1JSZA

Crystal structure analysis of n7,9-dimethylguanine-vp39 complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
297
structure length
291
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESANEVAKKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVRSPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The "cap-binding slot" of an mRNA cap-binding protein: quantitative effects of aromatic side chain choice in the double-stacking sandwich with cap.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Transferase
molecule keywords VP39
total genus 102
structure length 291
sequence length 297
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2001-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1jszA00
3FPFA 2UZ4A 3SM3A 1I4WA 4KDRA 1BHJA 2ZBPA 3DMGA 2FYTA 2JHCA 4U7TB 3KR0A 1JSXA 2EJUA 3E7PA 5FTWA 3UJCA 2I6GA 1SUSA 2PX8A 1H1DA 3HVKA 4YMHA 4GQBA 3KHKA 1JSZA 3M6WA 4KVZA 4ER5A 3HVJA 2H00A 3DXZA 3K6RA 3LBYA 5E1DA 4E70A 3HVHA 5LSAA 5GM2A 1V39A 3CC8A 4AZWA 4P7FA 3GU3A 8MHTA 4KIGA 5DX8A 2YR0A 3H2BA 1QYRA 3EVDA 3UJ7A 3ID6C 2ZBQA 5FA8A 1R00A 4DM3A 5HIJA 4RWZA 4YV0A 2PLWA 5DSXA 1NV9A 1X19A 4DZRA 2PT6A 3DMHA 4PCLA 4YV2A 1D2CA 5FWAA 2FK8A 1PJZA 4GOLD 3BWCA 1L9KA 3G89A 4QQNA 3IHTA 4OA5A 5D1HA 5ICEA 1RJDA 2AOUA 2ZW9A 4GBED 1HNNA 5HIMA 4RTMA 5K01A 4GOMD 3BXOA 3B5IA 5K0BA 2R6ZA 1JG4A 3TMAA 5EOVA 1DUSA 2OZVA 3LCCA 4XUEA 2PX2A 3EVCA 3OU2A 3A27A 3MCZA 5EC8A 4OBWA 5FULA 2VDWA 5HFJA 5HILA 4ER6A 5K8VA 3I58A 4KWCA 1YZ3A 3UFBA 2CMGA 1EG2A 4C08A 2IIPA 3KPYA 4F85A 1F38A 3EVZA 3GJYA 1RI4A 3FUUA 4HRAA 3PB3A 1YF3A 2ZSUA 2ADMA 4GOOD 1SUIA 3L8DA 5P8WA 4CWAA 1XXLA 2AOWA 2PBFA 3FTEA 5GOZA 2AN5A 4RSRA 5EVJA 3OZTA 3BGIA 2ZWVA 1HMYA 4RVHA 4AZTA 3JWHA 4HTFA 3CJTA 1R18A 5E9QA 4PYNA 5EHIA 5E8JA 3JWGA 1R8YA 3TOSA 3DMFA 3LSTA 4X41A 2HR1A 1JTEA 4ZTBA 3MAGA 3AXTA 3BUSA 3G5LA 3OZSA 2GS9A 3KPJA 3UJDA 2UYQA 5FHRA 5KQRA 4NECA 3HTXA 5DXJA 5ICGA 4GUAA 3LGAA 3CJRA 4P58A 3AWIA 4G56A 3MB5A 3PS9A 4GF5A 5CVUA 3BGDA 5K0LA 4RVDA 1QANA 5IH3A 1JQDA 4ER0A 2PJDA 4LWPA 4F84A 3CKKA 1XVAA 4FP9A 4PCAA 4YUVA 1KXZA 3FUXA 1NW6A 5KQSA 2O0LA 1NW5A 1G8SA 4QTTB 3UBTA 3BT7A 5BW4A 1O9GA 2G71A 4PONA 4HG2A 4R8SA 5GIPE 1KR5A 3P9KA 3O31A 3I9FA 3EVGA 3MERA 4PIMA 1Q0SA 1YB2A 4Y30A 3TFWA 5GIOE 3CCFA 3SR4A 2OKCA 3LBFA 5EMMA 2XYQA 3DP7A 2AN4A 2G1PA 3FPEA 3R0QA 4KIFA 1BKYA 4RVGA 3IEIA 2IFTA 5F2OA 2WK1A 2XVMA 1PRYA 4R8RA 5DSTA 1ZG3A 2FK7A 4UOEA 1UFKA 1EIZA 4EVIA 5K0EA 3B3FA 3OCJA 5EZSA 2BZGA 1TW3A 3F4KA 1SG9A 3P2EA 1RI5A 4AZVA 3LCUA 3P97A 2ONYA 1NW7A 2OYRA 3SVZA 1AQIA 3VC1A 5CCBA 3SMQA 1XDSA 5HIIA 2DPMA 5LR6A 1P91A 4FGZA 2FRXA 4C03A 1UIRA 3EVEA 5BP7A 3PT9A 4IV0A 2OB1A 2CL5A 2PSSA 2C7PA 5JR3A 1KPHA 5H02A 1BC5A 4RV9A 3C6MA 3E23A 3HCBA 2PV0A 3HEMA 1RJGA 3P71T 3PFHA 4MQ4A 4X63A 5EZQA 1N7JA 5DTQA 1QZZA 2WA2A 2I7CA 2LD4A 3EGIA 4E2YA 3HCAA 3OFKA 3PVCA 4DA4A 5DM1A 1NKVA 1EJ0A 1XDZA 1RI2A 3GNLA 3O7WA 2NXJA 5C9ZA 1UWVA 5LQCA 3GRUA 4PYIA 2IDJA 4LG1A 5F2KA 1XDUA 3KQWA 2HWKA 5HZMA 1P1BA 3CVOA 1NW8A 4WXHA 5LQJA 2UYCA 3FUTA 3ERCA 1IY9A 1SQGA 3NVKI 3GRZA 4E33A 5BXYA 3LX6A 4L7VA 1VQ1A 2IBTA 1WZNA 3THRA 4PIPA 2V7EA 3NDIA 2ZFUA 4CXMA 4E2ZA 4EKGA 5CD1A 3P9NA 4RTKA 4QDJA 4ISCA 4QVGA 5DX0A 5FADA 3LCVB 2ERCA 3LKDA 3O4FA 4FSXA 5EIFA 5EKXA 3G8BA 2ZCJA 2XYVA 3E8SA 2GA9A 3RIEA 4DKJA 1KPGA 2YXDA 3G8AA 4PYLA 2FCAA 2BM8A 2IDKA 3K0BA 1Z3CA 3MTEA 2P3QA 4FR0A 3DLIA 3FUVA 3R3HA 3C0KA 4POOA 1FJXA 3KQYA 4FZVA 3P9CA 2B78A 2ZZKA 2B3TA 3G88A 3D2LA 3TQSA 1R8XA 4KDCA 3OU7A 4P7JA 3NVMB 5ICCA 2YUIA 3BWBA 1X1DA 1VIDA 3BKWA 3HA5A 2IGTA 1N7IA 5E1MA 3LL7A 4A6DA 5FCDA 2JHAA 2P40A 5G02A 3ORHA 3A7EA 4DF3A 4YUXA 5DTMA 3BGVA 4CTKA 2P3OA 3A4TA 1YFJA 2GLUA 2IBSA 2Z6QA 4HH4A 4M36A 3HA7A 4PWYA 5CUQA 4E2XA 2ONZA 2Y1WA 1L3IA 2P41A 2IP2A 3EGVA 3LDFA 3REOA 1NBHA 2B2CA 3I53A 1TW2A 2OXTA 5K05A 2Z6AA 3EVAA 1NE2A 4R6WA 5CVDA 3M4XA 3PX3A 3VSEA 3THSA 1U2ZA 3Q7EA 1VL5A 2PX4A 2CKDA 3IV6A 3FTFA 4ATNA 3DLCA 3BZBA 3G7UA 2VDVE 3B3GA 4X61A 4DMGA 3KQOA 5CVJA 5DRTA 3S68A 3E05A 4GEKA 4CKCA 2XBMA 3KPVA 5EMJA 1DL5A 1ORIA 3ELYA 2VZ9A 2AVNA 3G2OA 1FP2A 2QRVA 3MCTA 2PKWA 3UJBA 2PY6A 5FWDA 4DQ0A 1YFLA 3CJQA 3R6TA 3SSOA 3FYCA 2F8LA 5DX1A 3T7TA 3BKXA 3UZUA 3TKAA 4RTLA 2Y1XA 7MHTA 2EX4A 2PGXA 5DPMA 4BP3A 3AY0A 2BM9A 5LQNA 3MGGA 4QVKA 1IXKA 4M37A 1ZQ9A 3TM5A 2C7OA 1XCLA 2N47A 4OX9Y 1RJFA 4QPNA 3X0DA 4YUWA 1AV6A 3KQVA 4RTSA 5FQOA 2PX5A 1NW3A 3FPHA 2IH4A 2ZIFA 4C06A 2HTEA 3KKZA 2AOXA 3ER9A 2I9KA 2OBFA 4OQEA 4AX8A 2YTZA 1ZGAA 3SGLA 4CKBA 4KRGA 5T64A 5B1SA 3HVIA 3KQTA 2PXCA 2B9EA 3G2QA 5E9WA 1QAQA 2P1DA 3A25A 1NT2A 2H11A 3GWZA 5GWXA 2JH8A 3KQPA 1R6AA 2CMHA 3AJDA 4YV1A 3R9XB 4X60A 2H1RA 3G5TA 3HP7A 3KPUA 2IPXA 4PYKA 4V0RA 2O06A 4PGGA 5C0OE 3BWYA 2NXCA 5DM2A 2P35A 4EK9A 4BP1A 3A26A 2EG5A 2A14A 3QOXA 4E2WA 4MIKA 5EQJB 4CTJA 3M33A 3NW9A 4R05A 2AOTA 5E9JA 5GINE 2NP7A 4C07A 4GC5A 1SKMA 3FTDA 3HM2A 1O54A 3EPPA 2HV9A 4HC4A 5E2BA 3DULA 2YQZA 3TM4A 4PYJA 4MWZA 1DCTA 4PYQA 2C7RA 1M6EX 5F2NA 3SSNA 2HMYB 4Z2YA 1X1BA 2GPYA 1NBIA 1TPYA 3ELDA 1NV8A 3TKYA 4RVFA 5EMLA 4EQZA 4RTQA 1FP1D 2NXNA 1EAMA 2JJQA 4PYOA 1MJFA 1JG1A 