA 1MHTA 2PVCA 3EPPA 4RTKA 2JJQA 3FYDA 4BP1A 1Z3CA 3PFGA 4BY9E 3P71T 3T7RA 4RV9A 4CXMA 5D1HA 5FQOA 4PYKA 1G8AA 1X1CA 3G2QA 3ID6C 3O31A 4FR0A 3O4FA 1P1BA 4AUKA 3MTEA 1Y8CA 3UJCA 3IHTA 5CVUA 5GM1A 2NP6A 2P3OA 4FSXA 5E1BA 3NDIA 2CKDA 3FPEA 3P9KA 4PGGA 1INLA 4QVKA 4C04A 4MHTA 3FPFA 4M37A 3LCVB 2PBFA 3HCEA 4IV8A 5LQUA 1JG1A 2UYHA 1NV8A 2ZIFA 2VDUE 3DP7A 2EFJA 4C08A 3LKZA 4R8RA 3D2LA 3OFJA 3VC1A 1NW7A 2B25A 3NTVA 3TLJA 1WS6A 4RTQA 4DKJA 1NBIA 1SUSA 3CBGA 1VPTA 2Y1XA 4DM3A 1BHJA 1RJGA 5DTMA 4E31A 9MHTA 4HGYA 5DTQA 2ZWAA 5KS2A 1D2CA 5FHQA 3V97A 1XDSA 3DLCA 2GA9A 4F84A 4C06A 5K03A 2QYOA 3UJBA 2ZVJA 2FCAA 3EVFA 3OCJA 3QOWA 5LQCA 4KDCA 2ZIGA 3JWJA 3BUSA 3KPVA 4RTRA 4BLWA 5CIYA 3TMAA 2IH2A 4Z2YA 4B17A 3FTFA 3SVZA 2NYUA 3THRA 5DWQA 4HGZA 4CKEA 5KQSA 1FJXA 2H1RA 2IPXA 1WY7A 2VDVE 2XYRA 3TQSA 2PLWA 3G8BA 4RWZA 5CVVA 5DXJA 1PRYA 4OA8A 2ZBQA 3R9XB 3I5UA 2Z6UA 4KW7A 1P1CA 5K0NA 1AQJA 1G6Q1 1N7IA 4LECA 2NXCA 1BKYA 4QVGA 4EKIA 4C07A 4ER5A 1O54A 3RIEA 3A7DA 5DRTA 4PYJA 3LDUA 2GH1A 2PT9A 1G60A 2O05A 3SR4A 5CM2Z 5ERGB 4KIGA 3UJAA 5EZQA 2HR1A 3VSEA 1I9GA 2HWKA 4RVHA 2V7EA 2YTZA 2AOTB 2OY0A 2AN5A 3SSMA 5KQRA 4YUWA 2ORED 1TPYA 4FS8A 1EIZA 1RI3A 4RTSA 2Z6QA 2E5WA 4YV2A 3I64A 1F38A 4GC5A 1BC5A 2ZCJA 1NE2A 4EK9A 1XDUA 1H1DA 5M5BA 3AJDA 1RJFA 5EMJA 3ANXA 5T6BA 3KKZA 5EKUA 5GINE 3EVEA 2AOWA 1KP9A 5LQAA 4RX1A 4A6DA 1IXKA 3DOUA 5CVEA 4C03A 3QV2A 2OO3A 3JWIA 5EHGA 2ZFUA 5FA8A 3HA3A 2FYTA 3OZRA 3T0IA 2ZSUA 4X61A 4ATNA 3BT7A 1YB2A 4QDKA 4RTOA 4GBED 5U4XA 1X19A 1ORHA 3E23A 2N47A 2BR4A 1NT2A 3RW9A 2AOUB 3GRZA 4QTUB 2OXTA 4PGHA 5FADA 2NXJA 2OKCA 3LDFA 1L1EA 3LGAA 5DM1A 1QAQA 2G70A 3DLIA 3KQMA 4Y2HA 5HIMA 3X0DA 4YUYA 5LQJA 3TR6A 2IFTA 3HVKA 1JSXA 3LDGA 1XVAA 1XJ5A 3ELYA 2O0LA 4FT2A 4HTFA 2PV0A 3FUUA 5HIIA 3C3YA 3JWGA 4V0RA 2IIPA 2R3SA 3OZSA 4F86A 3VYWA 3FTEA 3OE5A 5DLYA 1I1NA 4XCXA 3MCTA 2ZIEA 1BOOA 3CC8A 4A6EA 1L3IA 5G02A 1FPQA 2NNWB 3BGVA 3T7SA 3THSA 4ER0A 3BGDA 4PCAA 3KQYA 4LWOA 2CMHA 5EMMA 1EAMA 3PB3A 3HVHA 5E9JA 4ER7A 3EEYA 1F3LA 2P1DA 3CJRA 4KVZA 2OYRA 2EG5A 1AF7A 2P3QA 3KR1A 4GEKA 5EMLA 1U2ZA 2G8NA 4P7GA 3UA3A 3HVIA 3FYCA 1HNNA 2PSSA 3DTNA 5DX0A 2XVAA 5T67A 3CGGA 2FPOA 1O9GA 3LCUA 4ER6A 2WA1A 2H00A 5DM2A 3Q87B 3BZBA 1FP1D 4GOOD 4G56A 4PYLA 2NXEA 5FUBA 2YX1A 4AZTA 3PTAA 1KXZA 4KWCA 3GU3A 1JG2A 4RSRA 4M7RA 5GWXA 3LBFA 4E2ZA 1XCLA 3UFBA 5EMKA 2P40A 3P9CA 2V74B 5FCDA 5HILA 2YXEA 4PNEA 2ONYA 4QQNA 3LSTA 4X41A 5BW5A 1AV6A 4U7TB 3P2IA 1SKMA 1L9KA 5EGSA 3FPHA 3BWYA 2QRVA 3A7EA 2QY6A 5JUWA 5BP7A 1FP2A 3IEIA 2BR5A 3KPWA 5E9QA 2C7QA 3B5IA 2YVLA 3PX3A 4U7PB 3BKXA 1ZHFA 1YUBA 4KIFA 2JHAA 1JQEA 2PY6A 5LR6A 2ZW9A 2ZZMA 3CJQA 3ELUA 3GO4A 4FP9A 1OR8A 3TFWA 4PYMA 3KQQA 3NWBA 5E1DA 1R6AA 1NKVA 2OZVA 3P2EA 2I6GA 3OFKA 1EJ0A 4PYNA 3EVAA 5CUQA 5DSTA 1M0EA 4OBWA 1XTPA 4YV1A 4DCGA 5FWAA 1KPGA 1XXLA 2AVNA 4P7FA 4X63A 4YMHA 4QPPA 2C7PA 3JWHA 3ERCA 2B3TA 2XYQA 3Q7EA 2PJDA 5K0CA 3G5TA 1YZHA 2VP3A 4M36A 3MERA 3E7PA 1X1DA 1WXWA 2PX2A 3M6VA 2PX5A 3GDHA 4NECA 3TM5A 3LL7A 3RODA 5K01A 5K8VA 2I9KA 4XUEA 1T43A 3R6TA 5F2NA 4POOA 3EVGA 1NW6A 3WSTA 2UYOA 3R0QA 4PINA 1AQIA 5CVJA 1RJEA 2HNKA 4EQZA 5EEHA 3OU2A 1YF3A 4ISCA 2O57A 3SM3A 3GWZA 4PYQA 3FUTA 3M4XA 4PONA 2CL5A 3I9FA 3S68A 3KPYA 3BXOA 1Q0TA 2BR3A 3CCFA 4HG2A 4OBXA 5EC8A 5EIFA 2AN4A 3DMGA 2AVDA 3DXXA 1JSZA 1N2XA 1RI5A 3KHKA 4PYIA 5K0GA 5K0LA 3G7UA 4E2XA 2G1PA 3UWPA 4AX8A 2PXXA 2DPMA 3TPZA 4RTJA 4OA5A 3PT9A 4QPNA 2PGXA 1NW5A 1EG2A 1P39A 3LPMA 3M70A 3B3FA 3PX2A 3V8VA 1VP3A 3GCZA 3UZUA 1I4WA 4H0NA 5DT2A 4GQBA 5K0JA 2BM9A 3L8DA 5DTRA 4WXHA 3BWMA 2YXDA 3DH0A 3O7WA 1KPIA 3UJ7A 2EJUA 2EX4A 3LX6A 2LD4A 4HTFB 4E33A 4EKGA 5EHIA 5DXAA 3FTDA 3MB5A 2IBTA 4HC4A 4X1OA 3MGGA 3KU1A 1JG4A 5E1OA 5EIWA 2FK7A 1ZGJA 4PWYA 1JR4A 1ORIA 5E2AA 3REOA 2JH9A 3OE4A 3TM4A 2ZZNA 5HOQA 5EG5A 5C1IA 1SG9A 2Q41A 4MWZA 2ADMA 1ZKDA 2UYCA 3ELWA 4CKCA 3KQVA 3GGDA 1VIDA 2GPYA 2PXAA 1VLMA 2K4MA 3MTIA 3I58A 1KIAA 4R6XA 5B1SA 3ELDA 1EJ6A 4V0QA 2P3LA 4MTLA 5DSXA 5HFJA 1KHHA 3HM2A 5T64A 4BLVA 1RI1A 2GLUA 3AY0A 4YUXA 1UIRA 2AOTA 1IY9A 5F2OA 3TOSA 2YR0A 4WVLA 1MJFA 1ZGAA 5EZSA 3AWIA 5F2KA 4E32A 3FPJA 2ZTHA 3SSOA 2WK1A 3KPUA 3NDJA 2I62A 3C0KA 2I7CA 4PIPA 3EEOA 3A4TA 3NVKI 1NW3A 3FUXA 5DRYA 2FHPA 5KYGA 3MHTA 1QZZA 3MQ2A 4AZWA 1L3BA 2C7RA 4RTPA 2XBMA 1VBFA 2QRVB 3TKYA 3AXSA 2IP2A 3G89A 2ESRA 3HP7A 2P8JA 4IKPA 2JH8A 5E8RA 2G71A 3LKDA 3KQOA 1NW8A 5CCXA 5E2BA 3GRRA 1B42A 2EJTA 1QYRA 4RVGA 2CMGA 3FUVA 5D1NA 3TRKA 1NBHA 3B3JA 5HIKA 4EVIA 4E30A 2ZZKA 3E8SA 4X60A 4C4AA 1KR5A 4FT4A 4DA4A 4GC9A 1VL5A 4R6WA 3HTXA 4IV0A 4E70A 1KPHA 5CD1A 3BWCA 1YZ3A 2AZTA 3M6XA 1PJZA 1VE3A 1V39A 2ERCA 3CVOA 2R6ZA 3DUWA 3OU7A 4OQDA 5DM4A 3SXJA 4L7VA 5E9WA 3FPGA 3C6KA 5LQKA 4K6MA 2OPBA 1R00A 2ZLBA 2P35A 2P7IA 3FRHA 2BM8A 3GXOA 3HCAA 5FTWA 4OQEA 3UJ8A 4YMGA 2P7HA 2JHCA 5FQNA 3NWEA 