1JSZA

Crystal structure analysis of n7,9-dimethylguanine-vp39 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The "cap-binding slot" of an mRNA cap-binding protein: quantitative effects of aromatic side chain choice in the double-stacking sandwich with cap.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
molecule keywords VP39
total genus 102
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2001-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jszA00
4CXMA 4PCAA 4M7RA 3T7SA 1JSXA 3SXJA 1P1CA 3O7WA 3A4TA 3TR6A 3P2IA 4E31A 5CIYA 3NJRA 1M6EX 1P91A 3G88A 3LL7A 4FZVA 5EIWA 3GRZA 1JTFA 4YMHA 1SKMA 1MHTA 3PB3A 1JQEA 3AY0A 4DQ0A 4E2YA 8MHTA 2ZVJA 3HA5A 4KWCA 2ZLBA 3B7PA 4QQKA 3THRA 3CJTA 4E33A 2EJUA 4GOND 2IBSA 1D2CA 1XVAA 2GPYA 2YQZA 2E5WA 4E2WA 2Y1XA 3LDUA 1NW8A 3CBGA 5CVDA 5GIPE 3M4XA 2BM9A 3D2LA 3DLCA 4KIFA 5D1NA 5BXYA 4BP1A 4MIKA 5C9ZA 3FTFA 2GS9A 3OFKA 3JWHA 1SUIA 3AXTA 5D1HA 1NW6A 2QM3A 3EMBA 2AN4A 3KQVA 3LCCA 4V0QA 1R6AA 4DCGA 1SUSA 5DLYA 5F2NA 4RSRA 4KVZA 3R3HA 4RVFA 3RIEA 1YF3A 1TW2A 1KPGA 1JTEA 2OPBA 2PSSA 4XUCA 2OZVA 3KR0A 4X41A 4PYKA 4HTFB 3FYCA 4L7VA 3G2PA 2ONZA 5DM2A 5LSAA 1NT2A 2PXAA 2PBFA 3O31A 5DTMA 3ER9A 1UFKA 2PT6A 4R05A 3UBTA 2ZFUA 2CKDA 4P7GA 3OPNA 5EGSA 4E2ZA 4Z2YA 1ZKDA 4IKPA 1F3LA 3DMGA 3IHTA 3PLAE 2YXLA 7MHTA 5E1BA 4BP3A 3FTDA 3HP7A 5FA5A 5EC8A 1KHHA 2F8LA 3M70A 2OKCA 3KQOA 4HH4A 4WXHA 1G60A 2JHPA 3EVGA 2IGTA 3GIWA 5C1IA 2NP6A 4GC5A 2VDWA 2ZIGA 3HA7A 2ZIFA 1BKYA 1XCLA 1VBFA 4RTOA 1G8SA 3FPEA 3C0KA 3G2QA 4LECA 3DMFA 3P9KA 3LCUA 3A25A 1AQIA 3UJ6A 4OBXA 3CKKA 4BLUA 1INLA 1NW5A 2PWYA 1JG3A 3BWYA 3LX6A 5P8WA 2P35A 2QRVA 2XYQA 3ELWA 3OE4A 1FP1D 1AF7A 2P7IA 3KQSA 3PFHA 1TW3A 3LPMA 3EVDA 1NV8A 4QPNA 2G71A 1WZNA 3GRYA 3FPGA 2AOUA 1R8XA 5EG5A 2JHCA 5K09A 3H2BA 2OB1A 5LR6A 5FQOA 1ORIA 2ZIEA 5DM4A 4YV0A 2O07A 2B2CA 3C6MA 1DCTA 2QE6A 3MB5A 1VP3A 3BKXA 3MCZA 5DRYA 5EEGA 2XYRA 2OYRA 3P2EA 5ERGB 4X60A 5EPEA 5FA8A 5HZMA 1ZHFA 2HR1A 1B42A 2P3OA 2R6ZA 4KIGA 2NP7A 1QZZA 4BLVA 3FUVA 1FPQA 2EX4A 5ICFA 4POOA 1KIAA 3KPWA 3K6RA 3P9NA 1I1NA 2UYQA 5FCDA 3SM3A 3FTCA 3DH0A 1O9HA 3GDHA 3FPHA 1P1BA 5E1OA 1YZ3A 4C06A 4DZRA 2AOUB 2LD4A 4AZSA 2PX2A 1M6YA 5DT2A 3KQMA 3OU6A 5K0JA 1L3CA 4RTRA 4C05A 2YUIA 4PYLA 4X63A 3B5IA 2JH9A 5G02A 3EEOA 1XDUA 2JH8A 4AZVA 10MHA 3M6VA 3BUSA 3I64A 2AOTA 1X1DA 5CM2Z 4BY9E 3P2KA 4EK9A 2ESRA 4EKIA 4PGGA 1R8YA 1NV9A 2QRVB 3UA4A 2AVDA 2P3QA 1VE3A 3CJQA 3EVEA 2B78A 3G5LA 1VL5A 5EKXA 4CTJA 2G8NA 4YUYA 5K0LA 3UJCA 3UJAA 4C07A 2NYUA 1D2GA 2QY6A 1KYZA 3EMDA 5EMKA 4C08A 4PIPA 5LQJA 4IWNA 2Z6UA 2ZCJA 1F38A 2HMYB 3Q7EA 3DTNA 3M6XA 4PCLA 3QOXA 3FYDA 2EFJA 5HIMA 2PLWA 2VDVE 3BGDA 3F4KA 5DX8A 4CWAA 3HVIA 2ZBRA 4PYOA 5E2BA 3TPZA 4YV1A 5FULA 2I9KA 3ERCA 1FP2A 3UJ7A 3PX2A 1XTPA 4FP9A 1JQDA 1SQFA 2NXCA 2Y1WA 1R74A 4F84A 3BKWA 4K6MA 2G70A 3NW9A 4EMSA 3DXXA 1VLMA 2O06A 3DP7A 2BM8A 4GBED 3VC1A 3M33A 2ERCA 4CKCA 4PYQA 3FZGA 2PXXA 2YR0A 3B3FA 3DXYA 5CCBA 1L3BA 2ZTHA 4A6EA 4DA4A 1KP9A 1I4WA 4AZWA 4HTFA 2V7EA 3DULA 3REOA 4OA5A 1Y8CA 3C3PA 3LDGA 4MHTA 1IM8A 5MHTA 3FRIA 2WA1A 5DSTA 2ZWVA 4RTPA 4FSDA 4ISCA 5GM2A 4G56A 5T67A 4PYMA 4EVIA 3G2OA 2JHAA 3DOUA 3DXZA 5EHIA 5EMJA 3GO4A 3PVCA 1ZGAA 4A6DA 5K0FA 5EZSA 1FJXA 3SR4A 2XBMA 2EG5A 4WVLA 2VP3A 5KQSA 1X1BA 5IH3A 3ANXA 4R8RA 3HCBA 1G8AA 2YVLA 3EVCA 1X19A 4M38A 5KS2A 2IPXA 4MWZA 4XUDA 2NXNA 1L9KA 5GM1A 4XUEA 5DWQA 5HFJA 4AUKA 3A27A 4RTJA 2NXJA 5FTWA 3BGIA 5K03A 1QANA 4GOMD 5LQRA 1VP9A 1O9GA 4LWPA 5DSXA 2Z6AA 2IH4A 1RJEA 4QQNA 2AN5A 1EQAA 1UWVA 3TOSA 3B3GA 2BR3A 4Y30A 3WSTA 5K0CA 3FUWA 4PWYA 3KQTA 4PYNA 5K0EA 2BH2A 3R24A 3HCAA 5E1MA 3KKZA 5K0GA 2PWPA 2AR0A 1EG2A 2AN3A 4RV9A 2PXCA 3O4FA 3EVAA 2H00A 1YUBA 5LQAA 5HOQA 3FPFA 5ICGA 5EMLA 4FR0A 3DMHA 1JG4A 3G89A 1Z3CA 5DX0A 4GC9A 4HSGA 3KPVA 4F85A 2UYOA 3I5UA 4FT2A 2GB4A 5DM1A 2FCAA 5IKMA 5DXJA 4E32A 1EJ6A 2I7CA 4PONA 1SVUA 1ZG3A 2PJDA 4RYLA 3LECA 2PVCA 3MERA 2ADMA 3JWGA 5CUQA 5CVUA 2FYTA 3P9CA 4P7FA 5M5BA 4DMGA 3GXOA 2C7OA 3G5TA 3EVFA 1U2ZA 4IV0A 3NMUF 2GH1A 2AOVA 3GRRA 1I9GA 1JQ3A 3KR1A 1G6Q1 5F2KA 5FHRA 4PYJA 3HCFA 5FWAA 2UZ4A 1JSZA 1EIZA 3FRHA 2AOXA 2XVAA 3ID6C 1RI1A 5DTQA 5F2OA 5FWDA 2P40A 1XXLA 1T43A 1DL5A 2GA9A 2O05A 3HEMA 4QDJA 5K0NA 1VPTA 3SX0A 4YV2A 5U4XA 3LDFA 3GCZA 4YUXA 4B17A 3P8ZA 3HA3A 3PT9A 3LBFA 5LQKA 3PS9A 4LWOA 5FQNA 3LKDA 3SSMA 4R6XA 4F86A 3HVKA 4FS8A 1QYRA 4GUAA 1RJDA 3V97A 3B89A 1NBHA 3UJ8A 1JG1A 3THSA 2IH2A 5BP7A 5FHQA 4CKEA 3G7UA 3KPYA 4QTTB 1YZHA 3FUUA 3NDJA 5DX1A 5DTRA 1BOOA 1KXZA 2KW5A 3UZUA 3DUWA 4PNEA 4FSXA 1P39A 5EEHA 3FUTA 3JWJA 5E9WA 4CKBA 2HNKA 1WY7A 3C3YA 3LCVB 4P7JA 2G1PA 3NDIA 1KPHA 3NWEA 4QDKA 5T64A 3EVBA 2Z6QA 1VIDA 3CC8A 2IFTA 3IV6A 4QPPA 3EGVA 5E9QA 3ELYA 3LBYA 2AZTA 5DPMA 3HNRA 5E8RA 1YFLA 5K05A 2OO3A 3E7PA 1G38A 1X1CA 3SGLA 4C03A 3EGEA 1H1DA 3R0QA 3BXOA 3BZBA 3KQWA 2PX8A 5EIFA 5LQCA 1AQJA 2IH5A 1NW7A 2ZBQA 3KHKA 1N7JA 3KQPA 5EQJB 1KPIA 4H0NA 2FRXA 3IYLW 4OQEA 3OU2A 4YUZA 4ER7A 4RTKA 1UIRA 4IV8A 2C7RA 3HCDA 3OCJA 3PFGA 3KQQA 1VQ1A 1YB2A 2WK1A 4ER0A 2B25A 3RODA 3DR5A 1NKVA 1XJ5A 4FGZA 5E9JA 