1O9HA 2QY6A 4PGHA 3KQQA 5GM1A 3A7DA 5E2AA 2Z6UA 3WSTA 3KU1A 5EG5A 2NXEA 3DH0A 3C6KA 2ZBRA 3GRYA 2ZVJA 2IH5A 4F86A 3HNRA 3P8ZA 5DT2A 3R24A 3V8VA 3FUWA 3LPMA 2G8NA 1IM8A 2NYUA 5EEGA 3UJ6A 4IV8A 1ZGJA 1QAMA 1QAOA 3I5UA 3JWIA 4FSDA 5EHGA 5ICFA 5C1IA 2AOVA 4C4AA 3LDUA 5JUWA 4WVLA 2VDUE 3LKZA 2QM3A 3KR9A 2ZULA 4P7GA 4IKPA 3VYWA 3EEYA 3T7RA 4AUKA 3OE4A 4PINA 2PVCA 3KPWA 4GC9A 3SSMA 3PX2A 1M6YA 2ZWAA 1MHTA 3AXSA 3P9IA 2FPOA 5E1OA 1JQEA 3MHTA 2P8JA 3C3YA 4RYLA 3RW9A 2AVDA 1T43A 2PWYA 5CVVA 3KQSA 4FS8A 2BR5A 5DWQA 2ZZMA 1BOOA 3M70A 1VBFA 2DULA 5ERGB 1F3LA 4AZSA 3CGGA 2OY0A 4MHTA 3UA3A 4MTLA 1RJEA 2OB2A 4DCGA 4LECA 1XCJA 1P1CA 3LHDA 5HOQA 4QTUB 5MHTA 2XYRA 1L3BA 4ER7A 5EGSA 2ZTHA 5DRYA 5EKUA 3UJAA 4BY9E 5CVEA 4X1OA 2XVAA 3GCZA 4E30A 3P2IA 5DXAA 4RTPA 5GP1A 3NWBA 4YUYA 3EEOA 3HCDA 4XCXA 4XUDA 2VP3A 3GRRA 3SXJA 3TLJA 2BH2A 2O05A 4ER3A 3FTCA 5HIKA 1INLA 1X1AA 3CBGA 3QV2A 3TPZA 2BR4A 2YXLA 4QPPA 4C04A 2AN3A 2NP6A 1ZKDA 4QQKA 4XUCA 3U81A 3NDJA 4PYMA 2QRVB 3DXXA 4A6EA 5M5BA 1JR4A 4KW7A 4EMSA 2AOTB 5DM0A 4FT4A 3QOWA 1SVUA 1VPTA 2O57A 4RX1A 5KVAA 2GB4A 3FRIA 3B3JA 3M6VA 9MHTA 1N2XA 2E5WA 5FQNA 4M38A 2JHPA 4LWOA 5HEKA 2JH9A 2AZTA 5E8RA 3NWEA 2O07A 3DR5A 3OZRA 2ZZNA 1FPQA 2GH1A 3UA4A 3HCCA 3KR1A 5D1NA 4K6MA 1XJ5A 3GRVA 1G8AA 4RTRA 1G60A 2AR0A 5U4XA 3EGEA 5KYGA 1RI3A 1AQJA 3ER8A 1R74A 5BW5A 5K0NA 3ME5A 5DLYA 1OR8A 2ESRA 1D2HA 1KHHA 1XTPA 2ZIGA 3FPGA 3NTVA 3HA3A 1KYWA 4RTNA 3SX0A 4E31A 1G55A 2FHPA 1ORHA 4CKEA 2B25A 5DM4A 1I9GA 5K09A 2C7QA 5CIYA 5IKMA 1Q0TA 3TR6A 2AS0A 4GOND 5T67A 4B17A 4O29A 5K0GA 1WXXA 2EFJA 4YMGA 2OPBA 2HNKA 2PT9A 2GAFA 4OA8A 1AF7A 2G72A 3DTNA 3LECA 2ZIEA 5LQKA 1VE3A 3ELWA 2Q41A 3LDGA 4R6XA 1SQFA 2V74B 4YUZA 1YUBA 3GO4A 4EKIA 5LQUA 3PLAE 3V97A 1WS6A 1JG3A 1M0EA 1X1CA 2VS1A 4OBXA 4Y2HA 2OO3A 1ZHFA 1EJ6A 3HCFA 3JWJA 4HTFB 1JTFA 3EVFA 3FYDA 5EEHA 5E1BA 1WY7A 3M6UA 4H0NA 3PFGA 5EMKA 5FUBA 5K0FA 2YXEA 4HGYA 1D2GA 4QDKA 4E32A 3GIWA 1KPIA 2AOUB 3B7PA 5K0JA 4RTOA 1YZHA 5CM2Z 3MQ2A 3I64A 5CCXA 1P39A 1KYZA 4FT2A 2IH2A 3FRHA 3FZGA 3GGDA 2QE6A 1WXWA 2QYOA 3IYLW 3KR2A 4U7PB 3RODA 3UJ9A 2P7HA 3P2KA 4IWNA 2EJTA 1KIAA 2G70A 3DOUA 3OE5A 1JG2A 4JXJA 4RTJA 1VP3A 1B42A 3DUWA 2K4MA 5DTRA 5LQRA 5KS2A 3VC2A 3GDHA 4PNEA 2UYHA 3HCEA 1RI1A 3G2MA 4BLWA 10MHA 2P3LA 2I62A 2KW5A 3Q87B 3DXYA 1WG8A 1Y8CA 2R3SA 2UYOA 3ANXA 1VP9A 5T6BA 3OU6A 2JG3A 4OQDA 3OPNA 4BLUA 5LQAA 2WA1A 5FHQA 4HGZA 2CWWA 4P7KA 3OFJA 3T0IA 1L1EA 3B89A 1KP9A 3FPJA 5EIWA 5FA5A 1VLMA 2ORED 3TRKA 3PTAA 3T7SA 4DCMA 2PXXA 3UJ8A 2NNWB 4M7RA 3C3PA 4C05A 1JQ3A 3BWMA 2YVLA 4BLVA 3EMDA 5K03A 3G2PA 1EQAA 3GXOA 4HSGA 3NJRA 3ELUA 2P7IA 3UWPA 4V0QA 3KQMA 1L3CA 1FBNA 2PXAA 2ZLBA 3EVBA 3M6XA 2PWPA 3MTIA 3EMBA 2BR3A 3NMUF 5K0CA 1I1NA 2YX1A 1G38A 5EPEA 1G6Q1
chains in the Genus database with same CATH superfamily
3L92A 4TXLA 3KS9A 4MQFB 2A58A 3EDOA 5D3MB 1VGRA 3B51X 1E2BA 1SEVA 3NBFA 2X5NA 4YWJA 3WP0A 3L0SA 1JDUA 1QQ5A 3PDIB 4AWXA 1H1DA 1R16A 4U63A 4XDHA 2RK3A 4C0HA 3Q7RA 1JSZA 4GYWA 3EEIA 4R7GA 5CX4A 2VJBA 3R3YA 5CLGA 2XOXA 3QYJA 2Y4NA 1UWKA 1FQJA 4Q1VA 5L3QB 2ZB7A 1U3UA 1QS0B 1Z07A 1IPFA 2H2WA 2P9QA 3CF0A 4MQEA 3SQWA 2YJZA 2DECA 1TCAA 1RT9A 1RLIA 5JG7A 1Z2NX 4HZUB 3WHIA 1U5AA 2DLNA 2QTWB 2YWRA 3C3WA 3Q0IA 4WCFC 5T4FA 3DMHA 1WHTB 1DC7A 1ZOPA 2ZG6A 4RSHA 1Q2XA 1GZSA 2YJ5A 3IQFA 3ND8A 4HB3A 2FMHA 3GJ8A 3HR8A 3D8SA 5SZHB 3KQHA 4ZICA 1R9JA 3TGPA 2AR7A 3CN9A 1PQWA 1THZA 2Q27A 3RC9A 1JG4A 4ZEVA 2FQQA 5F77A 3DWEX 1ZISA 2EDAA 4U6QA 3CSSA 1N0WA 2H8KA 3R6WA 2R4QA 3O8LA 1H05A 2C3UA 2QUHA 3HMKA 3QBJA 4G0XA 4KSBA 4O4LA 1KQNA 3RUCA 3T3PB 1EWTA 4C87A 4MVYA 3A32A 2HJWA 2PBZA 1KK1A 2NV2B 3S40A 3T7KA 4LNHA 4JITA 4ZK6A 1TUEA 2WJYA 1R4NA 3BK1A 2IIPA 2BD0A 4MWGA 3ZHRA 4ARZB 2C2MA 5HPYB 2MOKA 3R09A 4EJ0A 1M34A 1I2MA 1Z39A 1OYOA 3T1YB 2PLNA 1H65A 4D3DA 5EHNA 4FNGA 4CR6A 3E9CA 2BKUA 2IYAA 4IY1A 4O2AB 3TH5A 2I6FA 3KVNA 2QG4A 4I6JA 1JFTA 4RZSA 1VCIA 4PYNA 3IH5A 3NXSA 3E03A 1SIOA 4GI2A 2A86A 5HR5A 3KWMA 3R41A 2IDZA 1O6BA 3NETA 3O84A 3NC4A 3IMGA 5IEJA 3LOQA 2YKGA 4H59A 4UHKA 4QHTA 1YBMA 1JR3A 3RVBA 3CJRA 1JB9A 1XYYA 1X70A 1YO6A 2CLKB 4LRWA 1YQWA 2AXPA 1ULHA 3KLNA 1IBRA 3WX0A 5LXTB 4C2BA 2A0YA 4ZGBA 3NEJA 1XHFA 4GSYA 4JASB 4MRVA 4CT4B 2A1TR 2OKGA 1P5ZB 4GP6A 1KZYC 2A35A 4V0ME 4I1UA 1SXJD 1VL6A 2NGRA 2ZIXA 1QC5A 1S8NA 1WU7A 2N75A 4MRMB 3TL3A 3UPDA 5GIOE 2O59A 1FUEA 3DAOA 1EUQA 2OKCA 4ZO4A 2X9GA 2GYWA 3HLKA 4LV6A 3ZGVA 4YN3A 2H52A 2R86A 3T1QA 3E3AA 5JBQA 1K6XA 2QRZA 2Y1FA 1HZZA 1ZRNA 2BELA 2IFTA 4PPGA 4Q4HA 1QH0A 3F67A 3K5HA 1HG1A 1JR3E 3RFUA 4KQIA 2ZI6A 2JJ2A 4W1PA 4PLZA 4YRIA 5JBIA 5J4VA 2XUKA 3A1FA 1T26A 2IHZA 3KSAC 3GA0A 13PKA 4HSEA 4PGMA 2FGKA 4WDQA 1LSJA 4E5YA 3H3JA 2BTQB 2QLNA 4D79A 5I45A 2DHQA 4CPDA 2WKQA 3U9SA 3THWA 2O2DA 3C7CB 4FGZA 4JMLA 2FETA 1EK1A 1UPTA 2XY4A 3B8HA 4G1FA 4EG8A 1KPHA 1P0PA 1JEAA 1YASA 1E1KA 1PFYA 3E23A 2X6TA 3D5EA 4GI7A 5AMXA 2C97A 5LIPA 1BMFA 4TMWA 2X6QA 3OZIA 1CTQA 3FJOA 1L7OA 4DA4A 1W5AA 2WT8A 1Q3TA 2BFCB 3B6JA 3ECSA 4IIJB 4ZDWA 5F12A 1UWVA 1ZAYA 3KSDO 1KEPA 5A05A 3L4EA 1J0CA 5F2KA 4K87A 5D7NA 3SNKA 1OVMA 1FNMA 3U7EB 1DIOB 2BE7A 3RBXA 