3QOXA 1P91A 2XVMA 2IDJA 4Y30A 3OZTA 2BZGA 3HA5A 2VZ9A 4C05A 3UA4A 3HVJA 2PX8A 1TW3A 1WZNA 3BWBA 4BP3A 3P97A 3DMFA 3KR9A 4ER3A 5LSAA 1R74A 2O07A 5ICFA 2AR0A 2XYVA 2YQZA 3M6WA 2KW5A 4P58A 3CKKA 2PT6A 3M6UA 4UOEA 4AZVA 3KQSA 3MCZA 2FRXA 4E2YA 4GOLD 1VQ1A 3DR5A 2B78A 2QM3A 3OU6A 3G2MA 2PXCA 5DM0A 3PVCA 2YUIA 2OBFA 1KYWA 4EMSA 1ZQ9A 4R05A 4DCMA 4IWNA 1XDZA 3P9IA 2FK8A 5KVAA 3B89A 5K0EA 3M33A 4YV0A 3EGIA 1D2GA 3SMQA 3UJ6A 1G38A 3GNLA 5DX1A 3AXTA 4LG1A 2NXNA 4DZRA 3KQTA 3SGLA 1DL5A 3DXZA 1YFLA 1JTEA 1L3CA 3KQPA 4R8SA 3NW9A 3PLAE 1SVUA 3NVMB 2GAFA 3A25A 1NV9A 3IYLW 5FWDA 2PKWA 2PX4A 4FGZA 3G8AA 5LQNA 4KRGA 2AS0A 1SQFA 1EQAA 3MAGA 5GIPE 5ICCA 3EGEA 2CWWA 1HMYA 3BGIA 3U81A 1M6EX 3HA7A 1RI4A 4MIKA 4LWPA 5K05A 2IDKA 3HCCA
chains in the Genus database with same CATH superfamily
3O73A 5CT9A 1SWWA 1RADA 4N8DA 2TMGA 4IBOA 1G19A 3LE8A 1TQ8A 3NH6A 1L7PA 1ZN2A 2WU3A 4GL4A 2B37A 1NU8A 1U5CA 1GM5A 2R6GA 3BMNB 2X0KA 3LNCA 3D7NA 1PG2A 1GKYA 3N0WA 3UTDA 5CVDA 3AU8A 4MHSA 1D2HA 1B2LA 1MTOA 2IH4A 2P79A 2IS2A 4RY2A 1T10A 2H11A 4NFYA 5JROA 3DZBA 4KQ2A 3ER8A 3CVJA 2DJIA 1SELA 4MR9B 1QFYA 3LFUA 1ECBA 4D4IA 1NQ5A 3NYWA 2WVHA 2ZJYA 1PLKA 2IHZA 4JX8A 5SYNA 4WNYA 2P11A 2AQ8A 1EE9A 3EPRA 5TQJA 1AG9A 1AGNA 1U63A 4HEA1 1FBTA 2H9YA 4WY8A 2AUTA 4DQLA 2FPIA 4MW1A 1ACJA 1TM3E 1I7NA 4LY6A 1UKVY 4ZODA 4BHTA 3RTAA 4CG1A 2W2OA 1MC1A 3EARA 1C3XA 2QUIA 1WXIA 3UHOA 2E3JA 2A86A 1J49A 4ZKDA 2L19A 1ADGA 1DSSG 2B99A 1G3IA 5B37A 3ZXUB 4QPZA 3I52A 1EE2A 4GKAA 4U7HA 2Q6IA 4CTKA 1U04A 1MABA 2B4KA 3OQJA 3PYXA 4MIYA 1OYOA 4WBXC 4KKXB 4BIMA 1TE2A 5IZCA 1T8WA 4LZPA 5H3LA 3GP8A 2BTOA 2IA5A 3R9KA 2EZ9A 4O2RA 3AUXA 1CX9B 3RVJA 3UWKA 1M6WA 1U0EA 4GLLA 4TZKA 2H4FA 2I2FA 1H5NA 2YRXA 2G80A 3ADPA 3G8CA 4HEHA 4I5DA 4J1TA 4KTTE 1C4WA 3N2IA 3NUGA 1WXEA 3WA6A 1CUBA 1UK6A 1AB5A 1QC5B 3LA8A 2OLJA 3DZHA 5EKXA 5JMPA 2PH7A 2VUIB 1SKAA 1R6BX 1VLZA 1SHZA 4J7XA 4JEHA 1AM4D 4OGWA 4GOMD 3Q3CA 4ZVMA 5TPZD 2ZI9A 3T5MA 4XD2A 4K88A 2MCFA 3TLEA 2GB4A 2PX6A 2EARA 4RKFA 1KOFA 1JHQA 1SWVA 1JMKC 3OE1A 2IZ6A 3ZGNA 4EUKA 1NC3A 2Q29A 1HDEA 1PL8A 3VV3A 2FU5C 2CCGA 1ZOLA 1XJ0A 4WJLA 2XUJA 1RWPA 5FI0B 2XOXA 3LOUA 1XCPA 5IBRA 5KJ6A 2QTVA 1OH8A 2ZDGA 4XGQA 3SYLA 3HZZA 3NT4A 4BWGA 5DW3A 2C7OA 3ADDA 2W58A 4MR7B 5BWCA 1FTQA 1S2IA 2ZETA 1J8QA 2G9ZA 2P4HX 3AYZB 4CM9A 1E0KA 1WMFA 3H3FA 3P9ZA 1QIEA 1XIVA 1N2ZA 3PGMA 4OAOA 3HU1A 2G9RA 4QECA 4U2FA 1ZI6A 2NYVA 1NTOA 1T9KA 4LRSB 4NLLA 1P2VA 2BMWA 3H1BA 4F93B 3TXXA 2Q6TA 4NCHA 4F45A 2P91A 2J9ZB 5AM0A 3EX7C 1QF7A 1KC3A 4O4IB 3BAFA 1YS2X 4L5BA 3MJEA 2YKGA 3PU6A 2Z9CA 1W4RA 4XJXA 3TFOA 1TU3A 4EUNA 3PGLA 1S02A 4ZIRA 4DR2B 3MOIA 1W96A 4B87A 1MPXA 2BFDB 2WUDA 3F6CA 2JKVA 3JD3A 5HBGA 5A71A 5JJCA 3A10A 1ID8A 3JAMA 4JXZA 1X70A 3U0BA 1XP5A 4HCJA 4HLDA 3AM3A 1FNSA 2V6GA 4WBSA 5KWVA 2ID8A 1I1QB 4LBYA 4KQEA 1E2MA 5DT9A 4CLHA 3RSOA 4PAOA 2J32A 2N0SA 2WV7A 5AVKA 1SUWA 3DBHA 2W2LA 1KI9A 3BIJA 5IAJA 4F1WA 4DV7B 5AW6A 2RKWA 5M7EA 2QDXA 5CBKA 2LTAA 2WD7B 1Z08A 3RSSA 3UV6A 4FYKA 4RVOA 1ECGA 3DEFA 3RAEC 3FCOA 1BOFA 1WE2A 3BVPA 4QL3A 4EW2A 1BHJA 3TVDA 3ZHCA 3ESQA 3WTCA 3OZIA 2R65A 2YDYA 1RRPA 2HSEA 4JBNA 1QX3A 1SMKA 2WYOA 2VYVD 3PG5A 3LXMA 4D96A 3GGPA 5G0TA 1KC1A 3RJTA 3FZEA 3QBVA 4CFSA 4E15A 3HMQA 1XRMA 5H70A 3OZCA 2X6QA 2GEFA 4UOZA 1D4ZA 3K15A 1KFKB 3CZMA 2CZGA 3KB6A 3QOYA 2H1RA 2V03A 3WWYA 3ZIDA 5GZ6A 2CE2X 2RJ3A 1K7FB 1XWWA 3BWXA 4RBNA 3UOAB 4EI9A 1QH8A 3CLTD 3E81A 4M6WB 3BIFA 5DXJA 3TSZA 5C1PA 3N8KA 3EWIA 4GM1A 4JYPA 4Y6SA 5DWDA 1A9QA 1P1CA 3JPYA 5IP5A 1TZJA 4LK2A 4EGQA 2XGJA 1G6Q1 1XKXA 2ODWA 1BKYA 3HLKA 1CZKA 2CFOA 5DRTA 2WJ6A 5T8KA 3L7MA 5C32A 5JLAA 1AOXA 3OZXA 1MHPA 1D5WA 2CNBA 4NL4H 1I9GA 2WSBA 1AQ6A 4LDJA 4XDYA 1L4HA 3ZH9B 3VC3A 2ZAIA 5BUQA 4XQGA 4RMGA 1DG3A 1XG5A 5JNSA 1U6KA 5GJBA 4CHTA 3C3BA 4Y18A 2VP6A 5JSZA 5FV4A 1GN8A 3GF4A 4FB4A 4MSUA 2WAYA 4TTIA 3ANXA 4N0QA 1PTJC 3WA7A 4CIAA 1KZ7B 1H4QA 4KRYA 2VHTA 4CQJA 1YKGA 3RS9A 3ZLTA 3AMVA 3AZOA 3UMFA 2JFHA 5ALVA 5FI5A 1YBVA 1V26A 4EJSC 4RTOA 5U4XA 1VA5A 2X8BA 3AL3A 1WCWA 1I30A 4PG7A 4YLEA 2V0GA 2BBTA 4EX7A 3MTBA 1E2PA 1N0UA 2D5CA 4QQFA 4Q1VA 4AKTA 2BUCA 2D5LA 2Y6UA 2OC4A 3RC3A 4I99A 2VZLA 2F1IA 3PDWA 3H5VA 4JR0A 4JT2A 4WESB 3R23A 4TXLA 3K1TA 4OJMX 2ZPUA 2IFTA 1FRQA 3MF4A 1SHJA 2ZRQA 4GOXA 4Q4AB 4D97A 5BR4A 1XCOA 4D3SA 4EG7A 3K4HA 2IIPA 2R3SA 3BJZA 4F86A 1SK8A 2XMSA 3OE5A 4KKVA 3VR4H 3ADCA 2PANA 1ZH0A 1L3IA 3C8ZA 1XNRB 2AJTA 4BECA 1LU9A 3LY7A 2Q1XA 2CYCA 1C41A 2BM1A 1BMTA 5A3JA 3SEAA 5DMXA 3GGCA 2VT2A 2JNWA 1XU7A 2YYSA 1OF1A 3IO5A 2Q6VA 3R41A 3W5VA 2X5NA 4BVEA 2NT4A 3VTAA 5DX0A 5ARDA 1EDZA 2A9RA 2XVAA 2HF7A 4HMQA 3N7UA 1P44A 4JZYA 3UK1A 5CA1A 6ABPA 1QNFA 4BO7A 5KVVA 1GSAA 1RIIA 1XZKA 4PHTA 3K5IA 5HRCA 4QELA 4QVIA 2ZJBA 2DR3A 3QWBA 1BS9A 1T2UA 1T0UA 2QSUA 2R6FA 1STOA 4J49A 1CRLA 2VNHA 1CUGA 2XE4A 4XQ0A 5JVDA 1FU8A 