3T7TA 4QVKA 3T7RA 2FK8A 3R6TA 4C4AA 3SVZA 3UFBA 3A7DA 4U7PB 1L1EA 2PY6A 3TKYA 1WXWA 2V74B 2N47A 3HM2A 2HV9A 2CMGA 3ELDA 4RWZA 3AJDA 2ONYA 3A26A 3MTEA 2P41A 2IIPA 2YTZA 3BWCA 3ORHA 3TKAA 1KYWA 3MQ2A 3M6UA 2P8JA 2CWWA 2A14A 2AOWA 3ELUA 5EHGA 5ICCA 4GEKA 2C7QA 3PTAA 1SG9A 2PKWA 3GU3A 4XCXA 4AX8A 3P9IA 3BT7A 3UA3A 3AWIA 2IDJA 3MCTA 4GQBA 2BZGA 2YXEA 4EQZA 3JWIA 1JR4A 5HEKA 4NECA 5LQNA 5GOZA 5C0OE 5FUBA 1IY9A 1QAOA 1ZQ9A 2GLUA 3OZRA 4E2XA 1ORHA 2O57A 3TFWA 2H11A 1R18A 3CVOA 3E8SA 2IBTA 1RI5A 2ORED 2OY0A 3CCFA 4MQ4A 2AS0A 1KR5A 3B3JA 4KRGA 4PINA 5HIJA 3GRUA 5CVEA 3TMAA 5DM0A 1O54A 3C6KA 1NW3A 4U7TB 3UJDA 4OA8A 2NNWB 3LHDA 3DLIA 1XDSA 1N2XA 1RJFA 3GNLA 3IEIA 4FT4A 3MGGA 3GRVA 4OBWA 3KU1A 4X61A 3X0DA 4RVDA 5K0BA 3SSNA 2DPMA 1MJFA 1WG8A 2VDUE 2ZW9A 3LSTA 5FADA 1NE2A 5GWXA 3EGIA 5LQUA 3EEYA 1BHJA 2YXDA 3LKZA 2JG3A 2ZBPA 4OX9Y 1NBIA 2P7HA 3UJBA 2C7PA 1HMYA 4CTKA 3G2MA 1EAMA 3NTVA 5JR3A 3TM5A 4BLWA 5EMMA 3BWBA 2HWKA 2ZZKA 3MHTA 3A7EA 2CL5A 4KDCA 4O29A 2ZZNA 3GGDA 3CGGA 1WXXA 1SQGA 5GINE 2YX1A 1Q0TA 2CMHA 2I6GA 2ZULA 4R8SA 1YFJA 4YMGA 3HCCA 5HILA 2P1DA 3FPJA 1X1AA 4HGZA 2B9EA 1D2HA 3MAGA 4DF3A 2UYCA 2IDKA 1L3IA 1JG2A 2BR4A 4M37A 1G55A 5HIIA 4DM3A 4X1OA 1ZGJA 1RI3A 3KQYA 4YUVA 3T0IA 1FBNA 3E05A 2PX4A 4RX1A 4ZTBA 2H1RA 2VS1A 3BWMA 3G8BA 2PGXA 1BC5A 3AXSA 3K0BA 5K8VA 2ZZMA 5EOVA 1V39A 3SMQA 5E2AA 3HVHA 4RTLA 5DRTA 2G72A 5EKUA 3TM4A 3V8VA 3LGAA 1XCJA 2DULA 3I53A 4PYIA 2AOTB 4HRAA 4V0RA 4Y2HA 1IXKA 3HVJA 5EVJA 3KR2A 4QVGA 4C04A 3I58A 4RTNA 5H02A 2IP2A 3L8DA 1OR8A 3OZTA 1AV6A 5CVVA 5CD1A 5HIKA 5CVJA 4KW7A 3HTXA 5KVAA 3VYWA 2PX5A 1WS6A 4HG2A 4PGHA 3G8AA 2B3TA 3KPJA 3SSOA 3P71T 3P97A 3S68A 3UWPA 3QOWA 3ME5A 5BW5A 4DCMA 3OFJA 5ICEA 1XDZA 3OU7A 5B1SA 4RTSA 3HCEA 4HGYA 2UYHA 4DKJA 3R9XB 3GJYA 2OXTA 1Q0SA 1HNNA 2ZWAA 2HTEA 3VSEA 5K01A 5JUWA 5E8JA 4PIMA 3EVZA 4ER6A 2I62A 4P58A 2WA2A 4KDRA 2XYVA 2Q41A 3NVKI 4GF5A 1M0EA 2FK7A 4GOLD 4ER3A 4RVGA 4ATNA 5BW4A 5GIOE 5DXAA 3Q87B 4AZTA 1QAQA 3KPUA 3QV2A 3NVMB 2BR5A 3U81A 2FHPA 1TPYA 4EKGA 2JJQA 3KR9A 3I9FA 5T6BA 3RW9A 2XVMA 2OB2A 2QYOA 1DUSA 3OZSA 3GWZA 2VZ9A 1EJ0A 2FPOA 4M36A 5KQRA 4LG1A 3NWBA 2NXEA 3TLJA 2AVNA 2R3SA 2PV0A 4HC4A 4RVHA 4ER5A 4UOEA 4GOOD 5CCXA 3MTIA 2PT9A 4P7KA 5E1DA 1PJZA 5KYGA 4OQDA 5EZQA 3OE5A 3E23A 4E70A 1N7IA 3FUXA 4RTQA 2OBFA 3M6WA 3TQSA 4R6WA 3VC2A 9MHTA 1RI2A 2ZSUA 3PX3A 4RTMA 1PRYA 3ER8A 4QTUB 1QAMA 1RJGA 2EJTA 1RI4A 3UJ9A 1R00A 3FTEA 4E30A 2K4MA 2O0LA 3EPPA 5GP1A 3CJRA 4JXJA 3TRKA 2GAFA 4YUWA 3BGVA 2P3LA 4MTLA
chains in the Genus database with same CATH superfamily
1NP6A 3GVPA 4DIOA 1KSJA 4F04A 3DZFA 4GZ3A 4YRPA 3GY0A 1QZ3A 2HZ7A 1OVGA 3LY8A 3A4TA 4EEZA 4LHWA 2DR2A 3AHFA 3D2AA 3OX4A 3P2IA 2ZQ5A 2BE9A 3QW2A 2Z5LA 1WMSA 1XQVA 1Z07A 5EHNA 3WQQA 1PVVA 3I2FA 1EQUA 2O2DA 1L4BA 3FETA 2CUZA 2P2GA 3A9RA 3F78A 3OM0A 1ORDA 1OWOA 1HEIA 3P9SA 4J0KA 3WRVA 2B36A 4DQ0A 3VDQA 2BMDA 2JRLA 4KZPA 2EARA 4X7PA 4N5IX 1TTHA 3T5DA 4DC1A 4F5EA 4G0VA 1PX2A 1FC0A 3BIJA 3F5FA 4HPJB 5C3MA 2J09A 3KTDA 1KK0A 1S1MA 4I4NA 4Y9RA 4BNYA 3LDUA 1DC8A 3SHQA 1KI6B 5C7LO 4P3OA 4QXAA 3W7BA 5GIPE 4OH7A 2VSNA 1U7HA 2BM9A 2G9ZA 2NOAA 3BCSA 3ABSB 3JAWB 3L84A 3GLIE 1TQ6A 2IDZA 4QO8A 3AXTA 3FLEA 4C7JA 2VLIA 1YXMA 4RMNA 4UDXX 3M9XA 4D56A 1P72A 1U0RA 1VLJA 3JQBA 2Q0XA 1I7NA 2QYTA 3FVWA 3G8DA 3PNKA 5FI3A 3I4CA 4HD8A 2PSSA 5ESXA 1KORA 4KPYA 2A1IA 3VSCA 4BDSA 3PFKA 4BC0A 5ILGA 1U7WA 3BA1A 1RWMA 2RBGA 3LNTA 2PXAA 4DC0A 3QXSA 3CVYA 3O8BA 5C34B 2FPIA 4XASA 3VR1A 4YAEA 1ZRNA 3GLGE 4ZOEA 1NF8A 3V4SA 2VNKA 5EGSA 3HJCA 1E62A 2XQGA 3N0VA 3QE9Y 2JLVA 4IKPA 3SX4A 3PLAE 5CURA 5IYZB 3I04A 2HHCA 5FPKA 2OQ2A 1RCFA 3OKFA 4CEJB 4UTZA 2GN9A 4IZHA 2WD9A 3FTPA 4RMIA 5EC8A 3A4MA 1IL0A 1KHHA 2V3WA 4L5IA 4V0ME 2C1XA 4RJKA 3TLXA 3DFFA 3T4XA 1DIGA 2JHPA 2IGTA 3RS7A 3ZWNA 2IUFA 2A88A 3C4JA 4GC5A 1U2RA 4LF7B 3SEFA 3CO0S 1S89A 3TAUA 1ACLA 1T15A 5TVKA 1QP4A 2QRMA 2A5LA 3IULA 5AHWA 3KL2A 3TRIA 4AZ0B 1TM5E 2F1KA 4IUBS 5B36A 1XCMA 4P0TA 3UJ6A 4D46A 2Z8YA 4YRBA 2ZIWB 1T1JA 3CNLA 3OMWA 2FFAA 1EFLA 2QRVA 1VI5A 2ZSEA 3C15C 1S02A 3R7BA 3ODPA 3ZE7A 1W85B 5JS7A 2FHSA 1TIKA 2FEAA 4NENB 4ZAYA 4WTOA 5AJVB 2CB9A 3PXAA 1I4DD 4DMMA 4LOKA 1BX0A 1PL6A 4TKUA 1FDIA 4UBOA 4MWCA 2E9SA 4RDXA 3E82A 4BFLA 4NZOA 1J70A 4PAOA 2I4OA 4GZMA 3G1TA 4HH0A 9LDTA 2HF2A 2YY6A 2MMGA 3G79A 2ZUVA 2M6LA 3DLHA 3Q7QA 5KZMB 3RSCA 4EUKA 1V8BA 3PHBE 3QXGA 3QFHA 2A8YA 4I6EA 1VZ2A 3TQHA 1P2FA 2GAIA 3BRSA 4M54A 4X60A 1S8NA 4CMBA 1WA5A 2R6FA 3EZNA 3IPCA 3KJGA 1V96A 4RD2A 3FROA 3IKJA 2OFFA 4AMGA 1FPQA 3A58B 3O3CA 4POOA 3FI9A 4LDNA 3VHRA 3KPWA 1ISFA 1IEWA 1SVIA 5CW1A 1TRKA 5IYZF 3CNOA 3KZXA 4NHOA 5GZ6A 2H06A 1HSOA 3NI2A 4EW1A 3MCWA 5B58T 4DYVA 3C3XA 5JECA 3Q6NA 4WZBA 4Z1MA 1FRFS 3SS7X 4TXNA 3FOAA 3EGCA 2GA8A 2G80A 3CT4A 4N4AA 4JX9A 2GO7A 3REQA 1L3CA 4ZJUA 4B79A 2JIMA 1NUSA 1YCHA 1ZUWA 1RE1A 2ZYUX 1C9NA 3DJYA 3FF1A 4OJKA 3KSDO 2WWVD 1KO4A 1ND5A 3VZSA 4EHJA 1ZH8A 3BXEA 3MZ0A 4WNCA 3O4VA 4EK9A 2FDCA 1GGMA 2NVWA 2X1VA 5E6UB 4ZAVA 1PL0A 2AVDA 3AINA 3CJQA 3K0AA 1GCOA 4WXYB 4GO1A 3E9CA 3OAAA 4YDQA 5ITZB 2F8TA 4KAJA 