4NESA 5DK6A 1DEKA 1ENPA 1GPMA 2A33A 1JT9A 2Z0MA 4W9NC 4F8JA 9LDTA 1PR2A 4PX3A 5H3LA 1A5SB 1SKQA 3ETCA 4HBGA 2W37A 1Y7IA 3ZDXB 1U7UA 4UM9B 3VU8A 5I4CA 2GJ9A 3C1OA 5JJCA 1HV8A 4HDRB 3R0XA 1GFIA 3P9QA 1H0RA 1AUOA 1LF0A 2GWHA 1C8LA 1YI1A 4MKGA 2FCAA 1G2IA 5ALHA 1VA4A 1Y3IA 1W9HA 1ZJYA 2C0PA 1QUEA 2I5PO 5J59A 4BC0A 4PZPA 5EIAA 4BZPA 1AHHA 1ACJA 2J7KA 5GONB 5H1YA 2WFLA 4H7PA 3JQQA 1AQLA 4Q0MA 3HB9A 3ICQB 3NRBA 3P9CA 4CKCA 5A2QA 3IPCA 1Y6JA 1E0SA 3IMCA 2FI1A 4JP3A 4BQEA 2WU8A 2DPHA 2MIIA 1EVYA 3D8BA 3AGPA 2BW0A 4I9NA 5E1MA 3IESA 5CIQA 1ZNYA 3I2HA 2HA6A 4B85A 1H1LA 1PV2A 2R8PA 1OPRA 3TTVA 1GRVA 3ORHA 2NVOA 4GR4A 5DTMA 1IBLB 4P35A 4F5WA 4N0DA 5TEVA 1CUVA 3OQBA 3ZWVA 5CFQA 2AXEA 1GG5A 4ZZ2A 1G8HA 2Y1WA 4JB2A 4LXUA 1EXVA 1KYVA 2GILA 1PG0A 3LDFA 5AWFC 2DH6A 4FYVA 3CN7A 3H8SA 5KVSA 2MINA 2EEZA 3PXXA 1GPNA 4GM4A 4JC0A 5CGZA 5ALPA 3PX3A 3ZZTA 2JL1A 1UZUA 3C3MA 5DYIA 1NASA 1V1JA 3PE3A 4KI7A 2P5YA 4K3VA 3DBOB 4A0GA 1LBEA 4JYPA 5KJ1A 2XMRA 1RLUA 3GGOA 3OCZA 4FGJA 3RC8A 5AK6A 3BZBA 1BRMA 3QVGB 3G7UA 2VDVE 2IYEA 2NOAA 3B3GA 3OA0A 3QY9A 4TRRA 4ZAVA 3RUEA 3AIMA 3S1SA 1SOUA 4J91A 4K46A 4TV9F 1YL6A 1JEYA 3WFZA 3EQ7A 3S1LA 3ZXYA 1Q77A 2Q50A 4TUYB 3GLFE 2BM0A 3VGJA 3CNQS 2XZLA 1WP9A 3E5NA 3NTLA 4GAEA 4JEUA 5FWDA 3BMOB 4WV3A 4NHEA 3W2GA 4DQ0A 3LYHA 3HCOA 4FZ5A 4P3PA 5AICA 1S4MA 2CBZA 1Y9EA 2IYWA 4JBLA 2GAOA 5J23A 1DG9A 3DO8A 2OSBA 4MUXA 3ROGA 1AV6A 2HHJA 2ZRCA 4OK6A 1LJLA 3CUKA 2CT8A 4LOKA 1JAHA 3STTA 5ITZA 1L4MA 1MIOB 3EIWA 1QLWA 4M8LA 1UM9A 2IYOA 1R3UA 2JKZA 3G85A 3M34A 2BLNA 2BRUC 2B7BA 4FI3F 1Z47A 2PSDA 2V4MA 1XCBA 1XRJA 2ZQ5A 5T64A 1KARA 1X8LA 3V2IA 3H1BA 2JFBA 2WV9A 4RHCA 1KO4A 3A1TA 5KKNB 4OSEA 2FQXA 1W94A 3AW9A 1J9ZA 4L8YA 5AUOB 3PL1A 1L4NA 2YZGA 5LMUB 3R9XB 4YLEA 2VRWA 4FFBA 2D0OB 3SF8B 4CQNA 5LP1A 1VLHA 3BM5A 1B6GA 1P29A 4GYJA 2R1UA 4PY2A 5FP0A 2J6BA 4FYXA 1TJ5A 1OU4A 3OPYI 4B6FA 3EBPA 1PEKE 3NANA 3EH2A 5FLXA 3GJ6A 3WL7A 5GJVC 3ZYZA 1LSSA 4UNNA 2Q5OA 2NPOA 1XU9A 4DMFA 3ORYA 2ZSAA 1U3FA 3DULA 3ZGXA 2EFGA 2I7XA 2QWXA 5JDIC 3D6VA 1M6EX 4L2IA 3E9RA 2CHFA 2GPBA 1OX6A 2DWUA 2WM8A 1UJBA 1Z2AA 1GNVA 4MIYA 4BVJA 4EG0A 3SKYA 4ZT4A 1PNRA 2AUNA 5JNRA 4MMZB 3WHPA 2PS1A 1BSVA 1EJBA 3HI4A 2J3JA 3QVOA 5DW3A 3RJTA 5AOAA 3ZCVA 4RADA 2I29A 1NNLA 4RA6A 3TNFA 5C8ZA 2IUFA 3JZFA 1QIFA 4A82A 4D6PA 3BRQA 3TNDA 1UBEA 3WSTA 1JP7A 3KU1A 1IFXA 2E21A 4BNVA 2DFTA 5BSHA 2XCQA 3GRYA 4EQ6A 1NYTA 3DBRB 1SBNE 4UZSA 4L5CA 4M8SA 4A2CA 4FZRA 1VJRA 3ST7A 1PUIA 1AGRA 1WULS 5CLLA 2J0QA 4E13A 4JI7B 5IHPA 3VJMA 3HUUA 3IC5A 3TTYA 1ZGJA 2RHCA 4Z0PA 1QP0A 1SXJA 4IFEA 4TRJA 4B32A 3W7VA 4ZI3A 2PTGA 1U2QA 1E2DA 3A4NA 4I4TA 1D03A 2Q6TA 2VDUE 3VBCA 4WSOA 1X2BA 5JAMA 2OAP1 4RU1A 3HSKA 4F3YA 2GTIA 4P7GA 4URHA 5SY4A 4DV0B 1PVVA 2IUYA 3T7RA 1PYGA 1L7PA 3DDUA 1WF3A 4AMUA 3PXGA 3OG9A 4JJ4A 1CVRA 2CFIA 2A67A 2OHIA 4HADA 4KKVA 4P4SA 3SE0A 3WGVA 1JQEA 3O90A 1BVRA 3Q8MA 1P6UA 1YGYA 3C3YA 2QLLA 4KE6A 3RW9A 2FZ4A 2Y1CA 4Y9DA 2FR8C 3F6YA 4UTNA 5DDIP 3GVIA 5HMMA 3WDSA 1TM5E 3EEFA 2H4ZA 2YY5A 2C57A 2ECKA 4L5JA 5EI5A 2WYWA 5JNWA 5IFLA 2YHBA 4YR9A 5LYJF 1QCDA 3QXCA 3DO5A 1NRJB 4J4HA 3AP1A 2ZPAA 4C7OA 1WHSB 2AJBA 1KAQA 1SU4A 2DF8A 5EJIA 3TIGA 1POWA 3VX4A 4DMCA 5JPIA 1SULA 5L51A 1DBRA 4UM9D 3ER6A 3TOXA 3W06A 2EAUA 4LK3A 1PWYE 1IPHA 3P2IA 3SFZA 2VSXA 1XPRA 5GP1A 1JXMA 4DLLA 4XCXA 1HBJA 1GZ6A 2PNFA 2XMPA 4OYLA 1QJCA 4UHEA 1MO4A 4V39A 3RSFA 3UGQA 1YU6A 2JIDA 2RGXA 4CM3A 1INLA 2ZOSA 1OF1A 1K8RA 2Z1NA 1A5ZA 1JFRA 3LT1A 4OQXA 4QPPA 4EUKA 3S2ZA 1T2NA 1YS2X 2HU7A 4XUCA 2H1HA 4MVXA 1EUDB 2AR9A 4BFLA 5KNCH 3KTAB 3RS8A 3K4QA 3ZK9A 2V6MA 3DL2A 3O47A 1C3LA 2GD2A 3IOBA 2IYSA 1N75A 1QK3A 1RIIA 1F0NA 3A05A 1K6EA 4IIJF 1YZLA 1LK0A 2SECE 3FRIA 2QTNA 3T12A 4OIMA 5TSDA 2VAVA 3VR1A 4CM8A 3NX4A 5HA5A 3RVDA 5AKGA 2PKEA 1MO5A 1ECLA 1ZEJA 2IT1A 3UTCA 3EEBA 3TPCA 3L4BC 1A9SA 3R3VA 4GD3Q 1YZQA 4JHLA 3GEHA 1N2SA 2C5HA 1OR8A 1Y8QB 1KKMA 2R7AA 2ZIGA 3IIIA 1P2SA 2PS0A 3FPGA 4N7BA 1UPCA 3NHAA 3CZMA 4YCSA 1KEKA 1IMJA 1MJGA 1HYBA 2Z2ZA 3GPDG 3JQAD 1H5UA 3F7OA 2FZLA 2OV3A 1K4MA 1P6QA 1OAKA 1TMKA 4M1OA 3H5AA 3JQGB 4YRQA 1DB3A 5E2IA 4BX9A 4YMIA 4IVRA 1XR3A 4A2WA 2JIOA 5FL7D 1UMDB 2QUZA 5JATA 2W83A 3DEFA 4KGZA 5ICSA 2FZGA 2ZETA 4PC3A 4OA8A 1P9WA 2PKXA 1GQ2A 1VLVA 2QUBA 2JLUA 5DHQA 1LZLA 1U5CA 2EOAA 2Q5QA 2E6KA 1FS6A 3MWEB 4LHXA 1YGPA 2WSLA 5EUQB 2R60A 1ADFA 2P0EA 3E3NA 1NJ5A 2QW8A 2X2FA 1JTFA 1PGQA 3IJEB 1EBBA 2ZPUA 4MGHA 4YGXB 3L06A 4MCIA 5FUBA 2XYHA 1P1IA 2H4JA 2QTVA 1Y9JA 4O8CA 5U4QA 4KZKA 2R4TA 3T38A 2XUOA 3AEUB 4AD8A 4FMBB 3U2QA 4QBGB 4HXYA 5CM2Z 3U4GA 2RGDA 2UKDA 3GFGA 2BKXA 1Q95A 3G59A 4Z0TA 1YMQA 4JT4A 1G6HA 2ZVDA 3LMKA 4QQRA 2OXIA 3LNTA 3GWGA 2WJ3A 2VYVD 3HKDA 2P6PA 3PXCX 3KJQA 2I2CA 1NP6A 3DZ8A 5HQTA 2B1QA 1TGYA 1TD9A 1ABEA 4ZVKA 3CINA 1DCKA 2J3HA 4WY2A 5BNWA 3WRVA 3CSUA 1IBCA 5CT6A 1KEWA 2I62A 4G26A 4QU0A 2D5BA 3LHFA 4CV2A 2ZANA 1RPAA 1DJPA 2R85A 1XCMA 1B43A 3DYIA 1ZNXA 3KHUA 3ODPA 1XVTA 4AULA 1Z36A 2O2JA 2ZRKA 3OPNA 4YAIA 4TMXA 4N76A 4L5AA 3KUDA 5KKCA 1PX0A 1P0CA 2QX4A 3BMNA 4IVPA 5DASA 4DBLC 3CZQA 2AK3A 2JAWA 3A4IA 3JCZA 3TKLA 4UM5A 1E1QD 2XDQB 3I83A 4XFJA 2WTUA 