4UM5A 3CBQA 1W36C 3MMZA 1L5HA 4YRQA 1CUWA 2ONYA 1WZIA 5AVVA 3P4UA 2DPYA 4NABA 5CJ2A 2NVUA 2GK3A 3T9DA 1R3UA 3TTSA 4LYGA 1UP4A 3NHSA 4CMBA 3BICA 4DCVA 3ZWAA 5MGBA 3ZDAA 1HO3A 2BR5A 4PZDA 3IXMA 2WHQA 1QIFA 3GGGA 4KAAA 4XD7D 2X14A 3BG5A 1GAWA 3PUKA 4G2TA 3VR2D 4E21A 2HQ1A 3IE2A 4F56A 4GG1A 3W6OA 1U0JA 5DTEA 2VH2A 2ZW9A 4ICIA 1WBBA 3ICOA 4DLTA 4ABYA 4PYMA 3GXBA 1EFHA 1FVHA 4P82A 2ZCVA 1U3CA 4V3BA 4Y2XA 1UJCA 2PKYX 4GP7A 1W0JA 2IBMA 1K6EA 3HBFA 5AVUA 3ABQB 1YZQA 1BA2A 2B4QA 1O6CA 2IJGX 3ERCA 4GMGA 3MAAC 4U2CA 5A4JA 3S2EA 2ZSAA 2PJDA 4GWGA 1YOBA 2G36A 4B48A 1QO9A 4FMBB 5E7JA 3FYHA 1X1DA 2PX2A 2GMWA 3HO6A 3IALA 5I5EA 3G59A 4Q4DA 1EUYA 1Z8DA 3LVQE 4X24A 2JI4A 3I4LA 5BW6B 2I9KA 5F3DA 5E38A 2ATIA 3OZWA 3DMRA 2BL4A 4QPJC 4ZALA 4YT2A 1NW6A 2VLIA 5IRCD 4OYHA 4BNWA 4L3OA 2HNKA 1R6XA 5EXPA 1DBWA 1NN1A 3SHQA 5EEHA 2J3QA 2Q3JA 2H1OA 2DSTA 3LQKA 1BHQ1 3R0JA 5F9HA 4M54A 2QXTA 5DXFA 5EQDA 3ETHA 3UMGA 5H4GA 3D5TA 2HGZA 1Z6AA 5BWNA 5CDFE 4F7DA 5JMWA 3VKWA 4D8YA 3HCPA 3SZMA 3WWPA 1JSZA 1HE8B 1N2XA 3KHKA 4AC9A 5KYXA 2QVCA 3OLQA 1NBAA 3ISTA 3TG8A 5JSQA 2I91A 1Y6RA 5EKTA 4DCOA 2AFVA 3EYAA 3IOCA 2XAUA 3QLVA 1DELA 4MVJG 2EP5A 1EG2A 3ZJVA 1RKVA 1V9SA 1OXKB 3K2BA 3QYFA 5J43A 3UZUA 2C29D 1KY4A 1QFXA 1P81A 3B6EA 4JI6B 2ZB8A 3LYAA 1CY1A 5K0JA 2GEVA 2OEPA 2VN8A 4M1EA 1Z4NA 4FU0A 4TTAA 4XW2A 1C7FA 1PNVA 5HQ3A 1QRUA 5GOTA 4Z6KA 2G8LA 2RGCA 3FLEA 3B1ZA 3FSEA 3NATA 4QGFA 4LF9B 1IVSA 4XQCA 1QP4A 1VGRA 4KXXA 1DLJA 3F6SA 5CLIA 2C0CA 1DZIA 4HC4A 3JQBC 3ODGA 2W6MA 3HDYA 1S4QA 5BVGA 4TUYF 5HOQA 3N2GA 3NHRA 5EG5A 5TC4A 1Y82A 2HRDA 3EVNA 1HTWA 3JQCA 1QHEA 3UAXA 3EUWA 3GGDA 3PRKE 4TLAA 3R8XA 1SULA 3Q10A 2CNWD 3QPVA 3IERA 3MWKA 4IUCS 4XX0A 1AGPA 4P9NA 2E18A 2G67A 3NTLA 3TLAA 1SHUX 3LRXA 3F98A 3G79A 3GQBB 4DPKA 3IKJA 4QG3A 3NX4A 4L9AA 3DBIA 4BFSA 5IDVA 3IKLA 5LCXA 2J9GA 5LUBA 5EIHA 4AMZA 4A15A 1XSEA 3RBVA 4BTLA 4AROA 3G0HA 1UQTA 1IN4A 2W00A 4QYXA 1NFFA 4LE0A 2JGFA 1E5LA 4RL4A 3QLUC 3LWNA 3C97A 1E9VA 2X8LA 4UEWA 3SJBA 2FPUA 1HFJA 1NW3A 5EWLB 1RACA 4IHJF 3MHTA 5JFTA 3ZDYB 2GEJA 1RWVA 4MB2A 2XBMA 3NASA 3F46A 5JAUA 4RMIA 1P7PA 1RBMA 2KBFA 4PZEA 2RIRA 2XW6A 3SEQA 3VRHA 4AJKA 2G71A 4TMVA 4PSVA 1T0JB 4URUR 2GLTA 3CUSA 3FG9A 3AFGA 1HTTA 4V1CI 2XUZA 4DCPA 1YZTA 3SOPA 2G63A 4IP0A 2V4MA 3DQZA 3F6YA 1C9EA 4MOWA 1KR5A 2I9PA 5AT1A 1VJTA 1M10A 3NXKA 3O4GA 1YCHA 1JJIA 3I05A 4IV0A 1AGRA 1B26A 3KBBA 4C4XA 1LBQA 2E21A 4IVPA 4FEEA 3SCZA 5HM8A 3QUSA 3EZ9A 4G4SO 3UMJA 5LA6F 1C3OB 3QKRA 4LJAA 3U4QB 1YS1X 3ZN2A 4Z4CA 1XK7A 3D6FA 4OXRA 1O9BA 1R00A 2C2WA 2VP0A 2YDXA 3QI2A 2BE7A 4WA7A 2WB2A 3FDZA 3NOOA 4BX8A 4E0BA 1P0QA 2C5FA 1IPFA 4IM7A 1KTVA 3VR4A 3HKCB 2C9OA 2R11A 4KLRA 5FTLA 3C2QA 2HSGA 3EEBA 3ESAA 4MJLA 2QUKA 3MT7A 4HPJB 4P8RA 3AGPA 1L4FA 4JUBA 3DXFA 2AF3C 1MXHA 1GKKA 3CLKA 3DDWA 5A4MS 3I9JA 4PU0A 2DERA 4S35A 3L0ZA 3ITKA 3KQSA 4WK2B 4A0RA 2F43A 3A9VA 1TGYA 1VQ1A 2P2NA 2VJNA 3H5IA 4V2UA 3OLYA 1J6UA 5CR9A 5CAEA 5CT5A 1FDRA 1TM7E 1O6FA 4QUBA 4KV9A 3T3NA 1TJNA 4WNAB 1Y81A 2B6HA 2OCKA 1NF2A 4C7XA 1DOHA 4ZRDA 1HOTA 4XCVA 2AQHA 1GPBA 1E1LA 1L5FA 4RQTA 4C7JA 4ESVA 4XWTA 4B3JA 2VBIA 4F96A 1HH4A 1NF9A 1YFLA 3H9GA 4R8SA 4M3NA 2YN0A 4JP3A 3U7EB 2WU8A 2GYVA 2PH1A 1NYTA 5HJ7A 1WW8A 2BAGA 2PX4A 2XI4A 3ROGA 2AS0A 3O90A 4W9NC 4S3MA 4DLZA 4WV3A 5ICCA 3U0VA 1I2CA 1NR7A 1G5FA 4PF1A 1YJ8A 1DEXA 1Y4DE 4L72A 3TLBA 1BNCA 4EUHA 8ABPA 4DNXA 4M0UA 3C6QA 4FTWA 5H16A 3BJEA 4ROSA 1TQ4A 4O59O 3A26A 3IBTA 2IUSA 3K5HA 4NCJA 4ZT5A 2VK4A 1MOQA 3PICA 1QHYA 2R8ZA 1LVHA 3BGSA 2PGNA 4H3VA 3OTOB 3IP7A 4O1IA 3PEYA 1UBRS 5B3JA 5CIQA 1FFGA 4DLAA 5G0WA 5D7BA 4PCLA 1LNSA 3BL8A 5HKBA 4J0HA 2GHIA 2FQXA 2GS9A 2WTEA 1NF8A 1HYEA 3QEBZ 3HCBA 1Y0BA 1FMTA 3C1AA 1ADFA 3EXHC 3HSKA 1REQA 4MDHA 4RNCA 2HPVA 2Z1DA 2PZBA 3BHMA 2QPTA 3DAOA 2PDAA 1HF3A 3LHSA 3ONDA 3N07A 5HCUA 2ZIWB 4BMVA 4FDMA 4IOMA 2XMBA 4B4UA 3D6NB 2HQSA 2WA2A 3O38A 1K92A 3V9AA 1SBIA 2QMHA 3SZRA 4DIOA 1BEZA 4WCVA 3C1UA 3PNYA 1DVRA 3ORRA 4M0DA 4BV3A 5CLFA 2CFTA 2HLPA 3T9AA 1PUIA 2FTKE 4Z8XA 4BMOB 1Y7HA 5HKOA 4JU8A 3UCFA 621PA 2C4TA 2IP4A 1XCBA 1Y34E 1XDBA 2VO1A 5DNWA 2B30A 5FFMA 1TCBA 1X42A 3AUYA 3BKWA 3EIUA 4ERXA 1U1GA 2H7VA 4R54A 5G1PA 3EHDA 3WIDA 3HJAA 1MAHA 2G6TA 2WYVA 4M86A 2WMYA 3UT0A 2OB2A 3I2JA 5JXJA 2YASA 2GEDA 2PMBA 1HT2E 4J6FA 4K9QA 1WB6A 1BHSA 2AN3A 1A8HA 2EF1A 1J4AA 3I0MA 1C7IA 2ZRNA 3B6ZA 5EZ6B 3U6BA 3SQLA 2W0MA 5IXJA 4RMJA 2ZDHA 1UFOA 1SVMA 1NNLA 1QBKC 2QP9X 1O08A 4RHUA 5DK4A 4EY6A 4YUZA 4HNSA 3KLPX 2E6UX 2PLRA 1HY3A 1CC1S 4LDAA 2AMVA 1ZISA 4BUZA 1NNUA 4LRXA 2B94A 3N3AC 4GT1A 2IXGA 3CXUA 1FDVA 4P83A 2JW5A 4BLSA 4JB3A 1QG0A 4KQHA 4RIGA 1OAOC 1SKUA 5K9ZA 4GUAA 4D9BA 2G28A 4JROA 4TV8B 1RXUA 3DXYA 3ZDRA 1DIOB 1Z63A 4MV4A 4MI9A 1JPUA 1DUSA 4C6TA 1BS1A 4E12A 2OECA 3W2EA 4CF7A 2A14A 5BNIA 2OQIA 2ARKA 2QAIA 3OWXA 1ETUA 1LDYA 2C3YA 2Q9UA 