3GLUA 4IJMA 5BN1A 5FUMA 5KQMA 2GN1A 1M5RA 1M75A 1X9HA 3KHSA 3R6WA 4EI9A 2DKFA 1F38A 3OPYB 1WB9A 2FEKA 1QX4A 1NMZA 5K7SA 1A3CA 4PQYA 3DLPX 4Q9NA 4DDHA 1KVUA 4YXWD 5JNTA 1JU9A 2QN6A 4H77A 2XA1A 3HXQA 4PYOA 4MIYA 1XVLA 1P6QA 1A2KC 3LXRA 1IY8A 3NT5A 1O94C 2GTHA 1O96B 4Q3NA 3GHHA 3IVMA 2I0FA 1KEKA 1N77A 3RO7A 1ZK4A 2O06A 4Q7EA 1QO9A 2PGNA 1U2DC 1OGJA 3CF6R 1HYHA 1N2OA 2ZAIA 2ZS9A 1KIFA 3DYBA 3NUZA 3C3AA 1Z7WA 2NU8A 3TLGB 3THXB 3GP5A 3EXHC 1JQAA 4US1R 1YL6A 2H51A 3IODA 3OX3A 5EE9A 1SO8A 1TMKA 2D8MA 2H07A 1JWLA 1IATA 2W6PA 4HTFA 3RTCA 3DDSA 2ISCA 1Y8CA 3SEZA 3AQ4A 4HAOA 2HU7A 5BUQA 1MAAA 1KIMA 2GN4A 3CSDA 3FPLA 5DSTA 3SF8B 1VHWA 1RC0A 3U5ZB 5ALSA 3BL6A 5GM2A 4G56A 1NRWA 2QSZA 5EJIA 4B0PA 4LGVA 3A0UA 2PVPA 5DMHA 5IARA 4CLDA 2YH2A 4MP6A 3IDSA 4NOLA 4PQRA 4ENTA 4LXQA 1PNOA 2QW1A 5JO9A 1XQWA 2G8LA 4WVLA 4GP6A 4C0HA 1L5OA 1MW9X 1YRYE 1CHNA 4FDUA 4OSPA 3U39A 1L5NA 4F2GA 1SBZA 1XQ1A 4MS4B 4NYMQ 4QYXA 5JSZB 1R0BA 1FTGA 2QR5A 3ITNA 3AR9A 3GDFA 1MDFA 3IV9A 1AK9A 3KZCA 3FY4A 3SXUB 1L5MA 3C1AA 3NASA 1SU6A 1TZJA 2HI0A 4LV8B 1OI2A 3EOBI 2O8EB 1SXPA 3PA8A 1NZFA 5ADWA 1MRZA 3HYTA 2QDXA 3QRWA 4JT2A 3NEPX 1RBMA 3GRCA 4RV5A 2CK3A 5FLYA 3DAFA 3EEBA 1A5AB 1HYBA 1UWVA 3DO5A 3ZCRA 3F2IA 2XBLA 3ZDEA 4F71A 1BVYF 3FNFA 5LZ4A 2HSJA 1RJ9B 5DWVA 1LKZA 1MXFA 3VC3A 3HCAA 3U44B 1WXEA 2QE7A 4G1FA 2H8KA 2PWPA 2H0QA 1N75A 2Q6OA 3IBTA 4NFYA 4QXOA 4RS3A 4EEKA 3GJ3A 5IXYA 1C2TA 1RZVA 1SZDA 3DEHA 2D8AA 4R2KA 2MTBA 2QRLA 5I7WA 1R8QA 3N6VA 2CNBA 4QLOA 1LDMA 4TTVA 4BASA 2IXEA 4F85A 3IT1A 4UFNA 4EPVA 4KK3A 1IYZA 3H5IA 2Z1DA 3RK4A 5LMNB 4MGHA 5IP5A 4HFJA 3T7AA 1DX6A 3PA6A 2ZE8A 4TTIA 3W2TA 2OTCA 2OCAA 2BONA 4Q7LA 4W6QA 3NVDA 4ICIA 5EE5B 5FL7D 4D9FA 2ZBGA 3GMTA 2V9PA 1CX9B 1N5IA 2X1LA 2GH1A 3FNHA 3A31A 4IV0A 1FVFA 1Z6XA 4PO3X 4BL5A 3NCTA 1EFPA 4MYTA 1R4AA 5F2EA 4PRLA 4BGIA 1KNQA 3EIFA 2Q2NA 2DSNA 1XE3A 1DDOA 4HDKA 1FFWA 4RK1A 1FMCA 2ZBVA 4A3SA 5U4XA 5DW0A 1E9AA 3VU3A 3CPSA 4KJZA 5TQ0A 1DQRA 3VR2D 1HTBA 3EDYA 1CLEA 4LYHA 2I4LA 2ATEA 3O26A 3HDTA 2ZRGA 3DV0A 3KX2A 3SSMA 4XPIA 4BTVA 3HK2A 3JRWA 4GUAA 1J06A 1HXHA 2I78A 4LXTA 4OI1A 3H2ZA 3PGMA 4FMBB 4IIUA 2XTMA 5I5GA 4BMSA 2YHBA 4J1NA 1Z88A 3I05A 4F3CA 4ZODA 1XTIA 3GEDA 1S5PA 1JMKC 1KSHA 2KW5A 2DWOA 2RGWA 5KKNB 1XB2A 1G8HA 3P32A 3ZXYA 1YONA 3PXBA 4Y2TA 1SVSA 4BQRA 4N47A 3OOWA 5IWCA 1C3LA 1NXTA 3LQ1A 1SB9A 1BE8A 2EJCA 3NDIA 2Q3DA 4N9WA 5CJJA 4YP7A 1BCSB 2FW9A 2WD7A 2ECKA 2YZ7A 1RHMA 3B9PA 2QMZA 4WACA 4XQCA 5JEDA 1GVHA 4TMFA 2OCIA 1ZIYA 1NQUA 2EP7A 3UW1A 3DHNA 2VPZA 3AIOA 4UPVA 4D9IA 4DCOA 1UPAA 1PDWA 3BDIA 3E7PA 4ZVKA 4BQOA 5LLTA 1ORVA 2FZEA 3HMQA 3KKMA 4MQLA 2MMCA 1CY4A 4L8YA 2RG7A 3FR7A 3GVIA 4XR4A 2C5EA 1KMHB 3S40A 4M1ZA 1RMTA 4Q3BA 5BN3A 5LP6B 3SFZA 1RXVA 5PGMA 1D4OA 3L9XA 5TQJA 4B6RA 3A6GA 3B60A 4BZXA 3J7TA 4EWLA 1FRNA 3FOFC 1V1JA 2JCYA 2WZDA 2X6RA 3E18A 5A5FA 5L4NA 4DIKA 1KQOA 2Y6VA 4DN6A 3DCJA 4MHSA 1DARA 3RKUA 4KR7A 5T4BA 3G0HA 1YB2A 3VRHA 4IJKA 2QBYA 3R5JA 1UOEA 1AMOA 2ODQA 1L4GA 1SY7A 3AJ8A 3KB6A 1JIKA 2VF7A 3EG9B 1UKCA 4CM7A 4BMYA 3RU7A 1P1IA 1UDRA 4HGOA 3KDSE 4E88A 2W93A 4Z8XA 3N2YA 1GHTA 1KYWA 1IEQA 2FUG6 1XJQA 1HE5A 1O58A 3F47A 4XGRA 2D0PB 1W5TA 2OV4A 3UPDA 3B2QA 2GM9A 2UZ1A 4URUR 3LP6A 5CYFA 2XCSB 3MEQA 3GU3A 1A71A 3H2GA 1OFVA 1CJUC 2QQGA 5KJ6A 2AYXA 3CLSD 4OB8A 4HUJA 4Y1RA 2BEKA 4RORA 4QAJA 3N2IA 2C2MA 3UWSA 4R2MA 4CM5A 4HV4A 3OTWA 5BPHA 3ZVKA 3GUYA 1PFGA 3AVOA 2D6FA 4GX5A 1CEXA 3JQGA 1GPUA 2BFNA 4Y2SA 4L0CA 1Y4AE 4MQ4A 4QQFA 1KU6A 4KRGA 3IBYA 2J6BA 3PI6A 1DKMA 4G0XA 2HU2A 2AD1A 4IIGA 1A5ZA 4I55F 4Q9HA 5CDHA 1ZGCA 3DXFA 4OA8A 4K5QA 1XDSA 2PTGA 3L5OA 3MT9A 4EHDA 4OBWA 3K09A 1MJFA 2GCEA 3LSTA 1QYVA 1X7ZA 4W4TA 5LXTF 4F7WA 2BM0A 2NTJA 1V7PC 4G0PA 3W2HA 4E11A 4EUFA 1VG9B 4EG1A 1CUWA 4FYIA 3UJBA 3AJ9A 1P19A 3DTVA 3PXXA 3WDMA 3AI3A 1A95A 3FGZA 4OSOA 5E6RB 2WJAA 1DQZA 3QA9A 4GZ6A 3DUFA 4HWPA 3EUEA 5TC4A 2IC5A 1EUDA 2B7BA 3H9GA 4ARVA 2V7WA 5JZBA 5H3CA 4YMGA 1SC1A 1CW2B 3DBRB 4M0KA 2H85A 1MW8X 2AHOA 4QZVA 4W1RA 1PGOA 3WB0A 2FZVA 2YIJA 1L3IA 3PV0A 5KTSA 2QT0A 3SC4A 1TUEA 1CJCA 2JCXA 1WU8A 1ZGJA 2ALJA 1Z6QA 1NVWQ 1U7UA 3H9BA 2VTBA 4L28A 1Z2DA 5CBPA 3MMZA 1W9HA 3D8UA 2EBHX 2OCPA 2OHVA 3PZBA 4M0LA 5L7WA 3HB0A 2ZZMA 3DEKA 4M9RA 1V39A 5AOCA 5EWLA 4QEZA 1PNTA 2OK7A 1EWYA 3SMQA 3H4VA 2XCOA 5CLFA 3HWX1 2GX6A 4HAUA 5AVZA 4K9LA 4YXFA 3DBRA 1Z7GA 4KMMA 4V0RA 1LW6E 4PRYA 5HKLA 3VYVA 1E9VA 3IXQA 3PHGA 3CLUC 3HACA 3IMEA 4RQTA 4ENVA 2ASVA 2CFRA 3CBQA 1FYFA 3FGOA 4C2UA 4LJAA 1E1NA 4C5CA 4AMBA 1QOZA 4AJ9A 4TYNA 2C99A 1JAYA 1SUCA 3KPJA 3NOXA 5A6SB 5KS2A 2ZSJA 1K6EA 2ZT8A 1NOIA 4EUHA 1SA0A 2RJNA 4KSCA 3OFJA 4MUHA 4RTSA 1U99A 4MUFA 1ZA1A 3HCEA 4P92A 5E4TA 5EYPA 4ALNA 3M6IA 1VI2A 1OVMA 3RHFA 2X0FA 2VJDA 4NCJA 2YQ5A 2BFWA 2P9YA 1WP4A 3AP1A 4BVEA 1WLYA 1C8LA 4ER6A 2NQTA 3IJPA 2QXYA 5ER9A 4LZNA 1RACA 2O9JA 3C2QA 1S3IA 1SURA 2UZ0A 4EKDA 2V3CC 1N8TA 1RRVA 2P6NA 3A32A 3IUEA 2AEJA 4XM2A 1G5TA 4CR6A 4DLYA 5HK9A 4WMLA 3I9FA 1I6WA 3U80A 2HPZA 3I39X 2OB2A 1JJAA 2PUBA 3QLVC 4N5MA 4ZEMA 4C4PA 3A2KA 1SXJC 2QW8A 3OLVA 1JDBB 4Q9KA 1E3JA 4HDMB 2R1TB 1OX6A 