3WLLA 5KX5A 1WOMA 1KOFA 3HXMA 1NXOA 4NYJR 4L78A 4QU5A 3X3HA 3L41A 5EKSA 2ZRFA 3HJBA 1C14A 2RHLA 4KXMA 4EUNA 1RC0A 5AW9A 1UC5B 2YV2A 2JCBA 2I67A 2VI5A 2A1IA 3O3MB 3JYOA 1TYAE 2D62A 4MVCA 2F4VB 2GK6A 4JZKA 4BCCA 2Q2NA 2B1GA 1G9XA 1NMZA 4H17A 1RXVA 2IITA 4INOA 4AZWA 5IC6A 3L8HA 1QIEA 3HXKA 3PCRB 4JLDA 5CW2A 3T5GA 1M6HA 4ARCA 1HNZB 3ZS9A 2EJUA 2WU0A 3UJCA 3ICWA 1KMHA 1YRAA 1PDWA 2QTBA 3R9XA 2OECA 4R2JA 5IFKA 4D9BA 1RPZA 3CT6A 4B9AA 3DXZA 1FSFA 1USVA 4FNMA 4YDHB 1FSGA 1YVEI 3ED5A 2HYDA 3DC7A 3RWBA 1S6YA 1MJ5A 4UMEA 4YMSA 5J2TF 2OVBA 1IM5A 3I0NA 3NWOA 3QW2A 3VVCA 2PMEA 4MQLA 3TCXB 3VV2A 4E08A 4DZRA 1NQUA 5LU9A 2W2KA 1JYFA 1E64A 3KJEA 3FSRA 4NFHA 4OKSA 3GLIA 2H0AA 4X1YA 3DUFA 1HA3A 3I9NA 3OT1A 1Y4UA 2XVZA 2QD1A 5HKKD 1G3QA 1YS9A 2AOUA 3OIWA 1KAEA 1KETA 4WLFA 1L7QA 5DGDA 3ZZMA 3H42B 5JAZA 2BF7A 3B5IA 4C4YA 3IPLA 1Y8ZA 2XUPA 2ZT7A 3TL2A 1UBFA 4AS1A 1EAYA 2CNDA 4BLRA 5KOYA 2OZVA 5FPTA 1D5WA 1M34E 1WDLA 3LLCA 3ZWYA 4DABA 5HFJA 4OBWA 1U0LA 3S1AA 2H9AA 1VRCA 2HCBA 3WO0A 1QG0A 2A9RA 4MYRA 2HSGA 3I4CA 2Z1DA 2D1QA 1PJ8A 4Q7LA 1V3QE 4F4IA 2L0XA 3TLGB 1QYIA 1C7FA 4ZYUA 2JA2A 3FOZA 1L5GB 2I4RA 2QP9X 4JI8B 3FTEA 1E6EA 4BJ3A 2EJBA 1BH6A 4J03A 2RB5A 3SC6A 5C51B 1NDQA 3GMIA 1Q1EA 3B1YA 2D54A 4ZVRA 4BX3A 3P19A 1E96A 1BX3A 5KTRA 1DAEA 1KC1A 2DFDA 2FE4A 3U7QB 1E3WA 2Q3HA 1E6LA 3F46A 5LYJA 1BOFA 1NUTA 3PDHA 1N6OA 3DMYA 4W63A 4RW0A 3HDGA 1OREA 2I6TA 1G8MA 1X6VA 4C7BA 2PGDA 4Q3KA 2D0IA 1KQGA 2YWCA 4I6EA 4P58A 4PFJA 4IXTA 1E20A 1N1MA 1Q1GA 1IY2A 1QLJA 2WYUA 5BV2P 5ALTA 3WL6A 5IH3A 4DR5B 1AHIA 1IB6A 1KH2A 1QVVA 2FDXA 1R0KA 1Y1TA 2A5LA 2R7NA 2Q5JA 3DS8A 3QU5A 1PV4A 1EP3B 3COJA 3O92A 2HD4A 1D2EA 4KO1S 1NW5A 4TKVB 1M2WA 1SHKA 4L6AA 3H1AA 4OLHA 2G71A 1R8QA 1BH2A 2P5TB 3CW2A 2J5RA 3E18A 1PZHA 2O0MA 1O2DA 3F98A 4Y6LA 3MERA 2P9CA 4EPRA 5LXTA 1ISMA 3KQLA 4N6GA 2AE1A 2JCSA 1M0SA 3LPLA 1WLYA 3AOEA 4AICA 4OYRA 2BFNA 2E5FA 3AT1A 3IBGA 3JQRA 3MWYW 4ZC8A 1A9PA 1MEJA 2J07A 3EPRA 4KUEA 3DT9A 5F2OA 1JYSA 1S3GA 1ZKMA 4Z8YA 5DGTA 1DPGA 2FK7A 2I8CA 3PQ3A 1D4OA 2WTAA 2M6RA 1Z45A 4C0LA 1U1IA 4UTOA 4YMVA 1EMDA 4LJRA 2IXBA 1NVMB 3CUEF 4O33A 2ID8A 1A9XA 1OWNA 2P68A 2FSSA 2FSIA 2VHQA 2CLOB 3A1VA 3G0GA 1E2UA 1RI5A 3P2EA 1KQFA 3ZDZB 1JXOA 3VFDA 1XDSA 3VPDA 2FEPA 1SKAA 5KMGA 1CUBA 3D4PA 3FCYA 3PUZA 2BKAA 3QENA 3L0PA 1G19A 1XDWA 2CL5A 5EIHA 3U1VA 1AKVA 4JH0A 3ZIAD 1ZRMA 2GN2A 5E7MA 3F3KA 3C6MA 4KRXA 3HZZA 1MRZA 1E2PA 3IBYA 4AQ7A 1OH5A 1W5EA 4K8OA 1NHGA 2KE5A 1JA9A 4U2EA 5JRZA 3R7NA 1CR6A 2I7CA 4E2YA 1DJMA 5B1DA 1TT5A 1Q3KA 4IWYA 3QOYA 1G2PA 1UOOA 2BMEA 4YRSA 5ARDA 4WRRA 3WLHA 3R8XA 2IDJA 4RKQA 5AXAA 1WZIA 3T06B 1H69A 4BX2A 2PE5A 1Y6FA 2JBHA 3KKOA 3UJPA 2YRWA 2QGZA 3GCXA 4A73A 3GRZA 1CZNA 3ZNOA 3FFWA 1RLJA 1ZVJA 4S1PA 4D8UA 2B35A 1QOZA 3GPIA 3RU9A 3WDMA 1TYBE 3DJFA 4CMKA 3O8QB 1HDCA 3LDHA 2PMBA 3W9BA 5DX0A 2IPLA 2G8LA 2VVTA 4F4UA 1QX4A 4X44A 1R1DA 2BI4A 1MH1A 4FYWA 5ESDA 1P0QA 2TSYB 1KS9A 4EPWA 1K66A 3USCS 4LNUA 4IQ0A 2QT0A 1DWUA 1H1TA 1UM8A 4W1QA 4A4DA 5HRUA 5EIOA 3NYQA 4XSHA 3MMZA 3RV3A 4K9RA 1ZN2A 1YRWA 3RWMB 4JI2B 2WKRA 2A1UB 2I3ZA 4DCTA 4QBKA 1QB7A 4M53A 2IHVA 2DQ4A 4R9SA 4A9AA 4YJHA 1TZ2A 2R6GA 3R3HA 3BRWA 4LHYA 5FB3A 3D2LA 1R8XA 4I3HA 1WQ4A 3OU7A 5B3AA 3H87A 1JKFA 1UPXA 4UBIA 1K7SN 2ARKA 2DQKA 3CBQA 1N7IA 2QTMA 5HDQA 3W1WA 1GZ7A 4BZQA 3MF4A 2JHAA 5GONA 3MJVA 1DJNA 1N3YA 2P40A 4YPFA 1T6BY 2YVQA 1N2HA 3PHLA 3ROZA 3CNNA 5BPHA 2ZE7A 1A2OA 2GPSA 4Z1MA 4PHFA 3NIDB 4GPD1 4US1R 3EA0A 4L3VA 4DDKA 2P41A 3P9SA 3VR6H 1C4XA 1FU4A 4G1CA 2B7CA 1B41A 3A1NA 1X7ZB 2X15A 1NE2A 3HO8A 4HZUA 2HY7A 2EKLA 1Y4SA 1WB6A 3VSEA 2EQAA 3VPCA 2WSBA 1Z4MA 5DHRA 1VL5A 1U0HC 2EZ8A 3L7DA 4ZCQA 2Q9CA 2Q5EA 4C0WA 3UAGA 4IIFA 2WINI 3T52A 1C1YA 1RWPA 4N48A 4RPHA 4OFXA 2JFNA 1WVGA 3KPVA 2CZCA 3T5BA 1SZPA 1R5JA 3D1VA 3U7QA 3RVQA 1E66A 4EG1A 2FP3A 3E1SA 3EQ8A 4CLXA 3E7XA 4OAQA 4XQ0A 1EZ4A 5CB0A 3G0HA 4REMA 1VG9B 2V59A 4II7A 4OB7A 1O89A 1ZU5A 2C31A 4ZVVA 1P2GA 3VZSA 2PGLA 5HCIA 3RD5A 2GBPA 2JFFA 1OWOA 1SVOA 3D54D 2OO7A 2QRGA 1L7RA 5J4LA 2WG0A 3BXEA 1EP1B 3K72B 1ZVMA 2FB9A 2HF2A 3B60A 1M6VB 3GAMA 3GG9A 4G0PA 4R1UA 2XA2A 4TN5A 5G1NA 5MN4A 3CVVA 1C4KA 4W5RA 3RNOA 3BE8A 2CLSA 5B53A 5L7YA 2I9KA 4B3HA 2LR0A 2AHRA 1QKKA 4CKBA 5JCXA 3A6DA 3IAS6 1TO2E 3A25A 4PR0A 3BA6A 1TYDE 3QEMB 2GUGA 3GLUA 3I5AA 3LY8A 4MV3A 3IULA 3HZRA 4YV1A 1XN1A 1P2VA 2I1LA 3KPUA 1W5BA 1RQGA 1ABFA 3FCUB 3FVQA 3HN7A 5C0OE 2IXDA 4MO2A 2P35A 1EFRD 2YMLA 4O4IA 5BXQC 4L76A 5IJZA 4FXOA 3BJRA 3KJIA 4UREA 4XIIA 3V4SA 3M8KA 2QZ4A 3JD0A 1AB6A 2O1WA 1GITA 4GOJA 4GWKA 4GQAA 1GTSA 1N0HA 1OFGA 3DDOA 3N59A 2F59A 4XYEA 3V8PA 2GA8A 3SLKA 1PW7A 3IAXA 4UKDA 3UPUA 1DCTA 4EG4A 2C7RA 4AMBA 3PI6A 4A6PA 2W2OA 1W29A 2GPYA 1J22A 1U04A 1T9HA 2YWGA 4QQFA 1O95C 4W1RA 1UQRA 1W96A 1A1SA 4RVFA 5EMLA 2GJKA 2IW3A 5KC8A 1CF4A 2XCRB 1U31A 1ZINA 1KZGB 1BJRE 1KK3A 4OHFA 4ARIA 2QY6A 3WLIA 1SNYA 1ORWA 4HFRA 4UASA 4URWR 2ZDQA 1U0NA 1C81A 2ZWPA 3QPUA 4I1VA 3VPHA 2QRHA 2K87A 4TX1A 4OXNA 4XEUA 3ZR4B 2GOYA 3ZG6A 3UJHA 4F0JA 2Y1DA 2FSFA 1WOYA 1J24A 2ZJ4A 4RL6A 4B46A 4C88A 2OD2A 2RD2A 3GEMA 3M1AA 2ZWMA 3PYMA 1LV7A 1U1EA 3I5UA 