2UVPB 1P0PA 3P2KA 3U6KA 1KNXA 2E5FA 3UJ3X 3I9MA 5CX1B 1WZ2A 1N2CA 5K2MA 2XUGA 2QY9A 1D7OA 5EVJA 1G2QA 1ODJA 1DC5A 3HUTA 2AZ4A 4FNMA 4K28A 4F2PA 5C4GB 1Z83A 3SHVA 4ZOLF 3UYLA 4YPOA 1YKFA 3BK1A 3HNRA 4I7EA 1G8PA 4EJ0A 4GDMA 4RS3A 3DVLA 2V7UA 2V0NA 1TTHA 2FUCA 3ORHA 4KPEC 3IT2A 2O6LA 3VH2A 1VP9A 3PC2A 1DJMA 2QX4A 4RDHA 5JZVA 2P9HA 2YJTD 1AKUA 1E1KA 1JIXA 1QJ4A 3EPPA 2UVQA 4BNXA 3FYDA 4RD4A 3R0VA 1EH5A 1Z3CA 2J9FB 2P1RA 4OB6A 3HO8A 4HX2A 4PX3A 3T7RA 5HFAA 4ESOA 1E4OA 1Z6PA 4O5OA 2BONA 3ORYA 1JFFB 1LBSA 1WUYA 2H2FA 1Y8AA 1EVLA 1RLOA 1HFWA 2P65A 4RMHA 2OHFA 3IVMA 3JZAA 1N2IA 1Q0RA 2GRUA 3K35A 3R3JA 4ND6A 4PQGA 5COBA 3HUFA 5KMGA 4W82A 2FP4A 1LY1A 2J33A 1CUHA 2J3LA 3IBYA 2CKDA 3ZTYA 3V4LA 4UE3S 1JBEA 3WVNA 4DXHA 1VDZA 1LV8A 2PWBA 1T0PA 2HCJB 2QTFA 4M37A 1P9OA 3TXYA 4IJWA 1CJSA 1VBNA 3GJZA 3LKZA 4ZQCB 5HHTA 3W6ZA 1K9SA 4AS2A 2AW3A 2NZVG 1NW7A 4G1EB 3IOEA 4N65A 4RIHA 4X65B 3F5MA 2OAP1 3P0IA 4D5GA 4EZEA 2NSJA 3KJZA 1K5GA 1SO8A 2XTZA 4Q47A 1C81A 2XF8A 3CM0A 1KKUA 4MDYA 5T3YA 5D51S 1EX6A 1HDGO 3OQPA 3UV7A 3KZOA 3OOWA 2C5BA 4ND4A 2QYOA 2JD0A 2OTCA 3H11A 1G4UR 4GO1A 3GNSA 4I9UA 1B00A 1H2WA 1ZJ5A 2IV7A 3IVXA 5I8ZA 1CYEA 5FO1A 3T5DA 2I7VA 3IA2A 4FOSA 1L4UA 3P5BA 5I9SA 5TB5A 4AJ2A 1PNQA 3WGOA 1TK9A 1HLGA 2VNAA 4BE4A 1EXNA 4FHEA 4OA8A 4IGFA 4Q7EA 1YDGA 3CLHA 3TE6A 1I0ZA 3WDSA 3HK2A 4L0MA 4TUYA 3GP5A 3UJHA 4D9JA 3V1KA 1N0HA 2I2BA 2VTKA 2GPAA 1B93A 5L45A 1VXOA 4QBTA 1ZNZA 1OVMA 4Z7QB 2D4HA 2UUPA 4O4IF 1MJHA 2HR1A 1UT6A 2HWKA 2P2DA 3E1GA 3CQ9A 3R3SA 4U6QA 5J2UA 1L8OA 4EH1A 3DP9A 1TAHA 3D9QX 5IBQA 4CIBA 4FS8A 3HBLA 1RI3A 2WWRA 2V7BA 1JDSA 3T1YB 3C8MA 5CDHA 1QDUA 2GDJA 4UMDA 4MA5A 1PNRA 2BKUA 3WISA 1BCRB 1PW5A 1XROA 3K8ZA 2O2IA 3A32A 3OPVA 3I1YA 3I04A 2YCBA 2Y1FA 2ZYDA 4LMBA 1C30A 1RABA 2Q5JA 1ZJJA 4CF4A 2AGVA 2GD6A 4NMMA 4FOLA 2OO3A 3CNHA 1OH7A 3I2HA 2WTBA 1C1HA 2OG1A 1EI9A 2ZFUA 4C5BA 1H22A 1YIOA 5JYDA 3ZCPA 2C95A 4FYXA 4ZRMA 4FYVA 4P4NA 2XRMA 4V39A 1JEYB 1T4DA 5EWJB 5CB8A 2VRCA 1NJ1A 3D5EA 3JCZA 4NJMB 3RW9A 4BUCA 2B0CA 1KF0A 4KFUA 2FJUA 4UZEA 5FADA 2OKCA 3K9BA 4E1BA 1CWUA 1EDOA 2HT6A 3D3JA 2DT5A 2HJWA 4KPUA 1HLPA 4WRRA 4JX9A 4WLEA 5COQA 5E95A 4X92A 4RULA 5ADUS 3GFRA 3K9GA 4H31A 1DV1A 3OKAA 4CTMA 1G9SA 4JLAA 4YRDA 1QO7A 3ONWA 3A6FA 2X5JO 3FPAA 3I0NA 3QY0A 5BSTA 1O95D 5LA6A 3SQMA 3NV7A 3ZK8A 1NTRA 3ZWPA 5DLYA 1IB0A 3I62A 3FAKA 5I9NA 3IAM1 3B20A 1BOOA 1FJ2A 3LP6A 4QGBA 4AP9A 4KPYA 1KI3A 3H4VA 1X7ZB 4G5OA 5TMBA 3U3DA 1G6KA 1SIBE 1A7AA 4ER7A 4OU5A 2CXOA 4BFLA 3JATB 4BVLA 3OHPA 2EG5A 2O1SA 2XDAA 3VU3A 4TWIA 4BTEA 1U2ZA 1P2FA 4RCYA 4YXFA 2NO4A 3AR7A 3AI1A 3JQ7B 2WHPA 1SCDA 1ZK2A 2TSYB 3HYNA 4BVHA 5F51A 1XLWA 1I3KA 2DECA 3SD7A 2WA1A 5ALYA 1DIBA 3W5HA 4MWCA 1X92A 2F2TA 2WKQA 3M9LA 4PYLA 2ATCA 3L6CA 4DQVA 4O1MA 5K8LA 2KHZA 1IMOA 3GU3A 1QRRA 3A9CA 5GWXA 5HOEA 1G291 1GADO 3N59A 3QIVA 4TKVA 4YX9A 2C99A 1A9SA 2WABA 2AC4A 2CUKA 3OA2A 4S12A 4Y2SA 5HPYB 2ECFA 1K97A 1GQRA 3F7MA 3RTDA 4TZTA 2ZKLA 2LDXA 2V3VA 3NDBB 4QNRA 1Y42X 4NZZA 3DWGA 1JIJA 1P5JA 3FPHA 5COAA 4MW6A 3VOBA 3VKHA 5JUWA 1VBKA 4OLBA 5DCUA 4TXJA 1FP2A 3BMOA 2IPAB 2R6R1 3IQEA 3TSAA 3TL3A 1VG0B 3TQHA 3D8BA 2JA1A 3WXMA 1KS2A 2VQSA 2AG6A 1GNTA 2DBZA 2IUFA 5E6SA 3RF6A 4UPEA 1ISMA 2W43A 1YUBA 2BEUB 2ZQZA 2Q4BA 3EXEA 2H4ZA 3GELA 2P0AA 4N49A 2PY6A 1PJBA 4NEQA 5KTTA 3PRHA 4PSDA 2H51A 3DEAA 3KSMA 1APBA 2A92A 1TT5A 2AFIA 3TFWA 4L76A 2H85A 2BFNA 4R9UC 5B3KA 4ZAVA 4EYEA 4GSKA 3EFHA 5JS1A 4ZEWA 4CG0A 3WK4A 1EGHA 2FHSA 3BZUA 3N1UA 4O08A 4DLWA 1M0EA 4EEZA 4QDTA 5DHSA 4YAWA 4BASA 3WYCA 1DDOA 3QVTA 3PGA1 1VRWA 1KEEB 3JWHA 4MI1A 2C7PA 5CITA 4M36A 3C7DB 1GPDG 3DZDA 1BCSA 3ENNA 2QRGA 1VB5A 3QFFA 4PN3A 4NV3A 4CLDA 1PQYA 5EUMA 3KXPA 3EPLA 1PTJA 1Y1TA 2XH8A 3O2QB 1NKTA 1KEKA 2O7QA 5FWNA 4POOA 3EVGA 2BBSA 3W5UA 2C4WA 3I6ZA 1NKSA 1PQUA 3UAVA 4N82A 3K4QA 4NBLA 4C2AA 3ICCA 5KNCD 4EJSA 2RK4A 2XCTB 1YF3A 1WSAA 4IF4A 2Y99A 5TF4A 1IUKA 1V5WA 4BCCA 1GLGA 2BGKA 2J08A 4QBHA 1I4OA 3R5TA 4FJ2A 4U5XA 1Y9AA 4ARSA 3GZ4A 3NLLA 1A88A 3ZY4A 2FSSA 2ODPA 3IUBA 1P2UA 2CHQA 2VNSA 1GZ4A 1ID1A 4GPTA 4NCKA 2WHRA 4NWIA 1QOQB 3G7UA 5K0LA 3GUVA 4UTRA 1QU2A 1K0UA 3UWPA 4YC7A 4KOAA 3UJPA 3Q85A 5B55A 2IS6A 1I5OA 3GJ3A 1P2SA 2CLEB 2VXBA 1OIVA 4LSMA 2VCHA 2EZ4A 2OBMA 3PE3A 1JB9A 5G3ZA 4LJSA 3TE7A 5BT8A 5A5DA 3AETB 3QNWA 1HRKA 4PWZA 2ZVPX 4GI2A 3QUQA 1YSCA 2YOFA 2YWCA 3LLUA 2EX4A 2XCLA 3IODA 3MJ4A 5B1EA 4QX6A 1U9JA 2ZTSA 4AJNA 5JTUA 4E33A 4DV1B 1RRGA 2ZYSA 2OAGA 1FVFA 1Q0ZA 3OD1A 2H2HA 4A8JC 2QVYX 4JWTA 1UJ4A 5JAOA 4PLYA 1UJBA 2AD5A 2XNDA 3BMNA 4MVJH 2ZVQX 1W4ZA 4IMPA 1C0KA 1VCNA 4MA4A 4B2PA 3WBKA 2Q41A 3PCTA 4XLTA 2ZS9A 4ZT7A 4JN6B 3T15A 4LTNA 4OAQA 5DHTA 1V8OA 1VIDA 4EEKA 2MMGA 1MFZA 1Y8QB 4YROA 3C3DA 2ZYGA 4V0QA 1KJNA 4MR9A 1WTCA 1XZ8A 2NT3A 5CLGA 5CG1A 4GR4A 1EDBA 5DU2A 2F90A 3LPDA 4FZ5A 3S28A 1UIRA 2C2YA 5LPNA 1Z17A 