2WYWA 3ZHTA 4BYMA 3F2VA 2I8LA 4MMZB 1JSCA 3NP9A 1DRKA 5TE9A 4Y2VA 2DU8A 5LJIA 2B8JA 1K63A 5B1DA 4HEHA 1H2YA 3IUPA 2VHZA 4LZLA 3S6JA 1PJZA 5KYGA 2DEUA 5HF9A 3KKNA 3U3KA 3B20A 1CUEA 1BRMA 5LU8A 2OZLA 1IPHA 3FUXA 1X14A 2CN1A 3AI1A 4YMTA 4XYMA 1ECFA 2FPGB 2CNKA 4YDRA 1C80A 3BZWA 4FN4A 3DQZA 2W0MA 4O8ZA 3V3TA 1EGHA 1OBHA 3WL7A 1VKRA 3K9GA 2A0KA 3OQNA 1NI3A 4WJLA 4U2CA 3FCOA 1ZGGA 3WS7A 5THQA 1DZ3A 2G77B 5IT9A 3RADC 3DL4A 2VK4A 1GPAA 2FR1A 2QG9A 2WICA 3GRFA 4H4CA 4XWKA 2R8ZA 1YZVA 1U2QA 3RFTA 5JSQA 4CXMA 1QZUA 3R3ZA 3Q88A 3T7SA 5F3RA 4PO8A 1P1CA 1WABA 2FWNA 3IBFA 4BZWA 3JQBC 4A0FA 1BVHA 3SOZA 1DRVA 1P91A 2V8BA 4FDTA 5G0SA 3U1TA 3BG5A 1QF9A 2KJQA 1DQPA 3SX2A 3ZXUB 3THYA 1ADGA 2W00A 4MVXA 2C57A 5SY4A 4ES6A 3JVDA 4EZIA 1QSGA 5I7SA 4Q05A 2V6GA 1LDEA 5FV4A 2Q1TA 3OA2A 4II2A 4Z8YA 3NONA 5KYWB 3VR5A 4XI9A 4E13A 2FNAA 1E2EA 4TL6A 5CGQB 4HLDA 3PWSA 4V1CB 3TG2A 3ZVMA 1JZTA 5AXAA 2X8BA 2Q4RA 5DXFA 4BLSA 1N2ZA 3A6JA 3SOPA 1FFBA 3NFYA 4QRDA 4EG0A 5JAHA 2CV2A 1CF2O 3BPSA 2FRDA 3ILHA 1K6XA 5C9ZA 1Y8ZA 1BDJA 5L45A 1L5SA 5LN1A 2GS9A 3OFKA 2QTMA 4GXNA 2OT3B 4JMLA 1OBVA 3KQVA 2KSQA 3LCCA 4N39A 2N42A 2N75A 2YNMA 1VSUA 1X42A 2WWGA 3KUKA 4JJ6A 4ARIA 4MVJP 4PRKA 4BP8A 4DNQA 3IPXA 1KI4A 1JTEA 2BVNA 3EODA 3OJ0A 1D2RA 1V37A 1Z2PX 1D1SA 2YFQA 3KR0A 3T9DA 3VAYA 4BO5A 3VTFA 5IK2D 4PS0A 2O8DB 3HY3A 3O31A 4R05A 2H2FA 2P2DA 1PYDA 1VMAA 1L1QA 1L7EA 1Q0HA 1T4MA 4LYEA 5ALQA 3MMPA 1K92A 3OJWA 4I1IA 4MYSA 2VO1A 5DCUA 4ZOLB 1I3LA 4AFNA 4DA8A 3THYB 1ZUNB 2YXLA 1OLUB 4Z5XA 1M73E 1ZJZA 3D8RA 2L82A 3RNLA 3UCEA 2COUA 4G97A 4URWR 3UMRA 3IOYA 4R2WA 4HDKB 2OKCA 3QLUC 3AP2A 2AJBA 3OUTA 3EVGA 3QV1A 5JPIA 4ARZB 2Q8QA 1CZHA 5IEBA 5H8WA 2NP6A 5HUQA 3RVQA 2O6HA 3O1HB 2D5IA 4NFSA 5E7IA 1G8KA 3FBGA 3O8DA 4HRYA 2VWHA 5EJ8A 4PW0A 4L08A 2HK7A 4NEQA 5AJXA 4M7OA 1HDOA 1GRRA 1STOA 1GPDG 3BWYA 5F3WB 3N87A 1FUIA 2P35A 3E70C 1XAGA 1B93A 3KJNA 5JNVA 2ZJBA 3VHLB 4ZVMA 4HR7A 5IF3A 4NCHA 1YRAA 5KWJA 2Q3LA 1AGRA 2R97A 4UHDA 1T2UA 4QU8A 3T3MB 2WU8A 4CUKA 4DLPA 3WXBA 4MS1A 5HPYB 4FB4A 5JBQA 2XE4A 3UAYA 2O1XA 4J0HA 2I71A 2H7XA 3C3BA 5HE9A 1ADCA 2IOYA 5FTKA 1GKLA 2C9ZA 1BEUB 2FW0A 3Q1LA 2J9XB 2QE6A 3KT8A 5HKAA 4XYEA 3QJGA 1J8FA 4TOIA 5A1JA 4XYGA 1UC5B 2EQ5A 1VSQA 2J30A 5LBTA 4RHEA 5EPEA 9LDBA 3D2BA 2MCFA 3BD8A 2OOSA 3DW3X 4EM6A 2X86A 3KTAA 3N07A 4MPTA 4PS1A 4LYGA 2F6RA 1C7EA 1C9JA 2CLLB 4BJ1A 3ESAA 4EKNB 3GNSA 3P0RA 5D3ZA 4RKQA 5JCJD 2YJGA 3LCRA 3H9JA 3B2EA 3LXMA 4YJ3F 3VKVA 2ARKA 5DNAA 1M2KA 4YRDA 3KTAB 4G25A 1A2OA 1IMJA 4YS6A 3EFOA 1VPVA 2YHIB 3M2PA 2OFWA 3JTMA 1AQYA 2YUTA 5AQEA 2HUNA 2LD4A 2QJRA 3H3XA 2P2LA 4PSUA 4BUZA 1Q7BA 1EVYA 4EAQA 4AD8A 4OKSA 1FTNA 2FQXA 2HMUA 5FNVB 1Q2XA 2VDPB 4O8CA 4D8YA 4NNOA 1NG9A 5IN4A 4ABTA 3RPEA 4Q37A 3IJ5A 4QOHA 1IUPA 4L4SA 3TINA 1KK1A 3I64A 5J2UB 2ZYSA 3O92A 4EGQA 2G04A 1KMNA 4GKJB 3VKUA 3WMRA 4CCAA 3FDZB 1K8YB 4RH3A 3NAGA 1MPTA 3PYLA 5L9AA 5FBWB 5KSOA 1VL5A 2WVJA 1HDZA 2HGSA 1OZHA 3VU9A 3L8HA 5IABA 3UJAA 3WGVA 5KYUB 1KYZA 4RSMA 1T2CA 2PKEA 2JLXA 4D6XA 3KTFA 4JJAA 5BOSB 2HMYB 4KRFA 3LKBA 1XVUA 4LV5B 5CT9A 1LU9A 3M6XA 4PCLA 1YBMA 3LT0A 5IN5A 3MVEA 1CE8A 2JARA 4IFIA 4CWAA 3NBQA 5BWOA 2F3UA 1BS2A 1W4CA 1ML4A 2AR7A 3JQAA 3CW8X 3WJAA 1MO4A 1EXWA 1ZMXA 3D64A 1R74A 4F84A 3NATA 4XVHA 3BWVA 2Q9BA 3J81A 3QA3E 2ERCA 5IANA 1YO6A 3QEMA 2PZKA 1XK7A 3KK0A 1GDTA 3V7UA 4PAGA 2Z08A 4AIRA 4CLRA 4A8JB 1U3GA 3RWBA 4HGPA 1RC1A 3AUKA 1KP9A 3MJEA 2WIKA 4FJ2A 2DQ4A 4L4UA 4EYGA 3II6X 1K9SA 5H83A 4ZJYA 5BN5A 2Y99A 1N3BA 3ROQA 2QN9A 4V3BA 4CODB 1WZEA 4D8WA 3C3MA 1NY6A 1V6SA 1K8XB 2IY8A 3UHOA 5T67A 3TIIA 1GFZA 4ZI7F 5FPTA 3UH1A 4E5VA 5CW2A 2W22A 6REQA 1IDOA 4O1HA 4A6XA 3I28A 1DO8A 1QB7A 4DWVA 4ARBA 4TKVA 3BSFA 5ALRA 2PCLA 5B2ZA 3BMNA 4BFYA 1N9GB 1UODA 4F11A 2NO5A 3O6VA 1L5HB 3HCBA 4IQFA 2HQBA 1G8AA 3DDUA 3OO0A 4D0GA 5KYKA 3AUSA 1X19A 2AE2A 4WLEA 3WLFA 1GWNA 4YCLA 4XUDA 1PQUA 1CZKA 3TSWA 4AUKA 1CFJA 2WTEA 2FVYA 4IDGA 3FCAA 5ALNA 3IL2A 3PHHA 1E9FA 4MR7A 3RVBA 1O9GA 2ORYA 4IS2A 4EJSA 3KWMA 3UT5A 2PTHA 2VK2A 3Q2IA 2DAPA 4HLNA 2ZEJA 2X77A 4KQHA 5AYVA 4Z7JA 4QGHA 5JMWA 3TH5A 2FQ1A 3JR3A 1Z4QA 2C4NA 2GBLA 2QT1A 4BIMA 4WESA 2ZR0A 1DEHA 4OHXA 1AQLA 4L3OA 4CV3A 2AR0A 1FCJA 1K06A 3GJRA 1YAJA 3OO1A 1NUTA 4KVFA 4ZV9A 3R7SA 4S1VA 5EHZA 1BW9A 1YHZA 3G89A 4P4GA 4PLHA 1XNRB 4FT2A 3J80A 2EBUA 3RTAA 2Y0PA 5DXJA 3B6MA 3V4PB 4UATA 3V42A 5AJWA 3L0ZA 4PEVA 1T0JB 2O48X 1Q7GA 4C0WA 1YGPA 3WQSB 4P7FA 3GXOA 2QVLA 1SBYA 1YR1A 4WLFA 4HDMA 1VLVA 2JVKA 5IS2A 1CUZA 1R9JA 3HJHA 2AC4A 3KBOA 4ZN6A 2V98A 4BATA 1ZLYA 5AVXA 1ODJA 1M67A 1P1JA 2OBNA 2X3UA 4IV5A 1MQ9A 1TJ5A 4QDOA 4QYIA 2DPXA 1R1DA 5AOBA 3T95A 1AV7A 5ICCA 3E3MA 1GZ6A 4YC7A 3MJVA 3U3MA 5JH7B 1EUYA 3HJFA 3GFPA 1XZFA 4IUYA 4F93B 4N0MA 2WAMA 5AOAA 1XVIA 1XXHB 5AKEA 4BNJA 5IYZA 3KOXA 2WZQA 3P9PA 2EG9A 2G4VA 2VUIB 3RYTC 4FS8A 2IU3A 3STYA 5FA6A 1T4CB 5B6IA 3ITEA 1RQGA 2FW1A 2PIDA 2WQZA 5F4BA 1V11A 4IDNA 3TW8A 3R7DA 3QYJA 2GPNA 5JWHA 2F3QA 2GCGA 5DULA 2Y4NA 1H65A 3K8YA 3NNSA 4ZEVA 3DB1A 5L95A 3DOIA 1AE1A 1Z75A 2QM7A 3CX8A 4RF2A 5EUBA 3OAAD 2C2GA 4ND3A 3W1WA 2JFWA 1G9SA 3OPQA 