1LK7A 2WF9A 4B4WA 1N1EA 1OKKA 3OZVA 3UNXA 4F4HA 1MQ8B 1DG1G 1M2VB 1W4CA 3EPHA 2H9YA 3RU3A 3PSAA 1D04A 4FEGA 3KZ1E 3D81A 3UMMA 1JH9A 1G9SA 1X7XA 3RSQA 5CDTA 4AUKA 4LE2A 3TYXA 2W9XA 2A9FA 1STOA 3AZQA 4IUYA 1Q7CA 2DQYA 1NGSA 2C9CA 1C7QA 4JSTA 5C4GB 3V8MA 2E1PA 2FW1A 2R7MA 1OZAA 3LGSA 4UBNA 3I2YX 2W71A 1DPFA 5BQ5A 5IRCD 4PRKA 2XLCA 3L9WA 3HFRA 3ZX4A 2AWOA 4E5UA 3AESB 1NU8A 2C2XA 1F3LA 2F2TA 2JJ1A 4FEEA 4WECA 5CLQA 1T2CA 2WUDA 3PYXA 4MHTA 1G2OA 4NENA 2B20A 4IFBA 4LDRA 5D3QA 4ZVMA 3GGSA 3D3WB 3TZEA 4BTVA 1FB5A 3FRJA 3UHPA 1CUCA 2NZYA 4J0DA 2PT7A 2JB9A 4PVCA 1MFZA 1P18A 2H8GA 1X80A 4XQCA 5YASA 3K3PA 3TAXA 4DVJA 2C2GA 2FEWB 1FUKA 1G16A 2FSVC 3OTGA 1ZNZA 5DISB 4YUYA 2CUKA 1L5LA 4U2DA 2O05A 1T9GS 2SCUA 3O82A 4L5YA 4IMPA 5IHXA 3W6ZA 5A71A 3O4VA 3O2NA 1XXHA 3ZVKA 2REXB 4Y1RB 1NVUQ 2YXLA 1HT1E 3DF7A 4LMBA 1OC2A 1ECCA 3DXXA 3VYUB 2IQIA 4B1FA 4JOQA 3NAMA 2DXIA 1VPTA 2VWGA 1DIAA 4WJLA 1E2GA 1N2BA 2A0WA 1WL8A 2RGYA 3HNOA 3FJYA 1P5FA 1FUYB 3NYIA 2BSAA 2JH9A 1CP3A 4L4RA 4IS3A 3VU0A 4B6PA 4ZI7F 1SBCA 2AZTA 2RAPA 1R4AA 2X9QA 2Z2XA 3OZRA 5D2CA 5CDSA 1FPQA 1GP2A 1QH9A 3ZTWA 1GQSA 1PQ4A 1SHJA 1ISFA 2I4IA 2WWWA 4YIKA 2WPNA 2GBCA 1BE6A 4HEJA 1X3LA 3SFTA 1GGEA 4OF4A 1KHHA 4MDEA 3HA3A 4JI6B 4INJA 1CY8A 1JSLA 5LCXA 1V5GA 5CX1A 4OQMA 1RNLA 3M82A 4X64B 2CLMB 2C7QA 1HDIA 2PTHA 3Q1KA 2IRWA 2QROA 2PQ2A 5I3CA 2R751 3QLVA 4LJAA 5KTTA 4OGWA 3RYHA 1XELA 1U7DA 3BXZA 3EJ6A 1BDMA 3GLQA 1EQ2A 2HW8A 3GP8A 4YMGA 3TXYA 5JNSA 4P3OA 3PIDA 1TMYA 3HKEB 4KGDA 2VHUA 1RMYA 1ZZEA 5FF9A 1T5IA 4B3FX 3GO4A 1T15A 2B4RO 4JLBA 4BN0A 3QVGA 1QDLB 3QHPA 1HE8B 3R8CA 4OP2A 3RC7A 3IP9A 3K7EA 1ZUD1 2AYZA 2PA3A 4Y2HA 3V4LA 1MAHA 5I7FA 1O6CA 3QUTA 3ZXUB 4KXFB 3ZLVA 1K63A 2YN2A 2JFGA 3DUFB 4DXHA 1ICEA 1VA5A 4EF5A 2P9HA 4EDFA 4L5IA 3IIKA 3VHQA 4RTOA 1IN1A 1DBPA 3KAPA 5JASA 1PFGA 3FOWA 3WVNA 2UZIR 1V9CA 3WV5A 5FWNA 4K6KA 3HBMA 1U65A 1J4AA 3QPAA 4OM8A 1NBMD 5LMCA 4YVFA 3RODA 1XZPA 5ITSA 1R50A 4HAYA 2HBQA 4M1YA 4AROA 2X8BA 3GNQA 1OUMA 1NSTA 4TSFD 4B74A 1VP3A 2YC2C 3T3OA 3HCPA 3E82A 4U7WA 5BYJA 5JNTA 1LI4A 4OYYA 1LCIA 4QIHA 1USUA 2O50A 1YZTA 1JDNA 2WHXA 4MS3B 4F6CA 3PEWA 3A06A 4GMDA 4OY3A 4M9XA 3JPYA 1MW9X 4R2IA 3FCXA 2I1WA 4NTZA 5IYZF 2ERXA 5KYTA 3S81A 4C2UA 5A3VA 2VNKA 2GZAA 1YKGA 2Z3VA 2Q7XA 3EOZA 1VLMA 4G86A 4N12A 1SAYA 3TNJA 3UJ8A 2OC4A 2OYSA 3PC2A 4LJ9A 1YOVB 4R9RA 4CL0A 3D0QA 4C05A 4R2LA 4IHJF 4N5DA 3BTVA 3BRSA 3ZC3A 3EOBI 4BNFA 2BEUB 1IL0A 1DKMA 3LT0A 4NABA 4CU2A 2FJ0A 1U3TA 1DXYA 4WHMA 2I2BA 5KBYA 1F0PA 4I8IA 2Y2UA 5EE5B 2HJGA 3M6XA 4LJ5A 5DFAA 2PWPA 3L02A 5HK8A 4DM4A 3WWCA 2HKIA 2DT8A 2AQHA 3I9V1 4R1OA 1I1NA 3TD6A 2H4WA 1G38A 3QEJA 5CJPA 3V4FA 5BQ3A 1NBWB 1T4DA 2A3NA 3BWEA 2ZJBA 4AP9A 2XCUA 1FFYA 2ZBPA 1A9ZA 3NTXA 1RXWA 3KR0A 3DMPA 2PUWA 3NUZA 4MB6A 2IYYA 2Y68A 2ZUBA 1FSZA 4HLDA 4XRGA 4GU5A 4YRGA 4TYWA 2D7CA 4PXSA 3KHKA 5TX7A 1O97D 3CG4A 5I7OA 1SRQA 2RK6A 1QE0A 2YCBA 5LSAA 2G5GX 3AVWA 3ZHOA 4ZYLA 1XKLA 4P4UA 3A4VA 3EVDA 4LJYA 1P7VA 3AUTA 5KWJA 2YINC 3NTUA 1FIUA 1SO8A 2V6GA 1O5OA 4RELA 2WWGA 5K6AC 1T3LA 3D6JA 3OQJA 1LPOA 2EW8A 2GCOB 2HK9A 1J8FA 5JO9A 1QRTA 3RT9A 2I34A 1E1LA 1L5WA 5EESA 3WFIA 1D1TA 1QO0D 3VC7A 2WG2A 3WLJA 4D56A 4ARSA 1DBQA 1D4ZA 1GAEO 1I1HA 1RJDA 2BEJA 2WP8J 4LQLA 3SQNA 4EJ6A 3ZPXA 3HDHA 2WMOB 5ERXA 2YW9A 3KWJA 4X71A 1AMNA 1BDJA 5LN1A 4I4IA 4Y2TA 4OLFA 2Z3ZA 5EOVA 3TMAA 4TWBA 7YASA 3QVTA 3ZJVA 4OXIA 4MAAA 1KKLA 4MCJA 4LTDA 3U16A 3K70B 3CH4B 5FULA 1X14A 1IZ0A 2VDWA 1GPJA 5FDFA 1JFVA 1E0KA 3WFJA 4M89A 4J7XA 2VQ3A 2CMGA 3JYNA 2GKOA 4Y2UA 3TCNA 5B7QA 2Z2IA 2W7TA 4DCJA 4F85A 3EVZA 2W2XA 5HKBA 3Q6MA 2D3TA 2E2WA 3GJYA 1GCAA 3RUIA 5CVCA 1YDHA 3L8DA 1IEQA 1NLUA 4RSMA 3IEPA 1VJDA 3A14A 1MV8A 4FCVA 4RVHA 4L3OA 4P0TA 3IX7A 4RF3A 5DWDA 2BEWA 2IYNA 3E7FA 4F91B 1OB2A 2DYKA 1NW4A 3LSTA 5HS4A 5FD8A 2RONA 3MAGA 1R4MB 2HPZA 3OOWA 1FDSA 2ZJ8A 2CXNA 3RYFB 2YWFA 4C6TB 2PH7A 4Z54A 5AOVA 2H7VA 1M2EA 2QTAA 3TOVA 4FLEA 4O4JA 5DXJA 4BO2A 1OLXB 1NXPA 1ODFA 5FA6A 4KE7A 2V0CA 5C3MA 4LFAB 3R3XA 2NVWA 3NVAA 5FNVB 5IN4A 3KKNA 1GV0A 2V6FA 1VHJA 4OOEA 4AMVA 1T25A 2GBGA 3FI0A 4CM6A 3QLUA 4TV8A 1O3YA 1SY7A 4TMZA 1ZCAA 3UMYA 3L1HA 3NGMA 5BW4A 4MR9A 1QRUA 3S29A 1P4AA 4GEGA 1JAYA 1XCOA 4LF7B 2GJSA 1XXHB 2QIPA 3NCTA 3VZPA 3IUBA 5JZBA 2O2SA 3SQDA 4OHVA 1PLLA 4UEWA 3SR4A 2KPOA 2QAGB 3LBFA 4YP7A 4ZCMA 4GL2A 1A8SA 2IIBA 4GPZA 2WC1A 3VPXA 1R0RE 3R9IA 4CV3A 4P53A 1JB1A 3ETHA 1ZG3A 1IE3A 3BEDA 3HR4A 4A15A 2B8NA 4J49A 3HWWA 3RTAA 2XGMA 1XVVA 3A9RA 3QSGA 3TEMA 4N8DA 4D5GA 3GFRA 3F4KA 4J0CA 3V3KA 2XUAA 2H7YA 2OYRA 3I8XA 1VG8A 4HJXA 3VC1A 1M8KA 3C2QA 3NU1A 2FRXA 1N3BA 1SHLA 1IB0A 2GDJA 3Q2IA 4G23A 4JT2A 3RJ5A 1NOKA 4UZFA 4AIIA 4EHFA 2IJGX 4GLLA 5K3FA 4Y6QA 3BHJA 5FWYA 1Q0LA 5AKIA 2EQBA 1DOHA 3HCBA 2O7NA 2J48A 1YSCA 5A0VA 1A9TA 3C14C 5A04A 3AUYA 1A50B 3IV7A 3Q5GA 1DV1A 4QPZA 2DQZA 3NR2A 7ADHA 4L9AA 3HN2A 3IUEA 4RZXA 1I80A 4R83A 1NKVA 3B13B 5DIZA 3GH3A 5C9ZA 2ZKIA 1Y63A 5ALIA 1V35A 2RI1A 1FVFA 4EQ6B 1IXYA 3KQWA 1PUJA 1QQ6A 4O3FA 1XEWY 3PDIA 4GXNA 5TF0A 3VGPA 1J0BA 1YR8A 3RFXA 5LU8A 2UYCA 3FUTA 3GK3A 4EAQA 2H1LA 4QREA 5FFNA 5BXYA 2Q62A 3E61A 1WZNA 4DIOA 