3CWCA 1UC4B 4LFBB 4AMGA 1ZCBA 1JYFA 5IF3A 2A2ZA 1GXSB 2BT4A 2HU8A 1N5JA 3OZFA 5K3AA 3FVRA 4BBAA 4BN4A 4ETWA 1A50B 1FPMA 4A8PA 1XJCA 3EEOA 2EZUA 2XRFA 3HBJA 4Y6PA 1U0LA 4GVPA 3FUXA 1Z4IA 5DRYA 3HRKA 4GYYA 1E59A 4N7MA 4NYMR 5EVCA 2F9MA 1MLDA 2AEEA 2WEKA 3K71B 1L5MA 4YTEA 2EDCA 3C3WA 1Z4JA 4LGMA 4Y2UA 5CHYA 1TTPB 3TAUA 1PZHA 4E3WA 2PG3A 3U7IA 1KERA 5HFNA 3O4JA 1PR5A 3GRRA 3VTZA 2YVQA 4KFSA 3LG2A 1QRAA 5EKDA 5F4ZA 1R5OA 4WKNA 2IXEA 1ZOIA 4TXMA 1RYYA 3MW8A 4LVNA 4BAZA 2UAGA 3KOOA 3IDZA 4LE1A 5F9MA 3RG8A 3AR2A 3L18A 1G8YA 4QM7A 4ZVOA 1UBFA 2YV5A 3U9SA 3OICA 3BCRA 1KO8A 1PJZA 1WUIS 2AFHE 2I3ZA 3AR6A 3ML1A 4EG3A 1DJPA 4LOLA 4BEBA 3OU7A 1QVZA 5C1BA 4V1CB 5JD5A 2JCSA 4F2GA 3GNQA 4KFCA 4JCCA 3OCXA 2DH5A 1Z2CA 5DULA 4PY2A 5A6SB 4DDVA 4XTRA 5AOAA 2YJNA 4FFSA 2EGGA 1YUNA 1P1KA 3KDAA 1LGYA 4BMYA 1VPWA 1UP7A 3FY4A 3RHFA 5T4EA 3DFZA 4ZEOA 1XA0A 3BWBA 4KFTA 1W46A 2ECPA 1B3RA 4F3YA 3L6BA 2GYUA 3TQTA 3KTFA 3IV9A 2XGGA 4FMPA 2DKFA 2L42A 2OR3A 3CKKA 1T9AA 2Y8EA 4MW4A 3SN6A 2Q62A 1ZVVA 4QXPA 3F74A 3F4LA 4MR7A 2WWIA 5KQMA 3KRTA 4FMDB 2FMKA 5FTJA 1ZW1A 4ZZ2A 1Z36A 2Q9BA 3AKDA 4HWGA 1OV6A 3MWGA 1I10A 1YMUA 2JEZA 4ZVUA 3ZWBA 4F91B 1E9CA 1YZYA 1PWEA 4V3CA 2C7BA 2EX0A 1EFVB 1OHHD 3F0TA 1FRFS 4V0KA 3DL4A 4K2AA 4PLCA 4TT3D 4ZDWA 3W4IA 1SBZA 4YCJA 1V7QA 3A4LA 1PW7A 3C5HA 1T5IA 2FMFA 1RAGA 4G41A 5B4UA 1XMVA 8LDHA 3COPA 2WWYA 4FDVA 4LCJA 4O4IA 4EMBA 5LP6F 2VJQA 4ANFA 1DL5A 1FXUA 2BGTA 1KWGA 3AB3A 2NTNA 3EWNA 3PJEA 4LUCA 4NENB 3A25A 3HWSA 3P94A 4MV6A 1T2FA 3ZCSA 4BIIA 4R5HA 4DAOA 2BFDA 4ETIA 3A58B 3C3XA 2VJOA 4KIUA 4MS3B 3UEOA 5KSWB 3JQBA 1VA4A 1ZJWA 3PUVA 4LHYA 2Z98A 3HA7A 3GA7A 2E4XA 3E35A 4IQGA 1PQ4A 5AXAA 1NRJB 10MHA 3HCCA 1U0NA 4C7KA 2ZBFA 5HIJA 5JZSA 4C22A 1JG6A 3H5OA 4PO8A 1EB9A 4IJQA 2HLDD 2WWWA 1TC2A 4HADA 4BCDA 4L8YA 2WJWA 1E9FA 1R6DA 3QPAA 1J2YA 1CSEE 2D5BA 2XNHA 3FI0A 1N6HA 3HVUA 4IZHA 3WLJA 1H2HA 4FCCA 5A6VA 3KKQA 2WD7A 2Y1DA 3DE2X 4OK3A 9GPBA 2H57A 1TEZA 3QFRA 3GC6A 4OQQA 5KCMA 3OSZA 2FCRA 2I3BA 2J5KA 2XSZD 1Q77A 3W05A 5BUCA 2PUWA 2E49A 3ZHZA 1USIA 3FBTA 3NP9A 1OH5A 1IOWA 2OV8A 3V8EA 2IOYA 3ZZTA 1NLZA 1NBOA 3AK4A 5GIOE 4WK6A 3Q2OA 3RVQA 4C6HA 3QLUA 3T3MB 2DULA 1R9MA 1UOOA 1P4HA 4F85A 4ZRNA 1A1VA 4J2TA 4J0FA 4C88A 1YZLA 2H2GA 1TAGA 3JD2A 4M6WA 5ENVA 5TDHA 1ZONA 3PFHA 1AO0A 1UZMA 4PAQA 1JDBB 1TCVA 2OK7A 3MOGA 1J56A 3EB9A 3HUUA 1U1EA 5LDHA 2JH3A 3KB2A 3I9V1 3GJYA 4YQEA 3WLPA 1OFGA 3MRVA 5T4BA 2X5OA 1U8UA 4HGOA 5HM6A 3LC1O 4M1KA 5ER9A 1GILA 4EGSA 1UWVA 4WVFA 4WZAE 3NGLA 2P5YA 4W1PA 5GJVC 4XIIA 3GUZA 2GKSA 1U2QA 3F5QA 4WKGA 3IDQA 1IM8A 2Q6LA 4CFZA 2QRUA 4RVFA 5FORA 2D7DA 1SA0B 1LRLA 3FJOA 5BV8A 2X9NA 2FN7A 3OPNA 4XGNA 3ZHUA 5KNDD 1XMQB 3UUEA 2WD9A 4D3ZA 3ZR4B 1WJGA 3NYRA 5ICGA 1UWKA 3ENKA 5CDSA 1PFKA 4L50A 4P34A 3TSYA 4PIMA 3G2KA 4RPGA 4ZP1A 4ZAGA 1PJQA 1M8PA 2CKMA 2O1WA 3NEAA 1HI9A 2HFJA 4IF6A 4AQ7A 4E7PA 4ZZ1A 3C14C 1LSUA 4KC0A 3ZG6A 1IG3A 2P9ZA 3G5LA 3UAOA 3TLZA 4OX9Y 2C0PA 4MVJA 3PZBA 4ECEA 3HEMA 3AHIA 4C2TA 4G6ZA 1NVXQ 1Q1AA 4RYLA 3UNXA 1SD5A 1W25A 2FETA 1E98A 2MSEB 1JDUA 2O7NA 4KN6A 4TKUA 1TVKB 3RFUA 3S2FA 3W04A 4JC4A 4AU1A 2D06A 4W7HA 4X7BA 5D85A 2FFJA 2FWAA 4C3UA 4Q4AA 1F4LA 5M3BA 3WB2A 3MMSA 2DQYA 3RRMA 7MHTA 2O0HA 4LHXA 1E5XA 4MR8B 1K3TA 4DBVO 1E4EB 2R8OA 1CRWG 3JQ8B 2CDCA 4GP6A 3K20A 4PIVA 4W9NA 1KY3A 1RHMA 2H8GA 4PGMA 1QMPA 2PAFA 1MTZA 3C5EA 1QCCA 1UK8A 1CULC 3DM9B 5F4BA 5BO5A 2MMCA 1NR1A 3ICWA 3PQFA 2YN2A 1EVYA 1N6PA 1WIWA 3PUXA 3C7CB 3JV7A 3O5AA 1Y6QA 2R6CA 2VYQA 4ZCQA 4C3VA 1KYIA 5HRUA 2X8AA 3FRJA 1UXKA 3DYVA 4AUKA 5DN6D 2BW0A 1AKNA 2B3DA 3HI4A 4ZT3A 5CVUA 3VDXA 1O77A 4IX1A 4U8HA 2FQ1A 1O1YA 4J4TA 3E53A 2E9SA 4AN4A 3PVZA 1N6NA 2YMQA 2FAXA 3KOWA 4EENA 4RHTA 4C04A 4R2IA 4B75A 2O5VA 2J0EA 3EAGA 3RSLA 1C4OA 3AFNA 4IV8A 4BGVA 5I51A 3RK0A 2FW9A 4G97A 5HMMA 3EXHA 1EFDN 3DEKA 4G0NA 1M2WA 1N57A 4HN4B 4YP0A 1ZM2A 3WLNA 2B25A 1Y5IA 3O9VA 3B51X 3VC7A 1VHWA 4UVDA 4KMOA 4E31A 4UATA 3QXXA 4MJXA 1FE8A 4G86A 5JS2A 1D2CA 1YT5A 2YV1A 1XDSA 1OKKA 3FCSB 2C8LA 3L4BC 3OOJA 1FFAA 1NNI1 4HYTA 4AFNA 3H04A 4C3ZA 2A5LA 1L4GA 3LPNA 1DPGA 3JX9A 4HK4A 4JMLA 3RG2A 5LQCA 3TL6A 3WQSB 1RXWA 1J8FA 3JWJA 1E2JA 1BD4A 3AERB 2XQVA 3BFXA 4X66B 3PXEA 1DKUA 1WL8A 2QYSA 1L7DA 3N2YA 4UXHA 1PZFA 5B1DA 1S2LA 4IIVA 3ROPA 2PLWA 1II9A 3VO8A 4YYZA 5AESA 3QWFA 1JVBA 1PGQA 4RWZA 2QX8A 5D86A 3WP0A 1OH6A 1F1BA 1IXZA 1T1IA 2GZAA 2GZ1A 4KIJA 1HDRA 1IN8A 2XMGA 1O54A 4MKGA 4QTXA 2VOEA 2RI1A 3B5JA 2QL9A 1QHNA 3PQEA 3DKRA 3KSZO 1FS6A 2G77B 3OHMA 1X9GA 4Q4HB 1B2RA 1OJ7A 1K3FA 1QYVA 5I7FA 1K7CA 2AN5A 3DSRA 5EUCA 3WL6A 1KU0A 5DYTA 1WQ1R 3E8MA 1CJMA 3RRZA 1OAOA 3W34A 1GPAA 3TQRA 3NH9A 5KBYA 4NPCA 1EWKA 1KQPA 3C4VA 3RVPA 3JRNA 3N5CA 4UTNA 5M5BA 3ZBQA 3JYLA 4FKBA 4OP2A 5T6BA 1X13A 2HW8A 4EOGA 3GPBA 3IMKA 4A6DA 2EHJA 1MIOB 2GKOA 1IXKA 2YFQA 1AMOA 3GN2A 1OFHA 2FQYA 