4KGDA 2R84A 1X2BA 2AE1A 4QDKA 4PG8A 2C92A 4Q1CA 3VKHA 1IQPA 1YSCA 2PH7A 3MGCA 1TE2A 2M32A 4XLZA 4Q9DA 2WFLA 2VC2B 2YJNA 5IKEA 1RC8A 3LYAA 1ACMA 3P4UA 4NYMR 3SC3A 1C7IA 3WO1A 3ZDBA 2XCTB 2WJYA 2C95A 1G38A 4IIFA 2HNAA 3M81A 1Z56C 1MBZA 4URFA 5H68A 4C03A 3TEMA 3KQWA 5IT4A 4DYDA 1R0RE 2QU8A 5C2JB 3PEUA 4U63A 4ZAZA 1J9ZA 1NQ5A 1ZGHA 1UJ6A 1UQUA 3DEAA 3RS9A 1OT5A 3ND8A 3EIWA 4TSRA 4D4MA 2N9UA 3IE2A 4C4YA 4UU7A 4ER7A 2ZM6B 4PAQA 5E7QA 1K7FB 1PR5A 3PFGA 2I5PO 4MS3B 1EVIA 1CCWA 1L0BA 3I32A 3UMVA 2BMEA 3KUXA 3W78A 4O2AF 4E5UA 4AP6A 4DRZA 5COBA 3GGGA 4BV2A 1D8TA 2YYSA 4J43A 2IA5A 3ZY6A 2PUVA 4ZZ3A 2RARA 4EX7A 3RUPA 1CUIA 3CH5A 1C9EA 2N47A 2JA2A 1N8KA 4ONEA 5EXTA 1JSRA 5DCLA 2VYCA 2P69A 4RCZA 3VO2A 4ALJA 2ONYA 4UTOA 1U9IC 2R4QA 2WG2A 2IYRA 3CV3A 1YIDA 1Y1RA 3MWLA 1M8JA 1CSEE 2Q5EA 2ZKLA 4J9VA 4QGFA 2P8JA 4UM5A 1U1CA 4UDOA 3AHJA 3UTDA 2XEXA 3C7AA 3H13A 3M6FA 4QNNA 1YJAA 5HW0A 4JH0A 4YT8A 3RC8A 3QKUA 5CIWA 3FD8A 2PWAA 1J8QA 2XWQA 4FYHA 3F7NA 5ENZA 1AXRA 2R00C 3AWIA 4HX9A 3COVA 5B3AA 4E3WA 1YR6A 1QV6A 1BTOA 3IQZA 3PNQA 4BU0A 3IA7A 4EPWA 4RCVA 1WSAA 1QDUA 4F9TA 1ZD9A 3RVOA 4WRRA 1UMKA 4YJ2A 1GG5A 4IIJF 3B52X 3BK7A 5GPBA 4M9UA 2Q4TA 1GNQA 4TN5A 2R8BA 3B1KA 3UJDA 1X8KA 1E3IA 2ZUTA 4K9NA 2Z56A 4MO2A 1N2XA 5A2QA 2DB3A 4YXWA 4QFCA 1HLFA 3B12A 2OENG 4JFRA 2XMBA 4X1IA 5EZYA 2NU7B 1WMAA 5GWXA 4I5GA 2GKOA 2WKPA 3S28A 4D1YA 4C01A 3EGIA 4J75A 4OATA 1YMQA 4S04A 5LC1A 1YDEA 3MRXA 1U3VA 2R6JA 3AL2A 4MUEA 4G8JA 1YRBA 1IH8A 3L8GA 3NHSA 2QR3A 5JASA 4Q7KA 1B0ZA 2VG8A 4L7QA 3UG6A 1E8NA 2YVUA 2MSNA 4Z6KA 1G2IA 2I6GA 1YFJA 4XWAA 1XQ9A 2DQZA 3OZIA 3JQRA 3R5HA 2R8PA 1J39A 3D7NA 4DBVO 3EOAI 4N6NA 3FVTA 1HI9A 3T9BA 3ZBPA 4PSDA 1XV5A 1O8CA 5CK4A 3KG2A 2C0CA 1NDHA 1JG7A 3IUQA 1WUTA 1EESA 3BSYA 2HF9A 4QHSA 5HIIA 1WW8A 4EYOA 4F4CA 2C04A 3L0CA 5JW6A 3BBPA 4FZRA 1EDZA 2QVZX 1WRBA 3UXYA 3Q8MA 4B4VA 4C30A 1W0CA 1WMEA 2QEQA 2FN4A 3TIGA 4Z4EA 5HJ7A 5TF4A 3L9WA 1R9MA 4FOSA 1FBTA 2VIIA 3L6CA 4HK4A 4Y18A 4EITA 5EKUA 5ITSA 1UBLS 2GM4A 4BCDA 3VBEA 3LGAA 3KB1A 3FPCA 3QSGA 1TXGA 1YQWA 3TBHA 4JLBA 4OXXA 1ZICA 2A0WA 4ARSA 4QVGA 1FS5A 2OFOA 3MS4A 4M1YA 2FPSA 1R6VA 1YMVA 4OOFA 5H81A 4OL0A 2X5OA 1J5PA 1Y9JA 1QGAA 3CF4G 4EB6A 4H7IA 1GCIA 1NSTA 4R1SA 3IP3A 1A96A 4U9UA 4WE3A 1G7RA 3MWGA 1CT9A 2O2XA 5BV1A 1T9DA 1MGOA 4HGYA 3FHLA 3GFBA 1ZPDA 1SCIA 4AJNA 2OXTA 3EF3A 1XTRA 5K01A 2XCUA 1RIFA 3I9JA 2V03A 4IXTA 3ETCA 2QKYA 4YT5A 2V5VA 4HWRA 3PD1A 4L74A 5JJBA 5JNWA 1UBMS 3G2LA 2XYVA 2YWGA 1X1QA 1HZZC 2C78A 4MQEB 4B6OA 1T9HA 1XRQA 2ZJ5A 4D45A 2QR2A 1QONA 1SVLA 3OMXA 4HNAA 5GZ1A 3AERA 5JCZA 2BR5A 4H35A 2A9JA 2C4VA 4K9DA 2WJIA 3EA0A 3LUDA 1Y5NA 2H59A 2ZSKA 3Q0TA 1CRQA 4U7GA 2CDRA 2FPOA 2DBVO 3EC7A 4KI0A 4C22A 1GSHA 1X8LA 1U0HC 4CDMA 2CD9A 5D01A 5G4KB 1XPUA 4LJ7A 3SN6A 2VXBA 4TKUB 1L7QA 4NHEA 3AEUA 5L6LB 2DERA 1IK6A 3QIVA 3VKGA 2O23A 3OE5A 4DTIA 3H2JA 2EKZA 4U6NA 1IRIA 1WXFA 2WSMA 1V2HE 1D7OA 1QGYA 4LSMA 2WAYA 2JGEA 2ZIUB 3SJCA 1R9GA 3UYLA 1A9OA 1EKXA 2QRZA 1C2YA 2GZDA 2CSUA 3BGSA 3L7DA 1A4IA 2K4MA 4URXR 1ABBA 1JDNA 1O6FA 3CISA 3Q7PA 4YROA 5I8ZA 4G0UA 4FOPA 1VJ1A 1H6DA 1U7DA 1KAQA 1DC5A 1N1EA 3ZGXA 1EFDN 3RU2A 1N7HA 4IDDA 1ULBA 1E2NA 3VVLA 2FN3A 1LEHA 1PS8A 1VJGA 2EP8A 1H1TA 3QU5A 3QY9A 1VIVA 2Q49A 3GRZA 4IJUA 4P4TA 5C8YF 1VYTA 1SKMA 3LW8A 1JQEA 3K30A 2CYAA 3MMNA 4I8XA 5TPZA 4B31A 4ZZ0A 3V4ZA 1M2EA 2JRCA 3IT3A 5JISA 5KOIA 5ETJA 5CLLA 2FPIB 2XEDA 2CFCA 2D7CA 1PZXA 5BT8A 2BF4A 4LN1A 1MFZA 3VR6A 1QHXA 4BS9A 5JSZA 3ILSA 3B1JA 3JD0A 2WHEA 1DFIA 4KMOA 4UTRA 3TRFA 3BRWA 1JP7A 3SBOA 5CHYA 3SQLA 2DF8A 3HCPA 2ONKA 3WHPA 5ED4A 2WNSA 5MGBA 4V0QA 1N6RA 3W7VA 4DQVA 1A9XB 4G1VA 4RSRA 2ZI9A 3T0GA 4A73A 3UMCA 3E7WA 2IPOA 2IYAA 2A4MA 2V8OA 3DZIA 4FFDA 1BX1A 4R1NA 5SY6A 4AKIA 3ENZA 2RGGA 4HTFB 1J7KA 2ECOA 3LQYA 3NQ41 4D3SA 1Q0LA 3KT6A 4LNAA 4H7EA 2EYQA 1BQEA 3AR3A 5BV0A 3K32A 2OD2A 3GWGA 1NVEA 4QNRA 3UB2A 5DKFA 2WJJA 1P7YA 3F96A 4FGUA 2NU8B 1IXYA 4V0SA 4MR8A 3THWB 4I8DA 3NHMA 1KF0A 2DLNA 2ZUSA 2YXNA 3G49A 3NHZA 4P2GA 4W1PA 4E07A 4ZYWA 2GXSA 2DBYA 3LOQA 3U7EB 3C6QA 1LSSA 2LCQA 2RHMA 3IDOA 3UWMA 3KZOA 3R75A 2G67A 4P3NA 2I33A 5CVCA 2FZCA 4ZGWA 4XDGA 1Y37A 2FN8A 3TR0A 4DJAA 1SCKA 1VA4A 3WGNA 4NU6A 1U0TA 1AGNA 1CQWA 3JYQA 2FUCA 3KL4A 2SBTA 3UGKA 1G21A 4K05A 1UR5A 1DG9A 3LCUA 3S2YA 1W2HA 2P9JA 4RY9A 4YCJA 4BTLA 4L2IA 2JEOA 1QWOA 5FI5A 4DUYB 4H1TA 4J7AA 3L82B 1PWZA 4TVKA 2IXGA 1APBA 3VPXA 3CEAA 1R66A 3WGMA 1P2VA 4FMCB 2ZB8A 4INJA 5I6DA 2P5SA 3B6JA 2PUCA 3FSGA 3K0HA 2R68A 1I0ZA 2WHYA 3H2BA 1S2NA 4ETNA 4CPDA 5EMHA 4Q7JB 3H9EO 1XZ8A 4R2HA 2AWNA 1XOIA 3QKRB 3H99A 3RJ9A 2H18A 4YV0A 5BUZA 5AWFC 1CYEA 1KKUA 1T8PA 5HM6A 5MN5A 4TTRA 2IITA 1B15A 1FDVA 4J0DA 2J85A 4TXMA 4X44A 3VNVA 4RL6A 5ERGB 4KO2S 1K4KA 4AU1A 1L1RA 3NB0A 1B26A 2XBUA 4Q4JB 1CQZA 2NP7A 4GFDA 4NMLA 1I1HA 1CV2A 4TGLA 3KZVA 2PS3A 1IB6A 1SWWA 3FDXA 3M6LA 3MT7A 4YGXB 5D7NA 4ZQEA 3RYHB 3IUYA 1KC1A 4KN6A 1VCMA 1U9IA 3VZCA 4Y1FA 4J16A 4ZMRA 4CLOA 1QHYA 1YOVB 2GFQA 2INGX 4DR7B 2QRQA 1O94D 1YZ3A 5EPUA 1T9GR 5C1BA 4DCUA 2JAPA 1UDWA 2ORVA 2YWJA 3NEAA 1HDEA 4Y7DA 3AFGA 1MRNA 