2HTFA 1YTLA 2FOLA 4PPYA 4EKGA 5HYVA 1DQNA 1J0XO 2A5FA 2AKYA 2FWRA 5CD1A 3M6LA 1N9KA 2O5CA 3L7YA 1TQDA 3HB1A 4WNAB 2Q5CA 1QS0A 2ZQZA 1SVKA 3GLRA 3NNDA 5F5NA 3WGTA 1NP7A 4I5GA 2YV1A 2JFOA 4O1HA 1X38A 3GH1A 3AY7A 3VOSA 3WO1A 4KNYA 1E1NA 4FDUA 3OCUA 2HPAA 5CA0B 1G5HA 3GA5A 4UCQA 3FDZB 3G8AA 2X86A 3CX3A 1LFDB 3VDRA 2RGAA 4H7DA 2WSSA 1G1AA 4DUZB 3INYA 1OWPA 2PIDA 4K2HA 1DRKA 1R0BA 3C8ZA 2EP7A 3L6BA 4NR0A 5JCJD 3C5VA 3L1IA 3GZNB 4N18A 1ISJA 3TQTA 1R6XA 3E8XA 1KO1A 3BWBA 3AR7A 2ZYRA 3MFQA 4GGMX 1Z0AA 1BXRB 3SQLA 2Y0EA 2DQSA 2CNLA 1KI7A 1IN6A 1DKUA 3VPFA 4DF3A 3BEOA 4PVDA 1ZMRA 3MJRA 1RJWA 1W44A 3KUUA 4KXLA 1R4NB 2C4HA 4IZIA 3UCEA 3WNZA 1VHQA 1D0SA 1X7WA 3CFYA 1KJWA 3LUBA 1U3GA 4KQXA 1FF9A 4C6HA 1MB2A 2OD9A 4V1CI 1H6AA 3GOHA 2CXUA 4HH3C 5IKOA 1AKUA 2EIXA 3G82C 3LFTA 2OEPA 2WZBA 4FMDB 5E4YA 4CLHA 2VIIA 4MA5A 3EVAA 4ABYA 4QUBA 4KQHA 4OLAA 2B4QA 5A4MS 2UZ3A 4B7CA 2OE2A 3BE4A 3ZNNA 2FR1A 4ZU6X 5CHYA 2ERYA 4Q4DA 3U4AA 1F8FA 3QYAA 4UE3S 1XMSA 2JGIA 1PP4A 2AVNA 5JHHB 1XG5A 1U7WA 2Z2YA 4KAFA 4DSUA 1T5BA 3OAAD 2JAOA 2OCDA 2V1UA 2A1UA 1UEXC 1W75A 1Y7HA 2F3TA 1E3MA 2PY6A 2V65A 4TKLA 5AJWA 4I50F 3PXAA 1E9SA 3V2GA 1JDZA 2X0JA 3EWAA 4OL0A 3WLFA 1MEOA 2H57A 2BT4A 1W8IA 2AF3C 3LO5A 1FMCA 5CURA 1W6RA 5K8JB 1KY2A 5F1KA 4EHLA 2X41A 2I54A 2NO7A 3KYCA 1FRVA 2JGFA 4RTSA 4L4ZA 1NW3A 1JQBA 2KMLA 5LJIA 4WJZA 1QO0A 2R8RA 4URVR 1J8VA 1FE8A 1OSNA 3P0RA 1M67A 2GZRA 4ABTA 3ES9A 4KRGA 5A5DA 5B1SA 1MT3A 2TRSB 2DHRA 4E88A 1KGSA 1DRJA 1K27A 1QAQA 3OZUA 1GZ4A 2F55A 1E7RA 1USKA 1UPBA 2G77B 5L6MB 2OC9A 2RCNA 3G7NA 3WYCA 2C9DA 2IP1A 3H8VA 3IUPA 2ABWA 4I1SA 1IYZA 1RKBA 3PBKA 1DU4A 2Q3JA 4UMFA 4A0HA 4Y1FA 2PKYX 3C6ZA 1TZKA 4CG3A 1VIYA 4ETNA 3UVEA 2WY2D 4QVIA 5JLAA 2VCHA 5E3HA 3BAZA 2J4CA 3SQOA 5GINE 4M7WA 5DYYA 2IXAA 1ESZA 4G0YA 4ZYWA 2I1VB 1IZYA 1RPNA 3TLBA 2ZYIA 4NS4A 4RK1A 2OT3B 1GPUA 3T9EA 3NAZA 3KYIB 4IVNA 1JJ7A 4WASA 3U3OA 1DAKA 1NV8A 1T8UA 3EFBA 4O2BF 1U9ZA 4JLWA 2VDOB 3AKZA 1LNZA 1SVSA 3R0ZA 1BWPA 5AXCA 5AM0A 1U7TA 1Z4JA 1SBZA 3I9V6 1XNGA 4JDUA 2G0TA 1MJFA 1ZK1A 5CG2A 5GVSA 1O9HA 1WPQA 2QDKA 4NNPA 2Z6UA 4MW1A 1EZ1A 1J56A 1WMAA 3THXA 5EG5A 5CAEA 1E2MA 1YS4A 4HLQB 4BWFB 1PFQA 3S44A 1BU5A 2EDCA 2ZBRA 3N2IA 1GNPA 3UJ3X 1MRNA 3ZJ5A 1R4MA 2ZVJA 2C4WA 4S24A 4F86A 3E58A 1W5FA 4HRVA 1OJ7A 4Q7JB 4S12A 4XGNA 3GEGA 3L0OA 3N58A 3P7MA 4CMGA 2YHSA 4MUKA 4MWCA 1UBMS 3R4VA 1OX4A 4H4DA 1S96A 1HO3A 4C4AA 3DW3X 1F0KA 3KZOA 3PJFA 1Z22A 1DKOA 4OSOA 2DJ5A 4P92A 4C0XA 5AQ1A 1XALA 1URPA 3ONVA 1M0TA 3EK2A 1MX3A 1PT6A 2Y0CA 1ACMA 2GNOA 3EZLA 5C1OA 2ZVPX 1BJKA 2E48A 2XDQA 2GFHA 2VAMA 3OUUA 2VP5A 1HLFA 2I2XB 3HRIA 5HZHA 2P27A 2YQ5A 1QRAA 3U37A 1O03A 2B1IA 1G8JA 2BN4A 2HLDA 5DO9A 1Y5NA 5LQAA 4U2GA 4NV3A 5AFSA 4HGRA 3FWHA 1K4KA 2FFBA 3L8ZA 4GMGA 2G67A 4WXPA 2BWJA 4GI5A 4JOCA 4X1IA 1DXHA 5J4HA 2DBRA 3DDHA 2QQEA 4WFJA 4BYMA 4YCBA 3ASUA 3P4XA 2BFDB 4DG9A 3L9XA 1X13A 4ER7A 5EGSA 1L9XA 1FC0A 2ZRAA 3P9XA 3INRA 1ZIYA 4OHRA 1ETUA 3OF5A 5EKUA 4FKZA 3RHZA 2GT1A 4FOSA 4XDYA 2HFKA 3JALA 3KSBC 1FX1A 3GCZA 3R0IA 3SVTA 5DXAA 2WM9B 3CEMA 4IOLA 1ZWLA 3E35A 3RVMA 1EXNA 2FFAA 2BZSA 1ENYA 3CIFA 3CZPA 3K9NA 4JU9A 4ER3A 1L1RA 4HDNB 3QI7A 1THGA 4Q82A 3UMBA 2QD3A 1PEAA 3DWIA 3HDYA 4C04A 1LB1B 2I6UA 1XNHA 2PL9A 2W2NA 5K3FB 3R3SA 4EPTA 1Y3FE 3VYTB 3AEQA 1K5DA 4D42A 4DT1A 1TOAA 1JIXA 5IJXA 4HTAA 5JXWA 1JR4A 2VSFA 1S7CA 1BXZA 2X8JB 1Q12A 4HEA1 4OX9B 1XV5A 9MHTA 3QWAA 1CR0A 3IOMA 3WLNA 1FFAA 5DM70 4NMXB 2J33A 5M7EA 1BFDA 4ZCLA 1ISSA 4NPAA 4UQLA 5DNEA 1NJ1A 5K1ZA 2PVSA 2XBLA 1H2AS 3DYBA 3PUHA 3QIVA 4Q1AA 4KCGA 4KXUA 2DWOA 4ND7A 4X3OA 5KOJB 1UCFA 1CYEA 2NU7B 4XVQA 4PSAA 3DQQA 2A30A 1Z13A 3TVDA 1PTKA 1I3CA 4PLFA 2P9YA 3P5BA 5REQB 2G6TA 1D2HA 2C92A 2NACA 4ASUD 1NPTO 5BOSB 3PC8A 3VU9B 1YA8A 4E31A 4G0VA 2RC5A 3JZDA 3CRRA 1JHYA 4ALKA 4ZJYA 2HHAA 4NFYA 1LDNA 3ZWAA 2WF5A 3PI7A 4EHNA 1MZPA 3WNQA 1MO2A 3GVPA 3AONB 5EIBD 4BVEA 4C89A 1XRLA 2EFJA 3OQHA 1MAVA 2GM4A 1DWPA 1I5EA 2HJHA 1WO8A 2HMUA 1Q0PA 2FJUA 4NH4A 1A1VA 4D3ZA 4UW9A 1NFQA 1J09A 1YONA 2ZIEA 3A8TA 3I1YA 5FR2A 1XZIA 4YUZA 5CB6A 1NIPA 4OQPA 2P2YA 3U56A 3OMXA 4I55F 4JLOA 1RKVA 3EIEA 4JYCA 1GPWB 4ZDJA 1M0EA 4B40A 4GVLA 4XWAA 2OO3A 5ELLA 5L4LA 2E4WA 5D8DA 1A9OA 2XMZA 3NKLA 3ZWQA 3GMTA 2W8BB 4BHTA 4ZZ1A 1KOLA 1DT3A 3VMMA 1EP9A 2IELA 2V5UA 4YCLA 2P6MA 3QWFA 5HW0A 3WBFA 4LQ4A 3MQ2A 5CCXA 1Q14A 1LBTA 1FS5A 1Z83A 4LF6B 3GGDA 3UTDA 1EYZA 3IPAA 4FMDF 3UJ9A 1OA0A 3OICA 1NN0A 2VA9A 3R4CA 4KFSA 4DV1B 1SIWA 3VAAA 3HPQA 2NPIA 2ZTUA 1FW8A 3JD1A 3BORA 2C78A 1U6KA 3BDVA 5EZ6B 2K4MA 4C7MA 1Q22A 4UTXA 3BVPA 2VDWB 3L7BA 3HCEA 5C5CA 3ZEAA 4E1AA 2MU1A 3WISA 4J0HA 4XFKA 4CIYA 2RAVA 4KR9A 1WG8A 2R3SA 2H51A 3I5MA 2WDZA 5DHFA 5T6BA 2JG3A 3GYGA 1T1SA 4BFXA 4TWZA 4ARAA 4QXQA 2RBKA 2WKSA 5HGJA 3T0IA 2REQA 5B55A 3RBVA 4TM7A 1KAMA 1AK9A 4IHAA 1GPLA 2YXNA 3LY7A 4JVLA 2AWNA 4EA8A 1JNYA 1ISHA 1TNDA 2GD1O 2O0HA 3QVVA 1RAHA 4M7RA 2YVAA 3II6X 3OM1A 4V0SA 5CDFE 1D6SA 2EJWA 1Q1ZA 2AYXA 3EUWA 3QU4A 4IYRA 4KIWA 4NOLA 5FKJA 2OK7A 3G0BA 1SQ5A 2I80A 4FKMA 5COAA 4CTOA 4YJGA 4TMTA 1KOGA 5FTLA 4GX5A 2XI4A 2OZKA 5ALSA 2H31A 3L79A 2BF4A 2ZLBA 4FNOA 3F71A 