1WZUA 1IY2A 1L7AA 4MWDA 2V7XA 1DIRA 3LDHA 5EJFA 3BT7A 1IBCA 1WNTA 3CT4A 2Q1YA 2ODAA 4GBED 5TPWB 4JJGA 3K0AB 4WKPA 3H6HA 4JP8A 5J58A 5K3DA 4IG4A 3X2EA 4LQDA 2ADFA 1UFQA 4HDKB 1N34B 1RZRD 2B7BA 4C1NA 3T61A 3VH4A 3KQUA 3VYSB 2CL7X 4B7CA 3O3MB 3J80A 1FQKA 2Y6VA 1A7KA 5CMLA 1A9RA 1DAHA 3HDGA 4HNGA 4GLFA 4QQ8A 3LDGA 3TECE 3NR2A 3GEHA 4YR7A 1KE2A 1F9AA 3KEOA 3K2EA 4JQCA 3O94A 1P75A 2P9YA 1YK0A 5GADl 4ZQHA 1RM4A 3QE3A 4OB8A 1E2HA 4YRGA 1K4MA 3WO0A 5F1KA 1YULA 1UL1X 3R0XA 4PLVA 5BMVF 1EK6A 3BGDA 1T9CA 2MSLA 3AYXB 5DYIA 1OZ0A 3WJ2A 1GV1A 2VDOB 1I4TD 4ZKEA 5CG2A 1VRCA 4G1UC 2NU8B 4BVBA 3L9XA 4X62B 1R9NA 2XWSA 3VYTB 4LJ7A 1DQPA 4FOPA 3U9TA 1GPJA 2O3UA 3PRJA 5F1OA 4MUNA 3TTUA 3GQBA 2H00A 2FSIA 2PU7A 3Q87B 4DBLC 6LDHA 4HQKA 3SIPA 1RWWA 6NULA 4O02B 4C6SA 3KQKA 1VC2A 4CMHA 3IQGX 4MV8A 1IATA 4DABA 5ALQA 3FGZA 1UDAA 1NG1A 1ZRNA 5I3ZA 3DV9A 3TGPA 4KHPB 4KQWA 5JNRA 4F3KA 1L9KA 5H5JA 5EWLA 5IAAA 5F73A 1V4BA 1T6ZA 2HV8A 4TLEA 1DB3A 1L8AA 5FPHA 5KPJA 4W5QA 1Q3KA 2OGWA 2Q2NA 3R75A 3UAGA 1U9ZA 2IY9A 1FU4A 2VHXA 3LI2A 1DJOA 5LJLA 3QGMA 4TTQA 3IQIX 3OLZA 1ZRSA 2PUJA 1JDBC 2RGNC 5SZJA 1DAKA 1AKVA 1E99A 1GLVA 1K6JA 1JIQA 1PFQA 1W5TA 3D8HA 3KSUA 3TLXA 3LHFA 1J42A 4MAFA 4CKYA 4BO9A 4X8MA 5F5XA 1Z68A 5DYWA 2REXB 3ILXA 2OHJA 1FEZA 1CD5A 4FXPA 4IFBA 3WFJA 5AVZA 1NPDA 2HNAA 4AT1A 3GFFA 2R6HA 1EJ0A 2J4DA 3CGWA 1Z7WA 2ZITA 4KG7A 1C3OA 2IXBA 4DLSA 3U4QA 2VPXA 4P7FA 1HSOA 4DMHA 2EOAA 1X77A 1J9EA 4AKGA 3FLAA 3AM4A 1ONNA 1QHXA 3Q7EA 2WJVA 5ECWA 4M1SA 4YP6A 3G2LA 1XQWA 3BSFA 3F4BA 2QN7A 1MMFB 3TBFA 1XLTC 4D25A 3E7PA 4X1KB 3HKCA 1N6LA 3H1PA 1KAMA 4FLFA 4AMYA 5LXTF 3D2CA 3WR5A 5K01A 1VI5A 4ZYTA 5K8VA 1N8KA 3V8BA 3I30X 4HFJA 2P4SA 2ZJ1A 4MKIA 1B23P 1ZMOA 1AQIA 1DC4A 5DTJA 3B85A 1YDFA 2FLWA 4R3UC 4YK7A 1QQ7A 1E5DA 3BMQA 3HB4X 3BGOS 2NSLA 5LU9A 2XB2A 4KP7A 1ZD9A 1KAOA 1R5NA 3OTQA 1YFKA 4KNYA 1XCMA 4WBNB 1B41A 1D6JA 3LT0A 4WNAA 1G21B 1FJGB 3SG0A 4MIEA 1SIWA 2QEQA 4Q02A 5EC8A 5JYBA 3ICQB 1F5SA 2XCIA 1IWOA 4ENQA 3AEXA 4YCNA 1EM8B 3U7FB 4WXYB 1QP7A 3GJSA 4RA9B 3LAWA 4KX3A 4X90A 1QU3A 1G8MA 2PTGA 4KXFB 5AKIA 5A4KA 1Z6TA 1A2QA 5BY2A 2VK1A 3KT3A 4I55B 3SWWA 1NW5A 2QKYA 1JHAA 1P39A 2M6SA 3JQRA 4QGHA 5LZ7A 4EY8A 1RRMA 2A9KA 2J5BA 3ZHOA 3SQXA 3H16A 4NYJR 4B3IA 1EHYA 2AA3A 3U4DA 2C2BA 3LX6A 1GQQA 2I2WA 1FXSA 1U0FA 3GJQA 3R6GA 3Q7SA 3PJDA 4XDHA 4KITB 1COZA 1SVSA 5AVYA 1AHPA 1OTXA 2VNJA 4IJKA 1TIBA 4QE3A 1TO6A 4ZHQB 5KAMA 2ES4A 3KFVA 5AW5A 4EHDA 1JR4A 1ORIA 4HXYA 5E2AA 2JH9A 2ZZNA 5FPTA 1YVEI 2YIDA 4M7WA 4XB6B 2VKTA 2Y93A 1X7GA 1BMQA 1BXZA 2BELA 2V4ZA 2IX3A 2C58A 1FY2A 1G7CA 1F8YA 4EFLA 5J9FA 2IUUA 5IFLA 1XZNA 2OOSA 1QP0A 4ZEVA 2W2XA 1MRNA 4AMBA 5B57C 4H3SA 3WX0A 3FNHA 4PLPA 4B4KA 2WF5A 1L7OA 1FFSA 2FPKA 2WVJA 2Y76A 3KP1A 2QQ0A 3IHLA 3LLMA 1FTNA 2A30A 1FUUA 2WG2A 4Z1MA 1KIFA 1C1XB 1PN3A 2DFVA 2DSNA 2HEGA 2EP8A 4G8JA 5BOVA 3LHIA 4C4ZA 1RQXA 4R7TA 4FILA 2OCXA 1N3IA 121PA 1QXSA 3IEXA 2EHDA 3RSQA 3GEPA 1ZA2A 4XFDA 2XOKD 2ZXUA 2I7CA 5DF1A 1LLQA 1NMEA 4QLBA 3CUUA 1ZNWA 1OVGA 1PBTA 3WGTA 1E6EA 5J4VA 4JVLA 2H18A 2HXYA 3JRXA 2XITA 1U8ZA 3DEHA 2IIBA 1DHRA 2ZSEA 1VG8A 1IEVA 1NBME 4YQZA 5YASA 2V3CC 4DHWA 1CY7A 4FVTA 4PZAA 3O8LA 2Q4TA 2R0QC 1W48A 4YB8A 4CN8A 4OMDA 5L6MB 1QK5A 1PX2A 2B0JA 2WE7A 2P69A 1G4HA 1XA3A 3FUVA 5AOCA 1RXCA 3DDOA 1IAQA 1SY7A 1Y37A 3DA8A 1TOAA 3IJ5A 4Q6WA 4ZI7B 3QYPA 2JFVA 3KZKA 5JAPA 2NZYA 3S7TA 4BMDA 2NUPA 3EGDB 2REQB 4G1BA 4PO1A 5CH5A 4G89A 1GTSA 3MD9A 2XECA 1FX0A 1SOAA 4GU5A 5EXEA 1GRNA 3CR7A 4AURA 5J1SB 3JZIA 2PZMA 3BQMB 3FRHA 3BF8A 2OLKA 3CRRA 4FINA 3UT5B 3U7JA 4OBBA 4RVNA 2RHHA 3OEWA 4ZVKA 1EQ2A 3IP5A 5JPIA 1JDPA 2Y0PA 1U5BA 3QUBA 4TTVA 1WUTA 3HSYA 1YE3A 4A5OA 4EKNB 3L4JA 2CMDA 2OK8A 1M6HA 1DMRA 3K8YA 2A5JA 2UVPA 3KXLA 3HQ4O 5IPFA 3EODA 2YC4C 3WLQA 1MJGA 3SR0A 5CX1A 1FNMA 2HA4A 4MP8A 1ADCA 1B0AA 1XQYA 3IAAA 3N2EA 4KK3A 3OFND 2Q3CA 1MRZA 3K4PA 5H1YA 3WY9A 1KY2A 2VJKA 4JUCA 2BEVB 1YMVA 1EWVA 1MU0A 3WGIA 3PVCA 3Q9SA 2K87A 16PKA 2LWIA 2JJYA 2LZ0A 3J7TA 3KKPA 4ARZB 3PR1A 4WJKB 4TKLA 5FBWB 2FEXA 3SMQA 2HLNA 3FW1A 1ZGGA 4W5HA 3TG2A 2J9FA 3KQTA 1FTSA 4ZT6A 1D09A 1TCCA 3RVSA 1IAVA 1DDIA 1XD8A 2UDPA 2J8ZA 1NMXA 5T41A 3ZW9A 3NW9A 1Z0IA 4R5MA 4Z53A 1JFFA 1G8HA 1HWYA 3HB5X 2QLFA 2QRLA 3TNDA 5JYCA 3EF1A 4A8JA 1N0VC 4BEWA 2YMMA 4DSOA 5LN1A 3SVLA 3C43A 4ADSG 4ML3A 3LWDA 2L18A 4KB5A 3V2GA 3OT4A 2HHCA 2WMDA 1QIDA 2COKA 1EFUA 2VTEA 1ZI9A 3A70A 3IBFA 1FTGA 1WG8A 4OI1A 5ICSA 2VDJA 1W6RA 4G0ZA 4BMXA 3DOOA 3ICPA 3SIXA 4LZWA 3CLRD 5U9CA 4WW0A 2GARA 1RWMA 3U4MA 5C51B 2E1RA 2JJ2A 3H9CA 5FBZA 3D7KA 3DKVA 3VR3A 3QVJA 5IDXA 4UDNA 4XR9A 4G9GA 4HO1X 4LXHA 1KYVA 1K5PA 2D1SA 3WXBA 3QF7A 1J0AA 1F0PA 1R18A 1THZA 1XHLA 1CXZA 1E2LA 1YZFA 3VKUA 2Y1WA 3U3ZA 4FEGA 1HC7A 2ZB4A 3IE1A 1ITZA 4FEAA 2YWDA 4W5NA 1TW2A 1C8VB 2IP1A 1YCFA 3BC1A 2GM3A 3VDMA 1HYBA 4GSYA 2A8YA 