3MK31 4J3FA 3UMGA 1CR4A 1D0IA 2QN7A 1XI2A 4NSNA 3TPFA 2XMZA 5DHFA 2J08A 1AXGA 4Z54A 2JIZD 1H8HD 1HQCA 4RBNA 2X76A 2ATXA 4KH0A 4EBBA 1EDDA 1FVHA 1EDEA 3BE8A 3SJUA 1KI8A 3LQFA 3G2HA 4PGGA 4UPEA 1NV9A 2OXRA 2QRVB 1LI5A 2HH9A 1J8MF 3OHPA 3ZBTA 2PSJA 4BQFA 4YUYA 1D04A 1I51A 3G8YA 2FH5B 4DA9A 3L7LA 1AZWA 1WZ2A 3IOBA 1XF9A 2W8BB 1DEKA 1FU4A 4IWNA 3JS5A 5DO9A 5JCXA 2H4WA 3U62A 1FTYA 3NWOA 4JODA 2AW3A 2CMKA 3BFKA 3FW1A 4RS4A 1LPAB 1UXKA 1X80B 4JX8A 1GQ2A 5INTA 5A0TA 2ANBA 1DZIA 5DX8A 2O7SA 1XHEA 4YJDA 3HVIA 2ZSAA 1OI4A 3UNXA 4KRYA 1X0XA 1ZH6A 4RMHA 1A77A 4CEJA 1JQDA 4P5EA 1NUPA 1R4NB 1V2GA 5DBHX 3D5TA 3DP7A 5KOHB 2BM8A 2GNAA 2KB0A 2JHFA 3DDNA 5D5PA 5LB4A 4BCCA 5CB8A 3FZGA 1P7WA 8ADHA 2DY1A 2Q4EA 3QQPA 4LS3A 1MT0A 3DFUA 3PNYA 2C97A 4MEBA 5KQLA 4K6HA 3VGJA 4FFMA 1L3BA 3MPUA 3SQXA 3QFTA 3U4IA 3QVJA 1UBKS 4M60A 3W6ZA 1SBTA 3DT9A 1IQ0A 1BGWA 1J6UA 1IEVA 1M8PA 4MUNA 4W99A 4WW0A 4BB0A 3O91A 4RTPA 3L49A 4ZV7A 4B6SA 1ZOLA 2J31A 1VJ5A 3DOUA 2W6ID 1J0AA 2P9CA 3RYFB 4ZYTA 1WVMA 2YYAA 3V1UA 4NBLA 5EZSA 4CW7A 3ZWYA 1S4MA 3MAJA 4HZGA 4KLNA 4MV5A 5ALFA 1K4MA 3V4VB 4C4TA 1FNBA 4COOA 4UCFA 5KJEA 4BB6A 3BQMB 1YBVA 3PRKE 4EQ6A 1T6XA 1ODTC 1MC4A 3E22B 3AOEA 3FMFA 2ZDQA 1YNSA 1QIDA 1BMFD 5GM1A 5LFAA 1N3LA 3H11A 4XUEA 5DWQA 2B1IA 1RRGA 2NYRA 4D0LB 4C3OB 5EJEA 5JV5A 1S7CA 2I6UA 3U7IA 3RTDA 1MDBA 3VO8A 4JB0A 3UJ3X 4CR7A 5IFKA 2FP4B 3IMGA 5LQRA 4V2IA 4YECA 1MO3A 2H1LA 5HILA 2C94A 5D00A 2QORA 1T4DA 1WJGA 2BR3A 1QHNA 3PWKA 5K0EA 3AR2A 5LCXA 2WV7A 3KQTA 1V9SA 3NC1C 4PYNA 4ZAGA 5EXDA 3DKKA 2I6XA 2Y8EA 3L05A 3UANA 3ULKA 5BSGA 1DAIA 2R48A 3NT2A 1P5JA 3D3QA 3LC1O 3N2ZB 3I01M 3OEHD 4RKYA 4C1NA 3WMXA 3ZXSA 3IOCA 2XMGA 3OKCA 1NZDA 4TUYB 5G4KA 2J0SA 2UYOA 2QLNA 3D7KA 2YJTD 5TSDA 3QEBZ 4BX9A 1DCFA 3QBDA 2ZPTX 4NABA 5FUYA 4K8OA 3NPMA 4D5EA 1RXEA 1O6BA 5HJ5A 4RF5A 2ADMA 4IGIA 3SYNA 2IHJA 3P9CA 1OT3A 3AL3A 5IUKC 3W34A 4A92A 1XEWX 4X3CA 1I6KA 1G8FA 2HU8A 3Q8LA 3WK8A 3CKMA 4J3JA 5G0WA 3WWOA 4FNAA 4E08A 2X3YA 3L06A 3G0DA 3KR1A 3NAZA 4MQEA 2AIRA 4YAOA 2NTYC 5FTJA 5C32A 3ZEAA 5C5EA 4YCBA 3CX3A 1SZCA 5KNBH 3RI3A 1GD1O 4JYMA 5KTPA 1AQ6A 2HXSA 2XAUA 3MTGA 4HFMA 2K6GA 4JEHA 2ZUDA 3OLCX 2VWGA 4QBIA 1H2XA 3TEJA 1E2DA 4EFKA 2GEBA 3LBFA 4GI1A 4EI2A 3GZTB 4KR6A 1V8FA 1JR6A 4XGQA 2AMJA 1XWWA 3DZCA 3KXIA 3HKCA 4TLBA 5LBIA 4EB6B 3HBNA 3QEJA 2G7ZA 4JOCA 1X13A 1XP8A 2P75A 3V97A 4DE5A 1IXRC 1XWIA 2CJYA 2Y92A 3L1UA 5T57A 2GASA 3D1LA 4RLHA 3VHXB 3ZHQA 4WBNA 3EXFB 5H59A 1U2GC 2A9KA 4UUAA 4X5OA 3SQDA 4FMDB 1U7TA 4F96A 1V3TA 1P39A 4YJ2F 4AS1A 1DPGA 4LSWA 4DXHA 1ULHA 3WB9A 4J90A 1E3EA 1KH3A 4HEQA 3PHIA 2WD8A 3IALA 1N9KA 2J4DA 1GFIA 4FX2A 4MARA 1U0OC 3H9UA 3RSHA 4UXIA 3VISA 3CC8A 4E21A 5C8YB 3VOAA 5JJKA 5AJHA 3EGVA 4TWAA 3A36A 5HF6A 4LQLA 1ZNWA 2NZWA 3FYSA 1YR3A 1VIYA 1RPAA 3IBSA 3C97A 4B3GA 3SIXA 1OBCA 2PMDA 3EGEA 3EXAA 3H97A 4ZTUB 3R0QA 3BXOA 1I5EA 3P2YA 4KMRA 1ETHA 1XAHA 2YINC 3RS8A 4CDRA 4EPYA 4A8HA 5LQCA 2IH5A 1G5HA 2ZSIA 4DLUA 3KHKA 3WTBA 2VDJA 4HH3C 4H0NA 1C81A 3C45A 3OEYA 4XVQA 2ZCVA 5EINA 2Q3BA 1H9BA 3EZ6A 1EUQA 4KNYA 2ZVQX 1TJ3A 4ZCLA 3PCTA 3WL4A 1RKUA 2D7JA 2WJHA 2B25A 1N6KA 1KGSA 2C83A 2N3ZA 2Q46A 2E1PA 3WKAA 3ZN2A 3PFFA 5BMVF 1M2VA 1T25A 4J94A 1L5WA 4PSVA 3OE7A 5KVVA 5FH9A 4TYWA 2QMOA 3TKYA 5D3KA 5CEEA 1WHSB 5C1DA 2PPLA 5FLKA 5DFAA 5DI3A 2WT8A 2F9LA 1JIQA 1D2AA 1NKSA 3C3WA 1E60A 1EX1A 1JMYA 1U0FA 2W2PA 4QGSA 2F90A 3AZOA 2A14A 1E1QA 1MEJA 2ZRMA 1O97C 1UF9A 3HB5X 2BAGA 1F4VA 5KYXB 5CX1A 1I3OA 1FNCA 3QI2A 3VPBA 3IEVA 3VA7A 5DHSA 2FRVA 5BQOA 4NMWA 1K5DA 3B1YA 4PAWA 1IY9A 1OW3B 2XOKA 2G0NA 2OV2A 3VPFA 1JL3A 4GD3Q 3GX1A 4WSOA 1EP9A 1L8OA 3G2IA 3S3TA 4UU0A 1W48A 2G1UA 2WRZA 3A6ZA 4MGKR 2VP6A 3PJGA 3GVCA 1KETA 4I50F 3NV9A 4O2RA 3T35A 3C6KA 3JYPA 4FXOA 4IUDS 3W4KA 1MJHA 3W5SA 2W43A 2GEDA 1VHTA 2FW8A 4RFSB 3HA2A 3E9YA 3D6NB 3GPIA 3FPBA 1UP6A 1W4AA 5LYJA 2GPSA 1HKUA 2R1VB 4RHUA 2YFHA 1OYYA 1BHJA 2FW6A 1PT7A 1AZTA 2XT0A 3E53A 3H2YA 1GN8A 3JQQA 4HWSA 4I46A 4X64B 4LYFA 1FNSA 5F76A 1NBIA 1NT4A 1ZK1A 4R4JA 5C4MA 1GDHA 1OBOA 3HUFA 4YCSA 1XYVA 4G9EA 3V00A 5IX8A 3I6YA 1UFOA 3R3XA 1A4RA 1T5BA 3JR7A 2J0QA 2JVIA 4NBTA 4DDKA 2Z83A 2OCLA 4BJHB 4DY4A 1WXXA 2E82A 2YX1A 3DYVA 3ZHUA 4OGWA 1W5EA 4R8SA 2GPBA 3DFMA 4NJEA 2GM5A 4BWFB 1NLMA 1JS1X 3A4VA 3SMVA 4C6TB 1IHYA 3NCHA 3NTQA 1D2HA 5C35A 2PJZA 4G1MB 1ZM4A 1OSNA 2CY0A 5LOVA 4MAFA 3A1DA 3TRJA 4IRMA 2QPLA 1I2BA 1PSWA 3GELA 1EGAA 3BWMA 3OA0A 4YH1A 5LZ5A 5B3LA 5BW5A 1KWGA 3TQIA 1UZLA 4QPDA 1PFWA 4L5CA 4NOMA 3L7CA 3ED5A 4BBPA 4RTLA 2G72A 3TW6A 3PTLA 2ZI6A 3JATB 2OGZA 1U5CA 3HBLA 2HSDA 3N8NA 3ONEA 1U5BA 2EYUA 3R4VA 3QITA 4ITRC 2ENWA 3I58A 2XUFA 5ADVA 1ADFA 4YAJA 4UMEA 1OIVA 5J5AA 4CHGA 3P94A 1T4CA 4IFEA 2AZDA 1FNNA 1YB4A 2JLRA 4M22A 4RM2A 1YOBA 3WSVA 2CT8A 1PR9A 5GVRA 3NYQA 3G02A 3AM1A 2C5FA 5FTNA 2GZ2A 5K1ZA 1CUBA 1ZVMA 2I6QA 3MW8A 4LI3X 2ATCA 2NADA 3VSEA 4ZEWA 1VSVA 3UMBA 3QVUA 4MV1A 5JUWA 3DL7A 1SR8A 1ZJ6A 5EWJA 4E4TA 4KDRA 3ORSA 2AJLI 1JX6A 1MJ5A 2NZ2A 3NVKI 1TEVA 4GF5A 3FCYA 4GOLD 1ORWA 3EXG2 1MAWA 1SC3A 1DO0A 4P36A 2V55B 3QFCA 4RVGA 3W5CA 2PGOA 4C4SA 4DRYA 3ENNA 