3BRCA 1TAHA 3MINB 3NPAA 4FFRA 3L6DA 3PQ5A 2V7GA 1RBYA 2OZLB 4J16A 5ISMA 4IZHA 1RVDA 3ESZA 2OM2A 4L08A 4WDRA 1Z82A 2AK2A 3GZJA 1K7YA 4IIHA 2GZSA 3BS4A 1N0UA 3CE6A 4NFLA 4EF4A 2ZB4A 4ZYZA 4GH5A 3JQEA 3H9BA 5F64A 4BKUA 1CEXA 3MIZA 2P2NA 3O21A 2G7ZA 4K2AA 3O8OB 2XA9A 1IY0A 5DYWA 2C4UA 3QLTA 4XD2A 3HUEA 3GU3A 1OQAA 2XH8A 5FPQA 3AB7A 1L5RA 1XZLA 2MINB 1Q92A 1ESNA 3NAGA 3P27A 1XTKA 2DM6A 4LJ7A 4Q1EA 4V0KA 5FTJA 5B4VA 1BEEA 2PT6A 4RPJA 4M7OA 4NMHA 2KLBA 2XB9A 1S2GA 4OKIA 4FGWA 2QYHA 3E3MA 3ETNA 4H7JA 1GSOA 1EXMA 1PJBA 2FXVA 2LNDA 2VNIA 2Q5FA 3N0VA 3OZGA 3SK0A 1IZ8A 3WIVA 3IT0A 2G36A 4MVJF 3EW7A 4P9NA 1HK7A 4MB2A 2LCQA 2Z3WA 4WK4B 3ZQ6A 5F9FA 2VYND 3UQYS 1U0EA 1IOVA 4H7IA 2FP4B 5C1BA 5M3BA 1Z74A 4P31A 1I94B 1GFSA 1Y5MA 3CM0A 3OCVA 3IUNA 1E5QA 3K8OE 4NCXA 5E6RB 3ECAA 3I58A 2WUVA 1DAFA 1IVSA 4TVKA 1EG2A 3R7SA 1M5TA 4DCPA 4TWJA 4WOPA 6ADHA 1FJHA 1NBEA 2VPWA 2YV5A 3JD4A 3LUFA 3O9ZA 4JP8A 1YF3A 2DUWA 1WF6A 3GT3A 1MP0A 2NSLA 2G9RA 1UOQA 2O20A 1WXEA 2AN5A 1E9RA 3FHOA 3GJRA 4NC9A 5EVJA 3DL0A 4A1FA 2PAFA 5GONF 1UPFA 3DCJA 4YS6A 3Q3JB 2H48A 5IBPA 3TOSA 2X76A 2XE6A 4O4HF 4OJMX 4ZTBA 5IK2A 2R1TA 4BLSA 1OV4A 2JGDA 4MV9A 1QIGA 4RSGA 3M1YA 2XF8A 4QELA 2O2EA 5DGCA 3TLAA 1VECA 4BV9A 3JAKA 2GO7A 4KZPA 3EW9A 4BEWA 1XKQA 4LYGA 3B12A 4HN2A 2XV1A 4N5LA 2HZ7A 4OMUA 2Q1SA 5IAGA 1TCCA 3REQA 4Q00A 2PZAA 1BXKA 4IXDA 4ZOLB 2JFHA 4TLLB 3LG2A 4RKRA 4WLUA 3RYIB 4XVCA 4Z4CA 1JF8A 1N6LA 4W5NA 1SQ6A 3PPIA 3WP1B 1G8SA 1HSZA 4RHYA 4PONA 1S02A 1GYQA 4PC7A 2CFSA 2Y99A 4J9VA 4M0EA 4UNRA 4QO8A 1YB2A 1OXTA 1X1RA 1ZN7A 4MZDA 4QYXA 5B6IA 3U61B 4A5SA 2JIBA 2ZDHA 3DWFA 5JCJA 4HUJA 1P4JA 4A1OA 4ZJUA 3MYYA 5JALA 2YIMA 1A8PA 2Q4EA 3FPEA 4WOCA 5DF1A 2QTRA 1P5JA 4K9KA 1DJQA 4RVGA 3O6VA 3A1SA 3UO8B 2WK1A 4ZHQF 4XX0B 4X0EA 1ZXBA 2YRXA 1PEYA 2FWIA 3OQVA 3WRYC 1RMQA 4I14A 2JBAB 1XTRA 3A37A 4FGSA 3Q6IA 5KAPA 4RV5A 1F3OA 4J1SA 3R9KA 4ARUA 1CQWA 1YK1A 2Q4RA 5EE1A 4AZVA 3PEVA 1NW7A 2IP4A 3H0EA 5DIFA 1J2YA 4G8BA 1UIMA 2O5VA 3HBJA 5EAIA 3OH8A 5I9LA 2OOKA 5LR6A 2CXQA 1JFSA 2NNLD 3NTQA 4BOYA 1DBVO 1C29B 1O94D 2C5AA 4OHUA 1Z28A 3N2LA 4V3BA 1IDN1 1KKUA 4BWVA 2VXCA 1SCBA 3DF9A 2VAXA 1WTCA 4RGVA 6NULA 3EZFA 1RACA 2GZHA 5JDCA 4H1TA 3AF5A 5DTJA 1VDZA 2VHYA 3HBLA 1U7OA 3GNLA 1N2ZA 3IRVA 1Z34A 1OBHA 2GRAA 4JJKA 4LG1A 2EFDB 1U3VA 1RWMA 3JWEA 2AHOA 3U4QB 3C3JA 1TGVA 2X5OA 3K96A 3MHPA 3NVKI 3OZCA 2QR3A 2QXUA 3ESQA 1XHLA 5J63A 2C04A 1KXJA 4F3TA 3LT5A 1BCRA 1S2NA 4RZUA 3SR0A 4MRSA 1YBVA 2XQIA 3G49A 4RTKA 3FMOB 5HMLA 5CHEA 4EABA 5L7WA 4TGLA 3LK6A 1U2EA 1FRZA 1TKAA 4OG2A 1TD1A 4BEJA 3Q88A 3GNSA 1WBDA 2BFPA 1CUJA 1L4YA 1ML3A 4TYYA 5GV7A 2EP5A 3UWMA 3L8EA 3W5HA 1TF2A 2N1BA 5EY5B 3SIRA 2YWJA 1ESCA 4PZLA 4Q05A 3DT8A 4NU0A 3D8UA 3PFBA 1U9CA 2BM8A 2H4XA 2IDKA 1CB0A 4N6NA 2O7SA 4UU0A 4DEYA 4JVSB 4QBIA 1ICIA 1UINA 2P3QA 2ZI9A 3AI1A 5DLQC 1PL6A 2B21A 3WLRA 3TO5A 3IHWA 3EGXA 3K9WA 1LD3A 5UKDA 3H7IA 1ODJA 3DNFA 4EY8A 3H9JA 1NZFA 3N39C 4UU1A 3HA5A 4CM7A 3WGNA 1NX9A 5FWXA 4B3TB 4Q3DA 3NXKA 3ROQA 2V96A 3W6OA 5K8CA 5AM3A 5HQ3B 3MMNA 1U8ZA 2NIPA 4O1IA 3TQOA 3ROTA 3MZ0A 1YQTA 1F6WA 2PMWB 3CT4A 4IGKA 1D4FA 1Q74A 4NCNA 4EG5A 4ERXA 1GM5A 1D2NA 3V32A 1ZLYA 3SJ7A 1EQUA 1VPDA 4MGZR 2HEIA 1I2CA 1XJ0A 2D2VA 4YQYA 5KWEA 4MZXA 4YQFA 5EJ8A 1QYXA 3I53A 1TW2A 3RIHA 2O8BA 1N6IA 3TSWA 3TCKA 2NZWA 3TAUA 1USGA 3LWDA 4TKMA 1EK0A 1YIOA 3NALA 4YO7A 2ZR9A 3HQ4O 2O14A 3KBOA 3QKSB 3KQOA 4Z8XA 3VZRA 3BTOA 2A4MA 5ENVA 1GTRA 1Z16A 1U3WA 3DOIA 1YRBA 3WQSB 4AG5A 2SHKA 2PZBA 3CO5A 3WR5A 1H0KA 3X2SA 1RU3A 2IHBA 3KJFA 4HAZA 3L1UA 2ODTX 3MJTA 1WKVA 1KERA 1L7EA 1Z0KA 2H5EA 1U7PA 2I55A 1SD5A 3AY0A 2ZJ5A 2WTMA 3FBWA 3QMVA 1G291 4JP2A 4RDIA 4CQMD 3I6YA 2XCTB 3WGUA 1UEJA 3ED1A 2V3VA 4XVUA 2NM0A 5DXFA 1RMTA 4AK9A 4NCAA 4C06A 1NLFA 3T7AA 1P80A 1HSOA 4X85A 2ANCA 3V7NA 3JZMA 3A9WA 4MCAA 2BFDA 4K9OA 4AX8A 1KI1A 1TUGA 2MMGA 3DKIA 4FI3C 5IF3A 3L5KA 2P30A 1Y42X 1X87A 1ZS9A 1JEEA 2J9FB 2PT5A 2W4QA 4Z9XA 1TF7A 4QGFA 5LFAA 1QHEA 4C6RA 4IRMA 3BOSA 1OI2A 1V8BA 3ZBUA 1YWGO 4ARBA 2CMHA 4MV7A 1MN6A 3K5PA 4OK5A 5AKKA 4BO0A 2Q46A 5JARA 3T3DA 2V7VA 3KVVA 1JMKC 1RYBA 2IKQA 1A9XB 4V0RA 4C4OA 4EK9A 5DM2A 4UBMA 1L8LA 3K0CC 1T13A 1NZJA 3FYUA 3IPYA 2BGMA 3V6MA 4AQDA 3KKQA 3PC3A 1UXIA 4EKEA 4JROA 1Z7GA 3ZZ1A 1X39A 3ABIA 1PFWA 3HM2A 1RLMA 5JSFA 1Z0SA 4KDFA 5E6RA 2BM1A 3SYNA 1NXQA 4JNCA 1WDMA 2P9JA 4P81A 3M5WA 3V3TA 1SMKA 3EYWA 1TFUA 3ZCRA 4AP6A 1KQ3A 4DJ5X 2PLFA 4TSRA 4X6UA 2FZWA 4K9PA 3VNRA 1TAUA 4Y3UA 2DWCA 3O94A 2X7HA 2B4KA 1KJIA 4DADA 4PYOA 2PZLA 2FMXA 1PR6A 3WGHA 4YDQA 2R2GA 4F92B 5AJUA 1WPXA 1EA5A 2FWJA 5JHGB 1ADGA 4RVUA 5L3QA 3WK4A 3S8YA 1L6RA 2FWBA 4ZQHA 3ND6A 4B3XA 1WA5A 4QOJA 1ULUA 1VBKA 3LP5A 2Q4DA 4GI1A 3EODA 5FFMA 3UGJA 2BY4A 4H4EA 2IH5A 2JI9A 4IOMA 2W42A 1MX9A 4LISA 5IWCA 3KYBA 4R7TA 3WBJA 5KEIA 2XUFA 5LBUA 4M22A 5EEGA 4EY3A 3CWCA 1RAEA 1AN9A 1B26A 3IR7A 3HV2A 5ICFA 3COYA 5SYAA 3PJRA 2NTNA 5AI6A 4DB4A 3LDUA 1L5SA 1V95A 2JGLA 3HA2A 5E7IA 4BZWA 2G3YA 1XMXA 4RD3A 1V4NA 4MUEA 2ORIA 2NZJA 3RC1A 4UC0A 2B36A 4LNUB 1BHO1 2ENUA 3TLXA 1M6YA 1JDJA 3C8DA 2WFAA 1L6IA 2FLVA 1PJSA 4YROA 1W47A 4X8MA 2OP0A 1Q0RA 1T43A 