1YQ9A 1U90A 1SCUB 4EAQA 1KVRA 2C7VA 4KX5A 2J48A 3OZVA 1P2BA 2QBYB 4OX9B 1Q0HA 3MWDB 5AVQA 1RBZA 1RJDA 5IF9A 4Q34A 3CVUA 4I1PA 1XZFA 3F3KA 3P9SA 3E7DA 4FKMA 2BCEA 5BMVA 1E3LA 2FUEA 4TS3A 4UBIA 4IIGA 2D74A 1R6VA 4FQ7A 3RTBA 5AI0A 1SEVA 2HK8A 5P21A 4M0LA 2P41A 1A7JA 1WUKS 2Q7XA 1FUIA 3B8EA 1GG2A 1YCGA 2FNAA 3GIDA 2IBSA 3AONB 4JLWA 4OIMA 3QBEA 1RPNA 1RWKA 3HCDA 1TRKA 3FMIA 5G40A 3RU3A 4W5WA 3KUDA 5AM5A 5JR3A 3BHIA 1Z2OX 1PJLA 3SIWA 4D81A 5JO0A 3AVQA 4O2LA 2RH5A 1C3EA 3EUEA 4J7AA 4ASUD 1BCRA 2FGJA 4YYEA 4RKEA 5KYWB 2H29A 1H42A 5D3KA 4GVXA 1RZ3A 3F6RA 1I36A 1YHZA 1K4KA 5AJTA 1DQYA 3ET5A 2B4YA 1C2YA 2J41A 3EVBA 3H9BA 5DASA 2W6ID 1OXVA 2A0YA 3GCWA 1IH8A 3ZDEA 4LI3X 4F12A 1E2UA 1ORWA 2E4ZA 2JFBA 4Q1AA 3DDSA 4ZTBA 3H2BA 5C46F 1E2QA 1JEYA 3FMFA 1O5TA 2I66A 1JKMA 3IA7A 3M81A 2XEXA 5EWJA 3GDWA 3EEFA 5EZYB 1KK2A 3KKLA 4NJMA 2IOFK 4DWOA 2W11A 3L1IA 1XL0A 4MROA 4YIKA 2VWPA 4M99A 1JG3A 5C0OE 1XPJA 4B3TB 1LX7A 2Z2KA 4O29A 2WG1A 3GLKA 3R5JA 3GNTA 1UFKA 4OJYA 5ESXA 2WJZB 1P7VA 2A9VA 2FZ5A 2Q28A 3G2OA 2WT9A 4DTIA 4MUGA 1JJ7A 1W29A 2C4KA 3A06A 1VOTA 2ECQA 2RONA 3L7LA 4URWR 1YAHA 3HCFA 5ECYA 1D07A 2FGKA 2IQ5A 4AWAA 3UB3A 1X1BA 4WZBA 5BXYA 1CQJA 2DVMA 1S6YA 1FSSA 3OQIB 4RLHA 3A37A 5BURA 1UFVA 2Q46A 3CRZA 4TYMA 3D7SA 3T12A 4N7RA 5AJVB 3UPTA 4FLMA 4XCQA 1U7WA 3U1VA 3CRNA 4MLCA 3GDFA 2W70A 3R7AA 1OXSC 2YIJA 3RFTA 4CLEA 3P71T 1NVTA 4M1MA 4R16A 2QAJA 3JATA 4QDZA 5HSGA 5KWEA 4EG1A 3GLIE 1FQJA 3JQ7A 4JYBA 3D6TB 2OXFA 2J30A 2JFWA 2OCGA 3IT3A 4D44A 4BX3A 3NKFA 1E6LA 5B1YA 3AHGA 5C8XA 2X2EA 2BFWA 4MA0A 4EB8A 3ROQA 1U9YA 1DRVA 2CD7A 2R1TB 4ZYZA 1LSSA 1ENPA 1ENZA 2VYND 2RB5A 2PNJA 4WACA 2ICAA 5LQUA 1QWOA 2ZIFA 1R15A 4F6LA 1N25A 4LZNA 2B1IA 4EZIA 4YRIA 1ESZA 2OQ2A 1IBLB 3A36A 1ENYA 3HPRA 1EYZA 4ZCPA 4RTQA 1O96A 2IC5A 2QNBA 4M8IA 4DUZB 2ABWA 4JNKA 4KYIB 5AI8A 5I8WA 4DV4B 3D02A 3QF4B 1H8ED 2DTXA 4BGUA 4LJRA 4II7A 3JTEA 1KJJA 2WMNB 5AUNB 1M1XB 3CLVA 3ET4A 5L95A 2ZXEA 2GA9A 3N74A 2GZ3A 5CK4A 2CLKB 5F98A 4A73A 1I7QB 3C4JA 2BEUA 1BN7A 2FCAA 3PXCX 5BSMA 1AKMA 2VUTA 4UTVA 1JI3A 3AUSA 4JASB 1FB5A 2QUZA 1YOVB 2YNMD 3OWHA 3SVZA 1WM1A 2NYUA 5DWQA 3QXSA 1VSVA 1Q6ZA 2H1IA 3PFNA 3TDNA 2IPXA 2JJ8A 2CLLB 1U7OA 5JHHB 2R5NA 3G8BA 4I9NA 2F3UA 4NYIQ 3A11A 2PQ2A 2NZUG 2X7JA 5SZIA 5TMDA 4BYGA 4U2DA 4J75A 3LT4A 1SQSA 2DKOA 3CISA 1ADJA 5K0NA 4AXXA 1KEEA 1AUPA 1E6UA 1Z07A 3TAXA 4O4HB 4QXOA 5IM5A 5F7OA 4IO0A 3DTVD 3RVKA 3I45A 2AI3A 3C70A 4B47A 1KK3A 1W52X 4GAEA 3GLGE 1DGQA 3VTKA 3HY3A 2PX0A 3NBUA 2TYSB 2X23A 3EYWA 1GQOA 4KQJA 1U2SA 1FMFA 2ZJ5A 1N5LA 2FUG6 4LHSA 4QULA 3TMYA 4RTSA 1NZDA 2DFKB 2P2GA 4M1QA 3GBVA 4ILKA 1H1DA 3VVMA 4Z9FA 1NXPA 3BDAA 4AAYA 1USKA 3DOJA 3HJFA 4R98A 3EVEA 1O2DA 1KHTA 4KZKA 3D59A 6CHYA 2AX4A 5GTDA 4CGYA 2OXRA 3SQOA 3KYCB 1GFIA 2FYTA 3OZRA 4PGFA 2Q27A 1KMIY 4LBZA 9LDTA 1OB2A 1H0RA 3WI7A 5K8TA 2V0CA 1Q2UA 4INOA 1NM5C 4QDKA 2BJHA 1LB1B 4TV9B 4NX2A 1Y6ZA 2WWVD 4UHEA 1K68A 4UEOA 4QTUB 2OXTA 5JCOC 1NI3A 4ID9A 4RU1A 4NICA 3G0CA 4U0JA 2X0JA 2Y1EA 3AETA 1TL7C 3LK7A 3SF8B 5HIMA 3QK7A 4RAQA 1DCMA 2WIFA 3FHTA 2HA7A 5EGNA 3ZD9A 3VPCA 5H59A 3QX9A 5CB4B 1QIGA 1ZM4A 4HNAB 3ZU2A 5CNMA 4MLZA 1JKIA 4P54A 3C3YA 5C80A 2WJAA 1VJGA 4CM3A 1MBZA 4CV3A 4ALNA 1J2TA 1R0ZA 3HZOA 1L5WA 2VYVA 4LQCA 4NU8X 1X3LA 1U3TA 2I76A 3BGVA 3W6UA 5LYJB 3ADBA 1A95A 1COWD 4K5QA 3VJLA 2AXNA 3D0QA 1EAMA 5FTMA 4BX2A 2ON6A 5E9JA 3ESCA 4Z2AA 3PHIA 2I80A 3H5NA 1P7YA 1FSFA 4QNNA 3MUOA 4IJUA 1N2SA 3KT0A 3WNVA 3D3KA 1N92A 1Y8QA 1Z82A 3K5WA 3V7YA 1Q21A 1Q22A 3EGCA 3MEQA 4I3HA 4EPRA 1LPAB 1ODFA 4FDUA 1AKWA 3BGWA 3S0JA 2GF9A 4MDEA 1JXAA 4JHLA 1W93A 2IPMA 2QXYA 1OLUB 4PVCA 1GCOA 4GOOD 1CR0A 1FX1A 2A0XA 3M3PA 3NJ8A 4XVRA 4D3FA 2YX1A 2OFOA 5HS6A 4D41A 4REMA 3T0FA 1BXKA 1E0SA 1Q7GA 1GG5A 5CLLA 1FDUA 2VK8A 4LRQA 5KU1A 2ZUWA 4NCBA 4PNEA 4HNUA 2JLRA 2IF2A 2YXEA 2ZU6A 1S2GA 2ACEA 2BF4A 2RH8A 1CUDA 2WHEA 1BH2A 5ALTA 5ETJA 4S1OA 1DBQA 1HE2A 1Z4QA 4J0GA 4FGWA 1JEAA 1IY1A 2ZOSA 1WMSA 2GZRA 3VSBA 2ATEA 3TZLA 1H6BA 1F2TB 5DZSA 4JBGA 4M0FA 7YASA 2HA3A 5IYZF 2WDZA 4ROTA 2Z3ZA 3TLYA 2I0FA 2WNIA 1RKQA 1ZHFA 1D1TA 2FZVA 1PIWA 4LZLA 4GPIB 5CGZA 1Q92A 1P29A 2NU7B 3FN4A 3GT0A 1PCXA 4DMRA 3F96A 4R1SA 5HBRA 3A1DA 2KSQA 2IHNA 3ZV7A 3I0ZA 4LXGA 1XHFA 1PG5A 4TN5A 4KBYA 3RYCA 1OWMA 2XRZA 2IYUA 2I6GA 3GZJA 1NSFA 2PUHA 2ROQA 4L8LA 3EN0A 4OQFA 4QXAA 4R9SA 5J4LA 5FWAA 5JCJA 2PO7A 1MO3A 2RGYA 4H3HB 4V1CA 1K88A 3OOYA 1G2PA 1PX0A 1E8MA 4MHOA 1XTQA 1LKZA 4FMCB 5HZHA 2FW0A 1KEWA 5A6SA 2QENA 4IRMA 4AF7A 4H1HA 1H0HA 5EJ5A 3PWTA 4D0LB 1IZYA 2PUTA 2A0FA 1WP4A 3ICVA 4QC2A 5AI6A 4B6QA 1L7QA 3M6VA 3KWMA 4UCXA 2R6DA 1VKRA 3WFIA 3BULA 4UUBA 3UWOA 4WUVA 1RHUA 5CFRA 1R4NB 2VCEA 5BQOA 3OBBA 3SHFA 1YQGA 3LL4A 4X3CA 4YI5A 5AP9A 2XDQB 4AUMA 4WSOA 3WQQA 1U0HC 1KYXA 1VIAA 4AJ9A 3KV3O 5KZMB 3SM3A 2FPGA 3KYIB 3OEHA 3FUTA 3GH3A 3M4XA 1OMOA 