3G82C 4B44A 4FC6A 1UPBA 4P5PA 3RHZA 4ZGBA 1Z62A 5ISMA 4TLLB 1F2UB 4D9MA 5K8JB 5G0UA 1ZD5A 2QN2A 1Y4UA 2C2XA 5JWRA 2VDMB 4DR4B 2JIOA 3MT8A 5H5JA 3BD9A 4ID9A 4K6OA 4R40A 1NJ1A 3NKLA 4JUDX 4ZCIA 4WT7A 4F6RB 4RVHA 1N4DA 1RAGA 2WIGA 1M0WA 3KXDA 4NNJA 3UJNA 1OXTA 3ZDCA 1FEZA 3A10A 5JHHB 5K4HA 4RYDA 3E81A 1PT6A 4JNKA 4WXPA 4MSUA 2I9PA 4DXAA 4KXQA 4D4LA 1EJBA 2R1ZA 4GWLA 4I3HA 3HR4A 4ZOBA 1ZBDA 3IKTA 4RTMA 2JIBA 3FIJA 3ER8A 1EK2A 3UJ9A 4A5OA 1QX3A 3KEOA 2E48A 3UT5B 2QPAA 1ZK3A 4JOBA 3DDZX 2RFLA 1XNJA 2PGLA 3MLAA 4WIAA 1ZYUA 3M5CA 4JJ8A 2A86A 4FEAA 3BGVA 5MF6A 3IP6A 4BP9A 1K3FA 4BKPA 3EXG1 1V8OA 1TB4A 1UBEA 2CMDA 2IYTA 2R5FA 5BN4A 4TZ0A 4M1TA 3LDHA 4DDTA 1I36A 1O94A 4JP5A 2GF9A 1R88A 1E5LA 1FQWA 4ZVTA 3H2IA 1Z29A 2Z09A 4EW3A 1FQJA 5KVCA 2YHAA 1O95D 3H7AA 1S8FA 4TYYA 1RP1A 3RTGA 3MTAA 4WXMA 3ZLJA 3OZBA 4Q1AA 1A82A 3LT4A 1EWRA 4QKQA 4JI5B 2WIDA 1TFRA 3NVAA 4DXDA 1QMGA 2HK6A 2XGOA 5BN5B 3V1KA 4BZQA 1RYDA 3PXEA 4E5PA 3WKCA 1J07A 4LHYA 4OI2A 1J2JA 2ODBA 2RC6A 2ZGVA 4ROSA 5DLYA 1BWQA 5BSWA 5CB4A 4QUKA 4GLLA 1L4UA 3RHSA 4DLAA 3SAJA 1FLDA 3WGLA 4WKCA 2C59A 3I1IA 1UBTS 3F6BX 1NNSA 2EFDB 2P27A 4JU9A 3GCGA 3ZS8A 1EFTA 1NT2A 4A23A 4CF7A 1RYBA 5LZ2A 2AUMA 2PT6A 3G13A 3NETA 1E3WB 1LA2A 3Q5EA 1GPNA 3ESCA 1ABFA 3ADBA 3DEFA 1LPBB 4PYRA 1S2IA 2N0SA 4X93A 2X41A 4RDIA 4WN9A 1G17A 3ZQKA 1Z35A 2DQKA 3B38A 3MOSA 1Y1KE 3F4BA 2HF7A 5K4GA 1MB4A 1YDWA 2VZ0A 5CRIA 3VX4A 4KIJA 4Z9YA 3ZGOA 4ARAA 5DCYA 1XN1A 5I9BA 4B3FX 2NPIA 3X3HA 1Q21A 4HJXA 1F7VA 1GG8A 4FQ5A 3KSZO 3PI7A 2ZIFA 3RK0A 1BKYA 2GMWA 3EE6A 4RLFA 5FFFA 2BEVB 4ZYUA 3LJKA 1MH9A 4BBJA 5M5BA 2WSBA 3R5TA 1JFFA 5ENVA 4JGGA 1TJPB 1PP4A 4BLUA 5KHOC 4N8DA 5T8KC 2X4IA 3ECSA 1LLQA 1JBQA 2D0IA 5DV9A 1BJKA 1C0IA 4Y7CA 2XYQA 3OE4A 5KOJB 1RKQA 1GYRA 4CKWB 3X2FA 1SQSA 1ZJJA 4JB3A 1ZEMA 2CJWB 2Y9PB 5IBPA 2ZSHA 5BVGA 2NXWA 4GG1A 1IJEA 3NV7A 1KMMA 1NMEA 3ZHVA 2JFXA 1WKCA 3EFOB 4RUKA 1IN4A 1P44A 3KLPX 3P7MA 4G6ZA 4K3UA 1AKVA 1XCGB 1K97A 1ONBA 5CYGA 5G2OA 4XA8A 3S2ZA 1UH5A 5DRYA 5EEGA 4PC3A 5C8ZA 4XVRA 4XR9A 2AQHA 1GLVA 1BA2A 1P8AA 2CLKB 4XDZA 5GQSA 1CDOA 1TTPB 4E22A 2HM7A 5EQTA 1UBNA 4TSFD 4D4GA 1HFWA 1S2DA 3PHJA 4XJSA 2BGWA 2UYQA 3K92A 2GZ3A 1GQOA 4MK4A 3CG4A 1LV7A 3DBLB 2VDRB 1Y9ZA 2CVOA 1FU7A 2XX3A 5JCOA 5BSMA 1R0SA 4P6VF 1JE0A 4BX2A 4DZRA 3WK7A 1TEHA 4MJ3A 4Y9DA 1DRJA 1SIWA 1UPTA 2XMSA 2AGVA 1MV5A 1H8EA 2R86A 3ZWVA 4EHBA 1B43A 3T3DA 5EMNA 5JD6A 4AZVA 2FZ4A 4UEWA 3RC9A 4A8TA 5CFNA 1BDHA 3VV2A 5AW3A 4QD3A 3V4FA 2RGBA 3SQWA 3IAM1 4J7CA 1LPOA 2FUEA 4EKIA 1ENOA 1M54A 2P79A 3UA4A 2R0QC 2YIVX 2DECA 5F73A 4O4JF 1U5AA 3KDPA 1N2CA 4ARZA 4E3ZA 1CS4C 4YAIA 4C07A 1SC4A 1D2GA 4BKMA 1SZPA 3OQIA 2D1RA 2G82A 5FPHA 1VC2A 3PDJA 3D7RA 2VRCD 4JP2A 4YP5A 1W0KA 1GA6A 2C29D 3H8WA 4NG4A 1JBKA 1TQDA 2J67A 3JZAA 4NZPA 3CZCA 4L9AA 1CUDA 2BDTA 1ZAKA 1Y1SA 3UO8B 3EZ2A 2VRWA 3VYTB 3I2YX 4KXXA 2PWBA 3LQQA 4DNXA 2PQ0A 4N7MA 2CDNA 1FP2A 1TVMA 3V48A 3ZE1B 1KO8A 1ZVKA 2OC4A 4Y6OA 4ECEA 2M1ZA 2GPAA 3IJEB 1RZUA 3LX5A 2JIZA 3M9WA 2X9QA 4K6MA 4YEDA 3GLRA 4S2EA 1PU2A 2Q3MA 2ZPUA 1C5KA 2QB5A 4H4EA 5AI6A 3I52A 4X65B 1TZCA 3AOEC 1KI7A 4UAJA 1K1EA 1LY1A 3S55A 4E15A 2X22A 3B1WA 1T36A 3ROGA 4GKKB 1X6VA 4OHZA 1I4WA 1E5XA 2YIMA 3TEFA 3QX7A 3DULA 4LK2A 2GNPA 2CVFA 2Q3EA 4NDNE 2DH6A 2B4TO 5H80A 3WV4A 4MUXA 3ZHXA 5I3CA 1JH8A 4MHTA 4KR3A 1HMPA 1PZGA 1WUYA 1YU9A 1YWGO 2GDJA 2GPWA 3CURA 3D4IA 4WFJA 4WY8A 3WHIA 5AHOA 4YX9A 2VUUA 4IRUB 2QJTA 2Z2XA 2JHAA 3KYJB 3PVCA 1EIWA 5AUOB 1RD4A 1LJ8A 1L7OA 2D54A 4O4LF 1A5BB 4QWWA 4RHTA 4X20B 4BLRA 5IKPA 1PJTA 2ZRLA 2PYZA 2C9CA 1PLLA 4LKRA 5GJBA 1XIVA 2LVBA 1KJNA 1NVVR 3CMCO 5D3MA 5B4TA 4QULA 4M38A 4HTAA 3SDZA 2GKGA 4B7AA 4D4IA 1WOYA 4OYYA 1H2BA 1GGKA 4QDZA 2G40A 4EGSA 4GDMA 1WPGA 1A1SA 1VPWA 4OQYA 5JU6A 2Z6AA 3O1IC 1TKAA 5CA0B 1QXSA 4NCAA 2GEJA 2WAOA 2E0IA 2ZE5A 3L6OO 4HFNA 3K31A 5CFLA 2DCUA 3T1QA 3WSTA 4GXTA 2Q8PA 3DNFA 5CJPA 3R24A 3DTYA 4MGZR 4KE7A 4H17A 2JGLA 4BNKA 3WKDA 3ZD8A 4MULA 5CXUA 1U4OA 1GUZA 5BVHA 3JVEA 1OILA 3GDOA 3QELB 4OQFA 2YHSA 4NE7A 4LGYA 1LQ2A 1E9DA 1R64A 1PGPA 1H1LA 1SKYE 4N8EA 4R3UC 1KYTA 2EEZA 3ZU3A 3VJRA 2OSBA 2PGIA 4JC0A 5IKMA 3PRHA 1N2JA 1USWA 2X2OA 1T3GA 1OFIA 1HE4A 2OGUA 2IEGA 5T3YA 3L1VA 1Q57A 3HBJA 1H5QA 4WASA 2XWSA 3D5EA 4DRXB 3LXUX 4K2AA 5D84A 2ZRCA 3KT3A 1AK1A 1IN5A 1VRWA 1AN0A 2ZROA 3N0WA 3LTNC 3HWRA 3LM8A 4BO4A 3OESA 4ZCTA 1Y5RA 4G1UC 1JSZA 4R5MA 3DOFA 5A04A 5B7QA 1V5EA 1Y1LA 5KCZA 3KVYA 2BOVA 1P0CA 2P40A 3FIUA 4AZSA 5K0NA 3A9WA 4ZALA 3KYIB 4AWAA 1G42A 2ID9A 1Y1TA 2KE5A 1E8DA 2IKSA 4OP1A 4RQBA 5C4GB 2I2BA 4NX2A 4WLOA 8ATCA 1JLLB 4Y1GA 1QVZA 3EIQA 2Y93A 4F91B 4ALLA 4B7ZA 1IHDA 1PV2A 1WKVA 2P9HA 4FCTA 4CKEA 1NFRA 4JJGA 3E3AA 4UU8A 4M4SA 3TNDA 2HYIC 2VAMA 1KXZA 4RJLA 5KJFA 4BKQA 1R4ZA 5CB4F 1JHQA 1LNSA 5I45A 3K2IA 3FB1A 3JQ9A 1RLMA 1KPHA 3UXEA 2HDWA 1JIXA 2Z6QA 5JC1A 4BFCA 3RRZA 1R0CA 4NE9A 3PCRB 1NN1A 1ZK0A 1I4OA 1UDBA 4EA7A 2W37A 2Q29A 4KN5A 5KYUA 2QX4A 4TQGA 5FP0A 4H08A 5KNCH 3WK9A 3WKBA 1SXHA 3LAWA 4MPDA 1TCAA 4TQUS 4DW8A 4J2HA 1QG2A 4MTCA 4Y2JA 3BZBA 1Z16A 1M33A 5FT9A 2QENA 3EWIA 2QQ5A 2XQJA 