4J3JA 3B6EA 1CUHA 3TW4A 2V6JA 3WLMA 1VBFA 2CCGA 3PJDA 1KZ6A 4MWSA 3GAAA 1YBHA 4ZARA 3L43A 1PZNA 1ZVKA 5E4FA 5WRFA 4KAJA 1RFGE 4H7FA 2BZ0A 5A4IS 1P1CA 2FEKA 2TMGA 1Z8DA 2X5XA 4G09A 3BQ9A 4N01A 3LVBA 2WZQA 2XADA 1SUAA 4X1OA 4KO8A 1NWHA 1O97C 4EY5A 4EW3A 3NWBA 3TLGA 1FRNA 2XJ9A 4TLMB 3KTFA 1IAQA 4JJ7A 5TXGA 3OT4A 1KI6A 3M6FA 2LW7A 5CM8B 3ONWA 3TPZA 3WZ2A 2P9BA 5JJKA 1X8XA 4PGAA 1DQZA 2VKQA 1T2DA 2F6RA 3K9QO 1DBSA 2H1CA 4O63O 4CQMA 2QVYX 2XTMA 1L7XA 1EX7A 1GAWA 4II2A 3VR4H 2ZJ6A 3CH5A 1ISPA 5K51A 5T57A 1US8B 2AF4C 3SBXA 4Q4JA 1JHRA 3VX3A 3OZFA 5JZSA 4UDOA 1BVUA 2NXWA 4AG3A 1U4OA 2CV2A 4BVFA 3RUFA 4ERNA 5FQNA 5BN3A 5PNTA 1OTYA 3ORSA 5A02A 1N6PA 3PG5A 4WQMA 4IF6A 5DH9A 5E8RA 3UAVA 5G4KA 1NKTA 2O07A 4KFRA 5BYAA 2ZZNA 5ADWA 1GG9A 1UEIA 3F2IA 5JUWA 4RTRA 4TVSA 4K1XA 3GRVA 2B2NA 5DCYA 4UU8A 2SKDA 4N3CA 1TJNA 1R74A 3D3KA 3L0DA 4RMHA 3CX8A 5EFOA 1M74A 3CONA 1O8CA 1X42A 3O3OB 4S1NA 5FBKA 5JXGA 2WYIA 1P72A 1OFTA 3PU6A 4UVIA 4C2AA 4EFKA 1G0OA 5BQFA 2Q4TA 3UPTA 2VBCA 3L7KA 1WCV1 2LCIA 2AJ8A 1PWXA 2ZIZA 3PPXA 4LPKA 5B6PA 5IKMA 3FAZA 1GPYA 4A03A 3RKUA 1K3UB 3KLBA 1DELA 4LQCA 4U7DA 1CJVC 3FPSA 5KQLA 4UE6A 5EPUA 4BU1A 4WZBE 4V2UA 3AUFA 3EXG1 3EDQA 4YRAA 2OG2A 1ZGHA 2PA0A 5CM9C 5IABA 2G72A 4JQZA 4Q7EA 1F2UB 4J3FA 1YUBA 4RAQA 4CCAA 5LM3A 3ANYB 1DOZA 3L0ZA 3I2FA 5K20A 1X1CA 2QY9A 2YZKA 2BEWB 1TECE 3PFGA 1WR8A 3IDZA 4XYLA 1TEZA 2IYUA 3Q9SA 1W48A 4ZEMA 3ILSA 1F7VA 1NATA 3DKKA 4Q1FA 1Q0UA 3T1TA 4MUBA 1YZHA 1B8PA 4ZXPA 3AM1A 1KYZA 2HU2A 1CU1A 2G04A 5I51A 3FZGA 3KC2A 5FPYA 3DLBA 3NDRA 5A4FS 4KR3A 4TTVA 1ZYUA 3G9UA 5ILGA 3UBMA 2EJTA 5AJZA 1AN0A 3RS3A 2X58A 3C6BA 3I23A 5IMSA 5BSUA 1I3LA 2O2GA 3BTUA 3W9SA 3DHWC 3AG6A 3I6QA 5ECWA 3U80A 1GQYA 2VNJA 5L6LB 1FA9A 1XROA 4UUAA 3RS9A 2W6MA 1IUOA 4J6FA 4MPTA 2V7UA 5GJCA 3DXYA 1ESMA 2HPVA 3NC1C 2QK4A 4BNLA 2H1IA 4S0ZA 1OYWA 2VUHB 1VP9A 3ANXA 3AO0B 5FUXA 4MS3A 2YWHA 1MORA 4RWEA 4BVHA 3B1XA 4V0OA 1VKZA 2CWWA 1P62B 1Y4ZA 2OGWA 1ZGCA 4UPVA 1YUMA 4Q3EA 5LWQA 3NHRA 3DZDA 3RSSA 1M1YE 3TRKA 1Y3AA 3BSFA 2JFXA 4TQGA 2ETVA 3A9TA 1WE2A 2F1RA 4DLPA 3QVWA 4C3ZA 2IEZA 1QVRA 3LOUA 4B3CA 5DK4A 4GUDA 2C03A 3JAWB 1FXUA 3SZUA 3PNSA 5HS6A 2Z09A 3P20A 5F21A 5HHTA 3GB9A 1AKWA 2VDPB 5I3ZA 2YV4A 2Q5LA 3BK7A 1C7RA 2IW1A 3NMUF 2OLJA 3LVQE 1H1LB 2GKGA 2PYDA 2WIDA 1N32B 3REQB 1TL7C 4HHEA 1NN5A 1JTVA 2WZCA 3GHHA 2HH9A 1YR7A 1EHYA 1U8YA 4WCDA 3IOEA 4PS0A 3ZKAA 5THKA 3ZWOA 1NXXA 4PE5B 1SUSA 1HM5A 3HYCA 1XWWA 4K9QA 4TUYF 2GBLC 4BE4A 4HAOA 3ONNA 1KZ4A 3QRWA 4ZT6A 5E1DA 2WDPA 1OH8A 1QHFA 3NHKA 2EARA 3KV3O 4TSFA 5GM2A 4CI0B 5MFPA 4XPIA 1N0VC 4FX5A 3JASA 2AJTA 4JQSA 3ZY6A 2WKWA 3QJ5A 2PUFA 2C9YA 2XRFA 1AGPA 2ZBQA 2AIRA 2I4MA 2ZAIA 3A04A 3Q15C 5HIJA 3TMKA 1NQWA 4M2LA 2POCA 4I9HA 1NV9A 1PGNA 1UMCA 1X19A 1ZU4A 2P2GA 2VF8A 2X5KO 4XQGA 5BUQA 4PCLA 1AJEA 5FWAA 3B1KA 1S2MA 2ZEJA 5CPBA 5K4HA 1PL8A 2QPOA 1IN8A 2ZAGA 2RG7A 1DV2A 3L5OA 1MOSA 4KQ2A 4UNSA 1IQUA 1CUEA 4GXRA 3BWCA 3MJEA 1J8YF 3WNVA 1TKBA 3ZV5A 3L4SO 4UTZA 4D9MA 1O0BA 2NYRA 4WLNA 3ROMA 1GUBA 3BHMA 3S5JA 4LJ8A 4OHPA 4EFLA 1SBHA 3L1JA 1HURA 2QN1A 3C1TA 3CCBA 1DRVA 3QFRA 3VZCA 1EE2A 4MQ5A 3O2SB 1DHRA 1U0OC 4NRDA 2FFHA 4LY9A 5AVQA 3HKBA 3SR3A 1UMBA 2DTDA 4EYEA 2JEYA 5DOVA 3BN3A 3T41A 3ZIUA 2AUMA 4NAUA 3VC3A 1QCCA 2JI6A 1HEUA 1IWPB 1SA0A 1Q1QA 4ZD6A 4YI5A 1OLOA 2BTOA 2EV9A 2ODWA 2YNMD 4A8JB 1MFPA 1BD4A 5KNCD 3IERA 1KVQA 3BGSA 3EDYA 3GEIA 4GMKA 2XNSA 4HVLA 2ZSUA 3Q5EA 3GUCA 1QGAA 4CWAA 1AXGA 2R4UA 4KOEC 1G3RA 5AJYA 1JZTA 1ISRA 4DQUA 1CWUA 4IMRA 2IS6A 3BGIA 3SMVA 2PZMA 1W30A 1R18A 2WILA 4FQ7A 5E9QA 3ZWMA 5EHXA 3UT5B 5J4KA 3V80A 2ZRIA 3SXUB 1NYQA 4DSNA 1W34A 1J0AA 1R0SA 1UJ5A 4QYIA 1EGMB 4Y9TA 5I7EA 3F7TA 5CJ2A 2BFFA 3DV9A 4JYAB 1FDVA 5LMZA 2G9QA 1EH5A 1XCGB 1YKFA 1Z8NA 3PPVA 3CLVA 2LCFA 3MS7A 1JDPA 3PIIA 2P65A 4UEJA 1O5IA 1DKPA 3F4BA 3GEPA 3PS9A 1TU0A 1CLUA 3GFBA 4N54A 4P4SB 4RD1A 4HVCA 2V54A 5B37A 4ER0A 3CF6R 4F84A 4LOAA 3IJRA 4OPMA 4PCAA 5IUKC 4YUVA 1A82A 3IT2A 4A2QA 5KTOA 2CB0A 1YRYE 1FUIA 4C7VA 2UZ1A 1IWBB 1I4EB 1WV1A 2GM5A 3ACBA 4G81A 3UBTA 2QG6A 1IIRA 1YMUA 3ZV3A 5I7HA 1QP7A 3W90A 3O31A 3D4OA 1YXMA 5DYNA 3CVJA 4A23A 3B70A 1OYYA 2RHJA 1WHSA 2JCYA 3B82A 1AGYA 1ZY2A 5H59A 4IGAA 1ZA2A 5JBNA 3DP7A 1P4GA 3MUOA 4DDVA 1DJOA 2I3DA 3C5EA 1LNQA 3EA4A 4I5IA 3AEYA 4O4HB 4AO7A 4CKXA 5JJ5A 1BKYA 3ZCUA 3K70D 4IDOA 3QVLA 4R8RA 4PPFA 1RQPA 4H15A 1CD5A 1QV6A 1AH2A 1T5DX 3T1OA 4GKBA 3O38A 5KB3A 2DRIA 5JTUA 2E4YA 2FSUA 2FPPB 5BMOA 5AT1A 1SG9A 4ZPXA 5L7TA 4WUTA 2RCYA 3KP1A 4LZJA 2IYZA 2DPLA 4YP1A 4PPQA 2DKFA 5DW0A 5EUBA 3ZD8A 2FN4A 1K06A 3N3AC 3O8NA 4MEJA 4S3MA 4TWAA 3RSZA 1NBME 1M3SA 4IJ5A 4L8VA 5BP7A 5J2TB 2Q3LA 1BC5A 4B8WA 4DCCA 3C8HA 3TB6A 1JLKA 2IHUA 3AV3A 3P71T 4YP5A 2AG5A 5K6TA 1HH4A 2FZ5A 4ZV4A 1U2SA 3BB4A 4WW0A 3W5AA 2P0AA 3OJLA 5DTQA 4RXUA 2V9PA 4EIWA 1GRNA 2F90A 1E3JA 2IF0A 3FWKA 3PVCA 2FEXA 4GOKA 2K7FA 2DUUA 1E92A 1RTKA 4R0VA 3X2FA 2EJCA 3LQ1A 5K8IA 4QO7A 2R6HA 1NVXQ 4WZ6A 4C4SA 4DHEA 1FPMA 4WXHA 1V3UA 4NL4H 2YJ6A 4LBVA 2X9NA 2YMMA 1ZW1A 3NASA 4WKGA 4YDSA 5TPZA 4AY3A 1D0VA 4L7VA 4ZMBA 2BEVA 3BWXA 3CB2A 4MW2A 2PKCA 3P9NA 2PG3A 2Q99A 4FE4A