3A4YA 1XE3A 5TARA 3SK0A 1IJEA 3FOAA 4E3ZA 1XPRA 4LHEA 3DXXA 4CKWB 4O33A 5IVPA 2VRWA 2O52A 2P5TB 3QUAA 4HAXA 4OSPA 1QQAA 2W71A 3GPLA 4MH0R 1MA3A 2WWGA 2PGXA 3BS4A 3DNPA 4NENA 2AJLI 4G36A 4WD3A 1ZAYA 4GQBA 1HE1C 5EYPA 4G25A 2DWCA 4MS3A 2QM7A 3NBQA 1QVAA 4G4GA 4PYRA 1H5QA 5DTRA 5BSKA 1ML4A 1I1HA 3PYMA 4U39A 4BPRA 3UJ7A 1AK9A 3GJ8A 2HCFA 3QKUA 4PCUA 1RRCA 1T4CB 3V32A 1OREA 4WERA 1G5QA 1VSQA 2WWXA 5B2FA 2Y9MB 3IMFA 1XU4A 4D74A 2O2HA 3MK31 3ORQA 4XD7A 3DZCA 4FWBA 4G5HA 1PZMA 2BZSA 5EJ2A 4EUSA 2P78A 3WLHA 3KYDB 3MQ4A 4BP8A 1SZDA 5C7OO 3QBTA 5HYVA 2GPYA 4FNGA 1AKYA 1MGOA 1TD1A 3ISJA 4J29A 4RSHA 4AJPA 4M1TA 5ALXA 5KCZA 1CJCA 3LPCA 1F51E 4IXNA 4RF5A 3RUEA 3U4GA 5K6AC 4GL2A 3HWWA 3FA2A 3CF2A 1G66A 2GLUA 1J5XA 3JAKB 2ZIZA 2CVPA 4Q93A 1Z4MA 2EAUA 5A0FA 5B53A 3PNSA 3A2MA 3K6JA 3ZX5A 5D6OA 1I3CA 1VKZA 4EHIA 3AILA 1PJ3A 2OWDA 3TUIC 4WBNF 1DJLA 3A4TA 2RGNA 5JXWA 1EM6A 4Q1BA 3VU9B 1C0EA 2QVLA 1BU8A 4G1FA 2AG5A 2VI5A 1H66A 4P86A 1VYUA 1MCZA 1RBYA 3HP7A 3QWIA 3LOPA 5BNFA 5TVKA 2DWOA 5E8RA 3ASVA 5A9RA 3OX3A 3S44A 2H92A 2XMRA 2CF5A 1A0OA 4KGVA 5TQ0B 3UGJA 2EJTA 4KH0A 3O0DA 5FJIA 1KO1A 1VL2A 2XQJA 1YB4A 4YLGA 4JI8B 3PRYA 1H5UA 1QB7A 2I6SA 5FNZA 2O3JA 4ZQGA 1R0RE 3DNFA 2LCIA 3VR1A 5BORA 3THWB 1SA0A 4I08A 2BGUA 1TJ4A 1E8NA 1E1RD 3MCAA 1XLTA 1NR5A 3ONVA 2DY1A 3I6YA 5LOVF 4LZOA 2V5AA 3L77A 4X44A 4W1SA 3PCXA 1AVTA 4ZU3A 3CVXA 3C7KA 3K2QA 1M8JA 2HDHA 3FSGA 3JVVA 3WWDA 2DB3A 3EW9A 2FWJA 3L0DA 3QZUA 4Q4JA 3EWAA 1JIIA 3C3CA 2PL3A 1NI4B 4BE7B 1B4DA 1C3LA 1S7GA 3H2ZA 3MA0A 4TQ9A 2JD2A 4LK3A 3SE7A 2A1UA 1L5YA 2EL7A 4IIJB 3HLYA 5DNUA 4K9PA 3SQDA 1D0VA 1WHSB 3EBOA 3VBEA 1KFBB 3U3OA 4PBRA 2PR7A 4F9FA 2ZT6A 4EGCB 5C81A 4BC1A 3EAFA 1TVKA 3N2ZB 3OC0A 4RPKA 3PT5A 1OFIA 1CY2A 2VHZA 3JZMA 4LRTB 3HCOA 4JXKA 2AL7A 4JV5B 1M3SA 3ANTA 3CMCO 3G2MA 1OX4B 2AWNA 2EEZA 2CVHA 1Z5ZA 1YK1A 2IKSA 4J3FA 1M1YA 3F97A 1YR8A 4MR8A 4BNVA 4F5EA 2IHBA 1E4EA 1RXSA 3JQ8A 3RASA 4BV8A 1TXGA 4IWNA 2R2AA 1L5GB 1VYHA 4Q3LA 4HYQA 3H4IA 4EFMA 5K0TA 1UKBA 2PUCA 2EFCB 3PF8A 3SF0A 1Z16A 4ZV7A 3ZY2A 1CVRA 1I14A 1TO1E 2ZWOA 4BO2A 3NHZA 4NONA 1NULA 2GAFA 3EZ6A 3HZRA 5FWDA 3DO8A 3WGJA 3HE3A 4AJ4A 3R77A 4ONEA 2YZNA 3S40A 1TNDA 2R4QA 3QUCA 5GIPE 1Z73A 4KLNA 3PE6A 2YV2A 2ATXA 4PRZA 3JZFA 2DBRA 5A5VA 1QIHA 3G2NA 3C5VA 4KJXA 3DOCA 5A3RA 2QUBA 3GARA 4LYYA 1SVIA 4ZI7F 1PDWA 3FTCA 3EGVA 3H5LA 1S2OA 3QPUA 2FVXA 1JVSA 4LHZA 4MZXA 4U5QA 3WKBA 4A0QA 3ZW8A 4DA7A 3KM0A 4UREA 1P4JA 2ID9A 2BSXA 1ODCA 1PD0A 3AF0A 3R3VA 4QUJA 1P18A 3WDKA 2X4IA 1E2GA 3PXDA 4XSGA 3WK7A 2OLEA 2PKQO 3DFKA 4UBOA 2OUIA 4AO7A 2HSWA 1S5PA 3FZGA 2R8EA 3KO8A 4MVXA 3WK9A 1ZVQA 2FR0A 1NVKA 2D3TA 2Q6KA 4HB3A 3BRCA 2VF8A 4CKCB 2HMYB 4I4TF 3O8CA 3B1JA 1FFXB 3KD2A 2X13A 3AR9A 3E5RA 1DBSA 3OP4A 4QEDA 421PA 3EVDA 2VEDA 4P92A 3WRXC 4MW9A 3HGMA 3CNBA 3V3TA 2ZULA 1XGKA 1GSIA 3AERA 2Y4NA 1UP6A 1V2GA 3E05A 4GYJA 2ETXA 1UJMA 4ZDJA 4U2GA 4GPEA 1EXVA 5JT1A 1FBNA 4KODA 4L9SA 1OA1A 5BPFA 4JEUA 3ZWVA 3U49A 3PD7A 2R5FA 3A27A 2ZRIA 4EJFA 3CO5A 1F4PA 2VF4X 4L0DA 4Y98A 1HDYA 1KMNA 1Z5OA 3COZA 4XVCA 5KVQA 2YY6A 3X2SA 1JJAA 3BTUA 2FN8A 2X40A 1K8QA 2Z5GA 1J9ZA 3NYQA 4YJHA 5FIUA 5JS6A 3T5PA 1AS2A 1O0SA 4DKXA 3F5SA 4PTYA 2XXBA 5H3CA 4ZDKA 4IH9A 2ZYTX 4JZKA 4O4JB 4RZIA 8GPBA 5JJKA 3UJ9A 3ZVKA 2MSCB 5FA5A 3A3PA 5BYJA 1U7TA 5JZBA 4AKIA 4DGSA 1U4NA 1SM4A 3GUCA 5K7SA 3LTEA 3A6KA 5L7WA 2CHUA 3AW8A 4R4JA 5A4AA 2OOKA 1B6TA 1MORA 2JLAA 4H4EA 5E6UA 1EVJA 2UZAA 4OQXA 5AW1A 5LLDA 1MB0A 1EDDA 2QSZA 2Y68A 3KT6A 2J07A 2D0PB 3OM8A 2HO5A 1GTRA 2XGMA 5DPMA 3DV2A 1MIOA 3JAWB 1QIKA 3TZBA 5GV7A 2GQ0A 3W9UA 4D98A 4DBZA 1KS9A 1WETA 2DP4E 3FKQA 3UK2A 3O8QB 1Q44A 4D99A 1QRTA 4RETA 2MDTA 1IFXA 3COVA 3ENWA 2HRCA 3LZ6A 3TKAA 3EZNA 1X8LA 4KUHA 5EHQA 2GJ9A 5D00A 5TPWA 5I47A 5KOYA 3K0AA 2G0TA 1YC2A 3QRWA 5CJJA 1JQLB 2JCYA 2R4UA 2VNKA 4HDKA 4FFOA 4B83A 1QYCA 3SU8A 3Q8WA 4DR7B 3PCRB 1ULAA 3UOWA 1J22A 2B36A 4E5DA 3UIEA 2XZLA 1UANA 6PFKA 5LP1A 2YJZA 4G2NA 1U9CA 3C3PA 4G8DA 4JUFA 3N75A 2ENWA 1QJCA 2WFMA 2RHDA 2JIZA 4QNMA 1UT8A 3KR2A 1SCKA 3OJEA 1Y3CE 1R0XA 2IYNA 2IZ1A 3TLMA 1NG9A 2NQ2C 1MZPA 1PR4A 1M34A 2COUA 2AOXA 5FJJA 1JA1A 1PUJA 4F2HA 2ZS7A 5BN4B 4LJLA 1H85A 1GFZA 2Y66A 4L4UA 4C4TA 4ESEA 1CVIA 2G3YA 4KWHA 1BIFA 4G9EA 2C96A 5D3MB 5JRJA 1IZ9A 3D0OA 1IJKA 4PYKA 2QR3A 4HSEA 1B0ZA 2V3WA 2E2WA 2VP9A 4YT4A 3ZTTA 2BJVA 5M34A 4CHGA 1RAEA 3AEUB 4HPWA 4DPMA 1CS0A 3NT5A 4N41A 4TXNA 5E1BA 3NDIA 2FVYA 3LBAA 1Q16A 3ILVA 4MGZR 4U8GA 4J16C 5DBIA 2FSPA 2OHXA 3GZNB 4L28A 3LCVB 4MCIA 3IUNA 5IJXA 3IURA 1NV8A 2BGRA 3BH0A 3MT9A 3D8NA 3WK8A 4R8RA 2H1VA 1X9IA 1JR2A 3L9WA 3ISVA 1ORTA 1DRJA 1PU2A 4LC9A 4EMSA 1Y1PA 2CK3D 1WU8A 1EUDB 3L7NA 1ULBA 2ZWAA 3BA6A 2D6FA 2PZ8A 2H1FA 2NADA 4C20A 1N6RA 3BRWD 4HLNA 4S1PA 2NPFA 4QOSA 2ZVJA 1CZLA 2F8MA 3TRHA 2I8CA 4BQNA 5ED4A 4KDCA 4RVSA 4D0GA 4IZIA 5CIYA 2NAC