3DT6A 3NEYA 4MWGA 4TXJA 1B4DA 3KSBC 3D6HA 4YAFA 2AC2A 5DK6A 2JATA 3P5SA 2ET6A 3IYLW 4FYKA 1C4XA 2I7DA 1I7QB 1ZC4A 3FWZA 4ROTA 1GCAA 2VYND 3CLRC 3DTVB 4B47A 4JYZA 1RWOA 1TK9A 3T5MA 5DP2A 3OTQA 3VYUB 3BERA 3ZCXA 4B3IA 3LUJA 3K1JA 4TV8A 1V0JA 2EHJA 4C4AA 2PA0A 4ND8A 3W4IA 4PZ0A 3R0VA 3RGGA 1WXWA 4JP3A 3USCS 2CDCA 1F4LA 2SICE 1U0JA 4KUHA 1V8PA 1WL8A 1XZLA 3MTEA 2HX1A 3L7BA 4YRFA 1Y89A 5BNFA 2BE7A 1LH0A 3CX4A 3OLZA 2CBXA 4UASA 4IH9A 4B32A 2IXDA 5JTUA 2C0QA 5B2FA 4TZ6A 1MIOB 3TJMA 1ZP6A 1DAEA 4RQAA 3S0JA 3BT7A 3QFFA 1ULZA 2HQOA 3CCCA 4BUCA 3PJFA 4YWJA 1QC5A 1OHHA 5FOTA 2XKBA 4A0QA 1JEYB 5LP6C 3WICA 3BF8A 1H4QA 1H6AA 1U02A 4GLOA 1HL7A 1VSTA 1YC5A 3CVOA 2IYYA 2H7VA 4KVAA 1OXKB 2EZ4A 3CUYA 2OY0A 4PGMA 1GTMA 1M7GA 4Y6LA 5FI1B 2QX6A 3SC2A 2I3BA 3HJUA 3EY4A 4NIMA 2QAJA 2FRDC 2QUIA 1Q7RA 2X5JO 3D6UA 3GJ8A 4W9NC 2GESA 2JBAA 3H4MA 4PHCA 1H2WA 3C3DA 4BDTA 4Z7NB 4W5NA 2B8TA 1WG8A 3FNIA 3ZD7A 4JZKA 2QM8A 4KLAA 1DS6A 2HFKA 3IT2A 4QVIA 3RAGA 3LKZA 4LJ6A 1RTKA 1CYDA 5JSFA 2O20A 3P0EA 1UADA 1URPA 5JZVA 2XUDA 1FTWA 5J40A 3HZOA 2CLEB 3NIWA 4ZIRA 5B3KA 1RR6A 4EHHA 2CL5A 5EP3A 2HSWA 1Z37A 4URVR 4CKCB 4RPKA 3HHEA 4G07A 4LSGA 2X8AA 2R7MA 4FKMA 1GO2A 1N6LA 3G9ZA 3HU5A 2OFXA 5HG0A 1ABEA 4HGZA 5TJ9A 3MLEA 4JJFA 2YV4A 2OPHA 2I2WA 1EGVB 3UW3A 3FLBA 3QG1A 2ZITA 4J07A 3UC5A 1E6UA 1T4GA 2B30A 3PF9A 2QMQA 4KQ2A 6AT1A 5JHGB 3IESA 4DM3A 1C0EA 3AFIA 1ZN2A 3VAAA 4XAQA 2CV1A 1KVRA 1NOKA 3BMCA 1PR3A 4NCXA 2IS4A 5FV7A 3AEKA 1FBNA 2PX4A 3HV0A 1KEUA 1BC5A 4FBMA 2C5LA 4AJEA 4EDFA 5I51A 1N25A 1XTSA 2QIOA 3W3AA 1RM3A 4JL5A 1M34E 3VU1A 2XB9A 2IPNA 2XDWA 4LISA 1YACA 3GFFA 4Y2HA 1TAQA 1HDGO 2IHUA 2IP4A 4FILA 2BI4A 2Q4BA 5ED0A 2UDPA 5LOVF 3UT0A 5IKOA 3A9TA 3KWFA 3X2EA 2PG3A 5BV2P 5KYWA 4NE2A 2QAIA 4UM9B 1CB0A 4KXLA 3IEMA 1M7BA 1G63A 2D1FA 4RIIA 2GN6A 4J3NA 3R7WA 4GS5A 3EEIA 3OIDA 3QU9A 2D3WA 1P3JA 4WBNB 4JBYA 5DVZA 2UYHA 2QU7A 2IBTA 4IHJA 1WZCA 4PZYA 1XZIA 1RQXA 1SELA 2VH1A 4KG7A 4QU0A 3LA8A 3O2QB 4ODIA 3W8EA 1V95A 1G0NA 1Q7CA 2Q0QA 3I4LA 4PIMA 2CZQA 4LOAA 4MI6A 4MITA 3NOQA 1GXSB 3LQ2A 3TPCA 4GYKA 4QUDA 4CNQA 2Z3WA 2PRIA 3O4RA 1M0EA 5J1TB 1W7AA 3QV2A 3SHFA 1JILA 2EGGA 4EKGA 3KIPA 3OZFA 4UM8B 4M87A 2GCOA 3SNHA 5ELXA 4F4DA 2FPGA 3CIFA 3WJ7A 4EHNA 3HHPA 3N1UA 1X7XB 4BN4A 3NBZC 4DMUB 7REQB 4ER5A 4XOIA 2MIIA 3BEDA 4ESEA 5AQ1A 4CEHA 3INTA 4Y2GA 4JKOA 1YC2A 4GM0A 1WP9A 2E6KA 1LBHA 4OQDA 2B5VA 2XHZA 2CSXA 1B14A 2LCFA 2H1FA 5FO0A 2WG0A 2XDQB 4QOEA 3UAZA 3M6WA 2EW8A 3OUUA 2C82A 4JENA 9MHTA 2EFGA 4OYHA 1H6BA 1G4AE 2K87A 2NTVA 1WF3A 221PA 2VWQA 1V9CA 3E9MA 2EJTA 3EQ9A 1Z22A 4DGQA 3RE1A 2HLNA 2QTGA 1TJYA 1C1DA 3B36A 4LRUA 2PFSA 4JXJA 3MELA 4YGYA 3R9WA 3B9RA 3H4TA 1TUIA 3QLVA 4G86A 3UIEA 4CTOA 4JBNA 4MTLA 1A7AA 4UHFA 3AVWA 1UBOS 1CUHA 1I24A 2I54A 3T6KA 4C0BA 1F9EA 5JDCC 2RSLA 1Z4KA 4G5FA 1MC1A 4W8HA 3G88A 3ZV5A 4DPKA 2H0RA 3IQWA 1Z38A 5ICMA 4E2YA 4WBXC 4BJ3A 3ODGA 4U2BA 1T8WA 1ISJA 2ZLBA 4HO1X 3WRYC 4FI3F 3FWHA 3U6KA 4TSKA 1H69A 5HCUA 2C9YA 4R5HA 1PW5A 5EUMA 1E4YA 2RHWA 4D9BA 1DLIA 1NNLA 4I1UA 3TLZA 2AKAB 2ZT6A 2RKWA 5JVDA 4I19A 2DM6A 3HCOA 3TW0A 1CEQA 2X5XA 4F12A 4NFLA 3HN7A 1EBFA 3DVAB 1GGEA 3PXGA 4BP1A 2OMEA 5LOVB 5EWLB 3ICCA 4MOWA 1XKTA 4K26A 5IBQA 4ZVRA 2F67A 3PU6A 4E5NA 3AKZA 4TTAA 1YZTA 2EX1A 3SE7A 4NOJA 2OK8A 4KFTA 4XUCA 2VTBB 3DONA 3SQMA 4LHSA 4DQUA 3CF2A 2NSLA 3IAUA 2ONZA 1Z6ZA 2H17A 3CFYA 5DHRA 3TTWA 4GICA 1SHKA 3EQ7A 1B76A 3AU8A 3K4PA 5CM8B 5E3JA 1QGUB 3OEEA 1WBJB 4JK3A 5IAAA 2AT1A 3M49A 4JA2A 5JYEA 1UZNA 1NVMB 1Q77A 2DBRA 1JFLA 1F3LA 5GONB 1GKUB 1KBOA 2BKAA 1UFQA 4YFYA 3EJ6A 4FW9A 1QLWA 1W49A 3OZDA 4PX5A 4Y9UA 3CINA 3DE7X 3DUFB 3FTDA 4YB8A 3O4GA 1PJCA 2GRAA 4N7BA 4XRRA 4CL0A 4C7MA 3M70A 1CERA 3HXLA 4LMBA 2PZLA 3K35A 3I5AA 1JPVA 1T29A 3I6BA 4PC6A 2XJ9A 2GN8A 4C43A 1C9YA 2I67A 2IEDA 4U7HA 4D4KA 5C7YA 4OAOA 2IHNA 3ICEA 2NGRA 1K7YA 1V47A 1Z13A 4YLEA 2CXQA 2W8BA 1JEJA 3LVQE 4DCVA 4M0MA 1Z5VA 2C20A 2E6UX 1LI4A 3IQEA 3GDWA 1INLA 3AHDA 4HRVA 1CS0A 1XRSB 1GPH1 2B6NA 5AVWA 4FE3A 4DV6B 3VKFA 1FP1D 3RJTA 3MTJA 2G5CA 5KPDA 3RVKA 3EF1A 3R77A 1L4HA 3REQB 4CG2A 2GPTA 1QV9A 2EVWX 1M2HA 3FPGA 3FPKA 4L02A 3UAOA 3V34A 1B41A 1JHZA 1UQTA 2WDPA 4WZBB 3JQGB 2WQ7A 4PQFA 1XROA 2C96A 3KO8A 3QHAA 4IXMA 4UNNA 1TIPA 2Y0DA 4EA8A 1YA8A 3HADA 3L4JA 4YP6A 1AU9A 1G5QA 2IHVA 1H4TA 4L85A 2ZXUA 4A91A 4BNLA 1D5WA 3PQ4A 1YOVA 4OB6A 2OYRA 3LC2O 5CH5A 5H1YA 2Q5JA 3W1EA 4E09A 1WHSA 5J4VA 4UAGA 1QZXA 1O5IA 1JA1A 3O21A 1MOSA 2IXBA 4HJRA 1A8PA 3FA2A 1WW3A 2IXAA 1E1QD 3P4XA 4Z9XA 1CJTC 4RPGA 2XYPA 4O33A 3RNOA 3FOZA 4IYJA 2VAPA 5M2QA 1DTWB 4V0NA 5AJYA 5FCDA 5J9FA 2OQRA 3E2IA 4RU1A 4FIDA 5JYCA 1WDWB 3KDAA 3GDHA 3RR2A 4EUEA 5FRDA 4ND7A 2J5KA 1FYEA 3DF9A 3H6HA 4CQJA 2WU0A 4OJMX 3N2KB 1Z0DA 1IN8A 2XSZA 4NENA 4O4HB 4XJVA 4B3DA 2X8WA 2PEZA 3N70A 2G1AA 1XD2A 3DKPA 4F3TA 2PFKA 3E3OA 2ZRJA 3H1PA 4MKXA 1CUJA 3SKXA 1W94A 5BR1A 5BWBA 10MHA 4UCQA 3BOSA 3GLHE 1QNLA 4L9WA 3OFSA 3LH5A 1W46A 1ZNXA 4O4IA 3RSFA 2ZSDA 3LQRA 2B37A 1DT3A 3U4DA 3P2KA 5AXCA 3EFBA 2B35A 1GQSA 1N7GA 2LP4Y 2O7VA 2Q62A 3FCEA 5C7OO 4CM9A 3WQRA 1T2FA 3G1WA 3BXGA 3RS3A